1S5GY

Structure of scallop myosin s1 reveals a novel nucleotide conformation
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
142
structure length
142
Chain Sequence
PQKQIQEMKEAFSMIDVDRDGFVSKEDIKAISEQLGRAPDDKELTAMLKEAPGPLNFTMFLSIFSDKLSGTDSEETIRNAFAMFDEQETKKLNIEYIKDLLENMGDNFNKDEMRMTFKEAPVEGGKFDYVKFTAMIKGSGEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Contractile protein
molecule keywords Myosin heavy chain, striated muscle
publication title Myosin subfragment 1 structures reveal a partially bound nucleotide and a complex salt bridge that helps couple nucleotide and actin binding.
pubmed doi rcsb
total genus 26
structure length 142
sequence length 142
ec nomenclature
pdb deposition date 2004-01-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Y PF13405 EF-hand_6 EF-hand domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1s5gY01
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1s5gY02
1FBVA 2JPTA 2ZN9A 3PSRA 4YGEB 3GK1A 2KGBC 2WCBA 1K9UA 2BCAA 2Y1MA 1DTLA 4YGCB 3LK1A 2ZNDA 3DF0B 1A75B 1SRAA 1NCZA 3D0YB 2F8PA 2PASA 4MEWA 2COLB 2K7CA 2KFFA 4MRXA 5KU1A 1TRFA 3OX6A 1EG3A 1SL7A 5HKWA 4DCKA 1YVHA 1K96A 2DOQA 4GUKA 1TNWA 5HYDA 1GGWA 4OV2A 5KSZA 4E68A 1PSBA 2JNXA 3BOWB 1M39A 1J7RA 3EKHA 2RGIA 1S6IA 3DD4A 1A03A 1BLQA 1R6PA 4MZKA 2KAYA 1CNPA 3CS1A 4C0LA 1VRKA 3I5FB 3VGOA 1IJ5A 4BY5A 3C1VA 4C0KA 1MR8A 4CFRA 1Y1UA 2G9BA 4MVFA 1SKTA 4I5KA 4N1GA 1MXEA 4QJ4B 2I2RE 3PALA 3D10A 1K94A 4OR9B 1L2OB 2GGMA 4HRGA 2EHBA 1B8RA 4YI9A 3DVJA 1TNXA 4CIDA 3AAJA 4FTGA 3BXKA 3DVKA 1F55A 1LINA 1TOPA 3NXAA 4GBAA 4PDZA 5I2LA 3D0YA 1SL8A 4I5LB 4NDCA 3TZ1A 3BUNB 2M1KB 1KQMB 5HKYA 1IWQA 4ICBA 1J55A 1UURA 2HF5A 3IQQA 5DKNA 5HLVA 2ZFDA 2I7AA 1JWDA 3BOWA 1KWOB 2KBMA 2EC6C 3BUOB 1BR4B 2NXQA 1UHKA 3EK7A 5CSIA 1CM4A 5AANA 1BT6A 1QS7A 2WORA 4CPVA 3PN7B 5PALA 1WRLA 3O2PA 1XFUO 3KEVA 1PULA 1U5IB 1WLMA 2HPSA 1NX0A 2JRFA 2L5XB 1CB1A 1E8AA 1G8IA 3WHTB 3VRPA 2E30A 1Y1XA 3OB1B 2KQ6A 2Y1NA 4OCIA 4PALA 3FWCA 3CLNA 1A2XA 2JTZA 2LHLA 3KPXA 1RTP1 2LNKA 1CMGA 4YGAA 1AUIB 3PM8A 1XFVO 2KDHA 5AFPA 1NUBA 1QLSA 1G33A 3FWBA 3MSEB 2K8MB 1SY9A 1KSMA 1GQMA 1AVSA 2JT0A 2WC8A 3FIAA 2NCPA 3LK0A 1WRKA 5DKRA 4FQOA 2LMTA 1CMFA 1OOJA 4I5JA 2M8UA 1BG1A 1LKJA 1XK4C 4ETOA 1IJ6A 1PRWA 5HLOA 2L50A 2HETA 1S6CA 2M1UA 1OZSA 1QIWA 1B4CA 1U5IA 1ZMZA 1DJGA 4MZJA 1CTRA 4N5XA 5TNCA 4D1EA 1PSRA 5DKQA 3M0WA 1TCOB 1MWNA 1B7TY 2NCOA 3PLFB 1K8UA 1QLKA 2M29A 3I5IC 1PVBA 4NDDA 1DGVA 4PHKA 1MF8B 1BF5A 1H4BA 2HQ8A 2KOTA 1L7ZA 3BQ3A 3DVMA 1FW4A 2FOTA 1ZFSA 2OS8C 4WQ3A 1YX7A 1AK8A 3RM1A 5B8IB 1WY9A 2JC2A 5F6TA 1F4QA 1YUSA 2JOJA 1K9PA 1CFDA 4PHJA 1S5GY 2MJWB 1KCYA 1LA3A 1PALA 3CR5X 1UHNA 3OP0A 3EVRA 1QASA 2F3ZA 1FF1A 1KK7Z 1DT7B 1KK8C 2LUXA 1A4PA 1YR5A 4CFQA 1IGVA 2JT3A 4R1EA 4JQ0D 1DJZA 1EL4A 1C7VA 2P6BB 1DJXA 2EC6B 1B8LA 1IH0A 1SCMB 1QVIY 3ZNIA 1TNQA 1XFWO 4PHMA 4HREE 1MXLC 1ZACA 4XYNA 4PHNA 1XFXO 3EVVA 1AHRA 2BBMA 1NP8A 1CDNA 1TN4A 1RECA 2LE9B 1CDPA 2Q4UA 3VRRA 3SIAA 2LLTA 2FCDA 2HQWA 2LP2A 4ORBB 1M31A 1ZUZA 1OSAA 2GV5A 2JU0A 1NCXA 1QX2A 4P2YB 1KFUL 2ZKMX 2KI4C 3GK2A 5BPJA 2BE4A 2LM5A 1JSAA 2VRGA 1CFPA 2M49B 4QJ5B 2V53A 1SR6B 1WLZA 1JBAA 3VRNA 3JVTC 4PCWA 2K0JA 5GQQC 2BKIB 2KGRA 1YUUA 1S26D 3HX4A 5K89A 2K7OA 1WRZA 3AAKA 1DJHA 3LLEA 1IG5A 3EVUA 1EXRA 1HT9A 2LCPA 2M0RA 1YUTA 2KYCA 1HQVA 2WCFA 1Y1AA 1XO5A 1J1EA 2SASA 2KI6C 4PE4A 5I2OA 3AKBA 3OB2B 2LVVA 2LP3A 4DIRA 1F4OA 2K2FA 2LANA 1J7OA 1QV1A 1YX8A 1JUOA 4YBHB 1CLLA 3I5IB 4OKHA 5CPVA 5CSNA 1K2HA 2A4JA 2KI6D 4DRWA 2EGDA 2F2PA 2KAVA 1LXFC 4U8DA 3WXAA 4P5OE 3KO0A 1JC2A 2WNDA 1KQVA 1CDLA 2OS8B 4AQJA 1DJIA 4I5NB 1B47A 5D69A 4A4CA 2IS9A 2K7DA 2M9GA 3WNXB 4YI8A 1LA0A 1NX1A 1TNPA 2KYFA 1DJYA 2BL0C 1ALVA 2D8NA 3CZTX 3SJSA 2L4HA 5CSJA 1UHHA 1IKUA 2JNFA 1XK4A 3HCMA 4XJKA 2E6WA 1KK8B 1Q80A 4GGFC 2LAPA 4QJ3B 1B8CA 2K61A 2H2KA 3TDZA 1M63B 1ODBA 1Y6WA 1NSHA 4YGDB 1G4YR 3F45A 3JTDC 1SL9A 1AP4A 1UUSA 2LLSA 1NPQA 4NDBA 3TUYC 1DMOA 1OMDA 1N2DA 1UHIA 2JZIA 2M3WA 1BU3A 3I5HC 4MLWA 1SYMA 2G2BA 1JF0A 1UP5A 3BUXB 3O4YA 3TS5C 3I5GC 2JXCA 5HKZA 1WDCC 1N65A 2LMVA 4DUQA 2KNEA 2MRDA 5J3XA 2OTGC 2GGZA 4JPZB 3PATA 1RFJA 3EK4A 4GPLB 2F2OA 5FYXA 1SCVA 2PVBA 3BUMB 1IQ5A 1FI6A 1DVIA 2CTNA 3NSLA 5ER5A 2KI4B 4JWQA 5G08A 1S1EA 3A4UB 1B9AA 5AERA 5IBWA 1BJFA 3SG5A 3VROA 3VRQA 5JJGA 1SNLA 2CCMA 3DVEA 5CSFA 1CLBA 3CWGA 4YGBB 1PVAA 2MAZA 1S6JA 1CFFA 2CXJA 1KFUS 3SG3A 4NQGA 1NX3A 2QPTA 4WQ2A 1QIVA 4UPGA 1YURA 2MHHA 1RWYA 2KBIA 3SG6A 1K95A 4BY4A 1EH2A 3FS7A 4PE7A 5AXIA 1YRTB 2JQ6A 2AMIA 2SCPA 1SK6D 1FI5A 1YRUB 3ZWHA 2LMUA 4MN0A 2WOSA 2LHIA 4CLNA 2CT9A 1QJTA 4N1FA 2R2IA 2CNPA 3CTNA 2NZ0A 1DF0A 1S36A 1TTXA 3BUWB 3IQOA 1AJ4A 3CR4X 2Q91A 4WRIA 2ZN8A 2FCEA 2KSPA 2FJUB 1XA5A 4HRHA 1OMVA 2KFGA 2BBNA 2O5GA 3TDIA 1ALWA 1R2UA 2KHNA 4TNCA 4A4BA 4YRUA 1H8BA 1F71A 2I18A 2L51A 2BECA 2KFHA 3PFVA 3WHUB 1QTXA 3SG4A 2BL0B 1QX7A 3CGAA 1KK7Y 1GGZA 1PK0D 1KSOA 2JTTA 3ICBA 3O78A 3O6BA 5D7FA 1NIWA 5I8NA 1KFXS 2M7LA 5KTYA 3EK8A 2MBXA 1QV0A 4PE1A 4XJKB 3QRXA 4DS7A 2PSRA 1W7JB 4ZCUA 4ZCVA 1RJVA 2ISDA 4AQIA 4F0ZB 1BODA 2KAXA 2WCEA 4ORAB 1XYDA 2LVJA 5JOLA 1A29A 1TCFA 1SW8A 3A8RA 1A75A 3DF0A 3JTDB 1J7QA 2F33A 1QXPA 1BOCA 1UHJA 1DGUA 1JFKA 2BCXA 2LVIA 1RROA 2ZRTA 4GGNA 3TUYB 3AKAA 3TDUA 2L98A 4L9MA 1V1FA 3RLZA 4MBEA 3I5HB 1GJYA 3OHMB 1CDMA 2Y4QA 1F54A 1BR1B 3TS5B 2L2EA 1IQ3A 1SCMC 1NX2A 3I5GB 2AUCA 2KQYA 1AJ5A 1WDCB 2JT8A 1KFXL 4M2OA 2OTGB 3CR2A 2JWWA 1XVJA 1FPWA 1S3PA 3IF7A 1B7TZ 1CFCA 