3AAJA

Crystal structure of ca2+-bound form of des3-23alg-2deltagf122
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
167
structure length
167
Chain Sequence
ADQSFLWNVFQRVDKDRSGVISDTELQQALSNGTWTPFNPVTVRSIISMFDRENKAGVNFSEFTGVWKYITDWQNVFRTYDRDNSGMIDKNELKQALSGYRLSDQFHDILIRKFDRQGRGQIAFDDFIQGCIVLQRLTDIFRRYDTDQDGWIQVSYEQYLSMVFSIV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Programmed cell death protein 6
publication title Molecular basis for defect in Alix-binding by alternatively spliced isoform of ALG-2 (ALG-2DeltaGF122) and structural roles of F122 in target recognition
pubmed doi rcsb
source organism Homo sapiens
molecule tags Apoptosis
total genus 57
structure length 167
sequence length 167
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-11-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13202 EF-hand_5 EF hand
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3aajA00
4UPGA 1J7OA 4NQGA 2NCOA 3KEVA 2KFFA 2OPOA 4ICBA 4CLNA 1RFJA 1DVIA 4N1GA 1CM4A 4U8DA 2PALA 1B7TZ 1JUOA 1DJHA 1TNWA 2KNEA 4P5OE 2KAYA 1N65A 2ZRSA 3JVTB 3SG4A 1YX8A 2I18A 1S36A 1J1EA 2JNXA 3I5FB 2M0RA 2M9GA 1NPQA 4GUKA 4MEWA 3KO0A 1JBAA 3PN7C 3DVJA 1SL9A 2HF5A 2KBIA 3CR5X 1RROA 1V1FA 4PE1A 4DS7A 1NWDA 3TDIA 2PVBA 5DKQA 3PALA 2Q91A 5AANA 2LMUA 4A4BA 4L9MA 1CNPA 1F8HA 5JJGA 2SCPA 2CBLA 3CR2A 4N1FA 5AEQA 1NSHA 2A4JA 2IS9A 1B8LA 4NDCA 1KQVA 4MBEA 3ZNIA 3I5IC 1SL8A 3DVEA 1ZOTB 2LANA 2ZFDA 1FW4A 1BG1A 2L0PA 3PN7B 4QJ4B 2K0JA 2MLEC 2JRFA 3TUYC 2M1KB 2CCMA 2CXJA 4AOMA 3GK1A 1TN4A 2QACA 1NCYA 2MLFC 2WOSA 2LC5A 1IGVA 1NX3A 4YI8A 1NUBA 2HQWA 5B8IB 1CFFA 1K94A 3DF0B 1KSMA 2JWWA 2LP3A 1LKJA 1S6IA 3VROA 4R1EA 2M29A 2MAZA 2KGRA 5KU1A 1BODA 4I5KA 3I5IB 1K93D 1WRKA 1KFUL 1WLMA 2CNPA 1F71A 1ZACA 4NDDA 1SMGA 1S6CA 3WXAA 1TOPA 4AQIA 2M49B 3SIAA 1W7JB 1MXLC 1UHJA 3CR4X 2LMVA 1CDPA 1B9AA 3NSKA 4MRYA 3D0YB 2KQ6A 2LVIA 2BBNA 3EKJA 3LL8B 2F2PA 4M2QA 2L4HA 2JPTA 2KSPA 4DIRA 2EGDA 1JF0A 4QJ5B 1A2XA 2JTTA 1G33A 2SASA 3VRNA 1BMOA 2D8NA 2M97A 1EL4A 5ER5A 5D69A 1CLLA 4YGDB 2LHLA 2K7CA 1B7TY 1SW8A 2MBXA 1CFCA 1SK6D 1FI6A 3GOFA 1QASA 4E68A 1HQVA 2BCAA 2CTNA 5I8NA 1EG3A 2G9BA 1SKTA 1DJGA 1G4YR 1PULA 1YUUA 1B1GA 4I5JA 1SBJA 1ZUZA 2M8UA 2I2RE 1OZSA 1SCVA 3BQ3A 1NCXA 4OKHA 1EXRA 2KAXA 1XFZO 3EK4A 1B47A 4PALA 1C7WA 3MSEB 1YRTB 2Y4QA 1CKKA 3OB2B 3BUNB 5K89A 5HLVA 1QLSA 2NLNA 1A75A 1ODBA 1S1EA 1TIZA 3HX4A 1WRLA 4WQ3A 2G2BA 2KQYA 2WORA 4MLWA 1H8BA 1NCZA 2F2OA 1TNXA 2JQ6A 1QTXA 4A4CA 1AHRA 2AMIA 1QX2A 1XYDA 2LE9B 4WQ2A 1QV1A 4MVFA 1PSBA 1UHIA 1BR1B 4ORBB 3LCPC 4PHNA 1PVAA 1YTZC 1CLMA 3I5FC 1J7QA 2E30A 2B1UA 3TDUA 2LVJA 3OB1B 2DOQA 1HT9A 3ZWHA 3SG2A 2E6WA 4YGAA 3ICBA 1H4BA 1BU3A 1SYMA 1A4PA 1DJIA 3JTDC 5CSIA 1CMGA 1KQMC 1TCFA 1U5IA 3AKBA 1KWOC 3O2PA 1KK7Y 1E8AA 2H2KA 4I5LB 4PHMA 1L7ZA 2BECA 1MF8B 3E3RA 3M0WA 2V53A 2WNDA 1K9UA 5CPVA 4M2PA 2Q4UA 1Y1XA 3BUOB 5GQQC 2VRGA 1IJ6A 2TN4A 4M2OA 4Q04A 1CMFA 4PE7A 1YVHA 3AAKA 5G08A 2BKIB 1EH2A 3I5GB 1NP8A 1OSAA 3SJSA 1IG5A 1M45A 3BUWB 1IRJA 2L2EA 4XJKA 2KFHA 2F8PA 4JQ0D 1QX5B 1S5GZ 1W7IB 2FJUB 2COLB 2LMTA 3JTDB 3O4YA 1UUSA 1KQMB 1KWOB 4PCWA 1BF5A 1XK4A 2LV7A 2ZNDA 1PALA 2AAOA 1CM1A 2JT3A 5CSJA 1XVJA 2JXCA 2NCPA 1M31A 1OE9B 2F33A 1DTLA 1EJ3A 3TZ1A 4D1EA 1QJTA 1A03A 2HPSA 1S3PA 3KPXA 5DKNA 1GGWA 1SL7A 3EK8A 3AAJA 1AJ4A 4YBHB 2ZN8A 2K7DA 5KTYA 1YUTA 5D7FA 2F3ZA 4WRIA 3SG3A 2ZN9A 4GGFA 3VGOA 1NX2A 1K9PA 2HQ8A 2L4IA 3GK4X 4DCKA 1CDNA 1J7PA 4YGEB 2I7AA 1L2OC 3K21A 2K8MB 4GFTA 3WHTB 1ALWA 3EVRA 1JFJA 4BY5A 2GGMA 1MQ1A 1RK9A 2JU0A 1YRUB 1OOJA 4NDBA 5HKZA 2K7BA 2H61A 1AP4A 1GGZA 2LLUA 3FWBA 4YRUA 1YUSA 3WNXB 1Y6WA 4ZCVA 1UHKA 2JTZA 1KK8B 1IQ5A 2WCEA 1XO5A 3VRRA 1KK7Z 2FOTA 3RLZA 2M3WA 3GK2A 2HETA 4ORCB 4PHKA 5AERA 1MR8A 1K95A 4OCIA 2KI6C 2FCEA 1K96A 2LUCA 2GGZA 1EG4A 2KI6D 1L2OB 2L51A 4MZLA 4PHJA 1AVSA 2KGBC 1SR6C 1DJXA 4CPVA 1YR5A 3H4SE 2BKHB 2PRUA 2L50A 2BL0C 2LP2A 4DUQA 3CWGA 1F55A 3D10A 3FS7A 1D1OA 1KCYA 4USLA 3BYAA 4CFRA 1A29A 3FIAA 2JOJA 1M39A 4P2YB 1QIVA 1JF2A 1JWDA 4YGBB 1OQPA 1Y1UA 1SCMC 3I5HC 4YI9A 4MZKA 1CLBA 2MA2A 3F45A 3NSIA 4N5XA 1DF0A 4TNCA 1UURA 5F6TA 1SR6B 3QRXA 2WCBA 3SIBA 1SPYA 1S5GY 2F3YA 2NXQA 4FQOA 4GAOA 4CFQA 2BL0B 1UHNA 5DKRA 2K7OA 4F0ZB 1A75B 1AJ5A 1MWNA 1B8RA 2KYFA 3SG5A 5HKWA 3CLNA 3OX6A 1QV0A 1J7RA 1QX7A 4GGNA 1QLKA 4HREE 1KFUS 1GQMA 1M63B 4YGCB 1IH0A 3TDZA 1SCMB 3I5HB 1S26D 3O6BA 1DT7B 2NZ0A 2P6BB 1X02A 2ZNEA 3FWCA 5AXIA 1C7VA 2JZIA 3PLFB 1CDMA 1NX1A 1DGVA 2KFGA 1QVIZ 3NSLA 3VRPA 5CSFA 1R6PA 1TNPA 4MN0A 1QIWA 1RJVA 3I5GC 1F54A 2MRDA 2CT9A 1TCOB 5HYDA 1DGUA 1YVLA 1U5IB 2EHBA 2M1UA 3WHUB 3CZTX 1BT6A 1XK4C 1JC2A 3BOWA 2BE6A 1NYAA 1YX7A 1FPWA 1RTP1 2L5XB 1B8CA 3EVUA 1FBVA 3A4UB 4ZCUA 4ETOA 2ISDA 2JULA 3OP0A 2LUXA 4OV2A 1DJZA 4IL1A 4FTGA 2JT0A 2KAVA 3CS1A 3NSOA 1RECA 3O78A 4ORAB 1WRZA 4GGFC 3EVVA 4XJKB 1LXFC 3HCMA 1WY9A 4QJ3B 3LLEA 1G8IA 3SG7A 1Y0VH 2JXLA 2M7NA 3NXAA 1XFWO 1CDLA 2H61C 2R2IA 1NIWA 2KBMA 2AUCA 2Y1MA 1PSRA 3OX5A 1ALVA 2LNKA 2WC8A 2BCBA 1NX0A 1Y1AA 1WDCB 1KK8C 1MHOA 1C07A 4XYNA 4BY4A 2ZKMX 2I94A 1LA0A 2LHIA 2RGIA 5IBWA 1KSOA 1MUXA 4HRHA 1V1GA 1SRAA 1KFXL 3DVMA 4PE4A 1BJFA 4I5NB 5KSZA 3EKHA 3IQQA 1IKUA 5AFPA 5JOLA 2MJWB 3PATA 1XFXO 4DRWA 1UWOA 2KYCA 4PE0A 5TNCA 2LLSA 2O5GA 2LVVA 1SY9A 2KOTA 1J1DA 4GNKB 3IQOA 4JWQA 1QVIY 2JT8A 2PSRA 2MHHA 2KI4C 1M46A 1XFUO 3DD4A 4GPLB 5CSNA 3SG6A 3PFVA 2K61A 4MSPA 1LA3A 3KHEA 2GV5A 1FI5A 5PALA 1QS7A 1B4CA 1OZOA 1UP5A 2BBMA 1R2UA 3AKAA 3A8RA 3BXKA 