3AAJA

Crystal structure of ca2+-bound form of des3-23alg-2deltagf122
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
167
structure length
167
Chain Sequence
ADQSFLWNVFQRVDKDRSGVISDTELQQALSNGTWTPFNPVTVRSIISMFDRENKAGVNFSEFTGVWKYITDWQNVFRTYDRDNSGMIDKNELKQALSGYRLSDQFHDILIRKFDRQGRGQIAFDDFIQGCIVLQRLTDIFRRYDTDQDGWIQVSYEQYLSMVFSIV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Programmed cell death protein 6
publication title Molecular basis for defect in Alix-binding by alternatively spliced isoform of ALG-2 (ALG-2DeltaGF122) and structural roles of F122 in target recognition
pubmed doi rcsb
source organism Homo sapiens
molecule tags Apoptosis
total genus 57
structure length 167
sequence length 167
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-11-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13202 EF-hand_5 EF hand
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3aajA00
4HRHA 3TDIA 1ODBA 2JT3A 3DF0A 3BXKA 2NLNA 3NSLA 3PALA 3A8RA 1UHNA 1XYDA 2PSRA 2COLB 2JXLA 3TDUA 1SCVA 1PVAA 2L4HA 3JTDB 1BG1A 2FCDA 3SG2A 2F3YA 1HT9A 4DRWA 1FBVA 2WCFA 2LE9B 4XJKB 4YGCB 1JWDA 1CDMA 1NUBA 3I5FB 1K95A 1X02A 4XYNA 1KK7Y 1ZFSA 2ZRTA 3BUOB 2HETA 1OSAA 1N65A 2CCMA 2K0JA 1QS7A 3SG3A 2BCXA 3I5IC 1N0YA 4MLWA 4A4CA 1L2OB 4YI8A 1K2HA 3EK8A 4CLNA 2Y4QA 2O5GA 2MLFC 4FTGA 2LVIA 3PSRA 5PALA 1GQMA 1OOJA 2CXJA 1KWOC 4HSZA 1IWQA 4WRIA 2M8UA 4DS7A 5AANA 5BPJA 3ZWHA 1CNPA 1DF0A 2JXCA 3GK2A 1CB1A 4QJ4B 2K7DA 2WNDA 3NXAA 4GPLB 2L50A 4OR9B 4PHNA 2L2EA 5GQQC 2SASA 1SNLA 1AHRA 2ZN9A 2E30A 2LVVA 3BUMB 1K94A 1MQ1A 1K9KA 1DJZA 4HRGA 4P2YB 3DVEA 1SR6B 4Q04A 1AP4A 1DF0B 1B9AA 1CM1A 1QATA 1QIWA 1DMOA 5DKRA 2M7LA 3TZ1A 1CFCA 1PK0D 2OS8C 1TCOB 5J3XA 1E8AA 1K90D 3H4SE 3LK0A 3PLFB 2I18A 2HPSA 3DVJA 1S6JA 1BODA 1K93D 2LV7A 2LAPA 1UHHA 1GGWA 2LP2A 4JPZB 3TUYC 1BR1B 2Y1NA 1KSMA 4NDDA 2LUXA 4AOMA 5AFPA 1NSHA 1G8IA 3KEVA 1B7TZ 1B4CA 1SY9A 5CSJA 1V1FA 2BCBA 1TNQA 1K9UA 2QACA 1AJ4A 4C0JA 1C7VA 2BECA 2JC2A 4P5OE 4E68A 1B8RA 1KK8C 1UWOA 2LMUA 2ZNDA 1BF5A 1DJYA 1TN4A 1UP5A 2M0RA 1C7WA 3JVTB 2P6BB 1EXRA 2F3ZA 3CR5X 1DJXA 4CIDA 1M63B 2EHBA 3O4YA 4MRYA 3FWCA 1CMGA 1BJFA 3CZTX 1YVHA 2Q91A 1YURA 2GGMA 1EJ3A 2LLTA 1MR8A 2LLSA 2MAZA 3LCPC 5HYDA 2GGZA 2HF5A 5I2QA 1OMDA 3OP0A 1MXLC 1A03A 2K7CA 2K7OA 3M0WA 3EK4A 2ISDA 2CT9A 1QXPA 1YUSA 1QLKA 3BOWA 1DJHA 1LINA 2BL0B 1EG4A 1G4YR 2KGRA 2LLUA 3WXAA 1BMOA 1KQMB 1QV1A 1NX1A 5CSIA 3SIBA 2MRDA 1DJGA 3CWGA 2K61A 4YBHB 1AK8A 3FIAA 1NCXA 3OX5A 1TNWA 3TS5B 3I5GB 2KAYA 2H61A 1EL4A 1M45A 2OPOA 4ICBA 3KF9A 4CFQA 4PDZA 5G08A 1CDLA 5CSFA 1H4BA 1YUTA 1F54A 4ORCB 1NYAA 1OZSA 3EKHA 4TNCA 2KBMA 4BY5A 1Y1UA 2LMVA 4PALA 4PE1A 5I2OA 3SG4A 2LNKA 5HLVA 1XFXO 2JQ6A 1PVBA 3K21A 3KO0A 3SJSA 4BY4A 2L0PA 1SCMB 1M31A 1YX7A 2FJUB 4YGEB 2MBXA 1KFUL 4M2QA 4AQIA 5B8IB 5AXIA 2EC6B 2L98A 1F70A 1FI6A 3MSEB 3VRNA 1QJTA 1FW4A 1WRZA 3VRQA 1XFZO 3RLZA 1EG3A 3VGOA 1SMGA 5HLOA 5AEQA 1IJ5A 2R2IA 5CSNA 3DF0B 3AAKA 2ZN8A 4L9MA 4WQ2A 1F8HA 3BQ3A 3CR4X 1XA5A 3OHMB 4CFRA 4QJ5B 1NIWA 1K96A 1U5IA 4GBAA 1WY9A 1QX7A 1A4PA 1BT6A 1QX2A 2EGDA 4USLA 1NPQA 1OMRA 1NX3A 2M97A 1W7JB 2QPTA 2GV5A 2VRGA 1N2DA 1R6PA 1SRAA 1PRWA 1LKJA 2M1UA 2KI6C 1J1EA 1TCFA 3PN7B 1G33A 3NSIA 1RFJA 2ZNEA 1FF1A 3AKAA 2KOTA 1F55A 1CLLA 1IGVA 2KI4B 2LHLA 2I2RE 1F4QA 1U5IB 2KFGA 1UHIA 3DVKA 2K2AA 1UHKA 4GNKB 4YRUA 1XO5A 2Y1MA 2KAXA 2DOQA 3CGAA 3DVMA 4ORAB 3HX4A 2LP3A 1OMVA 2JOJA 5KTYA 4N5XA 1DJWA 1CFDA 1KSOA 1AVSA 5FYXA 2OTGB 1MF8B 2Y5IA 3I5HB 1DVIA 1AJ5A 4OCIA 2BE6A 3EKJA 4GGNA 5TNCA 4GAOA 4GGFC 1FI5A 4YGAA 1F71A 3KPXA 2JWWA 1S6CA 4YI9A 1JC2A 1JSAA 4MZKA 5K89A 1BR4B 3GK4X 1B7TY 1ZOTB 2HQ8A 3SIAA 4DCKA 2BBNA 2NCPA 4U8DA 2BKHB 1NCYA 3JTDC 5D69A 1DGUA 1HQVA 3PM8A 1PSBA 3EVRA 5HKZA 1NWDA 1CTRA 3AKBA 3EK7A 1IQ5A 4PHKA 3SG5A 2L4IA 2F33A 4DUQA 3I5FC 2G9BA 3O2PA 4R1EA 1LA3A 1JFKA 1FPWA 3VRRA 1XFWO 1PSRA 1Y1AA 1SBJA 4PE4A 1UHJA 3LLEA 1WDCB 1QASA 1WLZA 3GK1A 1NX2A 3HCMA 2F2PA 4D1EA 1L2OC 1XK4C 2JU0A 1S5GZ 1K8UA 1K9PA 1IH0A 4PHJA 3O78A 4MBEA 1S1EA 4M2OA 5AERA 4M2PA 2MLEC 4ZCUA 1L7ZA 2BE4A 4AQJA 3RM1A 1J7OA 1KFXL 3EVUA 3OB2B 4HREE 1XFYO 4MVFA 5I2LA 1TOPA 2JZIA 4I5LB 2M1KB 2RGIA 1TIZA 1ALVA 3VRPA 1D1OA 2HQWA 2ZFDA 4JQ0D 4MZJA 4I5NB 1F4OA 2BBMA 1DT7B 1SR6C 1QVIZ 1SL9A 1BLQA 3CTNA 3PFVA 2PASA 4OVNF 1YTZC 2ZRSA 5KU1A 3BOWB 1MXEA 3I5IB 1QV0A 2FOTA 4OV2A 3OB1B 2V53A 3LK1A 1YX8A 1S6IA 5F6TA 1JBAA 1KCYA 2MJWB 2KYFA 5HKYA 1OQPA 3C1VA 1Y1XA 2KQ6A 1QIVA 1YVLA 1KWOB 1LVCD 1BOCA 3ZNIA 3WHTB 3IF7A 2F2OA 4GGFA 2ZKMX 1B1GA 1SL7A 2KGBC 4UPGA 1YRUB 1PALA 2O60A 4C0LA 4WQ3A 3AAJA 3IQQA 1CFPA 2WCBA 4IL1A 3JVTC 2FCEA 3SG6A 1A29A 3BYAA 1UURA 1TRFA 2KAVA 3QRXA 4F0ZB 1OE9B 1J7QA 2SCPA 4PE7A 5DKNA 4I5JA 4MZLA 1NCZA 1RTP1 2TN4A 4XJKA 5D7FA 1KFXS 2KSPA 3KHEA 4GFTA 2LUCA 2OS8B 1CKKA 2KNEA 1W7IB 2LANA 2WCEA 1ZUZA 2I7AA 5CPVA 5ER5A 2H2KA 1SPYA 2M49B 3CR2A 3TUYB 1SK6D 4NDBA 3BUNB 1IJ6A 1SKTA 2BL0C 2JULA 3CLNA 4PHMA 1KQMC 4PE0A 1QX5B 3BUWB 3WNXB 1XK4A 1TNXA 2AUCA 3NSKA 3E3RA 3TS5C 2KFHA 1ZMZA 1KK8B 2E6WA 2CBLA 3I5GC 1J7PA 3NSOA 3O6BA 1JF0A 1Y6WA 3FS7A 1CFFA 1CMFA 2PVBA 2MA2A 4CPVA 1DJIA 2MHHA 1BU3A 1KFUS 1B8CA 1KK7Z 2KBIA 4NQGA 1RJVA 2JT0A 1JF2A 2H61C 2M29A 4DIRA 2JRFA 1S36A 2LVKA 3CS1A 3OX6A 4I5KA 1SCMC 4MN0A 4MSPA 4A4BA 1CDNA 3DD4A 1A2XA 1OZOA 2EC6C 2JT8A 2LM5A 2NCOA 1JUOA 1KQVA 1RK9A 2BCAA 2I94A 1CDPA 1GJYA 2A4JA 1Y0VH 2PMYA 1C07A 1J1DA 4GUKA 2M9GA 2LMTA 4YGBB 2G2BA 1S5GY 3GOFA 1CLBA 3ICBA 1SYMA 3WHUB 1LXFC 1A75A 