1D1OA 3I5FC 2L0PA 1K93D 2M7NA 3KHEA 4PE0A 2B1UA 2O60A 5ER4X 1F8HA 2H61A 1XFZO 4M2QA 1QATA 2H61C 1QX5B 2QACA 3SIBA 4GGFA 4USLA 1MHOA 2ZNEA 1CLMA 1MUXA 2BCBA 2LV7A 2NLNA 5I2QA 1L2OC 2LUCA 2CBLA 2K2AA 1BMOA 3K21A 1X02A 2LVKA 1MQ1A 1NCYA 2ZRSA 1K9KA 1S5GZ 2AAOA 3E3RA 1B1GA 2BE6A 1F70A 1SMGA 1OE9B 2JXLA 3EKJA 3LCPC 1C7WA 1SR6C 1KQMC 1ZOTB 3H4SE 1SBJA 1N0YA 1OZOA 4MZLA 2MLEC 2OPOA 1KWOC 4HSZA 1YTZC 2Y5IA 1YVLA 1OMRA 1LVCD 2MA2A 1QVIZ 1EJ3A 1Y0VH 2MLFC 3PN7C 1V1GA 4MRYA 1M45A 1M46A 1CM1A 2L4IA 3OX5A 1DF0B 4MSPA 3GK4X 1SPYA 4IL1A 4GNKB 4ORCB 3SG2A 2K7BA 1TIZA 3KF9A 2I94A 4GFTA 1XFYO 2PRUA 3LL8B 2PMYA 3NSIA 4GAOA 1CKKA 2TN4A 1JFJA 3GOFA 4OVNF 4C0JA 3BYAA 1DJWA 2LC5A 4AOMA 1J1DA 5AEQA 1C07A 1J7PA 1IRJA 1UWOA 3NSKA 1EG4A 1JF2A 3JVTB 4M2PA 1RK9A 3NSOA 1W7IB 1K90D 3SG7A 2JULA 1NWDA 2LLUA 2M97A 4Q04A 1NYAA 2PALA 2BKHB 2F3YA 1OQPA
chains in the Genus database with same CATH superfamily
1FBVA 2JPTA 2ZN9A 3PSRA 4YGEB 3GK1A 2KGBC 2WCBA 1K9UA 2BCAA 2Y1MA 1DTLA 2YGUA 4YGCB 3LK1A 2ZNDA 3DF0B 1A75B 1SRAA 3FE9A 1NCZA 3D0YB 2F8PA 2PASA 3Q8IA 2COLB 2K7CA 2KFFA 4MEWA 4MRXA 5KU1A 1TRFA 3OX6A 1EG3A 1SL7A 5HKWA 4DCKA 1YVHA 1K96A 2DOQA 4GUKA 1TNWA 5FI2A 5HYDA 1GGWA 4OV2A 5KSZA 4E68A 3D74A 1PSBA 2JNXA 2WCHA 1OOHA 3BOWB 1M39A 1J7RA 3EKHA 2RGIA 1S6IA 3DD4A 1A03A 1BLQA 1R6PA 4MZKA 2KAYA 1CNPA 3CS1A 1SSEB 4C0LA 1VRKA 3I5FB 3R1OA 1IJ5A 3VGOA 3C1VA 4BY5A 4C0KA 1MR8A 3OBVA 4CFRA 1Y1UA 2G9BA 4MVFA 2KLEA 1SKTA 4I5KA 4N1GA 1MXEA 4IJ7A 4QJ4B 2I2RE 3PALA 3D10A 1K94A 4OR9B 1L2OB 2GGMA 4HRGA 2EHBA 1B8RA 4YI9A 3DVJA 2PYQA 1TNXA 4CIDA 3AAJA 4FTGA 3BXKA 1OOFA 3DVKA 1F55A 1LINA 1TOPA 3NXAA 4GBAA 4PDZA 5I2LA 2WC5A 3D0YA 3S0EA 1SL8A 4I5LB 4NDCA 3TZ1A 3BUNB 2M1KB 1KQMB 5HKYA 1IWQA 3K1EA 1J55A 1UURA 2HF5A 3IQQA 4ICBA 5DKNA 5EL2A 5HLVA 2ZFDA 2I7AA 1JWDA 3BOWA 1KWOB 2KBMA 2EC6C 3BUOB 2WCLA 1BR4B 2NXQA 3BFHA 1UHKA 3EK7A 5CSIA 1CM4A 5AANA 1BT6A 1QS7A 2WORA 4CPVA 3S0AA 3PN7B 5PALA 1WRLA 2K60A 3O2PA 1XFUO 3KEVA 1PULA 3S0GA 3BJHA 1U5IB 1WLMA 2HPSA 1NX0A 2JRFA 2L5XB 1CB1A 1E8AA 1G8IA 3WHTB 3VB1A 3VRPA 2E30A 1Y1XA 3OB1B 2JPOA 2KQ6A 2Y1NA 4OCIA 1OW4A 2BAPA 4PALA 3FWCA 3CLNA 1Z2CB 3IVTA 1A2XA 2JTZA 2LHLA 3DYEA 3KPXA 1RTP1 3V2LA 2LNKA 1CMGA 4YGAA 1AUIB 3DXLA 3FE6A 3PM8A 1XFVO 2KDHA 5AFPA 1NUBA 1QLSA 2FJYA 1G33A 3FWBA 3MSEB 4JKTA 2K8MB 1DELA 3D75A 1SY9A 1KSMA 1GQMA 1AVSA 2JT0A 2WC8A 3FIAA 2NCPA 3LK0A 1TWOA 1WRKA 5DKRA 4FQOA 2LMTA 1CMFA 1OOJA 4I5JA 2M8UA 1BG1A 1LKJA 1XK4C 4ETOA 1IJ6A 3PM2A 1PRWA 2WC6A 5HLOA 2L50A 2HETA 1S6CA 2M1UA 1OZSA 1QIWA 1B4CA 1U5IA 1ZMZA 1DJGA 4MZJA 1CTRA 4N5XA 5TNCA 4D1EA 1PSRA 5DKQA 3M0WA 1TCOB 1MWNA 3SS4A 1B7TY 2QEBA 2NCOA 3PLFB 1K8UA 1QLKA 2M29A 3I5IC 1PVBA 3QMEA 4NDDA 1DGVA 4PHKA 2GTEA 1MF8B 1BF5A 1H4BA 2HQ8A 2KOTA 3NHTA 1L7ZA 3BQ3A 3DVMA 1FW4A 2FOTA 1ZFSA 2OS8C 4WQ3A 1YX7A 3BFBA 3RZSA 1AK8A 3RM1A 3S0FA 1C3ZA 5B8IB 1WY9A 1T14A 2JC2A 5F6TA 1F4QA 3DZTA 1YUSA 2JOJA 1K9PA 1CFDA 3CZ0A 4PHJA 1S5GY 2MJWB 1KCYA 1LA3A 1PALA 3CR5X 1UHNA 3OP0A 3EVRA 1QASA 1W9ZA 2F3ZA 1FF1A 1KK7Z 1DT7B 1KK8C 2LUXA 1A4PA 2WCKA 1YR5A 4CFQA 1IGVA 2JT3A 1DC1A 1DEKA 4R1EA 4JQ0D 1DJZA 3SS5A 1EL4A 1C7VA 4FQTA 2P6BB 1DJXA 2EC6B 1B8LA 1IH0A 1SCMB 1QVIY 3ZNIA 1TNQA 1XFWO 4PHMA 4HREE 1MXLC 1ZACA 4XYNA 4PHNA 1XFXO 3B86A 3EVVA 1AHRA 2BBMA 1NP8A 1CDNA 1TN4A 1RECA 2LE9B 1CDPA 2Q4UA 3VRRA 3SIAA 2LLTA 2FCDA 2HQWA 2LP2A 1C3YA 4ORBB 1M31A 1ZUZA 1OSAA 2GV5A 2JU0A 1NCXA 1QX2A 4P2YB 4PT1A 1IIOA 1KFUL 2ZKMX 2KI4C 3GK2A 5BPJA 2BE4A 2LM5A 1JSAA 2VRGA 1CFPA 2M49B 4QJ5B 2V53A 1SR6B 1WLZA 1JBAA 3VRNA 3JVTC 4PCWA 2K0JA 5GQQC 2BKIB 2KGRA 1YUUA 1S26D 3HX4A 5I94A 5K89A 2H8VA 2K7OA 1WRZA 2QEOA 3AAKA 1DJHA 3LLEA 2ERBA 1IG5A 3EVUA 1EXRA 1HT9A 2LCPA 2M0RA 3CZ1A 1YUTA 2KYCA 1HQVA 2WCFA 1TUZA 1Y1AA 1XO5A 1J1EA 2SASA 2KI6C 4PE4A 5I2OA 3AKBA 3OB2B 2LVVA 2LP3A 4DIRA 1F4OA 2K2FA 2LANA 3DY9A 1QV1A 1J7OA 1YX8A 1JUOA 4YBHB 1CLLA 3I5IB 4OKHA 5CPVA 5CSNA 1K2HA 2A4JA 2KI6D 2L2CA 2EGDA 2F2PA 2KAVA 2QDIA 1LXFC 4U8DA 3WXAA 4DRWA 4P5OE 3KO0A 1JC2A 2QEVA 2WNDA 1KQVA 1CDLA 2OS8B 4AQJA 1DJIA 4I5NB 2P70A 3PJIA 1B47A 5D69A 4A4CA 2IS9A 2K7DA 2M9GA 3WNXB 4YI8A 1LA0A 1NX1A 1TNPA 2KYFA 1DJYA 2BL0C 3R1PA 1ALVA 2D8NA 3CZTX 3SJSA 2L4HA 4KYNA 3CZ2A 5CSJA 1UHHA 1IKUA 2JNFA 1XK4A 3B88A 3HCMA 3BFAA 4XJKA 3O4XA 2E6WA 1KK8B 1Q80A 4GGFC 2LAPA 4QJ3B 1B8CA 2K61A 2H2KA 3TDZA 1M63B 3D78A 1ODBA 1Y6WA 3D76A 4F7FA 1NSHA 4INWA 4YGDB 1G4YR 3F45A 3UO9A 3JTDC 1SL9A 1AP4A 1UUSA 2LLSA 2WCJA 1NPQA 3D73A 4NDBA 2KPHA 3TUYC 1DMOA 1OMDA 1N2DA 1UHIA 2JZIA 2M3WA 1BU3A 3I5HC 4MLWA 1SYMA 3S0BA 2G2BA 1JF0A 1UP5A 3BUXB 3O4YA 3TS5C 3I5GC 2JXCA 5HKZA 2BNXA 1WDCC 1N65A 2LMVA 4DUQA 2KNEA 2MRDA 1OOIX 5J3XA 2OTGC 3R72A 2GGZA 3UNWA 4JPZB 1DQEA 3PATA 1RFJA 3EK4A 1TUJA 4GPLB 2F2OA 5FYXA 1SCVA 2PVBA 3BUMB 5HL1A 1IQ5A 1FI6A 4INXA 1DVIA 2CTNA 3NSLA 5ER5A 2KI4B 4JWQA 5G08A 1S1EA 3A4UB 1B9AA 5AERA 5IBWA 1BJFA 3R1VA 3SG5A 3VROA 3VRQA 5JJGA 3S0DA 1SNLA 2CCMA 3DVEA 5CSFA 1CLBA 3CWGA 4YGBB 1PVAA 2MAZA 1S6JA 1CFFA 2CXJA 1KFUS 2KLDA 3SG3A 4NQGA 1NX3A 2QPTA 4WQ2A 1QIVA 4UPGA 1YURA 1GM0A 2MHHA 5FI6A 1RWYA 2KBIA 3SG6A 1K95A 1QWVA 4BY4A 1EH2A 3FS7A 4PE7A 5AXIA 1YRTB 2JQ6A 2AMIA 2SCPA 1SK6D 1FI5A 1YRUB 3ZWHA 2LMUA 4MN0A 2WOSA 2LHIA 4CLNA 2CT9A 3B6XA 1QJTA 4N1FA 2R2IA 2CNPA 3CTNA 2NZ0A 1DF0A 1S36A 1TTXA 3BUWB 3IQOA 1AJ4A 3CR4X 2Q91A 4WRIA 2ZN8A 2FCEA 2KSPA 2FJUB 1XA5A 4HRHA 1OMVA 2KFGA 2BBNA 2O5GA 3TDIA 1ALWA 1R2UA 2KHNA 2QEHA 4TNCA 4A4BA 4YRUA 1H8BA 1F71A 2I18A 2L51A 2BECA 