1IWQA 1OMRA 3DF0A 4MRXA 1VRKA 2EC6C 2M7LA 2K2AA 3KF9A 3OHMB 1K2HA 3TUYB 2OTGC 1CTRA 1N0YA 1PVBA 1XFVO 3VRQA 5HLOA 2KI4B 1ZFSA 2KHNA 5I2QA 2O60A 1DF0B 1BLQA 3PM8A 2Y1NA 2Y5IA 1LINA 2QPTA 2LCPA 3D0YA 1KFXS 1IJ5A 3PSRA 1JSAA 2K2FA 5J3XA 2FCDA 1PRWA 2LLTA 3BUMB 1J55A 4PDZA 4AQJA 1SNLA 1K9KA 1LVCD 2EC6B 1Q80A 1QXPA 1DJYA 1RWYA 1TNQA 3LK0A 2WCFA 2KDHA 1BR4B 4CIDA 2BCXA 1F4QA 5I2OA 2ZRTA 4OVNF 3TS5C 1GJYA 1ZMZA 3BUXB 2BE4A 4C0JA 4HRGA 1MXEA 3C1VA 4C0LA 2OTGB 1AUIB 4JPZB 1QATA 2PASA 1CFDA 3RM1A 3CGAA 1WLZA 1AK8A 1S6JA 5FYXA 1CB1A 5ER4X 5I2LA 1K90D 2LM5A 3EK7A 2OS8C 2LVKA 4OR9B 1TRFA 3DVKA 1DMOA 1N2DA 5BPJA 1JFKA 1OMDA 1YURA 3TS5B 1K8UA 2PMYA 3BOWB 3LK1A 2JC2A 1DJWA 1FF1A 1XA5A 4MZJA 1F70A 2JNFA 1TTXA 1CFPA 4C0KA 1IQ3A 1XFYO 3IF7A 4GBAA 2LAPA 3JVTC 2OS8B 1F4OA 1WDCC 1OMVA 1PK0D 3CTNA 5HKYA 1UHHA 2L98A 4HSZA 1BOCA
chains in the Genus database with same CATH superfamily
4UPGA 1J7OA 4NQGA 3V2LA 3R1PA 2NCOA 3KEVA 5I94A 2KFFA 2OPOA 4ICBA 4CLNA 1RFJA 3QMEA 1DVIA 4N1GA 1CM4A 4U8DA 2PALA 1B7TZ 1JUOA 1DJHA 1TNWA 2KNEA 4P5OE 2KAYA 1N65A 2WCLA 2PQLA 2ZRSA 3JVTB 3SG4A 1YX8A 2I18A 1S36A 3D78A 1J1EA 2JNXA 3I5FB 2M0RA 2M9GA 1NPQA 4GUKA 4MEWA 3KO0A 1JBAA 3PN7C 2L2CA 4FQTA 3DVJA 1SL9A 2HF5A 2KBIA 2JPOA 3CR5X 1RROA 1SSEB 1V1FA 1OOHA 4PE1A 4DS7A 1NWDA 3TDIA 2PVBA 5DKQA 2QDIA 2Q91A 3PALA 2LMUA 5AANA 4A4BA 4L9MA 1CNPA 1F8HA 5JJGA 2SCPA 2CBLA 3CR2A 2BAPA 4N1FA 5AEQA 1NSHA 1XFRA 3SS5A 2A4JA 2IS9A 1B8LA 4NDCA 1KQVA 4MBEA 3ZNIA 3I5IC 1SL8A 3DVEA 1ZOTB 2LANA 2ZFDA 1FW4A 1BG1A 2L0PA 3PN7B 4QJ4B 2K0JA 1OW4A 2JRFA 2MLEC 3SS4A 3TUYC 2M1KB 2CCMA 3Q8IA 2CXJA 4AOMA 3FE9A 3GK1A 1TN4A 2QACA 3L47A 1NCYA 2MLFC 2WOSA 2LC5A 1IGVA 1NX3A 4YI8A 1NUBA 2HQWA 5B8IB 1CFFA 1K94A 3DF0B 1KSMA 2JWWA 2LP3A 1LKJA 1S6IA 2K60A 3VROA 4R1EA 4F7FA 2M29A 2MAZA 2KGRA 5KU1A 1BODA 4I5KA 3I5IB 1K93D 1WRKA 1KFUL 1WLMA 2CNPA 1F71A 1ZACA 1W9ZA 4NDDA 1SMGA 1S6CA 3WXAA 1TOPA 4AQIA 2M49B 3SIAA 1W7JB 1MXLC 1UHJA 3CR4X 2LMVA 1CDPA 1B9AA 1C3ZA 3NSKA 3D0YB 2KQ6A 2LVIA 2BBNA 3EKJA 3LL8B 2F2PA 4M2QA 2L4HA 3B7AA 2JPTA 2KSPA 4DIRA 2EGDA 1JF0A 4QJ5B 1A2XA 2JTTA 1G33A 2SASA 3VRNA 1BMOA 2D8NA 2M97A 1EL4A 5ER5A 2WCMA 5D69A 1CLLA 4YGDB 2LHLA 2K7CA 1B7TY 1SW8A 2MBXA 1CFCA 1SK6D 1FI6A 3GOFA 1Z2CB 1QASA 4E68A 1HQVA 2BCAA 2CTNA 5I8NA 1EG3A 2G9BA 1SKTA 2QEOA 1DJGA 1G4YR 1PULA 1YUUA 1B1GA 4I5JA 2KLDA 2WC5A 1SBJA 1ZUZA 2M8UA 2I2RE 1OZSA 1SCVA 3BQ3A 1NCXA 4OKHA 1EXRA 2KAXA 2ERBA 1XFZO 2P71A 3EK4A 1B47A 2GTEA 4PALA 1C7WA 3MSEB 1YRTB 2Y4QA 1CKKA 3OB2B 3BUNB 5K89A 5HLVA 1QLSA 2NLNA 1A75A 1ODBA 1S1EA 1TIZA 3HX4A 1WRLA 4WQ3A 2G2BA 2KQYA 2WORA 3D74A 4MLWA 1H8BA 1NCZA 2F2OA 1TNXA 2JQ6A 2WCHA 1Z4HA 1QTXA 4A4CA 3R1VA 3S0GA 1AHRA 2AMIA 1OOGA 1QX2A 1XYDA 2LE9B 4WQ2A 2P70A 1QV1A 4MVFA 1PSBA 1UHIA 1BR1B 4ORBB 3B6XA 3LCPC 4PHNA 1PVAA 1YTZC 1CLMA 3I5FC 1J7QA 2E30A 2B1UA 3TDUA 2LVJA 3OB1B 2DOQA 1HT9A 3K1EA 1IIOA 3ZWHA 3SG2A 2E6WA 4YGAA 3ICBA 1H4BA 1BU3A 1SYMA 1A4PA 1DJIA 3JTDC 5CSIA 1CMGA 1KQMC 1TCFA 1U5IA 3AKBA 1KWOC 3O2PA 1KK7Y 1E8AA 2H2KA 4I5LB 4PHMA 1L7ZA 2BECA 1MF8B 3E3RA 3M0WA 2V53A 2WNDA 1K9UA 5CPVA 3UO9A 4M2PA 2Q4UA 1Y1XA 3BUOB 3BFHA 3D76A 5GQQC 2VRGA 1IJ6A 2TN4A 3PJIA 4M2OA 4Q04A 4PE7A 1CMFA 1YVHA 3AAKA 5G08A 2BKIB 1EH2A 3I5GB 1DELA 1NP8A 1OSAA 3SJSA 1IG5A 1M45A 1T14A 3BUWB 1IRJA 2L2EA 4XJKA 2KFHA 2F8PA 4JQ0D 1QX5B 1S5GZ 1W7IB 2FJUB 2COLB 2LMTA 3JTDB 3O4YA 1UUSA 1KQMB 1KWOB 4PCWA 4INWA 1BF5A 1XK4A 2LV7A 2ZNDA 1PALA 2AAOA 1CM1A 3S0FA 2JT3A 5CSJA 1XVJA 2JXCA 2NCPA 1M31A 1OE9B 2F33A 1DTLA 1EJ3A 3TZ1A 4D1EA 1QJTA 1A03A 2HPSA 1S3PA 3B87A 2KLEA 3KPXA 3FE8A 5DKNA 5FI6A 1GGWA 1SL7A 3EK8A 3NHTA 3AAJA 1AJ4A 4YBHB 2ZN8A 2K7DA 5KTYA 1YUTA 2H8VA 2F3ZA 4WRIA 5D7FA 3SG3A 2ZN9A 3BFAA 4GGFA 3VGOA 1NX2A 1K9PA 2HQ8A 2L4IA 3GK4X 4DCKA 1CDNA 1J7PA 4YGEB 2L5YA 2I7AA 1L2OC 3K21A 2K8MB 4GFTA 3WHTB 1ALWA 3EVRA 1JFJA 4BY5A 2GGMA 1MQ1A 1RK9A 2JU0A 1YRUB 1OOJA 4NDBA 5HKZA 2K7BA 2H61A 1AP4A 1GGZA 2LLUA 3FWBA 3PM2A 1TUZA 1YUSA 3WNXB 1Y6WA 4ZCVA 4YRUA 1UHKA 2JTZA 1KK8B 1IQ5A 4INXA 2WCEA 1XO5A 1DQEA 3VRRA 1KK7Z 2FOTA 3RLZA 2M3WA 3GK2A 2HETA 4ORCB 4PHKA 5AERA 1MR8A 1K95A 4OCIA 2KI6C 2FCEA 1K96A 2LUCA 2WCKA 2GGZA 1EG4A 2KI6D 1L2OB 2L51A 4MZLA 4PHJA 1AVSA 2KGBC 1SR6C 1DJXA 4CPVA 1YR5A 3H4SE 2BKHB 2PRUA 2L50A 3R72A 2BL0C 3CZ1A 2LP2A 5FI7A 4DUQA 3CWGA 5EL2A 3DY9A 3D10A 3FS7A 3S0DA 1D1OA 4USLA 1F55A 3BYAA 3VB1A 4CFRA 1KCYA 1A29A 3FIAA 2JOJA 1M39A 4P2YB 1QIVA 1JF2A 1JWDA 4YGBB 1OQPA 1Y1UA 1SCMC 3I5HC 4YI9A 4MZKA 3B88A 1CLBA 2MA2A 3F45A 3NSIA 4N5XA 1DF0A 4TNCA 1UURA 5F6TA 3DZTA 1SR6B 3QRXA 2WCBA 3OGNA 1SPYA 1S5GY 2F3YA 2NXQA 4FQOA 3SIBA 4GAOA 3UNWA 4CFQA 2BL0B 3CDNA 1UHNA 5DKRA 2K7OA 4F0ZB 1A75B 3L4LA 1P28A 1AJ5A 1MWNA 1B8RA 2KYFA 3SG5A 5HKWA 3CLNA 3OX6A 1QV0A 1J7RA 1QX7A 4GGNA 1QLKA 4HREE 1KFUS 1GQMA 1M63B 4YGCB 1IH0A 3TDZA 1SCMB 3I5HB 1S26D 3O6BA 1DT7B 2NZ0A 2P6BB 5FI2A 1X02A 2ZNEA 3FWCA 5AXIA 2FJYA 1C7VA 2JZIA 3PLFB 1CDMA 1NX1A 1DGVA 2KFGA 1QVIZ 3O4XA 2WC6A 3NSLA 3VRPA 5CSFA 1R6PA 2QEVA 1TNPA 4MN0A 1C3YA 1QIWA 1RJVA 3I5GC 1F54A 2MRDA 2CT9A 1TCOB 5HYDA 1DGUA 1YVLA 1U5IB 2EHBA 2M1UA 3WHUB 3CZTX 1QWVA 1BT6A 1XK4C 4JD9A 1JC2A 3BOWA 4KYNA 2BE6A 1NYAA 1YX7A 1FPWA 1RTP1 2L5XB 1B8CA 3EVUA 1FBVA 3A4UB 4ZCUA 4ETOA 2ISDA 2JULA 3OP0A 2LUXA 4JKTA 2BNXA 4OV2A 1DJZA 1OOFA 4FTGA 4IL1A 2JT0A 2KAVA 3BJHA 3BFBA 1RECA 3CS1A 3NSOA 1WRZA 3O78A 3EVVA 4GGFC 4ORAB 4XJKB 1LXFC 1OOIX 3HCMA 3NGVA 1WY9A 4QJ3B 3LLEA 1LS8A 1G8IA 3SG7A 1Y0VH 2JXLA 1ORGA 2M7NA 