1LA0A 1S3PA 1YUUA 1MHOA 2PRUA 1SW8A 1EH2A 2NXQA 2KQYA 3BUXB 5DKQA 1XVJA 2CTNA 2B1UA 2NZ0A 1J55A 2AMIA 2KYCA 3PN7C 2Q4UA 1ALWA 1J7RA 2LC5A 2KI4C 1QLSA 1NP8A 1QTXA 2KDHA 4MRXA 1A75B 5I8NA 3VROA 4ZCVA 1WLMA 4PCWA 4QJ3B 5HKWA 1IRJA 5IBWA 1RROA 1VRKA 1QVIY 2M7NA 1PULA 2M3WA 2L51A 1V1GA 1M39A 2KI6D 4OKHA 3TDZA 4C0KA 4ETOA 5JJGA 1TTXA 1GGZA 1XFUO 2L5XB 2AAOA 3D10A 2OTGC 2WORA 3D0YA 5JOLA 1YRTB 3I5HC 2KFFA 4MEWA 1CM4A 2D8NA 1ZACA 2JNXA 2KHNA 1JFJA 1TNPA 3IQOA 1DGVA 4ORBB 3LL8B 2LHIA 3FWBA 2WOSA 4N1FA 3A4UB 1NX0A 2LCPA 3D0YB 4JWQA 4FQOA 2K2FA 2LVJA 1WRKA 2BKIB 1Q80A 1SL8A 1WRLA 2IS9A 3SG7A 1B47A 1S26D 1IQ3A 4NDCA 2WC8A 5KSZA 1DTLA 3F45A 2JNFA 1CLMA 1H8BA 2JTTA 1AUIB 1M46A 1YR5A 1RWYA 1B8LA 2PALA 1R2UA 4YGDB 2JTZA 1MUXA 2CNPA 2F8PA 4N1GA 1WDCC 2JPTA 1IKUA 3PATA 1RECA 1IG5A 1XFVO 3EVVA 5ER4X 1MWNA 2K7BA 1UUSA 2K8MB
chains in the Genus database with same CATH superfamily
4HRHA 3TDIA 1ODBA 2JT3A 3DF0A 3BXKA 2NLNA 3NSLA 3PALA 3S0AA 3A8RA 1UHNA 1XYDA 2PSRA 2COLB 2JXLA 3TDUA 1SCVA 3S0DA 1PVAA 2L4HA 3JTDB 1BG1A 2FCDA 3SG2A 2F3YA 1HT9A 4DRWA 1FBVA 2WCFA 2LE9B 4XJKB 4YGCB 1JWDA 1CDMA 1NUBA 2PYQA 3I5FB 1K95A 1X02A 4XYNA 1KK7Y 1TUZA 1ZFSA 2ZRTA 3BUOB 2GTEA 3B87A 2HETA 1OSAA 1N65A 2CCMA 2K0JA 1QS7A 3SG3A 2BCXA 3I5IC 1N0YA 4MLWA 4A4CA 1L2OB 4YI8A 1K2HA 3EK8A 4CLNA 2Y4QA 2O5GA 2MLFC 4FTGA 2LVIA 3PSRA 5PALA 1GQMA 3B88A 1OOJA 2CXJA 1KWOC 1TUJA 4HSZA 1IWQA 4WRIA 2M8UA 4DS7A 5AANA 5BPJA 3ZWHA 1CNPA 1DF0A 2JXCA 3GK2A 1CB1A 4QJ4B 2K7DA 2WNDA 3NXAA 4GPLB 2L50A 3FE9A 4OR9B 4PHNA 2L2EA 5GQQC 2SASA 3D77A 1SNLA 1AHRA 2ZN9A 2E30A 2LVVA 3BUMB 1K94A 1MQ1A 1K9KA 1DJZA 4HRGA 4P2YB 3DVEA 1SR6B 4OZDA 4Q04A 1DF0B 1B9AA 1CM1A 1QATA 1QIWA 1AP4A 1DMOA 4IJ7A 5DKRA 2M7LA 3TZ1A 3UO9A 1CFCA 1PK0D 2OS8C 1TCOB 5J3XA 1E8AA 1K90D 3H4SE 3LK0A 3PLFB 2I18A 2BNXA 2HPSA 3DVJA 4KYNA 1S6JA 1T14A 3S0BA 1K93D 5FI6A 2LV7A 2LAPA 1UHHA 1BODA 1GGWA 2LP2A 4JPZB 3TUYC 1BR1B 2Y1NA 1KSMA 3D78A 4NDDA 2LUXA 4AOMA 5AFPA 1P28A 1NSHA 1G8IA 2JPOA 1B7TZ 3KEVA 1B4CA 1SY9A 5CSJA 3K1EA 1V1FA 2BCBA 1TNQA 1K9UA 2QACA 1AJ4A 4C0JA 1C7VA 2BECA 2JC2A 4P5OE 4E68A 1B8RA 1KK8C 1UWOA 3NHTA 2LMUA 2ZNDA 1BF5A 2KLEA 1DJYA 1TN4A 1UP5A 2M0RA 1C7WA 3JVTB 2P6BB 1EXRA 2F3ZA 2WC5A 3CR5X 1DJXA 2P71A 4CIDA 3B86A 2L5YA 1M63B 2EHBA 3O4YA 4MRYA 3FWCA 1CMGA 1BJFA 3CZTX 1YVHA 2Q91A 1YURA 2GGMA 1EJ3A 2QEHA 2LLTA 1MR8A 2LLSA 2MAZA 3LCPC 5HYDA 2GGZA 2HF5A 5I2QA 1OMDA 3OP0A 1MXLC 1A03A 2K7CA 2K7OA 3M0WA 3EK4A 2ISDA 2CT9A 1QXPA 1YUSA 1QLKA 3BOWA 1DJHA 1LINA 2BL0B 1EG4A 1G4YR 2KGRA 2LLUA 3WXAA 1BMOA 1KQMB 1QV1A 1NX1A 5CSIA 3SIBA 2MRDA 1DJGA 3CWGA 2K61A 4YBHB 1AK8A 3FIAA 1NCXA 3OX5A 1TNWA 3TS5B 3I5GB 2KAYA 2H61A 1EL4A 1M45A 2OPOA 4ICBA 3KF9A 4CFQA 4PDZA 5G08A 1CDLA 5CSFA 1H4BA 1YUTA 1F54A 4ORCB 1C3YA 1NYAA 3N7HA 4JKTA 1OZSA 3EKHA 4TNCA 2KBMA 4BY5A 3BFHA 1Y1UA 2LMVA 4PALA 4PE1A 4INWA 5I2OA 3SG4A 2LNKA 5HLVA 1XFXO 2JQ6A 1PVBA 3K21A 3B7AA 3KO0A 3SJSA 4BY4A 2L0PA 1SCMB 1M31A 1YX7A 2FJUB 3DXLA 3DYEA 1KFUL 4M2QA 4YGEB 2MBXA 5AXIA 2EC6B 2L98A 4AQIA 5B8IB 3MSEB 1F70A 1FI6A 3VRNA 1QJTA 1Z4HA 1FW4A 1WRZA 3VRQA 1XFZO 3RLZA 1EG3A 2WC6A 3VGOA 1SMGA 5HLOA 4FQTA 5AEQA 1IJ5A 2R2IA 5CSNA 3EG5B 3DF0B 3AAKA 2ZN8A 4L9MA 4WQ2A 1F8HA 3BQ3A 3CR4X 1XA5A 3OHMB 4CFRA 4QJ5B 1NIWA 1K96A 1U5IA 4GBAA 1WY9A 1QX7A 1A4PA 1BT6A 1QX2A 1OOGA 1OW4A 1NPQA 2EGDA 4USLA 1OMRA 1NX3A 2M97A 1W7JB 2QPTA 2GV5A 2VRGA 1N2DA 1R6PA 1SRAA 1PRWA 1LKJA 3SS4A 2M1UA 2KI6C 1J1EA 1TCFA 3PN7B 1G33A 3NSIA 1RFJA 2ZNEA 1FF1A 3AKAA 2KOTA 1F55A 1CLLA 1IGVA 2KI4B 2LHLA 2I2RE 1F4QA 1U5IB 2KFGA 1UHIA 3DVKA 2K2AA 3CDNA 1UHKA 4GNKB 4YRUA 1XO5A 2Y1MA 1DC1A 2KAXA 2DOQA 3CGAA 3DVMA 4ORAB 3HX4A 2LP3A 1OMVA 2JOJA 3CYZA 5KTYA 4N5XA 1DJWA 3FE8A 1CFDA 1KSOA 1AVSA 2QDIA 5FYXA 2OTGB 1MF8B 3SS3A 2Y5IA 3I5HB 1DVIA 1AJ5A 4OCIA 2BE6A 3EKJA 4GGNA 5TNCA 4GAOA 3L4LA 4GGFC 1FI5A 4YGAA 1F71A 3KPXA 2JWWA 1S6CA 3OBVA 4YI9A 1JC2A 1JSAA 4MZKA 5K89A 1BR4B 3GK4X 1ZOTB 1B7TY 2HQ8A 3SIAA 4DCKA 2BBNA 5FI7A 2NCPA 3L4AA 2BKHB 4U8DA 1NCYA 3JTDC 5D69A 3FE6A 3IVTA 1DGUA 1HQVA 3PM8A 1PSBA 3EVRA 1TWOA 3V2LA 5HKZA 1NWDA 5D3OA 1CTRA 3AKBA 3EK7A 3S0GA 1IQ5A 4PHKA 3SG5A 2L4IA 2F33A 4DUQA 3I5FC 2G9BA 3BFBA 3O2PA 4R1EA 1LA3A 1JFKA 1FPWA 3VRRA 1DELA 1XFWO 1PSRA 1Y1AA 1SBJA 4PE4A 1SSEB 1UHJA 3LLEA 1WDCB 1QASA 1WLZA 3GK1A 1NX2A 3HCMA 2F2PA 3CZ0A 4D1EA 1L2OC 1XK4C 2JU0A 1S5GZ 1K8UA 1K9PA 3L47A 1IH0A 4PHJA 3O78A 4MBEA 3D75A 1S1EA 4M2OA 5AERA 4M2PA 2MLEC 3DZTA 5EL2A 1L7ZA 2BE4A 4ZCUA 3RM1A 4AQJA 1J7OA 1KFXL 3EVUA 3OB2B 4HREE 1XFYO 4MVFA 5I2LA 1TOPA 2JZIA 3Q8IA 2L2CA 4I5LB 2M1KB 2RGIA 1TIZA 1ALVA 3VRPA 1D1OA 2HQWA 2ZFDA 4JQ0D 4MZJA 4I5NB 1F4OA 2BBMA 4F7FA 1DT7B 1SR6C 1QVIZ 3CZ2A 1SL9A 1BLQA 3CTNA 3PFVA 4INXA 2PASA 1ORGA 3B6XA 4OVNF 1YTZC 2ZRSA 5KU1A 3BOWB 1Z2CB 1MXEA 3I5IB 1QV0A 2YGUA 2FOTA 4OV2A 3OB1B 2V53A 3LK1A 1YX8A 1S6IA 5F6TA 1JBAA 1KCYA 2MJWB 2KYFA 5HKYA 1C3ZA 3NGVA 1OQPA 3C1VA 1Y1XA 2KQ6A 3PM2A 1QIVA 1YVLA 1KWOB 1LVCD 1BOCA 3ZNIA 3WHTB 3IF7A 2F2OA 4GGFA 2ZKMX 1B1GA 1SL7A 2KGBC 4UPGA 1YRUB 1PALA 2O60A 4C0LA 4WQ3A 2BAPA 3VB1A 3AAJA 3IQQA 1CFPA 2WCBA 4IL1A 3JVTC 2FCEA 3SG6A 1A29A 3BYAA 1UURA 1TRFA 2KAVA 3QRXA 4F0ZB 1OE9B 1J7QA 2SCPA 3R1OA 4PE7A 4I5JA 4MZLA 5DKNA 1NCZA 1RTP1 2TN4A 4XJKA 5D7FA 1KFXS 2KSPA 3OGNA 3KHEA 4GFTA 2LUCA 2OS8B 1CKKA 2KNEA 1W7IB 2WCKA 2LANA 2WCEA 1ZUZA 3BJHA 2I7AA 5CPVA 5ER5A 2H2KA 1OOIX 1SPYA 2M49B 3CR2A 3TUYB 1SK6D 1LS8A 1DQEA 4NDBA 3BUNB 1IJ6A 1SKTA 2BL0C 2JULA 3CLNA 4PHMA 3SS5A 1KQMC 