1S5GY

Structure of scallop myosin s1 reveals a novel nucleotide conformation
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
142
structure length
142
Chain Sequence
PQKQIQEMKEAFSMIDVDRDGFVSKEDIKAISEQLGRAPDDKELTAMLKEAPGPLNFTMFLSIFSDKLSGTDSEETIRNAFAMFDEQETKKLNIEYIKDLLENMGDNFNKDEMRMTFKEAPVEGGKFDYVKFTAMIKGSGEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Myosin subfragment 1 structures reveal a partially bound nucleotide and a complex salt bridge that helps couple nucleotide and actin binding.
pubmed doi rcsb
molecule tags Contractile protein
molecule keywords Myosin heavy chain, striated muscle
total genus 26
structure length 142
sequence length 142
ec nomenclature
pdb deposition date 2004-01-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Y PF13405 EF-hand_6 EF-hand domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1s5gY01
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1s5gY02
1KK7Z 2F33A 3KEVA 3DVKA 1XFVO 5KU1A 1SL9A 3RLZA 2MJWB 2PRUA 2L51A 4R1EA 3CTNA 3ZWHA 4CIDA 1A03A 1S6CA 2JC2A 1JBAA 1XFYO 1S6JA 1B1GA 1LXFC 1Y1AA 2K2AA 2FCDA 2MAZA 2WCEA 2K7BA 2M3WA 1YX7A 3IF7A 4BY4A 2ZKMX 2NCOA 2M0RA 4XJKA 1M31A 1CLMA 1B8LA 1JF0A 2PASA 2ZNDA 3C1VA 2F8PA 2NXQA 3JTDB 1CM1A 2JWWA 2KFHA 5JJGA 1FW4A 2JXCA 2PSRA 1QXPA 1PSRA 3IQQA 1CMGA 1DGUA 2CT9A 2I2RE 1J55A 4YGBB 2LVKA 5KSZA 2KAYA 2WC8A 2L4IA 1BF5A 1YVLA 4ZCUA 1A2XA 2K7CA 4N1FA 2OTGB 4DUQA 1JC2A 2WOSA 4YGDB 4I5LB 2KNEA 1NCXA 1SKTA 1TCOB 3VRRA 1YR5A 1PSBA 1NWDA 1RK9A 1BJFA 2KFGA 4DS7A 1DJZA 3O78A 1SBJA 1V1FA 3TZ1A 3OP0A 5AXIA 5FYXA 2JZIA 3BUXB 1K95A 2I18A 4PCWA 1TTXA 1C7VA 2PALA 1J7QA 1TNPA 3BUNB 3DVEA 1XA5A 2G9BA 2Y1NA 3I5FC 1M39A 2PMYA 1X02A 2G2BA 3D10A 1UP5A 1XK4C 4CLNA 1QX5B 2KGRA 5D7FA 3LK0A 1U5IA 1XFZO 2JRFA 1WDCC 3O4YA 4MRYA 1BODA 