3NXAA 1XFWO 1CDLA 2H61C 2R2IA 1NIWA 3IVTA 2KBMA 2AUCA 2Y1MA 1PSRA 3OX5A 1ALVA 2LNKA 2WC8A 2BCBA 1Y1AA 1NX0A 3OBVA 1WDCB 1KK8C 1MHOA 1C07A 3EG5B 4XYNA 4BY4A 3N7HA 2ZKMX 2I94A 1LA0A 1TWOA 2LHIA 2RGIA 5IBWA 1KSOA 1MUXA 3R1OA 4HRHA 5D3OA 1V1GA 1SRAA 1KFXL 3DVMA 4PE4A 3S0BA 3NHIA 1BJFA 4I5NB 5KSZA 3EKHA 3IQQA 1IKUA 5AFPA 5JOLA 2MJWB 3PATA 1XFXO 4DRWA 1UWOA 2KYCA 4PE0A 5TNCA 2LLSA 2O5GA 2LVVA 5HL1A 1SY9A 2KOTA 2YGUA 1J1DA 4GNKB 3IQOA 4JWQA 1QVIY 2JT8A 3DYEA 2PSRA 2MHHA 2KI4C 3DXLA 1M46A 1XFUO 3DD4A 4GPLB 5CSNA 3SG6A 3PFVA 2K61A 4MSPA 1LA3A 3KHEA 2GV5A 3FE6A 1FI5A 5PALA 1QS7A 1B4CA 1OZOA 1UP5A 2BBMA 1R2UA 3AKAA 3A8RA 3BXKA 1IWQA 1OMRA 3DF0A 4MRXA 1VRKA 2EC6C 2M7LA 2K2AA 2PYQA 3SS3A 3KF9A 1DC1A 3OHMB 1K2HA 3TUYB 2OTGC 1CTRA 1N0YA 1PVBA 1XFVO 3VRQA 5HLOA 2KI4B 3S0AA 1ZFSA 2KHNA 5I2QA 2O60A 1DF0B 1BLQA 3PM8A 2Y1NA 2Y5IA 1LINA 2QPTA 2LCPA 3D0YA 1KFXS 1IJ5A 3PSRA 1JSAA 2K2FA 2QEHA 5J3XA 2FCDA 1PRWA 2LLTA 3BUMB 1J55A 4PDZA 4AQJA 4IJ7A 1GM0A 1SNLA 1K9KA 1LVCD 3CABA 2EC6B 1Q80A 1QXPA 1DJYA 1RWYA 1TNQA 3LK0A 2WCFA 2KDHA 1BR4B 4CIDA 2BCXA 1F4QA 5I2OA 2ZRTA 4OVNF 3TS5C 3D75A 1GJYA 1ZMZA 3BUXB 2BE4A 4C0JA 4HRGA 1MXEA 3C1VA 4C0LA 2OTGB 1AUIB 4JPZB 1QATA 2PASA 3CZ0A 1CFDA 2QEBA 3RM1A 3CGAA 1WLZA 1AK8A 3D77A 1S6JA 4PT1A 5FYXA 1CB1A 5ER4X 5I2LA 1K90D 2WCJA 2LM5A 3D73A 3EK7A 2OS8C 2LVKA 3L4AA 4OR9B 1TRFA 3DVKA 3CZ2A 1DMOA 3RZSA 1N2DA 3S0EA 5BPJA 1JFKA 1OMDA 1YURA 3TS5B 1K8UA 3B86A 2PMYA 3BOWB 3LK1A 2JC2A 1DJWA 1FF1A 1XA5A 4MZJA 1F70A 3CYZA 5DICA 2JNFA 1DEKA 1TTXA 1CFPA 4C0KA 1IQ3A 1XFYO 3IF7A 4GBAA 2LAPA 3JVTC 2OS8B 1F4OA 1WDCC 4OZDA 1OMVA 1PK0D 2KPHA 3CTNA 5HKYA 1UHHA 2L98A 4HSZA 1BOCA 4MRYA 1TUJA
chains in the Genus database with same CATH topology
4UPGA 1J7OA 4NQGA 2NCOA 3KEVA 2KFFA 2OPOA 4ICBA 4CLNA 1RFJA 1DVIA 4N1GA 1CM4A 4U8DA 2PALA 1B7TZ 1JUOA 1DJHA 1TNWA 2KNEA 4P5OE 2KAYA 1N65A 2ZRSA 3JVTB 3SG4A 1YX8A 2I18A 1S36A 1J1EA 2JNXA 3I5FB 2M0RA 2M9GA 1NPQA 4GUKA 4MEWA 3KO0A 1JBAA 3PN7C 3DVJA 1SL9A 2HF5A 2KBIA 3CR5X 1RROA 1V1FA 4PE1A 4DS7A 1NWDA 3TDIA 2PVBA 5DKQA 3PALA 2Q91A 5AANA 2LMUA 4A4BA 4L9MA 1CNPA 1F8HA 5JJGA 2SCPA 2CBLA 3CR2A 4N1FA 5AEQA 1NSHA 2A4JA 2IS9A 1B8LA 4NDCA 1KQVA 4MBEA 3ZNIA 3I5IC 1SL8A 3DVEA 1ZOTB 2LANA 2ZFDA 1FW4A 1BG1A 2L0PA 3PN7B 4QJ4B 2K0JA 2MLEC 2JRFA 3TUYC 2M1KB 2CCMA 2CXJA 4AOMA 3GK1A 1TN4A 2QACA 1NCYA 2MLFC 2WOSA 2LC5A 1IGVA 1NX3A 4YI8A 1NUBA 2HQWA 5B8IB 1CFFA 1K94A 3DF0B 1KSMA 2JWWA 2LP3A 1LKJA 1S6IA 3VROA 4R1EA 2M29A 2MAZA 2KGRA 5KU1A 1BODA 4I5KA 3I5IB 1K93D 1WRKA 1KFUL 1WLMA 2CNPA 1F71A 1ZACA 4NDDA 1SMGA 1S6CA 3WXAA 1TOPA 4AQIA 2M49B 3SIAA 1W7JB 1MXLC 1UHJA 3CR4X 2LMVA 1CDPA 1B9AA 3NSKA 4MRYA 3D0YB 2KQ6A 2LVIA 2BBNA 3EKJA 3LL8B 2F2PA 4M2QA 2L4HA 2JPTA 2KSPA 4DIRA 2EGDA 1JF0A 4QJ5B 1A2XA 2JTTA 1G33A 2SASA 3VRNA 1BMOA 2D8NA 2M97A 1EL4A 5ER5A 5D69A 1CLLA 4YGDB 2LHLA 2K7CA 1B7TY 1SW8A 2MBXA 1CFCA 1SK6D 1FI6A 3GOFA 1QASA 4E68A 1HQVA 2BCAA 2CTNA 5I8NA 1EG3A 2G9BA 1SKTA 1DJGA 1G4YR 1PULA 1YUUA 1B1GA 4I5JA 1SBJA 1ZUZA 2M8UA 2I2RE 1OZSA 1SCVA 3BQ3A 1NCXA 4OKHA 1EXRA 2KAXA 1XFZO 3EK4A 1B47A 4PALA 1C7WA 3MSEB 1YRTB 2Y4QA 1CKKA 3OB2B 3BUNB 5K89A 5HLVA 1QLSA 2NLNA 1A75A 1ODBA 1S1EA 1TIZA 3HX4A 1WRLA 4WQ3A 2G2BA 2KQYA 2WORA 4MLWA 1H8BA 1NCZA 2F2OA 1TNXA 2JQ6A 1QTXA 4A4CA 1AHRA 2AMIA 1QX2A 1XYDA 2LE9B 4WQ2A 1QV1A 4MVFA 1PSBA 1UHIA 1BR1B 4ORBB 3LCPC 4PHNA 1PVAA 1YTZC 1CLMA 3I5FC 1J7QA 2E30A 2B1UA 3TDUA 2LVJA 3OB1B 2DOQA 1HT9A 3ZWHA 3SG2A 2E6WA 4YGAA 3ICBA 1H4BA 1BU3A 1SYMA 1A4PA 1DJIA 3JTDC 5CSIA 1CMGA 1KQMC 1TCFA 1U5IA 3AKBA 1KWOC 3O2PA 1KK7Y 1E8AA 2H2KA 4I5LB 4PHMA 1L7ZA 2BECA 1MF8B 3E3RA 3M0WA 2V53A 2WNDA 1K9UA 5CPVA 4M2PA 2Q4UA 1Y1XA 3BUOB 5GQQC 2VRGA 1IJ6A 2TN4A 4M2OA 4Q04A 1CMFA 4PE7A 1YVHA 3AAKA 5G08A 2BKIB 1EH2A 3I5GB 1NP8A 1OSAA 3SJSA 1IG5A 1M45A 3BUWB 1IRJA 2L2EA 4XJKA 2KFHA 2F8PA 4JQ0D 1QX5B 1S5GZ 1W7IB 2FJUB 2COLB 2LMTA 3JTDB 3O4YA 1UUSA 1KQMB 1KWOB 4PCWA 1BF5A 1XK4A 2LV7A 2ZNDA 1PALA 2AAOA 1CM1A 2JT3A 5CSJA 1XVJA 2JXCA 2NCPA 1M31A 1OE9B 2F33A 1DTLA 1EJ3A 3TZ1A 4D1EA 1QJTA 1A03A 2HPSA 1S3PA 3KPXA 5DKNA 1GGWA 1SL7A 3EK8A 3AAJA 1AJ4A 4YBHB 2ZN8A 2K7DA 5KTYA 1YUTA 5D7FA 2F3ZA 4WRIA 3SG3A 2ZN9A 4GGFA 3VGOA 1NX2A 1K9PA 2HQ8A 2L4IA 3GK4X 4DCKA 1CDNA 1J7PA 4YGEB 2I7AA 1L2OC 3K21A 2K8MB 4GFTA 3WHTB 1ALWA 3EVRA 1JFJA 4BY5A 2GGMA 1MQ1A 1RK9A 2JU0A 1YRUB 1OOJA 4NDBA 5HKZA 2K7BA 2H61A 1AP4A 1GGZA 2LLUA 3FWBA 4YRUA 1YUSA 3WNXB 1Y6WA 4ZCVA 1UHKA 2JTZA 1KK8B 1IQ5A 2WCEA 1XO5A 3VRRA 1KK7Z 2FOTA 3RLZA 2M3WA 3GK2A 2HETA 4ORCB 4PHKA 5AERA 1MR8A 1K95A 4OCIA 2KI6C 2FCEA 1K96A 2LUCA 2GGZA 1EG4A 2KI6D 1L2OB 2L51A 4MZLA 4PHJA 1AVSA 2KGBC 1SR6C 1DJXA 4CPVA 1YR5A 3H4SE 2BKHB 2PRUA 2L50A 2BL0C 2LP2A 4DUQA 3CWGA 1F55A 3D10A 3FS7A 1D1OA 1KCYA 4USLA 3BYAA 4CFRA 1A29A 3FIAA 2JOJA 1M39A 4P2YB 1QIVA 1JF2A 1JWDA 4YGBB 1OQPA 1Y1UA 1SCMC 3I5HC 4YI9A 4MZKA 1CLBA 2MA2A 3F45A 3NSIA 4N5XA 1DF0A 4TNCA 1UURA 5F6TA 1SR6B 3QRXA 2WCBA 3SIBA 1SPYA 1S5GY 2F3YA 2NXQA 4FQOA 4GAOA 4CFQA 2BL0B 1UHNA 5DKRA 2K7OA 4F0ZB 1A75B 1AJ5A 1MWNA 1B8RA 2KYFA 3SG5A 5HKWA 3CLNA 3OX6A 1QV0A 1J7RA 1QX7A 4GGNA 1QLKA 4HREE 1KFUS 1GQMA 1M63B 4YGCB 1IH0A 3TDZA 1SCMB 3I5HB 1S26D 3O6BA 1DT7B 2NZ0A 2P6BB 1X02A 2ZNEA 3FWCA 5AXIA 1C7VA 2JZIA 3PLFB 1CDMA 1NX1A 1DGVA 2KFGA 1QVIZ 3NSLA 3VRPA 5CSFA 1R6PA 1TNPA 4MN0A 1QIWA 1RJVA 3I5GC 1F54A 2MRDA 2CT9A 1TCOB 5HYDA 1DGUA 1YVLA 1U5IB 2EHBA 2M1UA 3WHUB 3CZTX 1BT6A 1XK4C 1JC2A 3BOWA 2BE6A 1NYAA 1YX7A 1FPWA 1RTP1 2L5XB 1B8CA 