4PE0A 1QX5B 3BUWB 3WNXB 1DEKA 1XK4A 2WCJA 3O4XA 1TNXA 2AUCA 3NSKA 2KPHA 3E3RA 3TS5C 2KFHA 1ZMZA 1KK8B 2E6WA 2CBLA 3I5GC 3R1PA 1J7PA 3NSOA 3BFAA 3O6BA 2ERBA 1JF0A 1Y6WA 3FS7A 3NHIA 1CFFA 2QEOA 2KLDA 1CMFA 2PVBA 2MA2A 3DY9A 3CZ1A 4CPVA 1DJIA 2MHHA 1BU3A 1KFUS 1B8CA 1KK7Z 2KBIA 4NQGA 1RJVA 2JT0A 1JF2A 2H61C 2M29A 4DIRA 2JRFA 1S36A 2LVKA 3CS1A 3OX6A 4I5KA 3S0EA 1SCMC 4MN0A 3QMEA 4MSPA 4A4BA 1CDNA 3DD4A 1A2XA 1OZOA 2EC6C 2JT8A 5FI2A 2WCHA 2LM5A 1XFRA 2NCOA 1JUOA 1KQVA 1RK9A 4JD9A 2BCAA 2I94A 1CDPA 1GJYA 1W9ZA 2A4JA 2K60A 1Y0VH 2QEBA 2PMYA 3R72A 1J1DA 4GUKA 3S0FA 1C07A 2M9GA 2LMTA 4YGBB 2G2BA 1S5GY 3GOFA 1CLBA 3ICBA 1SYMA 2H8VA 2WCMA 3WHUB 1LXFC 1A75A 1LA0A 1S3PA 1YUUA 1MHOA 2PRUA 2P70A 1SW8A 1EH2A 2NXQA 2KQYA 3BUXB 3PJIA 5DKQA 1XVJA 2CTNA 2B1UA 2NZ0A 1J55A 2AMIA 2KYCA 3PN7C 1IIOA 2Q4UA 1ALWA 1J7RA 2LC5A 2KI4C 1QLSA 1NP8A 1QTXA 2KDHA 4MRXA 1A75B 5I8NA 3VROA 4ZCVA 1WLMA 1GM0A 4PCWA 4QJ3B 4PT1A 5HKWA 3R1VA 1IRJA 5IBWA 1RROA 1VRKA 1QVIY 2M7NA 1PULA 2M3WA 2L51A 1V1GA 1M39A 2KI6D 4OKHA 3TDZA 4C0KA 4ETOA 5JJGA 1TTXA 1GGZA 1XFUO 2L5XB 2AAOA 3D10A 2OTGC 2WORA 3D0YA 5JOLA 1YRTB 3I5HC 2KFFA 4MEWA 1CM4A 2PQLA 2D8NA 1ZACA 2JNXA 2KHNA 1JFJA 1TNPA 3IQOA 1DGVA 3RZSA 4ORBB 3LL8B 2LHIA 3FWBA 2WOSA 3D73A 4N1FA 3A4UB 1NX0A 2LCPA 3D0YB 4JWQA 2QEVA 4FQOA 2K2FA 1OOHA 2LVJA 1WRKA 3UNWA 2BKIB 1Q80A 1SL8A 1WRLA 2IS9A 3SG7A 1B47A 1S26D 1IQ3A 4NDCA 2WC8A 5KSZA 1DTLA 3F45A 2JNFA 1CLMA 1H8BA 2JTTA 1AUIB 3D74A 1M46A 1YR5A 1OOFA 1RWYA 1B8LA 2WCLA 2PALA 1R2UA 4YGDB 2JTZA 1MUXA 2CNPA 2F8PA 1QWVA 4N1GA 1WDCC 2FJYA 2JPTA 1IKUA 3PATA 5DICA 1RECA 3CABA 5HL1A 1IG5A 1XFVO 3EVVA 3D76A 5ER4X 1MWNA 2K7BA 5I94A 1UUSA 2K8MB
chains in the Genus database with same CATH topology
4HRHA 3TDIA 1ODBA 2JT3A 3DF0A 3BXKA 2NLNA 3NSLA 3PALA 3A8RA 1UHNA 1XYDA 2PSRA 2COLB 2JXLA 3TDUA 1SCVA 1PVAA 2L4HA 3JTDB 1BG1A 2FCDA 3SG2A 2F3YA 1HT9A 4DRWA 1FBVA 2WCFA 2LE9B 4XJKB 4YGCB 1JWDA 1CDMA 1NUBA 3I5FB 1K95A 1X02A 4XYNA 1KK7Y 1ZFSA 2ZRTA 3BUOB 2HETA 1OSAA 1N65A 2CCMA 2K0JA 1QS7A 3SG3A 2BCXA 3I5IC 1N0YA 4MLWA 4A4CA 1L2OB 4YI8A 1K2HA 3EK8A 4CLNA 2Y4QA 2O5GA 2MLFC 4FTGA 2LVIA 3PSRA 5PALA 1GQMA 1OOJA 2CXJA 1KWOC 4HSZA 1IWQA 4WRIA 2M8UA 4DS7A 5AANA 5BPJA 3ZWHA 1CNPA 1DF0A 2JXCA 3GK2A 1CB1A 4QJ4B 2K7DA 2WNDA 3NXAA 4GPLB 2L50A 4OR9B 4PHNA 2L2EA 5GQQC 2SASA 1SNLA 1AHRA 2ZN9A 2E30A 2LVVA 3BUMB 1K94A 1MQ1A 1K9KA 1DJZA 4HRGA 4P2YB 3DVEA 1SR6B 4Q04A 1AP4A 1DF0B 1B9AA 1CM1A 1QATA 1QIWA 1DMOA 5DKRA 2M7LA 3TZ1A 1CFCA 1PK0D 2OS8C 1TCOB 5J3XA 1E8AA 1K90D 3H4SE 3LK0A 3PLFB 2I18A 2HPSA 3DVJA 1S6JA 1BODA 1K93D 2LV7A 2LAPA 1UHHA 1GGWA 2LP2A 4JPZB 3TUYC 1BR1B 2Y1NA 1KSMA 4NDDA 2LUXA 4AOMA 5AFPA 1NSHA 1G8IA 3KEVA 1B7TZ 1B4CA 1SY9A 5CSJA 1V1FA 2BCBA 1TNQA 1K9UA 2QACA 1AJ4A 4C0JA 1C7VA 2BECA 2JC2A 4P5OE 4E68A 1B8RA 1KK8C 1UWOA 2LMUA 2ZNDA 1BF5A 1DJYA 1TN4A 1UP5A 2M0RA 1C7WA 3JVTB 2P6BB 1EXRA 2F3ZA 3CR5X 1DJXA 4CIDA 1M63B 2EHBA 3O4YA 4MRYA 3FWCA 1CMGA 1BJFA 3CZTX 1YVHA 2Q91A 1YURA 2GGMA 1EJ3A 2LLTA 1MR8A 2LLSA 2MAZA 3LCPC 5HYDA 2GGZA 2HF5A 5I2QA 1OMDA 3OP0A 1MXLC 1A03A 2K7CA 2K7OA 3M0WA 3EK4A 2ISDA 2CT9A 1QXPA 1YUSA 1QLKA 3BOWA 1DJHA 1LINA 2BL0B 1EG4A 1G4YR 2KGRA 2LLUA 3WXAA 1BMOA 1KQMB 1QV1A 1NX1A 5CSIA 3SIBA 2MRDA 1DJGA 3CWGA 2K61A 4YBHB 1AK8A 3FIAA 1NCXA 3OX5A 1TNWA 3TS5B 3I5GB 2KAYA 2H61A 1EL4A 1M45A 2OPOA 4ICBA 3KF9A 4CFQA 4PDZA 5G08A 1CDLA 5CSFA 1H4BA 1YUTA 1F54A 4ORCB 1NYAA 1OZSA 3EKHA 4TNCA 2KBMA 4BY5A 1Y1UA 2LMVA 4PALA 4PE1A 5I2OA 3SG4A 2LNKA 5HLVA 1XFXO 2JQ6A 1PVBA 3K21A 3KO0A 3SJSA 4BY4A 2L0PA 1SCMB 1M31A 1YX7A 2FJUB 4YGEB 2MBXA 1KFUL 4M2QA 4AQIA 5B8IB 5AXIA 2EC6B 2L98A 1F70A 1FI6A 3MSEB 3VRNA 1QJTA 1FW4A 1WRZA 3VRQA 1XFZO 3RLZA 1EG3A 3VGOA 1SMGA 5HLOA 5AEQA 1IJ5A 2R2IA 5CSNA 3DF0B 3AAKA 2ZN8A 4L9MA 4WQ2A 1F8HA 3BQ3A 3CR4X 1XA5A 3OHMB 4CFRA 4QJ5B 1NIWA 1K96A 1U5IA 4GBAA 1WY9A 1QX7A 1A4PA 1BT6A 1QX2A 2EGDA 4USLA 1NPQA 1OMRA 1NX3A 2M97A 1W7JB 2QPTA 2GV5A 2VRGA 1N2DA 1R6PA 1SRAA 1PRWA 1LKJA 2M1UA 2KI6C 1J1EA 1TCFA 3PN7B 1G33A 3NSIA 1RFJA 2ZNEA 1FF1A 3AKAA 2KOTA 1F55A 1CLLA 1IGVA 2KI4B 2LHLA 2I2RE 1F4QA 1U5IB 2KFGA 1UHIA 3DVKA 2K2AA 1UHKA 4GNKB 4YRUA 1XO5A 2Y1MA 2KAXA 2DOQA 3CGAA 3DVMA 4ORAB 3HX4A 2LP3A 1OMVA 2JOJA 5KTYA 4N5XA 1DJWA 1CFDA 1KSOA 1AVSA 5FYXA 2OTGB 1MF8B 2Y5IA 3I5HB 1DVIA 1AJ5A 4OCIA 2BE6A 3EKJA 4GGNA 5TNCA 4GAOA 4GGFC 1FI5A 4YGAA 1F71A 3KPXA 2JWWA 1S6CA 4YI9A 1JC2A 1JSAA 4MZKA 5K89A 1BR4B 3GK4X 1B7TY 1ZOTB 2HQ8A 3SIAA 4DCKA 2BBNA 2NCPA 4U8DA 2BKHB 1NCYA 3JTDC 5D69A 1DGUA 1HQVA 3PM8A 1PSBA 3EVRA 5HKZA 1NWDA 1CTRA 3AKBA 3EK7A 1IQ5A 4PHKA 3SG5A 2L4IA 2F33A 4DUQA 3I5FC 2G9BA 3O2PA 4R1EA 1LA3A 1JFKA 1FPWA 3VRRA 1XFWO 1PSRA 1Y1AA 1SBJA 4PE4A 1UHJA 3LLEA 1WDCB 1QASA 1WLZA 3GK1A 1NX2A 3HCMA 2F2PA 4D1EA 1L2OC 1XK4C 2JU0A 1S5GZ 1K8UA 1K9PA 1IH0A 4PHJA 3O78A 4MBEA 1S1EA 4M2OA 5AERA 4M2PA 2MLEC 4ZCUA 1L7ZA 2BE4A 4AQJA 3RM1A 1J7OA 1KFXL 3EVUA 3OB2B 4HREE 1XFYO 4MVFA 5I2LA 1TOPA 2JZIA 4I5LB 2M1KB 2RGIA 1TIZA 1ALVA 3VRPA 1D1OA 2HQWA 2ZFDA 4JQ0D 4MZJA 4I5NB 1F4OA 2BBMA 1DT7B 1SR6C 1QVIZ 1SL9A 1BLQA 3CTNA 3PFVA 2PASA 4OVNF 1YTZC 2ZRSA 5KU1A 3BOWB 1MXEA 3I5IB 1QV0A 2FOTA 4OV2A 3OB1B 2V53A 3LK1A 1YX8A 1S6IA 5F6TA 1JBAA 1KCYA 2MJWB 2KYFA 5HKYA 1OQPA 3C1VA 1Y1XA 2KQ6A 1QIVA 1YVLA 1KWOB 1LVCD 1BOCA 3ZNIA 3WHTB 3IF7A 2F2OA 4GGFA 2ZKMX 1B1GA 1SL7A 2KGBC 4UPGA 1YRUB 1PALA 2O60A 4C0LA 4WQ3A 3AAJA 3IQQA 1CFPA 2WCBA 4IL1A 3JVTC 2FCEA 3SG6A 1A29A 3BYAA 1UURA 1TRFA 2KAVA 3QRXA 4F0ZB 1OE9B 1J7QA 