1UWOA 1NX2A 3PN7C 2LVJA 1MF8B 3KPXA 3SG5A 2MBXA 2JQ6A 4C0LA 1NYAA 2LMVA 3K21A 3FWCA 4NDCA 1ALVA 3HX4A 1WY9A 1NP8A 2LUCA 1CNPA 3GK1A 4A4BA 2KSPA 5CSFA 1L2OC 3PALA 1Y0VH 3AKAA 2LE9B 1WRKA 5I8NA 4FQOA 2LM5A 3WHUB 4I5JA 4FTGA 1W7IB 2LHIA 1KQMB 2K7OA 2O5GA 5ER5A 1S1EA 1QLKA 2AUCA 4DRWA 5CSJA 4QJ4B 1DF0B 1OOJA 1XFWO 3DVJA 5ER4X 3EK8A 4Q04A 1K2HA 5G08A 3I5HC 1TNXA 3TUYC 3PATA 2IS9A 4ORCB 5F6TA 4JWQA 2MA2A 3DF0B 4HRGA 1PRWA 1QS7A 1SL8A 2KI6C 1H8BA 1SR6B 2L50A 2KI4B 1M46A 3O6BA 1SMGA 2KAVA 5TNCA 5D69A 1DJXA 4U8DA 5I2OA 1QVIZ 2NCPA 1BR1B 2MHHA 4PHKA 2VRGA 1QX7A 2MLFC 2NLNA 2JU0A 3PFVA 1Q80A 5KTYA 1DGVA 1WLMA 3KF9A 1SCVA 1MWNA 1KK8C 3I5GC 3EVRA 2KQYA 2FJUB 1DJYA 3TDIA 3IQOA 4P5OE 3EVVA 2OS8C 2TN4A 3I5HB 4GGFA 4HREE 4YI8A 3LLEA 4ORAB 4P2YB 1PVAA 1A75A 3JVTB 4NDBA 1RROA 1Y6WA 3VROA 1WDCB 1K94A 1CTRA 4DCKA 1EH2A 2ZN9A 4NDDA 2DOQA 1PALA 3M0WA 3SJSA 4CFRA 4USLA 2V53A 2K8MB 3H4SE 4N1GA 4YRUA 5PALA 1TRFA 1KFXS 2KDHA 3CR2A 1NCZA 3KHEA 3TDUA 1QIVA 1YUUA 2MRDA 2LVIA 2F3ZA 1FF1A 1IH0A 4NQGA 1CDMA 2KI4C 1IJ6A 1XYDA 1DJHA 1VRKA 4GGNA 3A4UB 2KYCA 3JTDC 1UURA 2LHLA 2L98A 1ODBA 3BYAA 3TUYB 1TNQA 3D0YB 3VRQA 1KSMA 1U5IB 1AUIB 2LAPA 3ICBA 3LL8B 1CFFA 1JWDA 2I7AA 3FIAA 3TDZA 1HT9A 1LA0A 1PVBA 3SIAA 4ETOA 4HSZA 1OQPA 2CXJA 3CGAA 1B4CA 1CB1A 3A8RA 1LVCD 2EC6B 4C0JA 1KK7Y 1B8RA 1ZMZA 2F3YA 2I94A 1XFUO 5HKZA 2M49B 2SASA 1DJIA 1K9KA 2PVBA 1FBVA 1LA3A 1IKUA 2COLB 3AAJA 2BE4A 3I5FB 1CLBA 3PN7B 1CM4A 1BLQA 2KQ6A 2Q4UA 1ZOTB 1TOPA 1YUSA 1EXRA 2LP3A 1IG5A 3VRPA 3OB1B 4WRIA 3CR4X 1DF0A 1IQ5A 2L2EA 3FWBA 2OTGC 2M7LA 2L5XB 3CLNA 4N5XA 1BMOA 1F55A 4GNKB 1AVSA 1OZOA 3EK7A 3NSOA 4HRHA 1OSAA 1NPQA 1K93D 2K7DA 2M8UA 3PLFB 1DTLA 2LVVA 2E6WA 2LLSA 2L0PA 4OCIA 5CSIA 3TS5B 1MQ1A 4OR9B 2HF5A 1JUOA 1IQ3A 2LC5A 1S26D 1K9PA 1J7OA 2ZRSA 5GQQC 2SCPA 1RTP1 