2KFHA 3PFVA 3WHUB 1QTXA 3SG4A 2BL0B 1QX7A 3NGVA 3CGAA 1KK7Y 1GGZA 1PK0D 1KSOA 2JTTA 3ICBA 3O78A 3O6BA 5D7FA 1NIWA 1XFRA 3SS3A 5I8NA 1KFXS 5DICA 2M7LA 5KTYA 3EK8A 1ORGA 2MBXA 1QV0A 4PE1A 4XJKB 3QRXA 4DS7A 2PSRA 1W7JB 4ZCUA 4ZCVA 1RJVA 2ISDA 4AQIA 4F0ZB 1BODA 2KAXA 2WCEA 4ORAB 1XYDA 2LVJA 5JOLA 3NHIA 1A29A 1TCFA 1SW8A 3A8RA 1A75A 3B87A 3CYZA 3DF0A 3JTDB 1J7QA 2F33A 1QXPA 1BOCA 1UHJA 1DGUA 1JFKA 2BCXA 2LVIA 1RROA 3CABA 3EG5B 1OOGA 2ZRTA 4GGNA 3TUYB 3AKAA 3TDUA 2L98A 4L9MA 1V1FA 3B7AA 3RLZA 4MBEA 3I5HB 1GJYA 5FI7A 3OHMB 1CDMA 2Y4QA 1F54A 1BR1B 3TS5B 2L2EA 1IQ3A 1SCMC 1NX2A 3I5GB 2AUCA 2KQYA 1AJ5A 1WDCB 2JT8A 1KFXL 3L47A 2OTGB 4M2OA 3CR2A 2JWWA 1XVJA 1FPWA 1S3PA 3IF7A 1B7TZ 1CFCA 1D1OA 3I5FC 2L0PA 1K93D 2M7NA 3KHEA 4PE0A 2L5YA 2B1UA 2O60A 5ER4X 1F8HA 2H61A 1XFZO 4M2QA 5D3OA 1QATA 2H61C 1QX5B 2QACA 3SIBA 4GGFA 4USLA 2P71A 1MHOA 2PQLA 2ZNEA 1CLMA 1MUXA 2BCBA 2LV7A 2NLNA 4OZDA 1L2OC 5I2QA 2LUCA 2CBLA 2K2AA 1BMOA 3K21A 1X02A 2LVKA 2WCMA 1MQ1A 1NCYA 2ZRSA 1K9KA 1S5GZ 2AAOA 3E3RA 3D77A 1B1GA 1Z4HA 2BE6A 1F70A 1SMGA 1OE9B 2JXLA 3EKJA 3LCPC 1C7WA 1SR6C 3OGNA 1KQMC 1ZOTB 3H4SE 1SBJA 1N0YA 1OZOA 4MZLA 2MLEC 2OPOA 1KWOC 4HSZA 1YTZC 2Y5IA 1YVLA 1OMRA 1LVCD 2MA2A 3L4LA 1QVIZ 1EJ3A 1Y0VH 2MLFC 3PN7C 1V1GA 4JD9A 4MRYA 1M45A 1M46A 1CM1A 2L4IA 3OX5A 1DF0B 4MSPA 1LS8A 3GK4X 1SPYA 4IL1A 4GNKB 4ORCB 3SG2A 2K7BA 1P28A 1TIZA 2I94A 3KF9A 1XFYO 2PRUA 3LL8B 2PMYA 4GFTA 3NSIA 4GAOA 1CKKA 2TN4A 1JFJA 3GOFA 4OVNF 4C0JA 3BYAA 1DJWA 2LC5A 4AOMA 1J1DA 5AEQA 3CDNA 1C07A 1J7PA 1IRJA 1UWOA 3NSKA 1EG4A 3N7HA 1JF2A 3JVTB 4M2PA 3L4AA 1RK9A 3FE8A 3NSOA 1W7IB 1K90D 3SG7A 2JULA 1NWDA 2LLUA 2M97A 4Q04A 1NYAA 2PALA 2BKHB 2F3YA 1OQPA
chains in the Genus database with same CATH topology
1FBVA 2JPTA 2ZN9A 3PSRA 4YGEB 3GK1A 2KGBC 2WCBA 1K9UA 2BCAA 2Y1MA 1DTLA 4YGCB 3LK1A 2ZNDA 3DF0B 1A75B 1SRAA 1NCZA 3D0YB 2F8PA 2PASA 4MEWA 2COLB 2K7CA 2KFFA 4MRXA 5KU1A 1TRFA 3OX6A 1EG3A 1SL7A 5HKWA 4DCKA 1YVHA 1K96A 2DOQA 4GUKA 1TNWA 5HYDA 1GGWA 4OV2A 5KSZA 4E68A 1PSBA 2JNXA 3BOWB 1M39A 1J7RA 3EKHA 2RGIA 1S6IA 3DD4A 1A03A 1BLQA 1R6PA 4MZKA 2KAYA 1CNPA 3CS1A 4C0LA 1VRKA 3I5FB 3VGOA 1IJ5A 4BY5A 3C1VA 4C0KA 1MR8A 4CFRA 1Y1UA 2G9BA 4MVFA 1SKTA 4I5KA 4N1GA 1MXEA 4QJ4B 2I2RE 3PALA 3D10A 1K94A 4OR9B 1L2OB 2GGMA 4HRGA 2EHBA 1B8RA 4YI9A 3DVJA 1TNXA 4CIDA 3AAJA 4FTGA 3BXKA 3DVKA 1F55A 1LINA 1TOPA 3NXAA 4GBAA 4PDZA 5I2LA 3D0YA 1SL8A 4I5LB 4NDCA 3TZ1A 3BUNB 2M1KB 1KQMB 5HKYA 1IWQA 4ICBA 1J55A 1UURA 2HF5A 3IQQA 5DKNA 5HLVA 2ZFDA 2I7AA 1JWDA 3BOWA 1KWOB 2KBMA 2EC6C 3BUOB 1BR4B 2NXQA 1UHKA 3EK7A 5CSIA 1CM4A 5AANA 1BT6A 1QS7A 2WORA 4CPVA 3PN7B 5PALA 1WRLA 3O2PA 1XFUO 3KEVA 1PULA 1U5IB 1WLMA 2HPSA 1NX0A 2JRFA 2L5XB 1CB1A 1E8AA 1G8IA 3WHTB 3VRPA 2E30A 1Y1XA 3OB1B 2KQ6A 2Y1NA 4OCIA 4PALA 3FWCA 3CLNA 1A2XA 2JTZA 2LHLA 3KPXA 1RTP1 2LNKA 1CMGA 4YGAA 1AUIB 3PM8A 1XFVO 2KDHA 5AFPA 1NUBA 1QLSA 1G33A 3FWBA 3MSEB 2K8MB 1SY9A 1KSMA 1GQMA 1AVSA 2JT0A 2WC8A 3FIAA 2NCPA 3LK0A 1WRKA 5DKRA 4FQOA 2LMTA 1CMFA 1OOJA 4I5JA 2M8UA 1BG1A 1LKJA 1XK4C 4ETOA 1IJ6A 1PRWA 5HLOA 2L50A 2HETA 1S6CA 2M1UA 1OZSA 1QIWA 1B4CA 1U5IA 1ZMZA 1DJGA 4MZJA 1CTRA 4N5XA 5TNCA 4D1EA 1PSRA 5DKQA 3M0WA 1TCOB 1MWNA 1B7TY 2NCOA 3PLFB 1K8UA 1QLKA 2M29A 3I5IC 1PVBA 4NDDA 1DGVA 4PHKA 1MF8B 1BF5A 1H4BA 2HQ8A 2KOTA 1L7ZA 3BQ3A 3DVMA 1FW4A 2FOTA 1ZFSA 2OS8C 4WQ3A 1YX7A 1AK8A 3RM1A 5B8IB 1WY9A 2JC2A 5F6TA 1F4QA 1YUSA 2JOJA 1K9PA 1CFDA 4PHJA 1S5GY 2MJWB 1KCYA 1LA3A 1PALA 3CR5X 1UHNA 3OP0A 3EVRA 1QASA 2F3ZA 1FF1A 1KK7Z 1DT7B 1KK8C 2LUXA 1A4PA 1YR5A 4CFQA 1IGVA 2JT3A 4R1EA 4JQ0D 1DJZA 1EL4A 1C7VA 2P6BB 1DJXA 2EC6B 1B8LA 1IH0A 1SCMB 1QVIY 3ZNIA 1TNQA 1XFWO 4PHMA 4HREE 1MXLC 1ZACA 4XYNA 4PHNA 1XFXO 3EVVA 1AHRA 2BBMA 1NP8A 1CDNA 1TN4A 1RECA 2LE9B 1CDPA 2Q4UA 3VRRA 3SIAA 2LLTA 2FCDA 2HQWA 2LP2A 4ORBB 1M31A 1ZUZA 1OSAA 2GV5A 2JU0A 1NCXA 1QX2A 4P2YB 1KFUL 2ZKMX 2KI4C 3GK2A 5BPJA 2BE4A 2LM5A 1JSAA 2VRGA 1CFPA 2M49B 4QJ5B 2V53A 1SR6B 1WLZA 1JBAA 3VRNA 3JVTC 4PCWA 2K0JA 5GQQC 2BKIB 2KGRA 1YUUA 1S26D 3HX4A 5K89A 2K7OA 1WRZA 3AAKA 1DJHA 3LLEA 1IG5A 3EVUA 1EXRA 1HT9A 2LCPA 2M0RA 1YUTA 2KYCA 1HQVA 2WCFA 1Y1AA 1XO5A 1J1EA 2SASA 2KI6C 4PE4A 5I2OA 3AKBA 3OB2B 2LVVA 2LP3A 4DIRA 1F4OA 2K2FA 2LANA 1J7OA 1QV1A 1YX8A 1JUOA 4YBHB 1CLLA 3I5IB 4OKHA 5CPVA 5CSNA 1K2HA 2A4JA 2KI6D 4DRWA 2EGDA 2F2PA 2KAVA 1LXFC 4U8DA 3WXAA 4P5OE 3KO0A 1JC2A 2WNDA 1KQVA 1CDLA 2OS8B 4AQJA 1DJIA 4I5NB 1B47A 5D69A 4A4CA 2IS9A 2K7DA 2M9GA 3WNXB 4YI8A 1LA0A 1NX1A 1TNPA 2KYFA 1DJYA 2BL0C 1ALVA 2D8NA 3CZTX 3SJSA 2L4HA 5CSJA 1UHHA 1IKUA 2JNFA 1XK4A 3HCMA 4XJKA 2E6WA 1KK8B 1Q80A 4GGFC 2LAPA 4QJ3B 1B8CA 2K61A 2H2KA 3TDZA 1M63B 1ODBA 1Y6WA 1NSHA 4YGDB 1G4YR 3F45A 3JTDC 1SL9A 1AP4A 1UUSA 2LLSA 1NPQA 4NDBA 3TUYC 1DMOA 1OMDA 1N2DA 1UHIA 2JZIA 2M3WA 1BU3A 3I5HC 4MLWA 1SYMA 2G2BA 1JF0A 1UP5A 3BUXB 3O4YA 3TS5C 3I5GC 2JXCA 5HKZA 1WDCC 1N65A 2LMVA 4DUQA 2KNEA 2MRDA 5J3XA 2OTGC 2GGZA 4JPZB 3PATA 1RFJA 3EK4A 4GPLB 2F2OA 5FYXA 1SCVA 2PVBA 3BUMB 1IQ5A 1FI6A 1DVIA 2CTNA 3NSLA 5ER5A 2KI4B 4JWQA 5G08A 1S1EA 3A4UB 1B9AA 5AERA 5IBWA 1BJFA 3SG5A 3VROA 3VRQA 5JJGA 1SNLA 2CCMA 3DVEA 5CSFA 1CLBA 3CWGA 4YGBB 1PVAA 2MAZA 1S6JA 1CFFA 2CXJA 1KFUS 3SG3A 4NQGA 1NX3A 2QPTA 4WQ2A 1QIVA 4UPGA 1YURA 2MHHA 1RWYA 2KBIA 3SG6A 1K95A 4BY4A 1EH2A 3FS7A 4PE7A 5AXIA 1YRTB 2JQ6A 2AMIA 2SCPA 1SK6D 1FI5A 1YRUB 3ZWHA 2LMUA 4MN0A 2WOSA 2LHIA 4CLNA 2CT9A 1QJTA 4N1FA 2R2IA 2CNPA 3CTNA 2NZ0A 1DF0A 1S36A 1TTXA 3BUWB 3IQOA 1AJ4A 3CR4X 