2SCPA 4PE7A 5DKNA 4I5JA 4MZLA 1NCZA 1RTP1 2TN4A 4XJKA 5D7FA 1KFXS 2KSPA 3KHEA 4GFTA 2LUCA 2OS8B 1CKKA 2KNEA 1W7IB 2LANA 2WCEA 1ZUZA 2I7AA 5CPVA 5ER5A 2H2KA 1SPYA 2M49B 3CR2A 3TUYB 1SK6D 4NDBA 3BUNB 1IJ6A 1SKTA 2BL0C 2JULA 3CLNA 4PHMA 1KQMC 4PE0A 1QX5B 3BUWB 3WNXB 1XK4A 1TNXA 2AUCA 3NSKA 3E3RA 3TS5C 2KFHA 1ZMZA 1KK8B 2E6WA 2CBLA 3I5GC 1J7PA 3NSOA 3O6BA 1JF0A 1Y6WA 3FS7A 1CFFA 1CMFA 2PVBA 2MA2A 4CPVA 1DJIA 2MHHA 1BU3A 1KFUS 1B8CA 1KK7Z 2KBIA 4NQGA 1RJVA 2JT0A 1JF2A 2H61C 2M29A 4DIRA 2JRFA 1S36A 2LVKA 3CS1A 3OX6A 4I5KA 1SCMC 4MN0A 4MSPA 4A4BA 1CDNA 3DD4A 1A2XA 1OZOA 2EC6C 2JT8A 2LM5A 2NCOA 1JUOA 1KQVA 1RK9A 2BCAA 2I94A 1CDPA 1GJYA 2A4JA 1Y0VH 2PMYA 1C07A 1J1DA 4GUKA 2M9GA 2LMTA 4YGBB 2G2BA 1S5GY 3GOFA 1CLBA 3ICBA 1SYMA 3WHUB 1LXFC 1A75A 1LA0A 1S3PA 1YUUA 1MHOA 2PRUA 1SW8A 1EH2A 2NXQA 2KQYA 3BUXB 5DKQA 1XVJA 2CTNA 2B1UA 2NZ0A 1J55A 2AMIA 2KYCA 3PN7C 2Q4UA 1ALWA 1J7RA 2LC5A 2KI4C 1QLSA 1NP8A 1QTXA 2KDHA 4MRXA 1A75B 5I8NA 3VROA 4ZCVA 1WLMA 4PCWA 4QJ3B 5HKWA 1IRJA 5IBWA 1RROA 1VRKA 1QVIY 2M7NA 1PULA 2M3WA 2L51A 1V1GA 1M39A 2KI6D 4OKHA 3TDZA 4C0KA 4ETOA 5JJGA 1TTXA 1GGZA 1XFUO 2L5XB 2AAOA 3D10A 2OTGC 2WORA 3D0YA 5JOLA 1YRTB 3I5HC 2KFFA 4MEWA 1CM4A 2D8NA 1ZACA 2JNXA 2KHNA 1JFJA 1TNPA 3IQOA 1DGVA 4ORBB 3LL8B 2LHIA 3FWBA 2WOSA 4N1FA 3A4UB 1NX0A 2LCPA 3D0YB 4JWQA 4FQOA 2K2FA 2LVJA 1WRKA 2BKIB 1Q80A 1SL8A 1WRLA 2IS9A 3SG7A 1B47A 1S26D 1IQ3A 4NDCA 2WC8A 5KSZA 1DTLA 3F45A 2JNFA 1CLMA 1H8BA 2JTTA 1AUIB 1M46A 1YR5A 1RWYA 1B8LA 2PALA 1R2UA 4YGDB 2JTZA 1MUXA 2CNPA 2F8PA 4N1GA 1WDCC 2JPTA 1IKUA 3PATA 1RECA 1IG5A 1XFVO 3EVVA 5ER4X 1MWNA 2K7BA 1UUSA 2K8MB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HRH A;  3TDI A;  1ODB A;  2JT3 A;  3DF0 A;  3BXK A;  2NLN A;  3NSL A;  3PAL A;  3A8R A;  1UHN A;  1XYD A;  2PSR A;  2COL B;  2JXL A;  3TDU A;  1SCV A;  1PVA A;  2L4H A;  3JTD B;  1BG1 A;  2FCD A;  3SG2 A;  2F3Y A;  1HT9 A;  4DRW A;  1FBV A;  2WCF A;  2LE9 B;  4XJK B;  4YGC B;  1JWD A;  1CDM A;  1NUB A;  3I5F B;  1K95 A;  1X02 A;  4XYN A;  1KK7 Y;  1ZFS A;  2ZRT A;  3BUO B;  2HET A;  1OSA A;  1N65 A;  2CCM A;  2K0J A;  1QS7 A;  3SG3 A;  2BCX A;  3I5I C;  1N0Y A;  4MLW A;  4A4C A;  1L2O B;  4YI8 A;  1K2H A;  3EK8 A;  4CLN A;  2Y4Q A;  2O5G A;  2MLF C;  4FTG A;  2LVI A;  3PSR A;  5PAL A;  1GQM A;  1OOJ A;  2CXJ A;  1KWO C;  4HSZ A;  1IWQ A;  4WRI A;  2M8U A;  4DS7 A;  5AAN A;  5BPJ A;  3ZWH A;  1CNP A;  1DF0 A;  2JXC A;  3GK2 A;  1CB1 A;  4QJ4 B;  2K7D A;  2WND A;  3NXA A;  4GPL B;  2L50 A;  4OR9 B;  4PHN A;  2L2E A;  5GQQ C;  2SAS A;  1SNL A;  1AHR A;  2ZN9 A;  2E30 A;  2LVV A;  3BUM B;  1K94 A;  1MQ1 A;  1K9K A;  1DJZ A;  4HRG A;  4P2Y B;  3DVE A;  1SR6 B;  4Q04 A;  1AP4 A;  1DF0 B;  1B9A A;  1CM1 A;  1QAT A;  1QIW A;  1DMO A;  5DKR A;  2M7L A;  3TZ1 A;  1CFC A;  1PK0 D;  2OS8 C;  1TCO B;  5J3X A;  1E8A A;  1K90 D;  3H4S E;  3LK0 A;  3PLF B;  2I18 A;  2HPS A;  3DVJ A;  1S6J A;  1BOD A;  1K93 D;  2LV7 A;  2LAP A;  1UHH A;  1GGW A;  2LP2 A;  4JPZ B;  3TUY C;  1BR1 B;  2Y1N A;  1KSM A;  4NDD A;  2LUX A;  4AOM A;  5AFP A;  1NSH A;  1G8I A;  3KEV A;  1B7T Z;  1B4C A;  1SY9 A;  5CSJ A;  1V1F A;  2BCB A;  1TNQ A;  1K9U A;  2QAC A;  1AJ4 A;  4C0J A;  1C7V A;  2BEC A;  2JC2 A;  4P5O E;  4E68 A;  1B8R A;  1KK8 C;  1UWO A;  2LMU A;  2ZND A;  1BF5 A;  1DJY A;  1TN4 A;  1UP5 A;  2M0R A;  1C7W A;  3JVT B;  2P6B B;  1EXR A;  2F3Z A;  3CR5 X;  1DJX A;  4CID A;  1M63 B;  2EHB A;  3O4Y A;  4MRY A;  3FWC A;  1CMG A;  1BJF A;  3CZT X;  1YVH A;  2Q91 A;  1YUR A;  2GGM A;  1EJ3 A;  2LLT A;  1MR8 A;  2LLS A;  2MAZ A;  3LCP C;  5HYD A;  2GGZ A;  2HF5 A;  5I2Q A;  1OMD A;  3OP0 A;  1MXL C;  1A03 A;  2K7C A;  2K7O A;  3M0W A;  3EK4 A;  2ISD A;  2CT9 A;  1QXP A;  1YUS A;  1QLK A;  3BOW A;  1DJH A;  1LIN A;  2BL0 B;  1EG4 A;  1G4Y R;  2KGR A;  2LLU A;  3WXA A;  1BMO A;  1KQM B;  1QV1 A;  1NX1 A;  5CSI A;  3SIB A;  2MRD A;  1DJG A;  3CWG A;  2K61 A;  4YBH B;  1AK8 A;  3FIA A;  1NCX A;  3OX5 A;  1TNW A;  3TS5 B;  3I5G B;  2KAY A;  2H61 A;  1EL4 A;  1M45 A;  2OPO A;  4ICB A;  3KF9 A;  4CFQ A;  4PDZ A;  5G08 A;  1CDL A;  5CSF A;  1H4B A;  1YUT A;  1F54 A;  4ORC B;  1NYA A;  1OZS A;  3EKH A;  4TNC A;  2KBM A;  4BY5 A;  1Y1U A;  2LMV A;  4PAL A;  4PE1 A;  5I2O A;  3SG4 A;  2LNK A;  5HLV A;  1XFX O;  2JQ6 A;  1PVB A;  3K21 A;  3KO0 A;  3SJS A;  4BY4 A;  2L0P A;  1SCM B;  1M31 A;  1YX7 A;  2FJU B;  4YGE B;  2MBX A;  1KFU L;  4M2Q A;  4AQI A;  5B8I B;  5AXI A;  2EC6 B;  2L98 A;  1F70 A;  1FI6 A;  3MSE B;  3VRN A;  1QJT A;  1FW4 A;  1WRZ A;  3VRQ A;  1XFZ O;  3RLZ A;  1EG3 A;  3VGO A;  1SMG A;  5HLO A;  5AEQ A;  1IJ5 A;  2R2I A;  5CSN A;  3DF0 B;  3AAK A;  2ZN8 A;  4L9M A;  4WQ2 A;  1F8H A;  3BQ3 A;  3CR4 X;  1XA5 A;  3OHM B;  4CFR A;  4QJ5 B;  1NIW A;  1K96 A;  1U5I A;  4GBA A;  1WY9 A;  1QX7 A;  1A4P A;  1BT6 A;  1QX2 A;  2EGD A;  4USL A;  1NPQ A;  1OMR A;  1NX3 A;  2M97 A;  1W7J B;  2QPT A;  2GV5 A;  2VRG A;  1N2D A;  1R6P A;  1SRA A;  1PRW A;  1LKJ A;  2M1U A;  2KI6 C;  1J1E A;  1TCF A;  3PN7 B;  1G33 A;  3NSI A;  1RFJ A;  2ZNE A;  1FF1 A;  3AKA A;  2KOT A;  1F55 A;  1CLL A;  1IGV A;  2KI4 B;  2LHL A;  2I2R E;  1F4Q A;  1U5I B;  2KFG A;  1UHI A;  3DVK A;  2K2A A;  1UHK A;  4GNK B;  4YRU A;  1XO5 A;  2Y1M A;  2KAX A;  2DOQ A;  3CGA A;  3DVM A;  4ORA B;  3HX4 A;  2LP3 A;  1OMV A;  2JOJ A;  5KTY A;  4N5X A;  1DJW A;  1CFD A;  1KSO A;  1AVS A;  