4AQJA 1QASA 1EG4A 1KQVA 3GK4X 4PALA 3WXAA 1MXEA 1SR6C 1ALWA 1B7TZ 1NUBA 4IL1A 4WQ2A 1DJWA 2JOJA 2M97A 1C7WA 3OX5A 1KSOA 1GJYA 4A4CA 1JSAA 2FCEA 2M1KB 4E68A 1J1DA 3DF0A 1SCMB 2LMTA 2K0JA 4OVNF 2BCXA 1KK8B 1F4QA 2CNPA 3I5GB 3D0YA 2Y1MA 1CDPA 1G8IA 1RJVA 3BUOB 3OHMB 2EGDA 1KQMC 5AFPA 2JT0A 1IJ5A 4ORBB 1J1EA 3BQ3A 1QTXA 2WCBA 2JNFA 1JF2A 2HPSA 2Q91A 1WRLA 3KO0A 1TCFA 2K2FA 1DJGA 4MBEA 3CR5X 3NSLA 1IRJA 3OX6A 1F70A 1G4YR 2Y5IA 1S36A 1GGWA 1OE9B 1A4PA 1YRUB 1A75B 1L2OB 1K96A 4CFQA 4GPLB 1F8HA 2BE6A 4M2QA 2GGZA 3SG2A 2JTTA 1UHJA 1XK4A 4MZJA 1SY9A 4MZLA 1IGVA 4AOMA 5DKQA 4XYNA 1SW8A 3CS1A 2JT3A 4UPGA 5HKYA 2BKHB 1DT7B 1R2UA 2WCFA 3OB2B 3NSKA 2HQ8A 1BOCA 1N65A 3CWGA 4MEWA 1KCYA 4GGFC 1M45A 2QACA 1D1OA 5K89A 1NX1A 1NX3A 2H61C 3BOWB 4F0ZB 1HQVA 1BG1A 1AJ4A 2RGIA 3VGOA 3QRXA 5DKRA 2JT8A 3BOWA 1CMFA 1K90D 1KFUL 4PE4A 1SNLA 2LANA 3F45A 1N0YA 3EK4A 1AJ5A 1CFDA 1XVJA 4GBAA 2JULA 4YGAA 2BL0B 3HCMA 2BBNA 3SG6A 3SG4A 2CCMA 2K61A 2LLTA 1B8CA 1KWOB 1V1GA 1DMOA 4M2PA 1QATA 2M9GA 1TIZA 1R6PA 1OMRA 1YRTB 1QJTA 4ZCVA 2BKIB 5HLVA 1SRAA 4ICBA 2ZFDA 1IWQA 1LKJA 5HKWA 1JFJA 2BL0C 1CDLA 4GAOA 3WHTB 1CLLA 2E30A 4PDZA 3BXKA 4PE0A 5B8IB 4PHMA 3AAKA 3EKHA 3EVUA 4M2OA 4YGEB 4OKHA 1QVIY 4WQ3A 2CTNA 1OZSA 1Y1XA 2JNXA 2HQWA 5BPJA 4YI9A 2ISDA 1J7PA 1GQMA 3NSIA 2BECA 1QV1A 1UUSA 1N2DA 3FS7A 4XJKB 1AP4A 2F2PA 2AMIA 1EG3A 1LINA 2H2KA 3I5IC 2AAOA 3EKJA 1WLZA 3E3RA 1NX0A 2JXLA 2P6BB 3O2PA 1FI6A 1XO5A 2BCAA 1B47A 2CBLA 3SG3A 4I5NB 3ZNIA 2M7NA 4I5KA 1CDNA 1RFJA 1S6IA 4MSPA 2HETA 4PE1A 1QIWA 1AHRA 1QV0A 5I2QA 5AEQA 5HYDA 2QPTA 2LNKA 3BUWB 1GGZA 2D8NA 1S5GY 1C07A 1SYMA 1RECA 2Y4QA 1WRZA 2O60A 4JPZB 4C0KA 4PHJA 3LK1A 5CPVA 1EJ3A 2GV5A 3GOFA 4MRXA 2M1UA 3VRNA 1UHIA 4MN0A 1BT6A 4BY5A 1BU3A 1OMVA 1KFXL 1F4OA 1PK0D 1YUTA 2L4HA 2LMUA 3GK2A 4PE7A 1DVIA 2BCBA 