2Q91A 4WRIA 2ZN8A 2FCEA 2KSPA 2FJUB 1XA5A 4HRHA 1OMVA 2KFGA 2BBNA 2O5GA 3TDIA 1ALWA 1R2UA 2KHNA 4TNCA 4A4BA 4YRUA 1H8BA 1F71A 2I18A 2L51A 2BECA 2KFHA 3PFVA 3WHUB 1QTXA 3SG4A 2BL0B 1QX7A 3CGAA 1KK7Y 1GGZA 1PK0D 1KSOA 2JTTA 3ICBA 3O78A 3O6BA 5D7FA 1NIWA 5I8NA 1KFXS 2M7LA 5KTYA 3EK8A 2MBXA 1QV0A 4PE1A 4XJKB 3QRXA 4DS7A 2PSRA 1W7JB 4ZCUA 4ZCVA 1RJVA 2ISDA 4AQIA 4F0ZB 1BODA 2KAXA 2WCEA 4ORAB 1XYDA 2LVJA 5JOLA 1A29A 1TCFA 1SW8A 3A8RA 1A75A 3DF0A 3JTDB 1J7QA 2F33A 1QXPA 1BOCA 1UHJA 1DGUA 1JFKA 2BCXA 2LVIA 1RROA 2ZRTA 4GGNA 3TUYB 3AKAA 3TDUA 2L98A 4L9MA 1V1FA 3RLZA 4MBEA 3I5HB 1GJYA 3OHMB 1CDMA 2Y4QA 1F54A 1BR1B 3TS5B 2L2EA 1IQ3A 1SCMC 1NX2A 3I5GB 2AUCA 2KQYA 1AJ5A 1WDCB 2JT8A 1KFXL 4M2OA 2OTGB 3CR2A 2JWWA 1XVJA 1FPWA 1S3PA 3IF7A 1B7TZ 1CFCA 1D1OA 3I5FC 2L0PA 1K93D 2M7NA 3KHEA 4PE0A 2B1UA 2O60A 5ER4X 1F8HA 2H61A 1XFZO 4M2QA 1QATA 2H61C 1QX5B 2QACA 3SIBA 4GGFA 4USLA 1MHOA 2ZNEA 1CLMA 1MUXA 2BCBA 2LV7A 2NLNA 5I2QA 1L2OC 2LUCA 2CBLA 2K2AA 1BMOA 3K21A 1X02A 2LVKA 1MQ1A 1NCYA 2ZRSA 1K9KA 1S5GZ 2AAOA 3E3RA 1B1GA 2BE6A 1F70A 1SMGA 1OE9B 2JXLA 3EKJA 3LCPC 1C7WA 1SR6C 1KQMC 1ZOTB 3H4SE 1SBJA 1N0YA 1OZOA 4MZLA 2MLEC 2OPOA 1KWOC 4HSZA 1YTZC 2Y5IA 1YVLA 1OMRA 1LVCD 2MA2A 1QVIZ 1EJ3A 1Y0VH 2MLFC 3PN7C 1V1GA 4MRYA 1M45A 1M46A 1CM1A 2L4IA 3OX5A 1DF0B 4MSPA 3GK4X 1SPYA 4IL1A 4GNKB 4ORCB 3SG2A 2K7BA 1TIZA 3KF9A 2I94A 4GFTA 1XFYO 2PRUA 3LL8B 2PMYA 3NSIA 4GAOA 1CKKA 2TN4A 1JFJA 3GOFA 4OVNF 4C0JA 3BYAA 1DJWA 2LC5A 4AOMA 1J1DA 5AEQA 1C07A 1J7PA 1IRJA 1UWOA 3NSKA 1EG4A 1JF2A 3JVTB 4M2PA 1RK9A 3NSOA 1W7IB 1K90D 3SG7A 2JULA 1NWDA 2LLUA 2M97A 4Q04A 1NYAA 2PALA 2BKHB 2F3YA 1OQPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FBV A;  2JPT A;  2ZN9 A;  3PSR A;  4YGE B;  3GK1 A;  2KGB C;  2WCB A;  1K9U A;  2BCA A;  2Y1M A;  1DTL A;  4YGC B;  3LK1 A;  2ZND A;  3DF0 B;  1A75 B;  1SRA A;  1NCZ A;  3D0Y B;  2F8P A;  2PAS A;  4MEW A;  2COL B;  2K7C A;  2KFF A;  4MRX A;  5KU1 A;  1TRF A;  3OX6 A;  1EG3 A;  1SL7 A;  5HKW A;  4DCK A;  1YVH A;  1K96 A;  2DOQ A;  4GUK A;  1TNW A;  5HYD A;  1GGW A;  4OV2 A;  5KSZ A;  4E68 A;  1PSB A;  2JNX A;  3BOW B;  1M39 A;  1J7R A;  3EKH A;  2RGI A;  1S6I A;  3DD4 A;  1A03 A;  1BLQ A;  1R6P A;  4MZK A;  2KAY A;  1CNP A;  3CS1 A;  4C0L A;  1VRK A;  3I5F B;  3VGO A;  1IJ5 A;  4BY5 A;  3C1V A;  4C0K A;  1MR8 A;  4CFR A;  1Y1U A;  2G9B A;  4MVF A;  1SKT A;  4I5K A;  4N1G A;  1MXE A;  4QJ4 B;  2I2R E;  3PAL A;  3D10 A;  1K94 A;  4OR9 B;  1L2O B;  2GGM A;  4HRG A;  2EHB A;  1B8R A;  4YI9 A;  3DVJ A;  1TNX A;  4CID A;  3AAJ A;  4FTG A;  3BXK A;  3DVK A;  1F55 A;  1LIN A;  1TOP A;  3NXA A;  4GBA A;  4PDZ A;  5I2L A;  3D0Y A;  1SL8 A;  4I5L B;  4NDC A;  3TZ1 A;  3BUN B;  2M1K B;  1KQM B;  5HKY A;  1IWQ A;  4ICB A;  1J55 A;  1UUR A;  2HF5 A;  3IQQ A;  5DKN A;  5HLV A;  2ZFD A;  2I7A A;  1JWD A;  3BOW A;  1KWO B;  2KBM A;  2EC6 C;  3BUO B;  1BR4 B;  2NXQ A;  1UHK A;  3EK7 A;  5CSI A;  1CM4 A;  5AAN A;  1BT6 A;  1QS7 A;  2WOR A;  4CPV A;  3PN7 B;  5PAL A;  1WRL A;  3O2P A;  1XFU O;  3KEV A;  1PUL A;  1U5I B;  1WLM A;  2HPS A;  1NX0 A;  2JRF A;  2L5X B;  1CB1 A;  1E8A A;  1G8I A;  3WHT B;  3VRP A;  2E30 A;  1Y1X A;  3OB1 B;  2KQ6 A;  2Y1N A;  4OCI A;  4PAL A;  3FWC A;  3CLN A;  1A2X A;  2JTZ A;  2LHL A;  3KPX A;  1RTP 1;  2LNK A;  1CMG A;  4YGA A;  1AUI B;  3PM8 A;  1XFV O;  2KDH A;  5AFP A;  1NUB A;  1QLS A;  1G33 A;  3FWB A;  3MSE B;  2K8M B;  1SY9 A;  1KSM A;  1GQM A;  1AVS A;  2JT0 A;  2WC8 A;  3FIA A;  2NCP A;  3LK0 A;  1WRK A;  5DKR A;  4FQO A;  2LMT A;  1CMF A;  1OOJ A;  4I5J A;  2M8U A;  1BG1 A;  1LKJ A;  1XK4 C;  4ETO A;  1IJ6 A;  1PRW A;  5HLO A;  2L50 A;  2HET A;  1S6C A;  2M1U A;  1OZS A;  1QIW A;  1B4C A;  1U5I A;  1ZMZ A;  1DJG A;  4MZJ A;  1CTR A;  4N5X A;  5TNC A;  4D1E A;  1PSR A;  5DKQ A;  3M0W A;  1TCO B;  1MWN A;  1B7T Y;  2NCO A;  3PLF B;  1K8U A;  1QLK A;  2M29 A;  3I5I C;  1PVB A;  4NDD A;  1DGV A;  4PHK A;  1MF8 B;  1BF5 A;  1H4B A;  2HQ8 A;  2KOT A;  1L7Z A;  3BQ3 A;  3DVM A;  1FW4 A;  2FOT A;  1ZFS A;  2OS8 C;  4WQ3 A;  1YX7 A;  1AK8 A;  3RM1 A;  5B8I B;  1WY9 A;  2JC2 A;  5F6T A;  1F4Q A;  1YUS A;  2JOJ A;  1K9P A;  1CFD A;  4PHJ A;  1S5G Y;  2MJW B;  1KCY A;  1LA3 A;  1PAL A;  3CR5 X;  1UHN A;  3OP0 A;  3EVR A;  1QAS A;  2F3Z A;  1FF1 A;  1KK7 Z;  1DT7 B;  1KK8 C;  2LUX A;  1A4P A;  1YR5 A;  4CFQ A;  1IGV A;  2JT3 A;  4R1E A;  4JQ0 D;  1DJZ A;  1EL4 A;  1C7V A;  2P6B B;  1DJX A;  2EC6 B;  1B8L A;  1IH0 A;  1SCM B;  1QVI Y;  3ZNI A;  1TNQ A;  1XFW O;  4PHM A;  4HRE E;  1MXL C;  1ZAC A;  4XYN A;  4PHN A;  1XFX O;  3EVV A;  1AHR A;  2BBM A;  1NP8 A;  1CDN A;  1TN4 A;  1REC A;  2LE9 B;  1CDP A;  2Q4U A;  3VRR A;  3SIA A;  2LLT A;  2FCD A;  2HQW A;  2LP2 A;  4ORB B;  1M31 A;  1ZUZ A;  1OSA A;  2GV5 A;  2JU0 A;  1NCX A;  1QX2 A;  4P2Y B;  1KFU L;  2ZKM X;  2KI4 C;  3GK2 A;  5BPJ A;  2BE4 A;  2LM5 A;  1JSA A;  2VRG A;  1CFP A;  2M49 B;  4QJ5 B;  2V53 A;  1SR6 B;  1WLZ A;  1JBA A;  3VRN A;  3JVT C;  4PCW A;  2K0J A;  5GQQ C;  2BKI B;  2KGR A;  1YUU A;  1S26 D;  3HX4 A;  5K89 A;  2K7O A;  1WRZ A;  3AAK A;  1DJH A;  3LLE A;  1IG5 A;  3EVU A;  1EXR A;  1HT9 A;  2LCP A;  2M0R A;  1YUT A;  2KYC A;  1HQV A;  2WCF A;  1Y1A A;  1XO5 A;  1J1E A;  2SAS A;  2KI6 C;  4PE4 A;  5I2O A;  3AKB A;  3OB2 B;  2LVV A;  2LP3 A;  4DIR A;  1F4O A;  2K2F A;  2LAN A;  1J7O A;  1QV1 A;  1YX8 A;  1JUO A;  4YBH B;  