5FYX A;  2OTG B;  1MF8 B;  2Y5I A;  3I5H B;  1DVI A;  1AJ5 A;  4OCI A;  2BE6 A;  3EKJ A;  4GGN A;  5TNC A;  4GAO A;  4GGF C;  1FI5 A;  4YGA A;  1F71 A;  3KPX A;  2JWW A;  1S6C A;  4YI9 A;  1JC2 A;  1JSA A;  4MZK A;  5K89 A;  1BR4 B;  3GK4 X;  1B7T Y;  1ZOT B;  2HQ8 A;  3SIA A;  4DCK A;  2BBN A;  2NCP A;  4U8D A;  2BKH B;  1NCY A;  3JTD C;  5D69 A;  1DGU A;  1HQV A;  3PM8 A;  1PSB A;  3EVR A;  5HKZ A;  1NWD A;  1CTR A;  3AKB A;  3EK7 A;  1IQ5 A;  4PHK A;  3SG5 A;  2L4I A;  2F33 A;  4DUQ A;  3I5F C;  2G9B A;  3O2P A;  4R1E A;  1LA3 A;  1JFK A;  1FPW A;  3VRR A;  1XFW O;  1PSR A;  1Y1A A;  1SBJ A;  4PE4 A;  1UHJ A;  3LLE A;  1WDC B;  1QAS A;  1WLZ A;  3GK1 A;  1NX2 A;  3HCM A;  2F2P A;  4D1E A;  1L2O C;  1XK4 C;  2JU0 A;  1S5G Z;  1K8U A;  1K9P A;  1IH0 A;  4PHJ A;  3O78 A;  4MBE A;  1S1E A;  4M2O A;  5AER A;  4M2P A;  2MLE C;  4ZCU A;  1L7Z A;  2BE4 A;  4AQJ A;  3RM1 A;  1J7O A;  1KFX L;  3EVU A;  3OB2 B;  4HRE E;  1XFY O;  4MVF A;  5I2L A;  1TOP A;  2JZI A;  4I5L B;  2M1K B;  2RGI A;  1TIZ A;  1ALV A;  3VRP A;  1D1O A;  2HQW A;  2ZFD A;  4JQ0 D;  4MZJ A;  4I5N B;  1F4O A;  2BBM A;  1DT7 B;  1SR6 C;  1QVI Z;  1SL9 A;  1BLQ A;  3CTN A;  3PFV A;  2PAS A;  4OVN F;  1YTZ C;  2ZRS A;  5KU1 A;  3BOW B;  1MXE A;  3I5I B;  1QV0 A;  2FOT A;  4OV2 A;  3OB1 B;  2V53 A;  3LK1 A;  1YX8 A;  1S6I A;  5F6T A;  1JBA A;  1KCY A;  2MJW B;  2KYF A;  5HKY A;  1OQP A;  3C1V A;  1Y1X A;  2KQ6 A;  1QIV A;  1YVL A;  1KWO B;  1LVC D;  1BOC A;  3ZNI A;  3WHT B;  3IF7 A;  2F2O A;  4GGF A;  2ZKM X;  1B1G A;  1SL7 A;  2KGB C;  4UPG A;  1YRU B;  1PAL A;  2O60 A;  4C0L A;  4WQ3 A;  3AAJ A;  3IQQ A;  1CFP A;  2WCB A;  4IL1 A;  3JVT C;  2FCE A;  3SG6 A;  1A29 A;  3BYA A;  1UUR A;  1TRF A;  2KAV A;  3QRX A;  4F0Z B;  1OE9 B;  1J7Q A;  2SCP A;  4PE7 A;  5DKN A;  4I5J A;  4MZL A;  1NCZ A;  1RTP 1;  2TN4 A;  4XJK A;  5D7F A;  1KFX S;  2KSP A;  3KHE A;  4GFT A;  2LUC A;  2OS8 B;  1CKK A;  2KNE A;  1W7I B;  2LAN A;  2WCE A;  1ZUZ A;  2I7A A;  5CPV A;  5ER5 A;  2H2K A;  1SPY A;  2M49 B;  3CR2 A;  3TUY B;  1SK6 D;  4NDB A;  3BUN B;  1IJ6 A;  1SKT A;  2BL0 C;  2JUL A;  3CLN A;  4PHM A;  1KQM C;  4PE0 A;  1QX5 B;  3BUW B;  3WNX B;  1XK4 A;  1TNX A;  2AUC A;  3NSK A;  3E3R A;  3TS5 C;  2KFH A;  1ZMZ A;  1KK8 B;  2E6W A;  2CBL A;  3I5G C;  1J7P A;  3NSO A;  3O6B A;  1JF0 A;  1Y6W A;  3FS7 A;  1CFF A;  1CMF A;  2PVB A;  2MA2 A;  4CPV A;  1DJI A;  2MHH A;  1BU3 A;  1KFU S;  1B8C A;  1KK7 Z;  2KBI A;  4NQG A;  1RJV A;  2JT0 A;  1JF2 A;  2H61 C;  2M29 A;  4DIR A;  2JRF A;  1S36 A;  2LVK A;  3CS1 A;  3OX6 A;  4I5K A;  1SCM C;  4MN0 A;  4MSP A;  4A4B A;  1CDN A;  3DD4 A;  1A2X A;  1OZO A;  2EC6 C;  2JT8 A;  2LM5 A;  2NCO A;  1JUO A;  1KQV A;  1RK9 A;  2BCA A;  2I94 A;  1CDP A;  1GJY A;  2A4J A;  1Y0V H;  2PMY A;  1C07 A;  1J1D A;  4GUK A;  2M9G A;  2LMT A;  4YGB B;  2G2B A;  1S5G Y;  3GOF A;  1CLB A;  3ICB A;  1SYM A;  3WHU B;  1LXF C;  1A75 A;  1LA0 A;  1S3P A;  1YUU A;  1MHO A;  2PRU A;  1SW8 A;  1EH2 A;  2NXQ A;  2KQY A;  3BUX B;  5DKQ A;  1XVJ A;  2CTN A;  2B1U A;  2NZ0 A;  1J55 A;  2AMI A;  2KYC A;  3PN7 C;  2Q4U A;  1ALW A;  1J7R A;  2LC5 A;  2KI4 C;  1QLS A;  1NP8 A;  1QTX A;  2KDH A;  4MRX A;  1A75 B;  5I8N A;  3VRO A;  4ZCV A;  1WLM A;  4PCW A;  4QJ3 B;  5HKW A;  1IRJ A;  5IBW A;  1RRO A;  1VRK A;  1QVI Y;  2M7N A;  1PUL A;  2M3W A;  2L51 A;  1V1G A;  1M39 A;  2KI6 D;  4OKH A;  3TDZ A;  4C0K A;  4ETO A;  5JJG A;  1TTX A;  1GGZ A;  1XFU O;  2L5X B;  2AAO A;  3D10 A;  2OTG C;  2WOR A;  3D0Y A;  5JOL A;  1YRT B;  3I5H C;  2KFF A;  4MEW A;  1CM4 A;  2D8N A;  1ZAC A;  2JNX A;  2KHN A;  1JFJ A;  1TNP A;  3IQO A;  1DGV A;  4ORB B;  3LL8 B;  2LHI A;  3FWB A;  2WOS A;  4N1F A;  3A4U B;  1NX0 A;  2LCP A;  3D0Y B;  4JWQ A;  4FQO A;  2K2F A;  2LVJ A;  1WRK A;  2BKI B;  1Q80 A;  1SL8 A;  1WRL A;  2IS9 A;  3SG7 A;  1B47 A;  1S26 D;  1IQ3 A;  4NDC A;  2WC8 A;  5KSZ A;  1DTL A;  3F45 A;  2JNF A;  1CLM A;  1H8B A;  2JTT A;  1AUI B;  1M46 A;  1YR5 A;  1RWY A;  1B8L A;  2PAL A;  1R2U A;  4YGD B;  2JTZ A;  1MUX A;  2CNP A;  2F8P A;  4N1G A;  1WDC C;  2JPT A;  1IKU A;  3PAT A;  1REC A;  1IG5 A;  1XFV O;  3EVV A;  5ER4 X;  1MWN A;  2K7B A;  1UUS A;  2K8M B; 
#chains in the Genus database with same CATH topology
 4HRH A;  3TDI A;  1ODB A;  2JT3 A;  3DF0 A;  3BXK A;  2NLN A;  3NSL A;  3PAL A;  3S0A A;  3A8R A;  1UHN A;  1XYD A;  2PSR A;  2COL B;  2JXL A;  3TDU A;  1SCV A;  3S0D A;  1PVA A;  2L4H A;  3JTD B;  1BG1 A;  2FCD A;  3SG2 A;  2F3Y A;  1HT9 A;  4DRW A;  1FBV A;  2WCF A;  2LE9 B;  4XJK B;  4YGC B;  1JWD A;  1CDM A;  1NUB A;  2PYQ A;  3I5F B;  1K95 A;  1X02 A;  4XYN A;  1KK7 Y;  1TUZ A;  1ZFS A;  2ZRT A;  3BUO B;  2GTE A;  3B87 A;  2HET A;  1OSA A;  1N65 A;  2CCM A;  2K0J A;  1QS7 A;  3SG3 A;  2BCX A;  3I5I C;  1N0Y A;  4MLW A;  4A4C A;  1L2O B;  4YI8 A;  1K2H A;  3EK8 A;  4CLN A;  2Y4Q A;  2O5G A;  2MLF C;  4FTG A;  2LVI A;  3PSR A;  5PAL A;  1GQM A;  3B88 A;  1OOJ A;  2CXJ A;  1KWO C;  1TUJ A;  4HSZ A;  1IWQ A;  4WRI A;  2M8U A;  4DS7 A;  5AAN A;  5BPJ A;  3ZWH A;  1CNP A;  1DF0 A;  2JXC A;  3GK2 A;  1CB1 A;  4QJ4 B;  2K7D A;  2WND A;  3NXA A;  4GPL B;  2L50 A;  3FE9 A;  4OR9 B;  4PHN A;  2L2E A;  5GQQ C;  2SAS A;  3D77 A;  1SNL A;  1AHR A;  2ZN9 A;  2E30 A;  2LVV A;  3BUM B;  1K94 A;  1MQ1 A;  1K9K A;  1DJZ A;  4HRG A;  4P2Y B;  3DVE A;  1SR6 B;  