3EVUA 1FBVA 3A4UB 4ZCUA 4ETOA 2ISDA 2JULA 3OP0A 2LUXA 4OV2A 1DJZA 4IL1A 4FTGA 2JT0A 2KAVA 3CS1A 3NSOA 1RECA 3O78A 4ORAB 1WRZA 4GGFC 3EVVA 4XJKB 1LXFC 3HCMA 1WY9A 4QJ3B 3LLEA 1G8IA 3SG7A 1Y0VH 2JXLA 2M7NA 3NXAA 1XFWO 1CDLA 2H61C 2R2IA 1NIWA 2KBMA 2AUCA 2Y1MA 1PSRA 3OX5A 1ALVA 2LNKA 2WC8A 2BCBA 1NX0A 1Y1AA 1WDCB 1KK8C 1MHOA 1C07A 4XYNA 4BY4A 2ZKMX 2I94A 1LA0A 2LHIA 2RGIA 5IBWA 1KSOA 1MUXA 4HRHA 1V1GA 1SRAA 1KFXL 3DVMA 4PE4A 1BJFA 4I5NB 5KSZA 3EKHA 3IQQA 1IKUA 5AFPA 5JOLA 2MJWB 3PATA 1XFXO 4DRWA 1UWOA 2KYCA 4PE0A 5TNCA 2LLSA 2O5GA 2LVVA 1SY9A 2KOTA 1J1DA 4GNKB 3IQOA 4JWQA 1QVIY 2JT8A 2PSRA 2MHHA 2KI4C 1M46A 1XFUO 3DD4A 4GPLB 5CSNA 3SG6A 3PFVA 2K61A 4MSPA 1LA3A 3KHEA 2GV5A 1FI5A 5PALA 1QS7A 1B4CA 1OZOA 1UP5A 2BBMA 1R2UA 3AKAA 3A8RA 3BXKA 1IWQA 1OMRA 3DF0A 4MRXA 1VRKA 2EC6C 2M7LA 2K2AA 3KF9A 3OHMB 1K2HA 3TUYB 2OTGC 1CTRA 1N0YA 1PVBA 1XFVO 3VRQA 5HLOA 2KI4B 1ZFSA 2KHNA 5I2QA 2O60A 1DF0B 1BLQA 3PM8A 2Y1NA 2Y5IA 1LINA 2QPTA 2LCPA 3D0YA 1KFXS 1IJ5A 3PSRA 1JSAA 2K2FA 5J3XA 2FCDA 1PRWA 2LLTA 3BUMB 1J55A 4PDZA 4AQJA 1SNLA 1K9KA 1LVCD 2EC6B 1Q80A 1QXPA 1DJYA 1RWYA 1TNQA 3LK0A 2WCFA 2KDHA 1BR4B 4CIDA 2BCXA 1F4QA 5I2OA 2ZRTA 4OVNF 3TS5C 1GJYA 1ZMZA 3BUXB 2BE4A 4C0JA 4HRGA 1MXEA 3C1VA 4C0LA 2OTGB 1AUIB 4JPZB 1QATA 2PASA 1CFDA 3RM1A 3CGAA 1WLZA 1AK8A 1S6JA 5FYXA 1CB1A 5ER4X 5I2LA 1K90D 2LM5A 3EK7A 2OS8C 2LVKA 4OR9B 1TRFA 3DVKA 1DMOA 1N2DA 5BPJA 1JFKA 1OMDA 1YURA 3TS5B 1K8UA 2PMYA 3BOWB 3LK1A 2JC2A 1DJWA 1FF1A 1XA5A 4MZJA 1F70A 2JNFA 1TTXA 1CFPA 4C0KA 1IQ3A 1XFYO 3IF7A 4GBAA 2LAPA 3JVTC 2OS8B 1F4OA 1WDCC 1OMVA 1PK0D 3CTNA 5HKYA 1UHHA 2L98A 4HSZA 1BOCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4UPG A;  1J7O A;  4NQG A;  2NCO A;  3KEV A;  2KFF A;  2OPO A;  4ICB A;  4CLN A;  1RFJ A;  1DVI A;  4N1G A;  1CM4 A;  4U8D A;  2PAL A;  1B7T Z;  1JUO A;  1DJH A;  1TNW A;  2KNE A;  4P5O E;  2KAY A;  1N65 A;  2ZRS A;  3JVT B;  3SG4 A;  1YX8 A;  2I18 A;  1S36 A;  1J1E A;  2JNX A;  3I5F B;  2M0R A;  2M9G A;  1NPQ A;  4GUK A;  4MEW A;  3KO0 A;  1JBA A;  3PN7 C;  3DVJ A;  1SL9 A;  2HF5 A;  2KBI A;  3CR5 X;  1RRO A;  1V1F A;  4PE1 A;  4DS7 A;  1NWD A;  3TDI A;  2PVB A;  5DKQ A;  3PAL A;  2Q91 A;  5AAN A;  2LMU A;  4A4B A;  4L9M A;  1CNP A;  1F8H A;  5JJG A;  2SCP A;  2CBL A;  3CR2 A;  4N1F A;  5AEQ A;  1NSH A;  2A4J A;  2IS9 A;  1B8L A;  4NDC A;  1KQV A;  4MBE A;  3ZNI A;  3I5I C;  1SL8 A;  3DVE A;  1ZOT B;  2LAN A;  2ZFD A;  1FW4 A;  1BG1 A;  2L0P A;  3PN7 B;  4QJ4 B;  2K0J A;  2MLE C;  2JRF A;  3TUY C;  2M1K B;  2CCM A;  2CXJ A;  4AOM A;  3GK1 A;  1TN4 A;  2QAC A;  1NCY A;  2MLF C;  2WOS A;  2LC5 A;  1IGV A;  1NX3 A;  4YI8 A;  1NUB A;  2HQW A;  5B8I B;  1CFF A;  1K94 A;  3DF0 B;  1KSM A;  2JWW A;  2LP3 A;  1LKJ A;  1S6I A;  3VRO A;  4R1E A;  2M29 A;  2MAZ A;  2KGR A;  5KU1 A;  1BOD A;  4I5K A;  3I5I B;  1K93 D;  1WRK A;  1KFU L;  1WLM A;  2CNP A;  1F71 A;  1ZAC A;  4NDD A;  1SMG A;  1S6C A;  3WXA A;  1TOP A;  4AQI A;  2M49 B;  3SIA A;  1W7J B;  1MXL C;  1UHJ A;  3CR4 X;  2LMV A;  1CDP A;  1B9A A;  3NSK A;  4MRY A;  3D0Y B;  2KQ6 A;  2LVI A;  2BBN A;  3EKJ A;  3LL8 B;  2F2P A;  4M2Q A;  2L4H A;  2JPT A;  2KSP A;  4DIR A;  2EGD A;  1JF0 A;  4QJ5 B;  1A2X A;  2JTT A;  1G33 A;  2SAS A;  3VRN A;  1BMO A;  2D8N A;  2M97 A;  1EL4 A;  5ER5 A;  5D69 A;  1CLL A;  4YGD B;  2LHL A;  2K7C A;  1B7T Y;  1SW8 A;  2MBX A;  1CFC A;  1SK6 D;  1FI6 A;  3GOF A;  1QAS A;  4E68 A;  1HQV A;  2BCA A;  2CTN A;  5I8N A;  1EG3 A;  2G9B A;  1SKT A;  1DJG A;  1G4Y R;  1PUL A;  1YUU A;  1B1G A;  4I5J A;  1SBJ A;  1ZUZ A;  2M8U A;  2I2R E;  1OZS A;  1SCV A;  3BQ3 A;  1NCX A;  4OKH A;  1EXR A;  2KAX A;  1XFZ O;  3EK4 A;  1B47 A;  4PAL A;  1C7W A;  3MSE B;  1YRT B;  2Y4Q A;  1CKK A;  3OB2 B;  3BUN B;  5K89 A;  5HLV A;  1QLS A;  2NLN A;  1A75 A;  1ODB A;  1S1E A;  1TIZ A;  3HX4 A;  1WRL A;  4WQ3 A;  2G2B A;  2KQY A;  2WOR A;  4MLW A;  1H8B A;  1NCZ A;  2F2O A;  1TNX A;  2JQ6 A;  1QTX A;  4A4C A;  1AHR A;  2AMI A;  1QX2 A;  1XYD A;  2LE9 B;  4WQ2 A;  1QV1 A;  4MVF A;  1PSB A;  1UHI A;  1BR1 B;  4ORB B;  3LCP C;  4PHN A;  1PVA A;  1YTZ C;  1CLM A;  3I5F C;  1J7Q A;  2E30 A;  2B1U A;  3TDU A;  2LVJ A;  3OB1 B;  2DOQ A;  1HT9 A;  3ZWH A;  3SG2 A;  2E6W A;  4YGA A;  3ICB A;  1H4B A;  1BU3 A;  1SYM A;  1A4P A;  1DJI A;  3JTD C;  5CSI A;  1CMG A;  1KQM C;  1TCF A;  1U5I A;  3AKB A;  1KWO C;  3O2P A;  1KK7 Y;  1E8A A;  2H2K A;  4I5L B;  4PHM A;  1L7Z A;  2BEC A;  1MF8 B;  3E3R A;  3M0W A;  2V53 A;  2WND A;  1K9U A;  5CPV A;  4M2P A;  2Q4U A;  1Y1X A;  3BUO B;  5GQQ C;  2VRG A;  1IJ6 A;  2TN4 A;  4M2O A;  4Q04 A;  1CMF A;  4PE7 A;  1YVH A;  3AAK A;  5G08 A;  2BKI B;  1EH2 A;  3I5G B;  1NP8 A;  1OSA A;  3SJS A;  1IG5 A;  1M45 A;  3BUW B;  1IRJ A;  2L2E A;  4XJK A;  2KFH A;  2F8P A;  4JQ0 D;  1QX5 B;  1S5G Z;  1W7I B;  2FJU B;  2COL B;  2LMT A;  3JTD B;  3O4Y A;  1UUS A;  1KQM B;  1KWO B;  4PCW A;  1BF5 A;  1XK4 A;  2LV7 A;  2ZND A;  1PAL A;  2AAO A;  1CM1 A;  2JT3 A;  5CSJ A;  1XVJ A;  2JXC A;  2NCP A;  1M31 A;  1OE9 B;  2F33 A;  1DTL A;  1EJ3 A;  3TZ1 A;  4D1E A;  1QJT A;  1A03 A;  2HPS A;  1S3P A;  3KPX A;  5DKN A;  1GGW A;  1SL7 A;  3EK8 A;  3AAJ A;  1AJ4 A;  4YBH B;  2ZN8 A;  2K7D A;  5KTY A;  1YUT A;  5D7F A;  2F3Z A;  4WRI A;  3SG3 A;  2ZN9 A;  4GGF A;  3VGO A;  1NX2 A;  1K9P A;  2HQ8 A;  2L4I A;  3GK4 X;  4DCK A;  1CDN A;  1J7P A;  4YGE B;  2I7A A;  