1CLL A;  3I5I B;  4OKH A;  5CPV A;  5CSN A;  1K2H A;  2A4J A;  2KI6 D;  4DRW A;  2EGD A;  2F2P A;  2KAV A;  1LXF C;  4U8D A;  3WXA A;  4P5O E;  3KO0 A;  1JC2 A;  2WND A;  1KQV A;  1CDL A;  2OS8 B;  4AQJ A;  1DJI A;  4I5N B;  1B47 A;  5D69 A;  4A4C A;  2IS9 A;  2K7D A;  2M9G A;  3WNX B;  4YI8 A;  1LA0 A;  1NX1 A;  1TNP A;  2KYF A;  1DJY A;  2BL0 C;  1ALV A;  2D8N A;  3CZT X;  3SJS A;  2L4H A;  5CSJ A;  1UHH A;  1IKU A;  2JNF A;  1XK4 A;  3HCM A;  4XJK A;  2E6W A;  1KK8 B;  1Q80 A;  4GGF C;  2LAP A;  4QJ3 B;  1B8C A;  2K61 A;  2H2K A;  3TDZ A;  1M63 B;  1ODB A;  1Y6W A;  1NSH A;  4YGD B;  1G4Y R;  3F45 A;  3JTD C;  1SL9 A;  1AP4 A;  1UUS A;  2LLS A;  1NPQ A;  4NDB A;  3TUY C;  1DMO A;  1OMD A;  1N2D A;  1UHI A;  2JZI A;  2M3W A;  1BU3 A;  3I5H C;  4MLW A;  1SYM A;  2G2B A;  1JF0 A;  1UP5 A;  3BUX B;  3O4Y A;  3TS5 C;  3I5G C;  2JXC A;  5HKZ A;  1WDC C;  1N65 A;  2LMV A;  4DUQ A;  2KNE A;  2MRD A;  5J3X A;  2OTG C;  2GGZ A;  4JPZ B;  3PAT A;  1RFJ A;  3EK4 A;  4GPL B;  2F2O A;  5FYX A;  1SCV A;  2PVB A;  3BUM B;  1IQ5 A;  1FI6 A;  1DVI A;  2CTN A;  3NSL A;  5ER5 A;  2KI4 B;  4JWQ A;  5G08 A;  1S1E A;  3A4U B;  1B9A A;  5AER A;  5IBW A;  1BJF A;  3SG5 A;  3VRO A;  3VRQ A;  5JJG A;  1SNL A;  2CCM A;  3DVE A;  5CSF A;  1CLB A;  3CWG A;  4YGB B;  1PVA A;  2MAZ A;  1S6J A;  1CFF A;  2CXJ A;  1KFU S;  3SG3 A;  4NQG A;  1NX3 A;  2QPT A;  4WQ2 A;  1QIV A;  4UPG A;  1YUR A;  2MHH A;  1RWY A;  2KBI A;  3SG6 A;  1K95 A;  4BY4 A;  1EH2 A;  3FS7 A;  4PE7 A;  5AXI A;  1YRT B;  2JQ6 A;  2AMI A;  2SCP A;  1SK6 D;  1FI5 A;  1YRU B;  3ZWH A;  2LMU A;  4MN0 A;  2WOS A;  2LHI A;  4CLN A;  2CT9 A;  1QJT A;  4N1F A;  2R2I A;  2CNP A;  3CTN A;  2NZ0 A;  1DF0 A;  1S36 A;  1TTX A;  3BUW B;  3IQO A;  1AJ4 A;  3CR4 X;  2Q91 A;  4WRI A;  2ZN8 A;  2FCE A;  2KSP A;  2FJU B;  1XA5 A;  4HRH A;  1OMV A;  2KFG A;  2BBN A;  2O5G A;  3TDI A;  1ALW A;  1R2U A;  2KHN A;  4TNC A;  4A4B A;  4YRU A;  1H8B A;  1F71 A;  2I18 A;  2L51 A;  2BEC A;  2KFH A;  3PFV A;  3WHU B;  1QTX A;  3SG4 A;  2BL0 B;  1QX7 A;  3CGA A;  1KK7 Y;  1GGZ A;  1PK0 D;  1KSO A;  2JTT A;  3ICB A;  3O78 A;  3O6B A;  5D7F A;  1NIW A;  5I8N A;  1KFX S;  2M7L A;  5KTY A;  3EK8 A;  2MBX A;  1QV0 A;  4PE1 A;  4XJK B;  3QRX A;  4DS7 A;  2PSR A;  1W7J B;  4ZCU A;  4ZCV A;  1RJV A;  2ISD A;  4AQI A;  4F0Z B;  1BOD A;  2KAX A;  2WCE A;  4ORA B;  1XYD A;  2LVJ A;  5JOL A;  1A29 A;  1TCF A;  1SW8 A;  3A8R A;  1A75 A;  3DF0 A;  3JTD B;  1J7Q A;  2F33 A;  1QXP A;  1BOC A;  1UHJ A;  1DGU A;  1JFK A;  2BCX A;  2LVI A;  1RRO A;  2ZRT A;  4GGN A;  3TUY B;  3AKA A;  3TDU A;  2L98 A;  4L9M A;  1V1F A;  3RLZ A;  4MBE A;  3I5H B;  1GJY A;  3OHM B;  1CDM A;  2Y4Q A;  1F54 A;  1BR1 B;  3TS5 B;  2L2E A;  1IQ3 A;  1SCM C;  1NX2 A;  3I5G B;  2AUC A;  2KQY A;  1AJ5 A;  1WDC B;  2JT8 A;  1KFX L;  4M2O A;  2OTG B;  3CR2 A;  2JWW A;  1XVJ A;  1FPW A;  1S3P A;  3IF7 A;  1B7T Z;  1CFC A;  1D1O A;  3I5F C;  2L0P A;  1K93 D;  2M7N A;  3KHE A;  4PE0 A;  2B1U A;  2O60 A;  5ER4 X;  1F8H A;  2H61 A;  1XFZ O;  4M2Q A;  1QAT A;  2H61 C;  1QX5 B;  2QAC A;  3SIB A;  4GGF A;  4USL A;  1MHO A;  2ZNE A;  1CLM A;  1MUX A;  2BCB A;  2LV7 A;  2NLN A;  5I2Q A;  1L2O C;  2LUC A;  2CBL A;  2K2A A;  1BMO A;  3K21 A;  1X02 A;  2LVK A;  1MQ1 A;  1NCY A;  2ZRS A;  1K9K A;  1S5G Z;  2AAO A;  3E3R A;  1B1G A;  2BE6 A;  1F70 A;  1SMG A;  1OE9 B;  2JXL A;  3EKJ A;  3LCP C;  1C7W A;  1SR6 C;  1KQM C;  1ZOT B;  3H4S E;  1SBJ A;  1N0Y A;  1OZO A;  4MZL A;  2MLE C;  2OPO A;  1KWO C;  4HSZ A;  1YTZ C;  2Y5I A;  1YVL A;  1OMR A;  1LVC D;  2MA2 A;  1QVI Z;  1EJ3 A;  1Y0V H;  2MLF C;  3PN7 C;  1V1G A;  4MRY A;  1M45 A;  1M46 A;  1CM1 A;  2L4I A;  3OX5 A;  1DF0 B;  4MSP A;  3GK4 X;  1SPY A;  4IL1 A;  4GNK B;  4ORC B;  3SG2 A;  2K7B A;  1TIZ A;  3KF9 A;  2I94 A;  4GFT A;  1XFY O;  2PRU A;  3LL8 B;  2PMY A;  3NSI A;  4GAO A;  1CKK A;  2TN4 A;  1JFJ A;  3GOF A;  4OVN F;  4C0J A;  3BYA A;  1DJW A;  2LC5 A;  4AOM A;  1J1D A;  5AEQ A;  1C07 A;  1J7P A;  1IRJ A;  1UWO A;  3NSK A;  1EG4 A;  1JF2 A;  3JVT B;  4M2P A;  1RK9 A;  3NSO A;  1W7I B;  1K90 D;  3SG7 A;  2JUL A;  1NWD A;  2LLU A;  2M97 A;  4Q04 A;  1NYA A;  2PAL A;  2BKH B;  2F3Y A;  1OQP A; 
#chains in the Genus database with same CATH topology
 1FBV A;  2JPT A;  2ZN9 A;  3PSR A;  4YGE B;  3GK1 A;  2KGB C;  2WCB A;  1K9U A;  2BCA A;  2Y1M A;  1DTL A;  2YGU A;  4YGC B;  3LK1 A;  2ZND A;  3DF0 B;  1A75 B;  1SRA A;  3FE9 A;  1NCZ A;  3D0Y B;  2F8P A;  2PAS A;  3Q8I A;  2COL B;  2K7C A;  2KFF A;  4MEW A;  4MRX A;  5KU1 A;  1TRF A;  3OX6 A;  1EG3 A;  1SL7 A;  5HKW A;  4DCK A;  1YVH A;  1K96 A;  2DOQ A;  4GUK A;  1TNW A;  5FI2 A;  5HYD A;  1GGW A;  4OV2 A;  5KSZ A;  4E68 A;  3D74 A;  1PSB A;  2JNX A;  2WCH A;  1OOH A;  3BOW B;  1M39 A;  1J7R A;  3EKH A;  2RGI A;  1S6I A;  3DD4 A;  1A03 A;  1BLQ A;  1R6P A;  4MZK A;  2KAY A;  1CNP A;  3CS1 A;  1SSE B;  4C0L A;  1VRK A;  3I5F B;  3R1O A;  1IJ5 A;  3VGO A;  3C1V A;  4BY5 A;  4C0K A;  1MR8 A;  3OBV A;  4CFR A;  1Y1U A;  2G9B A;  4MVF A;  2KLE A;  1SKT A;  4I5K A;  4N1G A;  1MXE A;  4IJ7 A;  4QJ4 B;  2I2R E;  3PAL A;  3D10 A;  1K94 A;  4OR9 B;  1L2O B;  2GGM A;  4HRG A;  2EHB A;  1B8R A;  4YI9 A;  3DVJ A;  2PYQ A;  1TNX A;  4CID A;  3AAJ A;  4FTG A;  3BXK A;  1OOF A;  3DVK A;  1F55 A;  1LIN A;  1TOP A;  3NXA A;  4GBA A;  4PDZ A;  5I2L A;  2WC5 