4OZD A;  4Q04 A;  1DF0 B;  1B9A A;  1CM1 A;  1QAT A;  1QIW A;  1AP4 A;  1DMO A;  4IJ7 A;  5DKR A;  2M7L A;  3TZ1 A;  3UO9 A;  1CFC A;  1PK0 D;  2OS8 C;  1TCO B;  5J3X A;  1E8A A;  1K90 D;  3H4S E;  3LK0 A;  3PLF B;  2I18 A;  2BNX A;  2HPS A;  3DVJ A;  4KYN A;  1S6J A;  1T14 A;  3S0B A;  1K93 D;  5FI6 A;  2LV7 A;  2LAP A;  1UHH A;  1BOD A;  1GGW A;  2LP2 A;  4JPZ B;  3TUY C;  1BR1 B;  2Y1N A;  1KSM A;  3D78 A;  4NDD A;  2LUX A;  4AOM A;  5AFP A;  1P28 A;  1NSH A;  1G8I A;  2JPO A;  1B7T Z;  3KEV A;  1B4C A;  1SY9 A;  5CSJ A;  3K1E A;  1V1F A;  2BCB A;  1TNQ A;  1K9U A;  2QAC A;  1AJ4 A;  4C0J A;  1C7V A;  2BEC A;  2JC2 A;  4P5O E;  4E68 A;  1B8R A;  1KK8 C;  1UWO A;  3NHT A;  2LMU A;  2ZND A;  1BF5 A;  2KLE A;  1DJY A;  1TN4 A;  1UP5 A;  2M0R A;  1C7W A;  3JVT B;  2P6B B;  1EXR A;  2F3Z A;  2WC5 A;  3CR5 X;  1DJX A;  2P71 A;  4CID A;  3B86 A;  2L5Y A;  1M63 B;  2EHB A;  3O4Y A;  4MRY A;  3FWC A;  1CMG A;  1BJF A;  3CZT X;  1YVH A;  2Q91 A;  1YUR A;  2GGM A;  1EJ3 A;  2QEH A;  2LLT A;  1MR8 A;  2LLS A;  2MAZ A;  3LCP C;  5HYD A;  2GGZ A;  2HF5 A;  5I2Q A;  1OMD A;  3OP0 A;  1MXL C;  1A03 A;  2K7C A;  2K7O A;  3M0W A;  3EK4 A;  2ISD A;  2CT9 A;  1QXP A;  1YUS A;  1QLK A;  3BOW A;  1DJH A;  1LIN A;  2BL0 B;  1EG4 A;  1G4Y R;  2KGR A;  2LLU A;  3WXA A;  1BMO A;  1KQM B;  1QV1 A;  1NX1 A;  5CSI A;  3SIB A;  2MRD A;  1DJG A;  3CWG A;  2K61 A;  4YBH B;  1AK8 A;  3FIA A;  1NCX A;  3OX5 A;  1TNW A;  3TS5 B;  3I5G B;  2KAY A;  2H61 A;  1EL4 A;  1M45 A;  2OPO A;  4ICB A;  3KF9 A;  4CFQ A;  4PDZ A;  5G08 A;  1CDL A;  5CSF A;  1H4B A;  1YUT A;  1F54 A;  4ORC B;  1C3Y A;  1NYA A;  3N7H A;  4JKT A;  1OZS A;  3EKH A;  4TNC A;  2KBM A;  4BY5 A;  3BFH A;  1Y1U A;  2LMV A;  4PAL A;  4PE1 A;  4INW A;  5I2O A;  3SG4 A;  2LNK A;  5HLV A;  1XFX O;  2JQ6 A;  1PVB A;  3K21 A;  3B7A A;  3KO0 A;  3SJS A;  4BY4 A;  2L0P A;  1SCM B;  1M31 A;  1YX7 A;  2FJU B;  3DXL A;  3DYE A;  1KFU L;  4M2Q A;  4YGE B;  2MBX A;  5AXI A;  2EC6 B;  2L98 A;  4AQI A;  5B8I B;  3MSE B;  1F70 A;  1FI6 A;  3VRN A;  1QJT A;  1Z4H A;  1FW4 A;  1WRZ A;  3VRQ A;  1XFZ O;  3RLZ A;  1EG3 A;  2WC6 A;  3VGO A;  1SMG A;  5HLO A;  4FQT A;  5AEQ A;  1IJ5 A;  2R2I A;  5CSN A;  3EG5 B;  3DF0 B;  3AAK A;  2ZN8 A;  4L9M A;  4WQ2 A;  1F8H A;  3BQ3 A;  3CR4 X;  1XA5 A;  3OHM B;  4CFR A;  4QJ5 B;  1NIW A;  1K96 A;  1U5I A;  4GBA A;  1WY9 A;  1QX7 A;  1A4P A;  1BT6 A;  1QX2 A;  1OOG A;  1OW4 A;  1NPQ A;  2EGD A;  4USL A;  1OMR A;  1NX3 A;  2M97 A;  1W7J B;  2QPT A;  2GV5 A;  2VRG A;  1N2D A;  1R6P A;  1SRA A;  1PRW A;  1LKJ A;  3SS4 A;  2M1U A;  2KI6 C;  1J1E A;  1TCF A;  3PN7 B;  1G33 A;  3NSI A;  1RFJ A;  2ZNE A;  1FF1 A;  3AKA A;  2KOT A;  1F55 A;  1CLL A;  1IGV A;  2KI4 B;  2LHL A;  2I2R E;  1F4Q A;  1U5I B;  2KFG A;  1UHI A;  3DVK A;  2K2A A;  3CDN A;  1UHK A;  4GNK B;  4YRU A;  1XO5 A;  2Y1M A;  1DC1 A;  2KAX A;  2DOQ A;  3CGA A;  3DVM A;  4ORA B;  3HX4 A;  2LP3 A;  1OMV A;  2JOJ A;  3CYZ A;  5KTY A;  4N5X A;  1DJW A;  3FE8 A;  1CFD A;  1KSO A;  1AVS A;  2QDI A;  5FYX A;  2OTG B;  1MF8 B;  3SS3 A;  2Y5I A;  3I5H B;  1DVI A;  1AJ5 A;  4OCI A;  2BE6 A;  3EKJ A;  4GGN A;  5TNC A;  4GAO A;  3L4L A;  4GGF C;  1FI5 A;  4YGA A;  1F71 A;  3KPX A;  2JWW A;  1S6C A;  3OBV A;  4YI9 A;  1JC2 A;  1JSA A;  4MZK A;  5K89 A;  1BR4 B;  3GK4 X;  1ZOT B;  1B7T Y;  2HQ8 A;  3SIA A;  4DCK A;  2BBN A;  5FI7 A;  2NCP A;  3L4A A;  2BKH B;  4U8D A;  1NCY A;  3JTD C;  5D69 A;  3FE6 A;  3IVT A;  1DGU A;  1HQV A;  3PM8 A;  1PSB A;  3EVR A;  1TWO A;  3V2L A;  5HKZ A;  1NWD A;  5D3O A;  1CTR A;  3AKB A;  3EK7 A;  3S0G A;  1IQ5 A;  4PHK A;  3SG5 A;  2L4I A;  2F33 A;  4DUQ A;  3I5F C;  2G9B A;  3BFB A;  3O2P A;  4R1E A;  1LA3 A;  1JFK A;  1FPW A;  3VRR A;  1DEL A;  1XFW O;  1PSR A;  1Y1A A;  1SBJ A;  4PE4 A;  1SSE B;  1UHJ A;  3LLE A;  1WDC B;  1QAS A;  1WLZ A;  3GK1 A;  1NX2 A;  3HCM A;  2F2P A;  3CZ0 A;  4D1E A;  1L2O C;  1XK4 C;  2JU0 A;  1S5G Z;  1K8U A;  1K9P A;  3L47 A;  1IH0 A;  4PHJ A;  3O78 A;  4MBE A;  3D75 A;  1S1E A;  4M2O A;  5AER A;  4M2P A;  2MLE C;  3DZT A;  5EL2 A;  1L7Z A;  2BE4 A;  4ZCU A;  3RM1 A;  4AQJ A;  1J7O A;  1KFX L;  3EVU A;  3OB2 B;  4HRE E;  1XFY O;  4MVF A;  5I2L A;  1TOP A;  2JZI A;  3Q8I A;  2L2C A;  4I5L B;  2M1K B;  2RGI A;  1TIZ A;  1ALV A;  3VRP A;  1D1O A;  2HQW A;  2ZFD A;  4JQ0 D;  4MZJ A;  4I5N B;  1F4O A;  2BBM A;  4F7F A;  1DT7 B;  1SR6 C;  1QVI Z;  3CZ2 A;  1SL9 A;  1BLQ A;  3CTN A;  3PFV A;  4INX A;  2PAS A;  1ORG A;  3B6X A;  4OVN F;  1YTZ C;  2ZRS A;  5KU1 A;  3BOW B;  1Z2C B;  1MXE A;  3I5I B;  1QV0 A;  2YGU A;  2FOT A;  4OV2 A;  3OB1 B;  2V53 A;  3LK1 A;  1YX8 A;  1S6I A;  5F6T A;  1JBA A;  1KCY A;  2MJW B;  2KYF A;  5HKY A;  1C3Z A;  3NGV A;  1OQP A;  3C1V A;  1Y1X A;  2KQ6 A;  3PM2 A;  1QIV A;  1YVL A;  1KWO B;  1LVC D;  1BOC A;  3ZNI A;  3WHT B;  3IF7 A;  2F2O A;  4GGF A;  2ZKM X;  1B1G A;  1SL7 A;  2KGB C;  4UPG A;  1YRU B;  1PAL A;  2O60 A;  4C0L A;  4WQ3 A;  2BAP A;  3VB1 A;  3AAJ A;  3IQQ A;  1CFP A;  2WCB A;  4IL1 A;  3JVT C;  2FCE A;  3SG6 A;  1A29 A;  3BYA A;  1UUR A;  1TRF A;  2KAV A;  3QRX A;  4F0Z B;  1OE9 B;  1J7Q A;  2SCP A;  3R1O A;  4PE7 A;  4I5J A;  4MZL A;  5DKN A;  1NCZ A;  1RTP 1;  2TN4 A;  4XJK A;  5D7F A;  1KFX S;  2KSP A;  3OGN A;  3KHE A;  4GFT A;  2LUC A;  2OS8 B;  1CKK A;  2KNE A;  1W7I B;  2WCK A;  2LAN A;  2WCE