1L2O C;  3K21 A;  2K8M B;  4GFT A;  3WHT B;  1ALW A;  3EVR A;  1JFJ A;  4BY5 A;  2GGM A;  1MQ1 A;  1RK9 A;  2JU0 A;  1YRU B;  1OOJ A;  4NDB A;  5HKZ A;  2K7B A;  2H61 A;  1AP4 A;  1GGZ A;  2LLU A;  3FWB A;  4YRU A;  1YUS A;  3WNX B;  1Y6W A;  4ZCV A;  1UHK A;  2JTZ A;  1KK8 B;  1IQ5 A;  2WCE A;  1XO5 A;  3VRR A;  1KK7 Z;  2FOT A;  3RLZ A;  2M3W A;  3GK2 A;  2HET A;  4ORC B;  4PHK A;  5AER A;  1MR8 A;  1K95 A;  4OCI A;  2KI6 C;  2FCE A;  1K96 A;  2LUC A;  2GGZ A;  1EG4 A;  2KI6 D;  1L2O B;  2L51 A;  4MZL A;  4PHJ A;  1AVS A;  2KGB C;  1SR6 C;  1DJX A;  4CPV A;  1YR5 A;  3H4S E;  2BKH B;  2PRU A;  2L50 A;  2BL0 C;  2LP2 A;  4DUQ A;  3CWG A;  1F55 A;  3D10 A;  3FS7 A;  1D1O A;  1KCY A;  4USL A;  3BYA A;  4CFR A;  1A29 A;  3FIA A;  2JOJ A;  1M39 A;  4P2Y B;  1QIV A;  1JF2 A;  1JWD A;  4YGB B;  1OQP A;  1Y1U A;  1SCM C;  3I5H C;  4YI9 A;  4MZK A;  1CLB A;  2MA2 A;  3F45 A;  3NSI A;  4N5X A;  1DF0 A;  4TNC A;  1UUR A;  5F6T A;  1SR6 B;  3QRX A;  2WCB A;  3SIB A;  1SPY A;  1S5G Y;  2F3Y A;  2NXQ A;  4FQO A;  4GAO A;  4CFQ A;  2BL0 B;  1UHN A;  5DKR A;  2K7O A;  4F0Z B;  1A75 B;  1AJ5 A;  1MWN A;  1B8R A;  2KYF A;  3SG5 A;  5HKW A;  3CLN A;  3OX6 A;  1QV0 A;  1J7R A;  1QX7 A;  4GGN A;  1QLK A;  4HRE E;  1KFU S;  1GQM A;  1M63 B;  4YGC B;  1IH0 A;  3TDZ A;  1SCM B;  3I5H B;  1S26 D;  3O6B A;  1DT7 B;  2NZ0 A;  2P6B B;  1X02 A;  2ZNE A;  3FWC A;  5AXI A;  1C7V A;  2JZI A;  3PLF B;  1CDM A;  1NX1 A;  1DGV A;  2KFG A;  1QVI Z;  3NSL A;  3VRP A;  5CSF A;  1R6P A;  1TNP A;  4MN0 A;  1QIW A;  1RJV A;  3I5G C;  1F54 A;  2MRD A;  2CT9 A;  1TCO B;  5HYD A;  1DGU A;  1YVL A;  1U5I B;  2EHB A;  2M1U A;  3WHU B;  3CZT X;  1BT6 A;  1XK4 C;  1JC2 A;  3BOW A;  2BE6 A;  1NYA A;  1YX7 A;  1FPW A;  1RTP 1;  2L5X B;  1B8C A;  3EVU A;  1FBV A;  3A4U B;  4ZCU A;  4ETO A;  2ISD A;  2JUL A;  3OP0 A;  2LUX A;  4OV2 A;  1DJZ A;  4IL1 A;  4FTG A;  2JT0 A;  2KAV A;  3CS1 A;  3NSO A;  1REC A;  3O78 A;  4ORA B;  1WRZ A;  4GGF C;  3EVV A;  4XJK B;  1LXF C;  3HCM A;  1WY9 A;  4QJ3 B;  3LLE A;  1G8I A;  3SG7 A;  1Y0V H;  2JXL A;  2M7N A;  3NXA A;  1XFW O;  1CDL A;  2H61 C;  2R2I A;  1NIW A;  2KBM A;  2AUC A;  2Y1M A;  1PSR A;  3OX5 A;  1ALV A;  2LNK A;  2WC8 A;  2BCB A;  1NX0 A;  1Y1A A;  1WDC B;  1KK8 C;  1MHO A;  1C07 A;  4XYN A;  4BY4 A;  2ZKM X;  2I94 A;  1LA0 A;  2LHI A;  2RGI A;  5IBW A;  1KSO A;  1MUX A;  4HRH A;  1V1G A;  1SRA A;  1KFX L;  3DVM A;  4PE4 A;  1BJF A;  4I5N B;  5KSZ A;  3EKH A;  3IQQ A;  1IKU A;  5AFP A;  5JOL A;  2MJW B;  3PAT A;  1XFX O;  4DRW A;  1UWO A;  2KYC A;  4PE0 A;  5TNC A;  2LLS A;  2O5G A;  2LVV A;  1SY9 A;  2KOT A;  1J1D A;  4GNK B;  3IQO A;  4JWQ A;  1QVI Y;  2JT8 A;  2PSR A;  2MHH A;  2KI4 C;  1M46 A;  1XFU O;  3DD4 A;  4GPL B;  5CSN A;  3SG6 A;  3PFV A;  2K61 A;  4MSP A;  1LA3 A;  3KHE A;  2GV5 A;  1FI5 A;  5PAL A;  1QS7 A;  1B4C A;  1OZO A;  1UP5 A;  2BBM A;  1R2U A;  3AKA A;  3A8R A;  3BXK A;  1IWQ A;  1OMR A;  3DF0 A;  4MRX A;  1VRK A;  2EC6 C;  2M7L A;  2K2A A;  3KF9 A;  3OHM B;  1K2H A;  3TUY B;  2OTG C;  1CTR A;  1N0Y A;  1PVB A;  1XFV O;  3VRQ A;  5HLO A;  2KI4 B;  1ZFS A;  2KHN A;  5I2Q A;  2O60 A;  1DF0 B;  1BLQ A;  3PM8 A;  2Y1N A;  2Y5I A;  1LIN A;  2QPT A;  2LCP A;  3D0Y A;  1KFX S;  1IJ5 A;  3PSR A;  1JSA A;  2K2F A;  5J3X A;  2FCD A;  1PRW A;  2LLT A;  3BUM B;  1J55 A;  4PDZ A;  4AQJ A;  1SNL A;  1K9K A;  1LVC D;  2EC6 B;  1Q80 A;  1QXP A;  1DJY A;  1RWY A;  1TNQ A;  3LK0 A;  2WCF A;  2KDH A;  1BR4 B;  4CID A;  2BCX A;  1F4Q A;  5I2O A;  2ZRT A;  4OVN F;  3TS5 C;  1GJY A;  1ZMZ A;  3BUX B;  2BE4 A;  4C0J A;  4HRG A;  1MXE A;  3C1V A;  4C0L A;  2OTG B;  1AUI B;  4JPZ B;  1QAT A;  2PAS A;  1CFD A;  3RM1 A;  3CGA A;  1WLZ A;  1AK8 A;  1S6J A;  5FYX A;  1CB1 A;  5ER4 X;  5I2L A;  1K90 D;  2LM5 A;  3EK7 A;  2OS8 C;  2LVK A;  4OR9 B;  1TRF A;  3DVK A;  1DMO A;  1N2D A;  5BPJ A;  1JFK A;  1OMD A;  1YUR A;  3TS5 B;  1K8U A;  2PMY A;  3BOW B;  3LK1 A;  2JC2 A;  1DJW A;  1FF1 A;  1XA5 A;  4MZJ A;  1F70 A;  2JNF A;  1TTX A;  1CFP A;  4C0K A;  1IQ3 A;  1XFY O;  3IF7 A;  4GBA A;  2LAP A;  3JVT C;  2OS8 B;  1F4O A;  1WDC C;  1OMV A;  1PK0 D;  3CTN A;  5HKY A;  1UHH A;  2L98 A;  4HSZ A;  1BOC A; 
#chains in the Genus database with same CATH topology
 4UPG A;  1J7O A;  4NQG A;  3V2L A;  3R1P A;  2NCO A;  3KEV A;  5I94 A;  2KFF A;  2OPO A;  4ICB A;  4CLN A;  1RFJ A;  3QME A;  1DVI A;  4N1G A;  1CM4 A;  4U8D A;  2PAL A;  1B7T Z;  1JUO A;  1DJH A;  1TNW A;  2KNE A;  4P5O E;  2KAY A;  1N65 A;  2WCL A;  2PQL A;  2ZRS A;  3JVT B;  3SG4 A;  1YX8 A;  2I18 A;  1S36 A;  3D78 A;  1J1E A;  2JNX A;  3I5F B;  2M0R A;  2M9G A;  1NPQ A;  4GUK A;  4MEW A;  3KO0 A;  1JBA A;  3PN7 C;  2L2C A;  4FQT A;  3DVJ A;  1SL9 A;  2HF5 A;  2KBI A;  2JPO A;  3CR5 X;  1RRO A;  1SSE B;  1V1F A;  1OOH A;  4PE1 A;  4DS7 A;  1NWD A;  3TDI A;  2PVB A;  5DKQ A;  2QDI A;  2Q91 A;  3PAL A;  2LMU A;  5AAN A;  4A4B A;  4L9M A;  1CNP A;  1F8H A;  5JJG A;  2SCP A;  2CBL A;  3CR2 A;  2BAP A;  4N1F A;  5AEQ A;  1NSH A;  1XFR A;  3SS5 A;  2A4J A;  2IS9 A;  1B8L A;  4NDC A;  1KQV A;  4MBE A;  3ZNI A;  3I5I C;  1SL8 A;  3DVE A;  1ZOT B;  2LAN A;  2ZFD A;  1FW4 A;  1BG1 A;  2L0P A;  3PN7 B;  4QJ4 B;  2K0J A;  1OW4 A;  2JRF A;  2MLE C;  3SS4 A;  3TUY C;  2M1K B;  2CCM A;  3Q8I A;  2CXJ A;  4AOM A;  3FE9 A;  3GK1 A;  1TN4 A;  2QAC A;  3L47 A;  