A;  3D0Y A;  3S0E A;  1SL8 A;  4I5L B;  4NDC A;  3TZ1 A;  3BUN B;  2M1K B;  1KQM B;  5HKY A;  1IWQ A;  3K1E A;  1J55 A;  1UUR A;  2HF5 A;  3IQQ A;  4ICB A;  5DKN A;  5EL2 A;  5HLV A;  2ZFD A;  2I7A A;  1JWD A;  3BOW A;  1KWO B;  2KBM A;  2EC6 C;  3BUO B;  2WCL A;  1BR4 B;  2NXQ A;  3BFH A;  1UHK A;  3EK7 A;  5CSI A;  1CM4 A;  5AAN A;  1BT6 A;  1QS7 A;  2WOR A;  4CPV A;  3S0A A;  3PN7 B;  5PAL A;  1WRL A;  2K60 A;  3O2P A;  1XFU O;  3KEV A;  1PUL A;  3S0G A;  3BJH A;  1U5I B;  1WLM A;  2HPS A;  1NX0 A;  2JRF A;  2L5X B;  1CB1 A;  1E8A A;  1G8I A;  3WHT B;  3VB1 A;  3VRP A;  2E30 A;  1Y1X A;  3OB1 B;  2JPO A;  2KQ6 A;  2Y1N A;  4OCI A;  1OW4 A;  2BAP A;  4PAL A;  3FWC A;  3CLN A;  1Z2C B;  3IVT A;  1A2X A;  2JTZ A;  2LHL A;  3DYE A;  3KPX A;  1RTP 1;  3V2L A;  2LNK A;  1CMG A;  4YGA A;  1AUI B;  3DXL A;  3FE6 A;  3PM8 A;  1XFV O;  2KDH A;  5AFP A;  1NUB A;  1QLS A;  2FJY A;  1G33 A;  3FWB A;  3MSE B;  4JKT A;  2K8M B;  1DEL A;  3D75 A;  1SY9 A;  1KSM A;  1GQM A;  1AVS A;  2JT0 A;  2WC8 A;  3FIA A;  2NCP A;  3LK0 A;  1TWO A;  1WRK A;  5DKR A;  4FQO A;  2LMT A;  1CMF A;  1OOJ A;  4I5J A;  2M8U A;  1BG1 A;  1LKJ A;  1XK4 C;  4ETO A;  1IJ6 A;  3PM2 A;  1PRW A;  2WC6 A;  5HLO A;  2L50 A;  2HET A;  1S6C A;  2M1U A;  1OZS A;  1QIW A;  1B4C A;  1U5I A;  1ZMZ A;  1DJG A;  4MZJ A;  1CTR A;  4N5X A;  5TNC A;  4D1E A;  1PSR A;  5DKQ A;  3M0W A;  1TCO B;  1MWN A;  3SS4 A;  1B7T Y;  2QEB A;  2NCO A;  3PLF B;  1K8U A;  1QLK A;  2M29 A;  3I5I C;  1PVB A;  3QME A;  4NDD A;  1DGV A;  4PHK A;  2GTE A;  1MF8 B;  1BF5 A;  1H4B A;  2HQ8 A;  2KOT A;  3NHT A;  1L7Z A;  3BQ3 A;  3DVM A;  1FW4 A;  2FOT A;  1ZFS A;  2OS8 C;  4WQ3 A;  1YX7 A;  3BFB A;  3RZS A;  1AK8 A;  3RM1 A;  3S0F A;  1C3Z A;  5B8I B;  1WY9 A;  1T14 A;  2JC2 A;  5F6T A;  1F4Q A;  3DZT A;  1YUS A;  2JOJ A;  1K9P A;  1CFD A;  3CZ0 A;  4PHJ A;  1S5G Y;  2MJW B;  1KCY A;  1LA3 A;  1PAL A;  3CR5 X;  1UHN A;  3OP0 A;  3EVR A;  1QAS A;  1W9Z A;  2F3Z A;  1FF1 A;  1KK7 Z;  1DT7 B;  1KK8 C;  2LUX A;  1A4P A;  2WCK A;  1YR5 A;  4CFQ A;  1IGV A;  2JT3 A;  1DC1 A;  1DEK A;  4R1E A;  4JQ0 D;  1DJZ A;  3SS5 A;  1EL4 A;  1C7V A;  4FQT A;  2P6B B;  1DJX A;  2EC6 B;  1B8L A;  1IH0 A;  1SCM B;  1QVI Y;  3ZNI A;  1TNQ A;  1XFW O;  4PHM A;  4HRE E;  1MXL C;  1ZAC A;  4XYN A;  4PHN A;  1XFX O;  3B86 A;  3EVV A;  1AHR A;  2BBM A;  1NP8 A;  1CDN A;  1TN4 A;  1REC A;  2LE9 B;  1CDP A;  2Q4U A;  3VRR A;  3SIA A;  2LLT A;  2FCD A;  2HQW A;  2LP2 A;  1C3Y A;  4ORB B;  1M31 A;  1ZUZ A;  1OSA A;  2GV5 A;  2JU0 A;  1NCX A;  1QX2 A;  4P2Y B;  4PT1 A;  1IIO A;  1KFU L;  2ZKM X;  2KI4 C;  3GK2 A;  5BPJ A;  2BE4 A;  2LM5 A;  1JSA A;  2VRG A;  1CFP A;  2M49 B;  4QJ5 B;  2V53 A;  1SR6 B;  1WLZ A;  1JBA A;  3VRN A;  3JVT C;  4PCW A;  2K0J A;  5GQQ C;  2BKI B;  2KGR A;  1YUU A;  1S26 D;  3HX4 A;  5I94 A;  5K89 A;  2H8V A;  2K7O A;  1WRZ A;  2QEO A;  3AAK A;  1DJH A;  3LLE A;  2ERB A;  1IG5 A;  3EVU A;  1EXR A;  1HT9 A;  2LCP A;  2M0R A;  3CZ1 A;  1YUT A;  2KYC A;  1HQV A;  2WCF A;  1TUZ A;  1Y1A A;  1XO5 A;  1J1E A;  2SAS A;  2KI6 C;  4PE4 A;  5I2O A;  3AKB A;  3OB2 B;  2LVV A;  2LP3 A;  4DIR A;  1F4O A;  2K2F A;  2LAN A;  3DY9 A;  1QV1 A;  1J7O A;  1YX8 A;  1JUO A;  4YBH B;  1CLL A;  3I5I B;  4OKH A;  5CPV A;  5CSN A;  1K2H A;  2A4J A;  2KI6 D;  2L2C A;  2EGD A;  2F2P A;  2KAV A;  2QDI A;  1LXF C;  4U8D A;  3WXA A;  4DRW A;  4P5O E;  3KO0 A;  1JC2 A;  2QEV A;  2WND A;  1KQV A;  1CDL A;  2OS8 B;  4AQJ A;  1DJI A;  4I5N B;  2P70 A;  3PJI A;  1B47 A;  5D69 A;  4A4C A;  2IS9 A;  2K7D A;  2M9G A;  3WNX B;  4YI8 A;  1LA0 A;  1NX1 A;  1TNP A;  2KYF A;  1DJY A;  2BL0 C;  3R1P A;  1ALV A;  2D8N A;  3CZT X;  3SJS A;  2L4H A;  4KYN A;  3CZ2 A;  5CSJ A;  1UHH A;  1IKU A;  2JNF A;  1XK4 A;  3B88 A;  3HCM A;  3BFA A;  4XJK A;  3O4X A;  2E6W A;  1KK8 B;  1Q80 A;  4GGF C;  2LAP A;  4QJ3 B;  1B8C A;  2K61 A;  2H2K A;  3TDZ A;  1M63 B;  3D78 A;  1ODB A;  1Y6W A;  3D76 A;  4F7F A;  1NSH A;  4INW A;  4YGD B;  1G4Y R;  3F45 A;  3UO9 A;  3JTD C;  1SL9 A;  1AP4 A;  1UUS A;  2LLS A;  2WCJ A;  1NPQ A;  3D73 A;  4NDB A;  2KPH A;  3TUY C;  1DMO A;  1OMD A;  1N2D A;  1UHI A;  2JZI A;  2M3W A;  1BU3 A;  3I5H C;  4MLW A;  1SYM A;  3S0B A;  2G2B A;  1JF0 A;  1UP5 A;  3BUX B;  3O4Y A;  3TS5 C;  3I5G C;  2JXC A;  5HKZ A;  2BNX A;  1WDC C;  1N65 A;  2LMV A;  4DUQ A;  2KNE A;  2MRD A;  1OOI X;  5J3X A;  2OTG C;  3R72 A;  2GGZ A;  3UNW A;  4JPZ B;  1DQE A;  3PAT A;  1RFJ A;  3EK4 A;  1TUJ A;  4GPL B;  2F2O A;  5FYX A;  1SCV A;  2PVB A;  3BUM B;  5HL1 A;  1IQ5 A;  1FI6 A;  4INX A;  1DVI A;  2CTN A;  3NSL A;  5ER5 A;  2KI4 B;  4JWQ A;  5G08 A;  1S1E A;  3A4U B;  1B9A A;  5AER A;  5IBW A;  1BJF A;  3R1V A;  3SG5 A;  3VRO A;  3VRQ A;  5JJG A;  3S0D A;  1SNL A;  2CCM A;  3DVE A;  5CSF A;  1CLB A;  3CWG A;  4YGB B;  1PVA A;  2MAZ A;  1S6J A;  1CFF A;  2CXJ A;  1KFU S;  2KLD A;  3SG3 A;  4NQG A;  1NX3 A;  2QPT A;  4WQ2 A;  1QIV A;  4UPG A;  1YUR A;  1GM0 A;  2MHH A;  5FI6 A;  1RWY A;  2KBI A;  3SG6 A;  1K95 A;  1QWV A;  4BY4 A;  1EH2 A;  3FS7 A;  4PE7 A;  5AXI A;  1YRT B;  2JQ6 A;  2AMI A;  2SCP A;  1SK6 D;  1FI5 A;  1YRU B;  3ZWH A;  2LMU A;  4MN0 A;  2WOS A;  2LHI A;  4CLN A;  2CT9 A;  3B6X A;  1QJT A;  4N1F A;  2R2I A;  2CNP A;  3CTN A;  2NZ0 A;  1DF0 A;  1S36 A;  1TTX A;  3BUW B;  3IQO A;  1AJ4 A;  3CR4 X;  2Q91 A;  4WRI A;  