4QJ5B 1QX2A 2OPOA 1ZFSA 3AKBA 2B1UA 2BBMA 4MZKA 2KFFA 4JQ0D 4PHNA 2F2OA 3DD4A 2EHBA 2KOTA 1MR8A 3PSRA 4OV2A 1B9AA 4GUKA 3WNXB 3NXAA 4TNCA 1FI5A 2JPTA 1MUXA 1RWYA 1H4BA 2LP2A 1QLSA 1B7TY 2WORA 3SG7A 1CFPA 1NIWA 2ZNEA 3CZTX 1TN4A 5HLOA 5AERA 2KAXA 2WNDA 4MLWA 1M63B 1J7RA 1NSHA 3BUMB 1SK6D 4L9MA 2KI6D 4QJ3B 1MXLC 1Y1UA 1K9UA 3TS5C 2KGBC 3MSEB 2KBIA 2FOTA 3DVMA 4D1EA 1E8AA 1K8UA 1XFXO 3JVTC 5J3XA 4DIRA 1G33A 1F54A 2MLEC 1UHNA 1YVHA 2H61A 1CFCA 1CKKA 1PULA 2NZ0A 1W7JB 1MHOA 1ZACA 4YGCB 1JFKA 2LV7A 2EC6C 1KWOC 5I2LA 1YX8A 1A29A 1L7ZA 2R2IA 3RM1A 4CPVA 2JTZA 3LCPC 1TNWA 1SCMC 2ZN8A 2ZRTA 1S5GZ 2LUXA 1S3PA 4AQIA 1AK8A 4MVFA 3SIBA 1NCYA 5CSNA 1YURA 1ZUZA 2KHNA 4GFTA 2LCPA 2KBMA 1BR4B 1SL7A 1FPWA 3PM8A 3I5IB 2LLUA 5AANA 4YBHB 1OMDA 2GGMA 5IBWA 1UHKA 2M29A 1KFUS 1F71A 1SPYA 1YTZC 1UHHA 2KYFA 1EL4A 2OS8B 5DKNA 2A4JA 5JOLA
chains in the Genus database with same CATH superfamily
1KK7Z 2F33A 3KEVA 3DVKA 1XFVO 3PJIA 1SL9A 5KU1A 3RLZA 2MJWB 2PRUA 2L51A 4R1EA 3CTNA 3ZWHA 4CIDA 1A03A 1S6CA 2JC2A 1JBAA 4INXA 3SS5A 1XFYO 1S6JA 1B1GA 1LXFC 1Y1AA 2K2AA 2FCDA 2MAZA 2WCEA 2K7BA 2M3WA 1YX7A 3IF7A 4BY4A 2ZKMX 2NCOA 2M0RA 4XJKA 1M31A 1CLMA 1B8LA 1JF0A 2PASA 2ZNDA 3C1VA 2F8PA 2NXQA 2WCKA 1CM1A 2JWWA 2KFHA 3JTDB 5JJGA 1FW4A 3D75A 2JXCA 2PSRA 1QXPA 1PSRA 2QEOA 3IQQA 1CMGA 1DGUA 2CT9A 2I2RE 1J55A 4YGBB 2LVKA 5KSZA 2KAYA 2WC8A 2L4IA 1BF5A 1YVLA 4ZCUA 1A2XA 2K7CA 4N1FA 2OTGB 4DUQA 3SS3A 1JC2A 2WOSA 4YGDB 4I5LB 2KNEA 3R1VA 1NCXA 1XFRA 1SKTA 3D77A 1TCOB 3VRRA 1YR5A 1PSBA 1NWDA 1RK9A 1BJFA 2KFGA 4DS7A 1DJZA 3O78A 1SBJA 4INWA 1V1FA 3TZ1A 3OP0A 5AXIA 2QEHA 5FYXA 2JZIA 3BUXB 1K95A 2I18A 4PCWA 1TTXA 1C3YA 1C7VA 2PALA 1J7QA 1TNPA 3BUNB 3DVEA 1XA5A 2G9BA 3D73A 2Y1NA 3I5FC 3CDNA 3D76A 1M39A 3CABA 2PMYA 1X02A 2G2BA 3D10A 1UP5A 1XK4C 4CLNA 