1NCY A;  2MLF C;  2WOS A;  2LC5 A;  1IGV A;  1NX3 A;  4YI8 A;  1NUB A;  2HQW A;  5B8I B;  1CFF A;  1K94 A;  3DF0 B;  1KSM A;  2JWW A;  2LP3 A;  1LKJ A;  1S6I A;  2K60 A;  3VRO A;  4R1E A;  4F7F A;  2M29 A;  2MAZ A;  2KGR A;  5KU1 A;  1BOD A;  4I5K A;  3I5I B;  1K93 D;  1WRK A;  1KFU L;  1WLM A;  2CNP A;  1F71 A;  1ZAC A;  1W9Z A;  4NDD A;  1SMG A;  1S6C A;  3WXA A;  1TOP A;  4AQI A;  2M49 B;  3SIA A;  1W7J B;  1MXL C;  1UHJ A;  3CR4 X;  2LMV A;  1CDP A;  1B9A A;  1C3Z A;  3NSK A;  3D0Y B;  2KQ6 A;  2LVI A;  2BBN A;  3EKJ A;  3LL8 B;  2F2P A;  4M2Q A;  2L4H A;  3B7A A;  2JPT A;  2KSP A;  4DIR A;  2EGD A;  1JF0 A;  4QJ5 B;  1A2X A;  2JTT A;  1G33 A;  2SAS A;  3VRN A;  1BMO A;  2D8N A;  2M97 A;  1EL4 A;  5ER5 A;  2WCM A;  5D69 A;  1CLL A;  4YGD B;  2LHL A;  2K7C A;  1B7T Y;  1SW8 A;  2MBX A;  1CFC A;  1SK6 D;  1FI6 A;  3GOF A;  1Z2C B;  1QAS A;  4E68 A;  1HQV A;  2BCA A;  2CTN A;  5I8N A;  1EG3 A;  2G9B A;  1SKT A;  2QEO A;  1DJG A;  1G4Y R;  1PUL A;  1YUU A;  1B1G A;  4I5J A;  2KLD A;  2WC5 A;  1SBJ A;  1ZUZ A;  2M8U A;  2I2R E;  1OZS A;  1SCV A;  3BQ3 A;  1NCX A;  4OKH A;  1EXR A;  2KAX A;  2ERB A;  1XFZ O;  2P71 A;  3EK4 A;  1B47 A;  2GTE A;  4PAL A;  1C7W A;  3MSE B;  1YRT B;  2Y4Q A;  1CKK A;  3OB2 B;  3BUN B;  5K89 A;  5HLV A;  1QLS A;  2NLN A;  1A75 A;  1ODB A;  1S1E A;  1TIZ A;  3HX4 A;  1WRL A;  4WQ3 A;  2G2B A;  2KQY A;  2WOR A;  3D74 A;  4MLW A;  1H8B A;  1NCZ A;  2F2O A;  1TNX A;  2JQ6 A;  2WCH A;  1Z4H A;  1QTX A;  4A4C A;  3R1V A;  3S0G A;  1AHR A;  2AMI A;  1OOG A;  1QX2 A;  1XYD A;  2LE9 B;  4WQ2 A;  2P70 A;  1QV1 A;  4MVF A;  1PSB A;  1UHI A;  1BR1 B;  4ORB B;  3B6X A;  3LCP C;  4PHN A;  1PVA A;  1YTZ C;  1CLM A;  3I5F C;  1J7Q A;  2E30 A;  2B1U A;  3TDU A;  2LVJ A;  3OB1 B;  2DOQ A;  1HT9 A;  3K1E A;  1IIO A;  3ZWH A;  3SG2 A;  2E6W A;  4YGA A;  3ICB A;  1H4B A;  1BU3 A;  1SYM A;  1A4P A;  1DJI A;  3JTD C;  5CSI A;  1CMG A;  1KQM C;  1TCF A;  1U5I A;  3AKB A;  1KWO C;  3O2P A;  1KK7 Y;  1E8A A;  2H2K A;  4I5L B;  4PHM A;  1L7Z A;  2BEC A;  1MF8 B;  3E3R A;  3M0W A;  2V53 A;  2WND A;  1K9U A;  5CPV A;  3UO9 A;  4M2P A;  2Q4U A;  1Y1X A;  3BUO B;  3BFH A;  3D76 A;  5GQQ C;  2VRG A;  1IJ6 A;  2TN4 A;  3PJI A;  4M2O A;  4Q04 A;  4PE7 A;  1CMF A;  1YVH A;  3AAK A;  5G08 A;  2BKI B;  1EH2 A;  3I5G B;  1DEL A;  1NP8 A;  1OSA A;  3SJS A;  1IG5 A;  1M45 A;  1T14 A;  3BUW B;  1IRJ A;  2L2E A;  4XJK A;  2KFH A;  2F8P A;  4JQ0 D;  1QX5 B;  1S5G Z;  1W7I B;  2FJU B;  2COL B;  2LMT A;  3JTD B;  3O4Y A;  1UUS A;  1KQM B;  1KWO B;  4PCW A;  4INW A;  1BF5 A;  1XK4 A;  2LV7 A;  2ZND A;  1PAL A;  2AAO A;  1CM1 A;  3S0F A;  2JT3 A;  5CSJ A;  1XVJ A;  2JXC A;  2NCP A;  1M31 A;  1OE9 B;  2F33 A;  1DTL A;  1EJ3 A;  3TZ1 A;  4D1E A;  1QJT A;  1A03 A;  2HPS A;  1S3P A;  3B87 A;  2KLE A;  3KPX A;  3FE8 A;  5DKN A;  5FI6 A;  1GGW A;  1SL7 A;  3EK8 A;  3NHT A;  3AAJ A;  1AJ4 A;  4YBH B;  2ZN8 A;  2K7D A;  5KTY A;  1YUT A;  2H8V A;  2F3Z A;  4WRI A;  5D7F A;  3SG3 A;  2ZN9 A;  3BFA A;  4GGF A;  3VGO A;  1NX2 A;  1K9P A;  2HQ8 A;  2L4I A;  3GK4 X;  4DCK A;  1CDN A;  1J7P A;  4YGE B;  2L5Y A;  2I7A A;  1L2O C;  3K21 A;  2K8M B;  4GFT A;  3WHT B;  1ALW A;  3EVR A;  1JFJ A;  4BY5 A;  2GGM A;  1MQ1 A;  1RK9 A;  2JU0 A;  1YRU B;  1OOJ A;  4NDB A;  5HKZ A;  2K7B A;  2H61 A;  1AP4 A;  1GGZ A;  2LLU A;  3FWB A;  3PM2 A;  1TUZ A;  1YUS A;  3WNX B;  1Y6W A;  4ZCV A;  4YRU A;  1UHK A;  2JTZ A;  1KK8 B;  1IQ5 A;  4INX A;  2WCE A;  1XO5 A;  1DQE A;  3VRR A;  1KK7 Z;  2FOT A;  3RLZ A;  2M3W A;  3GK2 A;  2HET A;  4ORC B;  4PHK A;  5AER A;  1MR8 A;  1K95 A;  4OCI A;  2KI6 C;  2FCE A;  1K96 A;  2LUC A;  2WCK A;  2GGZ A;  1EG4 A;  2KI6 D;  1L2O B;  2L51 A;  4MZL A;  4PHJ A;  1AVS A;  2KGB C;  1SR6 C;  1DJX A;  4CPV A;  1YR5 A;  3H4S E;  2BKH B;  2PRU A;  2L50 A;  3R72 A;  2BL0 C;  3CZ1 A;  2LP2 A;  5FI7 A;  4DUQ A;  3CWG A;  5EL2 A;  3DY9 A;  3D10 A;  3FS7 A;  3S0D A;  1D1O A;  4USL A;  1F55 A;  3BYA A;  3VB1 A;  4CFR A;  1KCY A;  1A29 A;  3FIA A;  2JOJ A;  1M39 A;  4P2Y B;  1QIV A;  1JF2 A;  1JWD A;  4YGB B;  1OQP A;  1Y1U A;  1SCM C;  3I5H C;  4YI9 A;  4MZK A;  3B88 A;  1CLB A;  2MA2 A;  3F45 A;  3NSI A;  4N5X A;  1DF0 A;  4TNC A;  1UUR A;  5F6T A;  3DZT A;  1SR6 B;  3QRX A;  2WCB A;  3OGN A;  1SPY A;  1S5G Y;  2F3Y A;  2NXQ A;  4FQO A;  3SIB A;  4GAO A;  3UNW A;  4CFQ A;  2BL0 B;  3CDN A;  1UHN A;  5DKR A;  2K7O A;  4F0Z B;  1A75 B;  3L4L A;  1P28 A;  1AJ5 A;  1MWN A;  1B8R A;  2KYF A;  3SG5 A;  5HKW A;  3CLN A;  3OX6 A;  1QV0 A;  1J7R A;  1QX7 A;  4GGN A;  1QLK A;  4HRE E;  1KFU S;  1GQM A;  1M63 B;  4YGC B;  1IH0 A;  3TDZ A;  1SCM B;  3I5H B;  1S26 D;  3O6B A;  1DT7 B;  2NZ0 A;  2P6B B;  5FI2 A;  1X02 A;  2ZNE A;  3FWC A;  5AXI A;  2FJY A;  1C7V A;  2JZI A;  3PLF B;  1CDM A;  1NX1 A;  1DGV A;  2KFG A;  1QVI Z;  3O4X A;  2WC6 A;  3NSL A;  3VRP A;  5CSF A;  1R6P A;  2QEV A;  1TNP A;  4MN0 A;  1C3Y A;  1QIW A;  1RJV A;  3I5G C;  1F54 A;  2MRD A;  2CT9 A;  1TCO B;  5HYD A;  1DGU A;  1YVL A;  1U5I B;  2EHB A;  2M1U A;  3WHU B;  3CZT X;  1QWV A;  1BT6 A;  1XK4 C;  4JD9 A;  1JC2 A;  3BOW A;  4KYN A;  2BE6 A;  1NYA A;  1YX7 A;  1FPW A;  1RTP 1;  2L5X B;  1B8C A;  3EVU A;  1FBV A;  3A4U B;  4ZCU A;  4ETO A;  2ISD A;  2JUL A;  3OP0 A;  2LUX A;  4JKT A;  2BNX A;  4OV2 A;  1DJZ A;  1OOF A;  4FTG A;  4IL1 A;  2JT0 A;  2KAV A;  3BJH