A;  1ZUZ A;  3BJH A;  2I7A A;  5CPV A;  5ER5 A;  2H2K A;  1OOI X;  1SPY A;  2M49 B;  3CR2 A;  3TUY B;  1SK6 D;  1LS8 A;  1DQE A;  4NDB A;  3BUN B;  1IJ6 A;  1SKT A;  2BL0 C;  2JUL A;  3CLN A;  4PHM A;  3SS5 A;  1KQM C;  4PE0 A;  1QX5 B;  3BUW B;  3WNX B;  1DEK A;  1XK4 A;  2WCJ A;  3O4X A;  1TNX A;  2AUC A;  3NSK A;  2KPH A;  3E3R A;  3TS5 C;  2KFH A;  1ZMZ A;  1KK8 B;  2E6W A;  2CBL A;  3I5G C;  3R1P A;  1J7P A;  3NSO A;  3BFA A;  3O6B A;  2ERB A;  1JF0 A;  1Y6W A;  3FS7 A;  3NHI A;  1CFF A;  2QEO A;  2KLD A;  1CMF A;  2PVB A;  2MA2 A;  3DY9 A;  3CZ1 A;  4CPV A;  1DJI A;  2MHH A;  1BU3 A;  1KFU S;  1B8C A;  1KK7 Z;  2KBI A;  4NQG A;  1RJV A;  2JT0 A;  1JF2 A;  2H61 C;  2M29 A;  4DIR A;  2JRF A;  1S36 A;  2LVK A;  3CS1 A;  3OX6 A;  4I5K A;  3S0E A;  1SCM C;  4MN0 A;  3QME A;  4MSP A;  4A4B A;  1CDN A;  3DD4 A;  1A2X A;  1OZO A;  2EC6 C;  2JT8 A;  5FI2 A;  2WCH A;  2LM5 A;  1XFR A;  2NCO A;  1JUO A;  1KQV A;  1RK9 A;  4JD9 A;  2BCA A;  2I94 A;  1CDP A;  1GJY A;  1W9Z A;  2A4J A;  2K60 A;  1Y0V H;  2QEB A;  2PMY A;  3R72 A;  1J1D A;  4GUK A;  3S0F A;  1C07 A;  2M9G A;  2LMT A;  4YGB B;  2G2B A;  1S5G Y;  3GOF A;  1CLB A;  3ICB A;  1SYM A;  2H8V A;  2WCM A;  3WHU B;  1LXF C;  1A75 A;  1LA0 A;  1S3P A;  1YUU A;  1MHO A;  2PRU A;  2P70 A;  1SW8 A;  1EH2 A;  2NXQ A;  2KQY A;  3BUX B;  3PJI A;  5DKQ A;  1XVJ A;  2CTN A;  2B1U A;  2NZ0 A;  1J55 A;  2AMI A;  2KYC A;  3PN7 C;  1IIO A;  2Q4U A;  1ALW A;  1J7R A;  2LC5 A;  2KI4 C;  1QLS A;  1NP8 A;  1QTX A;  2KDH A;  4MRX A;  1A75 B;  5I8N A;  3VRO A;  4ZCV A;  1WLM A;  1GM0 A;  4PCW A;  4QJ3 B;  4PT1 A;  5HKW A;  3R1V A;  1IRJ A;  5IBW A;  1RRO A;  1VRK A;  1QVI Y;  2M7N A;  1PUL A;  2M3W A;  2L51 A;  1V1G A;  1M39 A;  2KI6 D;  4OKH A;  3TDZ A;  4C0K A;  4ETO A;  5JJG A;  1TTX A;  1GGZ A;  1XFU O;  2L5X B;  2AAO A;  3D10 A;  2OTG C;  2WOR A;  3D0Y A;  5JOL A;  1YRT B;  3I5H C;  2KFF A;  4MEW A;  1CM4 A;  2PQL A;  2D8N A;  1ZAC A;  2JNX A;  2KHN A;  1JFJ A;  1TNP A;  3IQO A;  1DGV A;  3RZS A;  4ORB B;  3LL8 B;  2LHI A;  3FWB A;  2WOS A;  3D73 A;  4N1F A;  3A4U B;  1NX0 A;  2LCP A;  3D0Y B;  4JWQ A;  2QEV A;  4FQO A;  2K2F A;  1OOH A;  2LVJ A;  1WRK A;  3UNW A;  2BKI B;  1Q80 A;  1SL8 A;  1WRL A;  2IS9 A;  3SG7 A;  1B47 A;  1S26 D;  1IQ3 A;  4NDC A;  2WC8 A;  5KSZ A;  1DTL A;  3F45 A;  2JNF A;  1CLM A;  1H8B A;  2JTT A;  1AUI B;  3D74 A;  1M46 A;  1YR5 A;  1OOF A;  1RWY A;  1B8L A;  2WCL A;  2PAL A;  1R2U A;  4YGD B;  2JTZ A;  1MUX A;  2CNP A;  2F8P A;  1QWV A;  4N1G A;  1WDC C;  2FJY A;  2JPT A;  1IKU A;  3PAT A;  5DIC A;  1REC A;  3CAB A;  5HL1 A;  1IG5 A;  1XFV O;  3EVV A;  3D76 A;  5ER4 X;  1MWN A;  2K7B A;  5I94 A;  1UUS A;  2K8M B; 
#chains in the Genus database with same CATH homology
 4HRH A;  3TDI A;  1ODB A;  2JT3 A;  3DF0 A;  3BXK A;  2NLN A;  3NSL A;  3PAL A;  3A8R A;  1UHN A;  1XYD A;  2PSR A;  2COL B;  2JXL A;  3TDU A;  1SCV A;  1PVA A;  2L4H A;  3JTD B;  1BG1 A;  2FCD A;  3SG2 A;  2F3Y A;  1HT9 A;  4DRW A;  1FBV A;  2WCF A;  2LE9 B;  4XJK B;  4YGC B;  1JWD A;  1CDM A;  1NUB A;  3I5F B;  1K95 A;  1X02 A;  4XYN A;  1KK7 Y;  1ZFS A;  2ZRT A;  3BUO B;  2HET A;  1OSA A;  1N65 A;  2CCM A;  2K0J A;  1QS7 A;  3SG3 A;  2BCX A;  3I5I C;  1N0Y A;  4MLW A;  4A4C A;  1L2O B;  4YI8 A;  1K2H A;  3EK8 A;  4CLN A;  2Y4Q A;  2O5G A;  2MLF C;  4FTG A;  2LVI A;  3PSR A;  5PAL A;  1GQM A;  1OOJ A;  2CXJ A;  1KWO C;  4HSZ A;  1IWQ A;  4WRI A;  2M8U A;  4DS7 A;  5AAN A;  5BPJ A;  3ZWH A;  1CNP A;  1DF0 A;  2JXC A;  3GK2 A;  1CB1 A;  4QJ4 B;  2K7D A;  2WND A;  3NXA A;  4GPL B;  2L50 A;  4OR9 B;  4PHN A;  2L2E A;  5GQQ C;  2SAS A;  1SNL A;  1AHR A;  2ZN9 A;  2E30 A;  2LVV A;  3BUM B;  1K94 A;  1MQ1 A;  1K9K A;  1DJZ A;  4HRG A;  4P2Y B;  3DVE A;  1SR6 B;  4Q04 A;  1AP4 A;  1DF0 B;  1B9A A;  1CM1 A;  1QAT A;  1QIW A;  1DMO A;  5DKR A;  2M7L A;  3TZ1 A;  1CFC A;  1PK0 D;  2OS8 C;  1TCO B;  5J3X A;  1E8A A;  1K90 D;  3H4S E;  3LK0 A;  3PLF B;  2I18 A;  2HPS A;  3DVJ A;  1S6J A;  1BOD A;  1K93 D;  2LV7 A;  2LAP A;  1UHH A;  1GGW A;  2LP2 A;  4JPZ B;  3TUY C;  1BR1 B;  2Y1N A;  1KSM A;  4NDD A;  2LUX A;  4AOM A;  5AFP A;  1NSH A;  1G8I A;  3KEV A;  1B7T Z;  1B4C A;  1SY9 A;  5CSJ A;  1V1F A;  2BCB A;  1TNQ A;  1K9U A;  2QAC A;  1AJ4 A;  4C0J A;  1C7V A;  2BEC A;  2JC2 A;  4P5O E;  4E68 A;  1B8R A;  1KK8 C;  1UWO A;  2LMU A;  2ZND A;  1BF5 A;  1DJY A;  1TN4 A;  1UP5 A;  2M0R A;  1C7W A;  3JVT B;  2P6B B;  1EXR A;  2F3Z A;  3CR5 X;  1DJX A;  4CID A;  1M63 B;  2EHB A;  3O4Y A;  4MRY A;  3FWC A;  1CMG A;  1BJF A;  3CZT X;  1YVH A;  2Q91 A;  1YUR A;  2GGM A;  1EJ3 A;  2LLT A;  1MR8 A;  2LLS A;  2MAZ A;  3LCP C;  5HYD A;  2GGZ A;  2HF5 A;  5I2Q A;  1OMD A;  3OP0 A;  1MXL C;  1A03 A;  2K7C A;  2K7O A;  3M0W A;  3EK4 A;  2ISD A;  2CT9 A;  1QXP A;  1YUS A;  1QLK A;  3BOW A;  1DJH A;  1LIN A;  2BL0 B;  1EG4 A;  1G4Y R;  2KGR A;  2LLU A;  3WXA A;  1BMO A;  1KQM B;  1QV1 A;  1NX1 A;  5CSI A;  3SIB A;  2MRD A;  1DJG A;  3CWG A;  2K61 A;  4YBH B;  1AK8 A;  3FIA A;  1NCX A;  3OX5 A;  1TNW A;  3TS5 B;  3I5G B;  2KAY A;  2H61 A;  1EL4 A;  1M45 A;  2OPO A;  4ICB A;  3KF9 A;  4CFQ A;  4PDZ A;  5G08 A;  1CDL A;  5CSF A;  1H4B A;  1YUT A;  1F54 A;  4ORC B;  1NYA A;  1OZS A;  3EKH A;  4TNC A;  2KBM A;  4BY5 A;  1Y1U A;  2LMV A;  4PAL A;  4PE1 A;  5I2O A;  3SG4 A;  2LNK A;  5HLV A;  1XFX