2ZN8 A;  2FCE A;  2KSP A;  2FJU B;  1XA5 A;  4HRH A;  1OMV A;  2KFG A;  2BBN A;  2O5G A;  3TDI A;  1ALW A;  1R2U A;  2KHN A;  2QEH A;  4TNC A;  4A4B A;  4YRU A;  1H8B A;  1F71 A;  2I18 A;  2L51 A;  2BEC A;  2KFH A;  3PFV A;  3WHU B;  1QTX A;  3SG4 A;  2BL0 B;  1QX7 A;  3NGV A;  3CGA A;  1KK7 Y;  1GGZ A;  1PK0 D;  1KSO A;  2JTT A;  3ICB A;  3O78 A;  3O6B A;  5D7F A;  1NIW A;  1XFR A;  3SS3 A;  5I8N A;  1KFX S;  5DIC A;  2M7L A;  5KTY A;  3EK8 A;  1ORG A;  2MBX A;  1QV0 A;  4PE1 A;  4XJK B;  3QRX A;  4DS7 A;  2PSR A;  1W7J B;  4ZCU A;  4ZCV A;  1RJV A;  2ISD A;  4AQI A;  4F0Z B;  1BOD A;  2KAX A;  2WCE A;  4ORA B;  1XYD A;  2LVJ A;  5JOL A;  3NHI A;  1A29 A;  1TCF A;  1SW8 A;  3A8R A;  1A75 A;  3B87 A;  3CYZ A;  3DF0 A;  3JTD B;  1J7Q A;  2F33 A;  1QXP A;  1BOC A;  1UHJ A;  1DGU A;  1JFK A;  2BCX A;  2LVI A;  1RRO A;  3CAB A;  3EG5 B;  1OOG A;  2ZRT A;  4GGN A;  3TUY B;  3AKA A;  3TDU A;  2L98 A;  4L9M A;  1V1F A;  3B7A A;  3RLZ A;  4MBE A;  3I5H B;  1GJY A;  5FI7 A;  3OHM B;  1CDM A;  2Y4Q A;  1F54 A;  1BR1 B;  3TS5 B;  2L2E A;  1IQ3 A;  1SCM C;  1NX2 A;  3I5G B;  2AUC A;  2KQY A;  1AJ5 A;  1WDC B;  2JT8 A;  1KFX L;  3L47 A;  2OTG B;  4M2O A;  3CR2 A;  2JWW A;  1XVJ A;  1FPW A;  1S3P A;  3IF7 A;  1B7T Z;  1CFC A;  1D1O A;  3I5F C;  2L0P A;  1K93 D;  2M7N A;  3KHE A;  4PE0 A;  2L5Y A;  2B1U A;  2O60 A;  5ER4 X;  1F8H A;  2H61 A;  1XFZ O;  4M2Q A;  5D3O A;  1QAT A;  2H61 C;  1QX5 B;  2QAC A;  3SIB A;  4GGF A;  4USL A;  2P71 A;  1MHO A;  2PQL A;  2ZNE A;  1CLM A;  1MUX A;  2BCB A;  2LV7 A;  2NLN A;  4OZD A;  1L2O C;  5I2Q A;  2LUC A;  2CBL A;  2K2A A;  1BMO A;  3K21 A;  1X02 A;  2LVK A;  2WCM A;  1MQ1 A;  1NCY A;  2ZRS A;  1K9K A;  1S5G Z;  2AAO A;  3E3R A;  3D77 A;  1B1G A;  1Z4H A;  2BE6 A;  1F70 A;  1SMG A;  1OE9 B;  2JXL A;  3EKJ A;  3LCP C;  1C7W A;  1SR6 C;  3OGN A;  1KQM C;  1ZOT B;  3H4S E;  1SBJ A;  1N0Y A;  1OZO A;  4MZL A;  2MLE C;  2OPO A;  1KWO C;  4HSZ A;  1YTZ C;  2Y5I A;  1YVL A;  1OMR A;  1LVC D;  2MA2 A;  3L4L A;  1QVI Z;  1EJ3 A;  1Y0V H;  2MLF C;  3PN7 C;  1V1G A;  4JD9 A;  4MRY A;  1M45 A;  1M46 A;  1CM1 A;  2L4I A;  3OX5 A;  1DF0 B;  4MSP A;  1LS8 A;  3GK4 X;  1SPY A;  4IL1 A;  4GNK B;  4ORC B;  3SG2 A;  2K7B A;  1P28 A;  1TIZ A;  2I94 A;  3KF9 A;  1XFY O;  2PRU A;  3LL8 B;  2PMY A;  4GFT A;  3NSI A;  4GAO A;  1CKK A;  2TN4 A;  1JFJ A;  3GOF A;  4OVN F;  4C0J A;  3BYA A;  1DJW A;  2LC5 A;  4AOM A;  1J1D A;  5AEQ A;  3CDN A;  1C07 A;  1J7P A;  1IRJ A;  1UWO A;  3NSK A;  1EG4 A;  3N7H A;  1JF2 A;  3JVT B;  4M2P A;  3L4A A;  1RK9 A;  3FE8 A;  3NSO A;  1W7I B;  1K90 D;  3SG7 A;  2JUL A;  1NWD A;  2LLU A;  2M97 A;  4Q04 A;  1NYA A;  2PAL A;  2BKH B;  2F3Y A;  1OQP A; 
#chains in the Genus database with same CATH homology
 1FBV A;  2JPT A;  2ZN9 A;  3PSR A;  4YGE B;  3GK1 A;  2KGB C;  2WCB A;  1K9U A;  2BCA A;  2Y1M A;  1DTL A;  4YGC B;  3LK1 A;  2ZND A;  3DF0 B;  1A75 B;  1SRA A;  1NCZ A;  3D0Y B;  2F8P A;  2PAS A;  4MEW A;  2COL B;  2K7C A;  2KFF A;  4MRX A;  5KU1 A;  1TRF A;  3OX6 A;  1EG3 A;  1SL7 A;  5HKW A;  4DCK A;  1YVH A;  1K96 A;  2DOQ A;  4GUK A;  1TNW A;  5HYD A;  1GGW A;  4OV2 A;  5KSZ A;  4E68 A;  1PSB A;  2JNX A;  3BOW B;  1M39 A;  1J7R A;  3EKH A;  2RGI A;  1S6I A;  3DD4 A;  1A03 A;  1BLQ A;  1R6P A;  4MZK A;  2KAY A;  1CNP A;  3CS1 A;  4C0L A;  1VRK A;  3I5F B;  3VGO A;  1IJ5 A;  4BY5 A;  3C1V A;  4C0K A;  1MR8 A;  4CFR A;  1Y1U A;  2G9B A;  4MVF A;  1SKT A;  4I5K A;  4N1G A;  1MXE A;  4QJ4 B;  2I2R E;  3PAL A;  3D10 A;  1K94 A;  4OR9 B;  1L2O B;  2GGM A;  4HRG A;  2EHB A;  1B8R A;  4YI9 A;  3DVJ A;  1TNX A;  4CID A;  3AAJ A;  4FTG A;  3BXK A;  3DVK A;  1F55 A;  1LIN A;  1TOP A;  3NXA A;  4GBA A;  4PDZ A;  5I2L A;  3D0Y A;  1SL8 A;  4I5L B;  4NDC A;  3TZ1 A;  3BUN B;  2M1K B;  1KQM B;  5HKY A;  1IWQ A;  4ICB A;  1J55 A;  1UUR A;  2HF5 A;  3IQQ A;  5DKN A;  5HLV A;  2ZFD A;  2I7A A;  1JWD A;  3BOW A;  1KWO B;  2KBM A;  2EC6 C;  3BUO B;  1BR4 B;  2NXQ A;  1UHK A;  3EK7 A;  5CSI A;  1CM4 A;  5AAN A;  1BT6 A;  1QS7 A;  2WOR A;  4CPV A;  3PN7 B;  5PAL A;  1WRL A;  3O2P A;  1XFU O;  3KEV A;  1PUL A;  1U5I B;  1WLM A;  2HPS A;  1NX0 A;  2JRF A;  2L5X B;  1CB1 A;  1E8A A;  1G8I A;  3WHT B;  3VRP A;  2E30 A;  1Y1X A;  3OB1 B;  2KQ6 A;  2Y1N A;  4OCI A;  4PAL A;  3FWC A;  3CLN A;  1A2X A;  2JTZ A;  2LHL A;  3KPX A;  1RTP 1;  2LNK A;  1CMG A;  4YGA A;  1AUI B;  3PM8 A;  1XFV O;  2KDH A;  5AFP A;  1NUB A;  1QLS A;  1G33 A;  3FWB A;  3MSE B;  2K8M B;  1SY9 A;  1KSM A;  1GQM A;  1AVS A;  2JT0 A;  2WC8 A;  3FIA A;  2NCP A;  3LK0 A;  1WRK A;  5DKR A;  4FQO A;  2LMT A;  1CMF A;  1OOJ A;  4I5J A;  2M8U A;  1BG1 A;  1LKJ A;  1XK4 C;  4ETO A;  1IJ6 A;  1PRW A;  5HLO A;  2L50 A;  2HET A;  1S6C A;  2M1U A;  1OZS A;  1QIW A;  1B4C A;  1U5I A;  1ZMZ A;  1DJG A;  4MZJ A;  1CTR A;  4N5X A;  5TNC A;  4D1E A;  1PSR A;  5DKQ A;  3M0W A;  1TCO B;  1MWN A;  1B7T Y;  2NCO A;  3PLF B;  1K8U A;  1QLK A;  2M29 A;  3I5I C;  1PVB A;  4NDD A;  1DGV A;  4PHK A;  1MF8 B;  1BF5 A;  1H4B A;  2HQ8 A;  2KOT A;  1L7Z A;  3BQ3 A;  3DVM A;  1FW4 A;  2FOT A;  1ZFS A;  2OS8 C;  4WQ3 A;  1YX7 A;  1AK8 A;  3RM1 A;  5B8I B;  1WY9 A;  2JC2 A;  5F6T A;  1F4Q A;  1YUS A;  2JOJ A;  1K9P A;  1CFD A;  4PHJ A;  1S5G Y;  2MJW B;  1KCY A;  1LA3 A;  1PAL A;  3CR5 X;  1UHN A;  3OP0 A;  3EVR A;  1QAS A;  2F3Z A;  1FF1 A;  