A;  3BFB A;  1REC A;  3CS1 A;  3NSO A;  1WRZ A;  3O78 A;  3EVV A;  4GGF C;  4ORA B;  4XJK B;  1LXF C;  1OOI X;  3HCM A;  3NGV A;  1WY9 A;  4QJ3 B;  3LLE A;  1LS8 A;  1G8I A;  3SG7 A;  1Y0V H;  2JXL A;  1ORG A;  2M7N A;  3NXA A;  1XFW O;  1CDL A;  2H61 C;  2R2I A;  1NIW A;  3IVT A;  2KBM A;  2AUC A;  2Y1M A;  1PSR A;  3OX5 A;  1ALV A;  2LNK A;  2WC8 A;  2BCB A;  1Y1A A;  1NX0 A;  3OBV A;  1WDC B;  1KK8 C;  1MHO A;  1C07 A;  3EG5 B;  4XYN A;  4BY4 A;  3N7H A;  2ZKM X;  2I94 A;  1LA0 A;  1TWO A;  2LHI A;  2RGI A;  5IBW A;  1KSO A;  1MUX A;  3R1O A;  4HRH A;  5D3O A;  1V1G A;  1SRA A;  1KFX L;  3DVM A;  4PE4 A;  3S0B A;  3NHI A;  1BJF A;  4I5N B;  5KSZ A;  3EKH A;  3IQQ A;  1IKU A;  5AFP A;  5JOL A;  2MJW B;  3PAT A;  1XFX O;  4DRW A;  1UWO A;  2KYC A;  4PE0 A;  5TNC A;  2LLS A;  2O5G A;  2LVV A;  5HL1 A;  1SY9 A;  2KOT A;  2YGU A;  1J1D A;  4GNK B;  3IQO A;  4JWQ A;  1QVI Y;  2JT8 A;  3DYE A;  2PSR A;  2MHH A;  2KI4 C;  3DXL A;  1M46 A;  1XFU O;  3DD4 A;  4GPL B;  5CSN A;  3SG6 A;  3PFV A;  2K61 A;  4MSP A;  1LA3 A;  3KHE A;  2GV5 A;  3FE6 A;  1FI5 A;  5PAL A;  1QS7 A;  1B4C A;  1OZO A;  1UP5 A;  2BBM A;  1R2U A;  3AKA A;  3A8R A;  3BXK A;  1IWQ A;  1OMR A;  3DF0 A;  4MRX A;  1VRK A;  2EC6 C;  2M7L A;  2K2A A;  2PYQ A;  3SS3 A;  3KF9 A;  1DC1 A;  3OHM B;  1K2H A;  3TUY B;  2OTG C;  1CTR A;  1N0Y A;  1PVB A;  1XFV O;  3VRQ A;  5HLO A;  2KI4 B;  3S0A A;  1ZFS A;  2KHN A;  5I2Q A;  2O60 A;  1DF0 B;  1BLQ A;  3PM8 A;  2Y1N A;  2Y5I A;  1LIN A;  2QPT A;  2LCP A;  3D0Y A;  1KFX S;  1IJ5 A;  3PSR A;  1JSA A;  2K2F A;  2QEH A;  5J3X A;  2FCD A;  1PRW A;  2LLT A;  3BUM B;  1J55 A;  4PDZ A;  4AQJ A;  4IJ7 A;  1GM0 A;  1SNL A;  1K9K A;  1LVC D;  3CAB A;  2EC6 B;  1Q80 A;  1QXP A;  1DJY A;  1RWY A;  1TNQ A;  3LK0 A;  2WCF A;  2KDH A;  1BR4 B;  4CID A;  2BCX A;  1F4Q A;  5I2O A;  2ZRT A;  4OVN F;  3TS5 C;  3D75 A;  1GJY A;  1ZMZ A;  3BUX B;  2BE4 A;  4C0J A;  4HRG A;  1MXE A;  3C1V A;  4C0L A;  2OTG B;  1AUI B;  4JPZ B;  1QAT A;  2PAS A;  3CZ0 A;  1CFD A;  2QEB A;  3RM1 A;  3CGA A;  1WLZ A;  1AK8 A;  3D77 A;  1S6J A;  4PT1 A;  5FYX A;  1CB1 A;  5ER4 X;  5I2L A;  1K90 D;  2WCJ A;  2LM5 A;  3D73 A;  3EK7 A;  2OS8 C;  2LVK A;  3L4A A;  4OR9 B;  1TRF A;  3DVK A;  3CZ2 A;  1DMO A;  3RZS A;  1N2D A;  3S0E A;  5BPJ A;  1JFK A;  1OMD A;  1YUR A;  3TS5 B;  1K8U A;  3B86 A;  2PMY A;  3BOW B;  3LK1 A;  2JC2 A;  1DJW A;  1FF1 A;  1XA5 A;  4MZJ A;  1F70 A;  3CYZ A;  5DIC A;  2JNF A;  1DEK A;  1TTX A;  1CFP A;  4C0K A;  1IQ3 A;  1XFY O;  3IF7 A;  4GBA A;  2LAP A;  3JVT C;  2OS8 B;  1F4O A;  1WDC C;  4OZD A;  1OMV A;  1PK0 D;  2KPH A;  3CTN A;  5HKY A;  1UHH A;  2L98 A;  4HSZ A;  1BOC A;  4MRY A;  1TUJ A; 
#chains in the Genus database with same CATH homology
 4UPG A;  1J7O A;  4NQG A;  2NCO A;  3KEV A;  2KFF A;  2OPO A;  4ICB A;  4CLN A;  1RFJ A;  1DVI A;  4N1G A;  1CM4 A;  4U8D A;  2PAL A;  1B7T Z;  1JUO A;  1DJH A;  1TNW A;  2KNE A;  4P5O E;  2KAY A;  1N65 A;  2ZRS A;  3JVT B;  3SG4 A;  1YX8 A;  2I18 A;  1S36 A;  1J1E A;  2JNX A;  3I5F B;  2M0R A;  2M9G A;  1NPQ A;  4GUK A;  4MEW A;  3KO0 A;  1JBA A;  3PN7 C;  3DVJ A;  1SL9 A;  2HF5 A;  2KBI A;  3CR5 X;  1RRO A;  1V1F A;  4PE1 A;  4DS7 A;  1NWD A;  3TDI A;  2PVB A;  5DKQ A;  3PAL A;  2Q91 A;  5AAN A;  2LMU A;  4A4B A;  4L9M A;  1CNP A;  1F8H A;  5JJG A;  2SCP A;  2CBL A;  3CR2 A;  4N1F A;  5AEQ A;  1NSH A;  2A4J A;  2IS9 A;  1B8L A;  4NDC A;  1KQV A;  4MBE A;  3ZNI A;  3I5I C;  1SL8 A;  3DVE A;  1ZOT B;  2LAN A;  2ZFD A;  1FW4 A;  1BG1 A;  2L0P A;  3PN7 B;  4QJ4 B;  2K0J A;  2MLE C;  2JRF A;  3TUY C;  2M1K B;  2CCM A;  2CXJ A;  4AOM A;  3GK1 A;  1TN4 A;  2QAC A;  1NCY A;  2MLF C;  2WOS A;  2LC5 A;  1IGV A;  1NX3 A;  4YI8 A;  1NUB A;  2HQW A;  5B8I B;  1CFF A;  1K94 A;  3DF0 B;  1KSM A;  2JWW A;  2LP3 A;  1LKJ A;  1S6I A;  3VRO A;  4R1E A;  2M29 A;  2MAZ A;  2KGR A;  5KU1 A;  1BOD A;  4I5K A;  3I5I B;  1K93 D;  1WRK A;  1KFU L;  1WLM A;  2CNP A;  1F71 A;  1ZAC A;  4NDD A;  1SMG A;  1S6C A;  3WXA A;  1TOP A;  4AQI A;  2M49 B;  3SIA A;  1W7J B;  1MXL C;  1UHJ A;  3CR4 X;  2LMV A;  1CDP A;  1B9A A;  3NSK A;  4MRY A;  3D0Y B;  2KQ6 A;  2LVI A;  2BBN A;  3EKJ A;  3LL8 B;  2F2P A;  4M2Q A;  2L4H A;  2JPT A;  2KSP A;  4DIR A;  2EGD A;  1JF0 A;  4QJ5 B;  1A2X A;  2JTT A;  1G33 A;  2SAS A;  3VRN A;  1BMO A;  2D8N A;  2M97 A;  1EL4 A;  5ER5 A;  5D69 A;  1CLL A;  4YGD B;  2LHL A;  2K7C A;  1B7T Y;  1SW8 A;  2MBX A;  1CFC A;  1SK6 D;  1FI6 A;  3GOF A;  1QAS A;  4E68 A;  1HQV A;  2BCA A;  2CTN A;  5I8N A;  1EG3 A;  2G9B A;  1SKT A;  1DJG A;  1G4Y R;  1PUL A;  1YUU A;  1B1G A;  4I5J A;  1SBJ A;  1ZUZ A;  2M8U A;  2I2R E;  1OZS A;  1SCV A;  3BQ3 A;  1NCX A;  4OKH A;  1EXR A;  2KAX A;  1XFZ O;  3EK4 A;  1B47 A;  4PAL A;  1C7W A;  3MSE B;  1YRT B;  2Y4Q A;  1CKK A;  3OB2 B;  3BUN B;  5K89 A;  5HLV A;  1QLS A;  2NLN A;  1A75 A;  1ODB A;  1S1E A;  1TIZ A;  3HX4 A;  1WRL A;  4WQ3 A;  2G2B A;  2KQY A;  2WOR A;  4MLW A;  1H8B A;  1NCZ A;  2F2O A;  1TNX A;  2JQ6 A;  1QTX A;  4A4C A;  1AHR A;  2AMI A;  1QX2 A;  1XYD A;  2LE9 B;  4WQ2 A;  1QV1 A;  4MVF A;  1PSB A;  1UHI A;  1BR1 B;  4ORB B;  3LCP C;  4PHN A;  1PVA A;  1YTZ C;  1CLM A;  3I5F C;  1J7Q A;  2E30 A;  2B1U A;  3TDU A;  2LVJ A;  3OB1 B;  2DOQ A;  1HT9 A;  3ZWH A;  3SG2 A;  2E6W A;  4YGA A;  3ICB A;  1H4B A;  1BU3 A;  1SYM A;  1A4P