O;  2JQ6 A;  1PVB A;  3K21 A;  3KO0 A;  3SJS A;  4BY4 A;  2L0P A;  1SCM B;  1M31 A;  1YX7 A;  2FJU B;  4YGE B;  2MBX A;  1KFU L;  4M2Q A;  4AQI A;  5B8I B;  5AXI A;  2EC6 B;  2L98 A;  1F70 A;  1FI6 A;  3MSE B;  3VRN A;  1QJT A;  1FW4 A;  1WRZ A;  3VRQ A;  1XFZ O;  3RLZ A;  1EG3 A;  3VGO A;  1SMG A;  5HLO A;  5AEQ A;  1IJ5 A;  2R2I A;  5CSN A;  3DF0 B;  3AAK A;  2ZN8 A;  4L9M A;  4WQ2 A;  1F8H A;  3BQ3 A;  3CR4 X;  1XA5 A;  3OHM B;  4CFR A;  4QJ5 B;  1NIW A;  1K96 A;  1U5I A;  4GBA A;  1WY9 A;  1QX7 A;  1A4P A;  1BT6 A;  1QX2 A;  2EGD A;  4USL A;  1NPQ A;  1OMR A;  1NX3 A;  2M97 A;  1W7J B;  2QPT A;  2GV5 A;  2VRG A;  1N2D A;  1R6P A;  1SRA A;  1PRW A;  1LKJ A;  2M1U A;  2KI6 C;  1J1E A;  1TCF A;  3PN7 B;  1G33 A;  3NSI A;  1RFJ A;  2ZNE A;  1FF1 A;  3AKA A;  2KOT A;  1F55 A;  1CLL A;  1IGV A;  2KI4 B;  2LHL A;  2I2R E;  1F4Q A;  1U5I B;  2KFG A;  1UHI A;  3DVK A;  2K2A A;  1UHK A;  4GNK B;  4YRU A;  1XO5 A;  2Y1M A;  2KAX A;  2DOQ A;  3CGA A;  3DVM A;  4ORA B;  3HX4 A;  2LP3 A;  1OMV A;  2JOJ A;  5KTY A;  4N5X A;  1DJW A;  1CFD A;  1KSO A;  1AVS A;  5FYX A;  2OTG B;  1MF8 B;  2Y5I A;  3I5H B;  1DVI A;  1AJ5 A;  4OCI A;  2BE6 A;  3EKJ A;  4GGN A;  5TNC A;  4GAO A;  4GGF C;  1FI5 A;  4YGA A;  1F71 A;  3KPX A;  2JWW A;  1S6C A;  4YI9 A;  1JC2 A;  1JSA A;  4MZK A;  5K89 A;  1BR4 B;  3GK4 X;  1B7T Y;  1ZOT B;  2HQ8 A;  3SIA A;  4DCK A;  2BBN A;  2NCP A;  4U8D A;  2BKH B;  1NCY A;  3JTD C;  5D69 A;  1DGU A;  1HQV A;  3PM8 A;  1PSB A;  3EVR A;  5HKZ A;  1NWD A;  1CTR A;  3AKB A;  3EK7 A;  1IQ5 A;  4PHK A;  3SG5 A;  2L4I A;  2F33 A;  4DUQ A;  3I5F C;  2G9B A;  3O2P A;  4R1E A;  1LA3 A;  1JFK A;  1FPW A;  3VRR A;  1XFW O;  1PSR A;  1Y1A A;  1SBJ A;  4PE4 A;  1UHJ A;  3LLE A;  1WDC B;  1QAS A;  1WLZ A;  3GK1 A;  1NX2 A;  3HCM A;  2F2P A;  4D1E A;  1L2O C;  1XK4 C;  2JU0 A;  1S5G Z;  1K8U A;  1K9P A;  1IH0 A;  4PHJ A;  3O78 A;  4MBE A;  1S1E A;  4M2O A;  5AER A;  4M2P A;  2MLE C;  4ZCU A;  1L7Z A;  2BE4 A;  4AQJ A;  3RM1 A;  1J7O A;  1KFX L;  3EVU A;  3OB2 B;  4HRE E;  1XFY O;  4MVF A;  5I2L A;  1TOP A;  2JZI A;  4I5L B;  2M1K B;  2RGI A;  1TIZ A;  1ALV A;  3VRP A;  1D1O A;  2HQW A;  2ZFD A;  4JQ0 D;  4MZJ A;  4I5N B;  1F4O A;  2BBM A;  1DT7 B;  1SR6 C;  1QVI Z;  1SL9 A;  1BLQ A;  3CTN A;  3PFV A;  2PAS A;  4OVN F;  1YTZ C;  2ZRS A;  5KU1 A;  3BOW B;  1MXE A;  3I5I B;  1QV0 A;  2FOT A;  4OV2 A;  3OB1 B;  2V53 A;  3LK1 A;  1YX8 A;  1S6I A;  5F6T A;  1JBA A;  1KCY A;  2MJW B;  2KYF A;  5HKY A;  1OQP A;  3C1V A;  1Y1X A;  2KQ6 A;  1QIV A;  1YVL A;  1KWO B;  1LVC D;  1BOC A;  3ZNI A;  3WHT B;  3IF7 A;  2F2O A;  4GGF A;  2ZKM X;  1B1G A;  1SL7 A;  2KGB C;  4UPG A;  1YRU B;  1PAL A;  2O60 A;  4C0L A;  4WQ3 A;  3AAJ A;  3IQQ A;  1CFP A;  2WCB A;  4IL1 A;  3JVT C;  2FCE A;  3SG6 A;  1A29 A;  3BYA A;  1UUR A;  1TRF A;  2KAV A;  3QRX A;  4F0Z B;  1OE9 B;  1J7Q A;  2SCP A;  4PE7 A;  5DKN A;  4I5J A;  4MZL A;  1NCZ A;  1RTP 1;  2TN4 A;  4XJK A;  5D7F A;  1KFX S;  2KSP A;  3KHE A;  4GFT A;  2LUC A;  2OS8 B;  1CKK A;  2KNE A;  1W7I B;  2LAN A;  2WCE A;  1ZUZ A;  2I7A A;  5CPV A;  5ER5 A;  2H2K A;  1SPY A;  2M49 B;  3CR2 A;  3TUY B;  1SK6 D;  4NDB A;  3BUN B;  1IJ6 A;  1SKT A;  2BL0 C;  2JUL A;  3CLN A;  4PHM A;  1KQM C;  4PE0 A;  1QX5 B;  3BUW B;  3WNX B;  1XK4 A;  1TNX A;  2AUC A;  3NSK A;  3E3R A;  3TS5 C;  2KFH A;  1ZMZ A;  1KK8 B;  2E6W A;  2CBL A;  3I5G C;  1J7P A;  3NSO A;  3O6B A;  1JF0 A;  1Y6W A;  3FS7 A;  1CFF A;  1CMF A;  2PVB A;  2MA2 A;  4CPV A;  1DJI A;  2MHH A;  1BU3 A;  1KFU S;  1B8C A;  1KK7 Z;  2KBI A;  4NQG A;  1RJV A;  2JT0 A;  1JF2 A;  2H61 C;  2M29 A;  4DIR A;  2JRF A;  1S36 A;  2LVK A;  3CS1 A;  3OX6 A;  4I5K A;  1SCM C;  4MN0 A;  4MSP A;  4A4B A;  1CDN A;  3DD4 A;  1A2X A;  1OZO A;  2EC6 C;  2JT8 A;  2LM5 A;  2NCO A;  1JUO A;  1KQV A;  1RK9 A;  2BCA A;  2I94 A;  1CDP A;  1GJY A;  2A4J A;  1Y0V H;  2PMY A;  1C07 A;  1J1D A;  4GUK A;  2M9G A;  2LMT A;  4YGB B;  2G2B A;  1S5G Y;  3GOF A;  1CLB A;  3ICB A;  1SYM A;  3WHU B;  1LXF C;  1A75 A;  1LA0 A;  1S3P A;  1YUU A;  1MHO A;  2PRU A;  1SW8 A;  1EH2 A;  2NXQ A;  2KQY A;  3BUX B;  5DKQ A;  1XVJ A;  2CTN A;  2B1U A;  2NZ0 A;  1J55 A;  2AMI A;  2KYC A;  3PN7 C;  2Q4U A;  1ALW A;  1J7R A;  2LC5 A;  2KI4 C;  1QLS A;  1NP8 A;  1QTX A;  2KDH A;  4MRX A;  1A75 B;  5I8N A;  3VRO A;  4ZCV A;  1WLM A;  4PCW A;  4QJ3 B;  5HKW A;  1IRJ A;  5IBW A;  1RRO A;  1VRK A;  1QVI Y;  2M7N A;  1PUL A;  2M3W A;  2L51 A;  1V1G A;  1M39 A;  2KI6 D;  4OKH A;  3TDZ A;  4C0K A;  4ETO A;  5JJG A;  1TTX A;  1GGZ A;  1XFU O;  2L5X B;  2AAO A;  3D10 A;  2OTG C;  2WOR A;  3D0Y A;  5JOL A;  1YRT B;  3I5H C;  2KFF A;  4MEW A;  1CM4 A;  2D8N A;  1ZAC A;  2JNX A;  2KHN A;  1JFJ A;  1TNP A;  3IQO A;  1DGV A;  4ORB B;  3LL8 B;  2LHI A;  3FWB A;  2WOS A;  4N1F A;  3A4U B;  1NX0 A;  2LCP A;  3D0Y B;  4JWQ A;  4FQO A;  2K2F A;  2LVJ A;  1WRK A;  2BKI B;  1Q80 A;  1SL8 A;  1WRL A;  2IS9 A;  3SG7 A;  1B47 A;  1S26 D;  1IQ3 A;  4NDC A;  2WC8 A;  5KSZ A;  1DTL A;  3F45 A;  2JNF A;  1CLM A;  1H8B A;  2JTT A;  1AUI B;  1M46 A;  1YR5 A;  1RWY A;  1B8L A;  2PAL A;  1R2U A;  4YGD B;  2JTZ A;  1MUX A;  2CNP A;  2F8P A;  4N1G A;  1WDC C;  2JPT A;  1IKU A;  3PAT A;  1REC A;  1IG5 A;  1XFV O;  3EVV A;  5ER4 X;  1MWN A;  2K7B A;  1UUS A;  2K8M B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...