1KK7 Z;  1DT7 B;  1KK8 C;  2LUX A;  1A4P A;  1YR5 A;  4CFQ A;  1IGV A;  2JT3 A;  4R1E A;  4JQ0 D;  1DJZ A;  1EL4 A;  1C7V A;  2P6B B;  1DJX A;  2EC6 B;  1B8L A;  1IH0 A;  1SCM B;  1QVI Y;  3ZNI A;  1TNQ A;  1XFW O;  4PHM A;  4HRE E;  1MXL C;  1ZAC A;  4XYN A;  4PHN A;  1XFX O;  3EVV A;  1AHR A;  2BBM A;  1NP8 A;  1CDN A;  1TN4 A;  1REC A;  2LE9 B;  1CDP A;  2Q4U A;  3VRR A;  3SIA A;  2LLT A;  2FCD A;  2HQW A;  2LP2 A;  4ORB B;  1M31 A;  1ZUZ A;  1OSA A;  2GV5 A;  2JU0 A;  1NCX A;  1QX2 A;  4P2Y B;  1KFU L;  2ZKM X;  2KI4 C;  3GK2 A;  5BPJ A;  2BE4 A;  2LM5 A;  1JSA A;  2VRG A;  1CFP A;  2M49 B;  4QJ5 B;  2V53 A;  1SR6 B;  1WLZ A;  1JBA A;  3VRN A;  3JVT C;  4PCW A;  2K0J A;  5GQQ C;  2BKI B;  2KGR A;  1YUU A;  1S26 D;  3HX4 A;  5K89 A;  2K7O A;  1WRZ A;  3AAK A;  1DJH A;  3LLE A;  1IG5 A;  3EVU A;  1EXR A;  1HT9 A;  2LCP A;  2M0R A;  1YUT A;  2KYC A;  1HQV A;  2WCF A;  1Y1A A;  1XO5 A;  1J1E A;  2SAS A;  2KI6 C;  4PE4 A;  5I2O A;  3AKB A;  3OB2 B;  2LVV A;  2LP3 A;  4DIR A;  1F4O A;  2K2F A;  2LAN A;  1J7O A;  1QV1 A;  1YX8 A;  1JUO A;  4YBH B;  1CLL A;  3I5I B;  4OKH A;  5CPV A;  5CSN A;  1K2H A;  2A4J A;  2KI6 D;  4DRW A;  2EGD A;  2F2P A;  2KAV A;  1LXF C;  4U8D A;  3WXA A;  4P5O E;  3KO0 A;  1JC2 A;  2WND A;  1KQV A;  1CDL A;  2OS8 B;  4AQJ A;  1DJI A;  4I5N B;  1B47 A;  5D69 A;  4A4C A;  2IS9 A;  2K7D A;  2M9G A;  3WNX B;  4YI8 A;  1LA0 A;  1NX1 A;  1TNP A;  2KYF A;  1DJY A;  2BL0 C;  1ALV A;  2D8N A;  3CZT X;  3SJS A;  2L4H A;  5CSJ A;  1UHH A;  1IKU A;  2JNF A;  1XK4 A;  3HCM A;  4XJK A;  2E6W A;  1KK8 B;  1Q80 A;  4GGF C;  2LAP A;  4QJ3 B;  1B8C A;  2K61 A;  2H2K A;  3TDZ A;  1M63 B;  1ODB A;  1Y6W A;  1NSH A;  4YGD B;  1G4Y R;  3F45 A;  3JTD C;  1SL9 A;  1AP4 A;  1UUS A;  2LLS A;  1NPQ A;  4NDB A;  3TUY C;  1DMO A;  1OMD A;  1N2D A;  1UHI A;  2JZI A;  2M3W A;  1BU3 A;  3I5H C;  4MLW A;  1SYM A;  2G2B A;  1JF0 A;  1UP5 A;  3BUX B;  3O4Y A;  3TS5 C;  3I5G C;  2JXC A;  5HKZ A;  1WDC C;  1N65 A;  2LMV A;  4DUQ A;  2KNE A;  2MRD A;  5J3X A;  2OTG C;  2GGZ A;  4JPZ B;  3PAT A;  1RFJ A;  3EK4 A;  4GPL B;  2F2O A;  5FYX A;  1SCV A;  2PVB A;  3BUM B;  1IQ5 A;  1FI6 A;  1DVI A;  2CTN A;  3NSL A;  5ER5 A;  2KI4 B;  4JWQ A;  5G08 A;  1S1E A;  3A4U B;  1B9A A;  5AER A;  5IBW A;  1BJF A;  3SG5 A;  3VRO A;  3VRQ A;  5JJG A;  1SNL A;  2CCM A;  3DVE A;  5CSF A;  1CLB A;  3CWG A;  4YGB B;  1PVA A;  2MAZ A;  1S6J A;  1CFF A;  2CXJ A;  1KFU S;  3SG3 A;  4NQG A;  1NX3 A;  2QPT A;  4WQ2 A;  1QIV A;  4UPG A;  1YUR A;  2MHH A;  1RWY A;  2KBI A;  3SG6 A;  1K95 A;  4BY4 A;  1EH2 A;  3FS7 A;  4PE7 A;  5AXI A;  1YRT B;  2JQ6 A;  2AMI A;  2SCP A;  1SK6 D;  1FI5 A;  1YRU B;  3ZWH A;  2LMU A;  4MN0 A;  2WOS A;  2LHI A;  4CLN A;  2CT9 A;  1QJT A;  4N1F A;  2R2I A;  2CNP A;  3CTN A;  2NZ0 A;  1DF0 A;  1S36 A;  1TTX A;  3BUW B;  3IQO A;  1AJ4 A;  3CR4 X;  2Q91 A;  4WRI A;  2ZN8 A;  2FCE A;  2KSP A;  2FJU B;  1XA5 A;  4HRH A;  1OMV A;  2KFG A;  2BBN A;  2O5G A;  3TDI A;  1ALW A;  1R2U A;  2KHN A;  4TNC A;  4A4B A;  4YRU A;  1H8B A;  1F71 A;  2I18 A;  2L51 A;  2BEC A;  2KFH A;  3PFV A;  3WHU B;  1QTX A;  3SG4 A;  2BL0 B;  1QX7 A;  3CGA A;  1KK7 Y;  1GGZ A;  1PK0 D;  1KSO A;  2JTT A;  3ICB A;  3O78 A;  3O6B A;  5D7F A;  1NIW A;  5I8N A;  1KFX S;  2M7L A;  5KTY A;  3EK8 A;  2MBX A;  1QV0 A;  4PE1 A;  4XJK B;  3QRX A;  4DS7 A;  2PSR A;  1W7J B;  4ZCU A;  4ZCV A;  1RJV A;  2ISD A;  4AQI A;  4F0Z B;  1BOD A;  2KAX A;  2WCE A;  4ORA B;  1XYD A;  2LVJ A;  5JOL A;  1A29 A;  1TCF A;  1SW8 A;  3A8R A;  1A75 A;  3DF0 A;  3JTD B;  1J7Q A;  2F33 A;  1QXP A;  1BOC A;  1UHJ A;  1DGU A;  1JFK A;  2BCX A;  2LVI A;  1RRO A;  2ZRT A;  4GGN A;  3TUY B;  3AKA A;  3TDU A;  2L98 A;  4L9M A;  1V1F A;  3RLZ A;  4MBE A;  3I5H B;  1GJY A;  3OHM B;  1CDM A;  2Y4Q A;  1F54 A;  1BR1 B;  3TS5 B;  2L2E A;  1IQ3 A;  1SCM C;  1NX2 A;  3I5G B;  2AUC A;  2KQY A;  1AJ5 A;  1WDC B;  2JT8 A;  1KFX L;  4M2O A;  2OTG B;  3CR2 A;  2JWW A;  1XVJ A;  1FPW A;  1S3P A;  3IF7 A;  1B7T Z;  1CFC A;  1D1O A;  3I5F C;  2L0P A;  1K93 D;  2M7N A;  3KHE A;  4PE0 A;  2B1U A;  2O60 A;  5ER4 X;  1F8H A;  2H61 A;  1XFZ O;  4M2Q A;  1QAT A;  2H61 C;  1QX5 B;  2QAC A;  3SIB A;  4GGF A;  4USL A;  1MHO A;  2ZNE A;  1CLM A;  1MUX A;  2BCB A;  2LV7 A;  2NLN A;  5I2Q A;  1L2O C;  2LUC A;  2CBL A;  2K2A A;  1BMO A;  3K21 A;  1X02 A;  2LVK A;  1MQ1 A;  1NCY A;  2ZRS A;  1K9K A;  1S5G Z;  2AAO A;  3E3R A;  1B1G A;  2BE6 A;  1F70 A;  1SMG A;  1OE9 B;  2JXL A;  3EKJ A;  3LCP C;  1C7W A;  1SR6 C;  1KQM C;  1ZOT B;  3H4S E;  1SBJ A;  1N0Y A;  1OZO A;  4MZL A;  2MLE C;  2OPO A;  1KWO C;  4HSZ A;  1YTZ C;  2Y5I A;  1YVL A;  1OMR A;  1LVC D;  2MA2 A;  1QVI Z;  1EJ3 A;  1Y0V H;  2MLF C;  3PN7 C;  1V1G A;  4MRY A;  1M45 A;  1M46 A;  1CM1 A;  2L4I A;  3OX5 A;  1DF0 B;  4MSP A;  3GK4 X;  1SPY A;  4IL1 A;  4GNK B;  4ORC B;  3SG2 A;  2K7B A;  1TIZ A;  3KF9 A;  2I94 A;  4GFT A;  1XFY O;  2PRU A;  3LL8 B;  2PMY A;  3NSI A;  4GAO A;  1CKK A;  2TN4 A;  1JFJ A;  3GOF A;  4OVN F;  4C0J A;  3BYA A;  1DJW A;  2LC5 A;  4AOM A;  1J1D A;  5AEQ A;  1C07 A;  1J7P A;  1IRJ A;  1UWO A;  3NSK A;  1EG4 A;  1JF2 A;  3JVT B;  4M2P A;  1RK9 A;  3NSO A;  1W7I B;  1K90 D;  3SG7 A;  2JUL A;  1NWD A;  2LLU A;  2M97 A;  4Q04 A;  1NYA A;  2PAL A;  2BKH B;  2F3Y A;  1OQP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...