A;  1DJI A;  3JTD C;  5CSI A;  1CMG A;  1KQM C;  1TCF A;  1U5I A;  3AKB A;  1KWO C;  3O2P A;  1KK7 Y;  1E8A A;  2H2K A;  4I5L B;  4PHM A;  1L7Z A;  2BEC A;  1MF8 B;  3E3R A;  3M0W A;  2V53 A;  2WND A;  1K9U A;  5CPV A;  4M2P A;  2Q4U A;  1Y1X A;  3BUO B;  5GQQ C;  2VRG A;  1IJ6 A;  2TN4 A;  4M2O A;  4Q04 A;  1CMF A;  4PE7 A;  1YVH A;  3AAK A;  5G08 A;  2BKI B;  1EH2 A;  3I5G B;  1NP8 A;  1OSA A;  3SJS A;  1IG5 A;  1M45 A;  3BUW B;  1IRJ A;  2L2E A;  4XJK A;  2KFH A;  2F8P A;  4JQ0 D;  1QX5 B;  1S5G Z;  1W7I B;  2FJU B;  2COL B;  2LMT A;  3JTD B;  3O4Y A;  1UUS A;  1KQM B;  1KWO B;  4PCW A;  1BF5 A;  1XK4 A;  2LV7 A;  2ZND A;  1PAL A;  2AAO A;  1CM1 A;  2JT3 A;  5CSJ A;  1XVJ A;  2JXC A;  2NCP A;  1M31 A;  1OE9 B;  2F33 A;  1DTL A;  1EJ3 A;  3TZ1 A;  4D1E A;  1QJT A;  1A03 A;  2HPS A;  1S3P A;  3KPX A;  5DKN A;  1GGW A;  1SL7 A;  3EK8 A;  3AAJ A;  1AJ4 A;  4YBH B;  2ZN8 A;  2K7D A;  5KTY A;  1YUT A;  5D7F A;  2F3Z A;  4WRI A;  3SG3 A;  2ZN9 A;  4GGF A;  3VGO A;  1NX2 A;  1K9P A;  2HQ8 A;  2L4I A;  3GK4 X;  4DCK A;  1CDN A;  1J7P A;  4YGE B;  2I7A A;  1L2O C;  3K21 A;  2K8M B;  4GFT A;  3WHT B;  1ALW A;  3EVR A;  1JFJ A;  4BY5 A;  2GGM A;  1MQ1 A;  1RK9 A;  2JU0 A;  1YRU B;  1OOJ A;  4NDB A;  5HKZ A;  2K7B A;  2H61 A;  1AP4 A;  1GGZ A;  2LLU A;  3FWB A;  4YRU A;  1YUS A;  3WNX B;  1Y6W A;  4ZCV A;  1UHK A;  2JTZ A;  1KK8 B;  1IQ5 A;  2WCE A;  1XO5 A;  3VRR A;  1KK7 Z;  2FOT A;  3RLZ A;  2M3W A;  3GK2 A;  2HET A;  4ORC B;  4PHK A;  5AER A;  1MR8 A;  1K95 A;  4OCI A;  2KI6 C;  2FCE A;  1K96 A;  2LUC A;  2GGZ A;  1EG4 A;  2KI6 D;  1L2O B;  2L51 A;  4MZL A;  4PHJ A;  1AVS A;  2KGB C;  1SR6 C;  1DJX A;  4CPV A;  1YR5 A;  3H4S E;  2BKH B;  2PRU A;  2L50 A;  2BL0 C;  2LP2 A;  4DUQ A;  3CWG A;  1F55 A;  3D10 A;  3FS7 A;  1D1O A;  1KCY A;  4USL A;  3BYA A;  4CFR A;  1A29 A;  3FIA A;  2JOJ A;  1M39 A;  4P2Y B;  1QIV A;  1JF2 A;  1JWD A;  4YGB B;  1OQP A;  1Y1U A;  1SCM C;  3I5H C;  4YI9 A;  4MZK A;  1CLB A;  2MA2 A;  3F45 A;  3NSI A;  4N5X A;  1DF0 A;  4TNC A;  1UUR A;  5F6T A;  1SR6 B;  3QRX A;  2WCB A;  3SIB A;  1SPY A;  1S5G Y;  2F3Y A;  2NXQ A;  4FQO A;  4GAO A;  4CFQ A;  2BL0 B;  1UHN A;  5DKR A;  2K7O A;  4F0Z B;  1A75 B;  1AJ5 A;  1MWN A;  1B8R A;  2KYF A;  3SG5 A;  5HKW A;  3CLN A;  3OX6 A;  1QV0 A;  1J7R A;  1QX7 A;  4GGN A;  1QLK A;  4HRE E;  1KFU S;  1GQM A;  1M63 B;  4YGC B;  1IH0 A;  3TDZ A;  1SCM B;  3I5H B;  1S26 D;  3O6B A;  1DT7 B;  2NZ0 A;  2P6B B;  1X02 A;  2ZNE A;  3FWC A;  5AXI A;  1C7V A;  2JZI A;  3PLF B;  1CDM A;  1NX1 A;  1DGV A;  2KFG A;  1QVI Z;  3NSL A;  3VRP A;  5CSF A;  1R6P A;  1TNP A;  4MN0 A;  1QIW A;  1RJV A;  3I5G C;  1F54 A;  2MRD A;  2CT9 A;  1TCO B;  5HYD A;  1DGU A;  1YVL A;  1U5I B;  2EHB A;  2M1U A;  3WHU B;  3CZT X;  1BT6 A;  1XK4 C;  1JC2 A;  3BOW A;  2BE6 A;  1NYA A;  1YX7 A;  1FPW A;  1RTP 1;  2L5X B;  1B8C A;  3EVU A;  1FBV A;  3A4U B;  4ZCU A;  4ETO A;  2ISD A;  2JUL A;  3OP0 A;  2LUX A;  4OV2 A;  1DJZ A;  4IL1 A;  4FTG A;  2JT0 A;  2KAV A;  3CS1 A;  3NSO A;  1REC A;  3O78 A;  4ORA B;  1WRZ A;  4GGF C;  3EVV A;  4XJK B;  1LXF C;  3HCM A;  1WY9 A;  4QJ3 B;  3LLE A;  1G8I A;  3SG7 A;  1Y0V H;  2JXL A;  2M7N A;  3NXA A;  1XFW O;  1CDL A;  2H61 C;  2R2I A;  1NIW A;  2KBM A;  2AUC A;  2Y1M A;  1PSR A;  3OX5 A;  1ALV A;  2LNK A;  2WC8 A;  2BCB A;  1NX0 A;  1Y1A A;  1WDC B;  1KK8 C;  1MHO A;  1C07 A;  4XYN A;  4BY4 A;  2ZKM X;  2I94 A;  1LA0 A;  2LHI A;  2RGI A;  5IBW A;  1KSO A;  1MUX A;  4HRH A;  1V1G A;  1SRA A;  1KFX L;  3DVM A;  4PE4 A;  1BJF A;  4I5N B;  5KSZ A;  3EKH A;  3IQQ A;  1IKU A;  5AFP A;  5JOL A;  2MJW B;  3PAT A;  1XFX O;  4DRW A;  1UWO A;  2KYC A;  4PE0 A;  5TNC A;  2LLS A;  2O5G A;  2LVV A;  1SY9 A;  2KOT A;  1J1D A;  4GNK B;  3IQO A;  4JWQ A;  1QVI Y;  2JT8 A;  2PSR A;  2MHH A;  2KI4 C;  1M46 A;  1XFU O;  3DD4 A;  4GPL B;  5CSN A;  3SG6 A;  3PFV A;  2K61 A;  4MSP A;  1LA3 A;  3KHE A;  2GV5 A;  1FI5 A;  5PAL A;  1QS7 A;  1B4C A;  1OZO A;  1UP5 A;  2BBM A;  1R2U A;  3AKA A;  3A8R A;  3BXK A;  1IWQ A;  1OMR A;  3DF0 A;  4MRX A;  1VRK A;  2EC6 C;  2M7L A;  2K2A A;  3KF9 A;  3OHM B;  1K2H A;  3TUY B;  2OTG C;  1CTR A;  1N0Y A;  1PVB A;  1XFV O;  3VRQ A;  5HLO A;  2KI4 B;  1ZFS A;  2KHN A;  5I2Q A;  2O60 A;  1DF0 B;  1BLQ A;  3PM8 A;  2Y1N A;  2Y5I A;  1LIN A;  2QPT A;  2LCP A;  3D0Y A;  1KFX S;  1IJ5 A;  3PSR A;  1JSA A;  2K2F A;  5J3X A;  2FCD A;  1PRW A;  2LLT A;  3BUM B;  1J55 A;  4PDZ A;  4AQJ A;  1SNL A;  1K9K A;  1LVC D;  2EC6 B;  1Q80 A;  1QXP A;  1DJY A;  1RWY A;  1TNQ A;  3LK0 A;  2WCF A;  2KDH A;  1BR4 B;  4CID A;  2BCX A;  1F4Q A;  5I2O A;  2ZRT A;  4OVN F;  3TS5 C;  1GJY A;  1ZMZ A;  3BUX B;  2BE4 A;  4C0J A;  4HRG A;  1MXE A;  3C1V A;  4C0L A;  2OTG B;  1AUI B;  4JPZ B;  1QAT A;  2PAS A;  1CFD A;  3RM1 A;  3CGA A;  1WLZ A;  1AK8 A;  1S6J A;  5FYX A;  1CB1 A;  5ER4 X;  5I2L A;  1K90 D;  2LM5 A;  3EK7 A;  2OS8 C;  2LVK A;  4OR9 B;  1TRF A;  3DVK A;  1DMO A;  1N2D A;  5BPJ A;  1JFK A;  1OMD A;  1YUR A;  3TS5 B;  1K8U A;  2PMY A;  3BOW B;  3LK1 A;  2JC2 A;  1DJW A;  1FF1 A;  1XA5 A;  4MZJ A;  1F70 A;  2JNF A;  1TTX A;  1CFP A;  4C0K A;  1IQ3 A;  1XFY O;  3IF7 A;  4GBA A;  2LAP A;  3JVT C;  2OS8 B;  1F4O A;  1WDC C;  1OMV A;  1PK0 D;  3CTN A;  5HKY A;  1UHH A;  2L98 A;  4HSZ A;  1BOC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...