1QX5B 2KGRA 5D7FA 5FI2A 3LK0A 1U5IA 1XFZO 2JRFA 1WDCC 3O4YA 4MRYA 1BODA 1UWOA 2PYQA 1NX2A 3PN7C 2LVJA 1MF8B 1TUJA 3KPXA 2BAPA 2MBXA 3SG5A 2JQ6A 4C0LA 1NYAA 2LMVA 3K21A 3FWCA 4NDCA 3R72A 1ALVA 3HX4A 1WY9A 1NP8A 2LUCA 1CNPA 5DICA 3GK1A 4A4BA 2KSPA 5CSFA 1L2OC 3PALA 1Y0VH 3AKAA 2LE9B 1WRKA 5I8NA 4FQOA 2LM5A 3WHUB 4I5JA 4FTGA 1W7IB 2LHIA 1KQMB 2K7OA 2O5GA 5ER5A 1S1EA 1QLKA 2AUCA 4DRWA 5CSJA 4QJ4B 1DF0B 1OOJA 1XFWO 3DVJA 5ER4X 3V2LA 3EK8A 3O4XA 4Q04A 1K2HA 5G08A 3I5HC 1TNXA 3UO9A 3TUYC 3PATA 2IS9A 2WC5A 1W9ZA 4ORCB 5F6TA 4JWQA 2MA2A 3DF0B 4HRGA 1PRWA 3CYZA 1QS7A 1SL8A 2KI6C 1H8BA 1SR6B 2L50A 2KI4B 1C3ZA 1M46A 3O6BA 1SMGA 2KAVA 5TNCA 5D69A 3B87A 1DJXA 4U8DA 5I2OA 1QVIZ 2NCPA 1BR1B 3UNWA 2MHHA 4PHKA 2VRGA 1QX7A 2MLFC 2NLNA 2JU0A 3PFVA 3S0EA 1Q80A 3QMEA 1DGVA 1WLMA 5KTYA 3KF9A 2KLDA 1SCVA 1MWNA 1KK8C 3I5GC 1TWOA 3EVRA 2KQYA 3BFAA 3NHTA 2FJUB 1DJYA 3TDIA 3IQOA 4P5OE 3EVVA 2OS8C 2TN4A 3I5HB 4GGFA 4HREE 4YI8A 2WCLA 3LLEA 4ORAB 4P2YB 1PVAA 1A75A 3JVTB 4NDBA 1RROA 1Y6WA 5I94A 3VROA 1WDCB 1K94A 1CTRA 4OZDA 4DCKA 1EH2A 2ZN9A 4NDDA 2DOQA 2FJYA 1PALA 3M0WA 3SJSA 4CFRA 4USLA 2V53A 2K8MB 3H4SE 4N1GA 4YRUA 5PALA 1TRFA 1KFXS 2KDHA 3CR2A 1NCZA 3KHEA 3TDUA 1QIVA 1YUUA 2MRDA 2LVIA 2F3ZA 1FF1A 1IH0A 4NQGA 3S0FA 1CDMA 2KI4C 1IJ6A 1XYDA 1DJHA 1VRKA 4GGNA 3A4UB 2KYCA 3JTDC 1UURA 2LHLA 2L98A 1ODBA 3BYAA 3TUYB 3FE9A 1TNQA 3D0YB 3VRQA 1KSMA 1U5IB 1AUIB 2LAPA 3ICBA 3LL8B 3OGNA 1CFFA 1JWDA 3SS4A 2I7AA 3FIAA 3TDZA 1HT9A 1LA0A 1PVBA 3SIAA 4ETOA 4HSZA 1OQPA 1DELA 2CXJA 3N7HA 3CGAA 1B4CA 1CB1A 3A8RA 1OOHA 1LVCD 2EC6B 4C0JA 1KK7Y 1B8RA 1ZMZA 2F3YA 2I94A 1XFUO 5HKZA 1QWVA 2M49B 2SASA 1DJIA 2WCHA 1K9KA 2PVBA 1FBVA 1LA3A 1IKUA 3R1OA 2COLB 3AAJA 2BE4A 3I5FB 1CLBA 3PN7B 1CM4A 1BLQA 2KQ6A 3D78A 2Q4UA 1ZOTB 2JPOA 3BJHA 1TOPA 2WCJA 1YUSA 1EXRA 2LP3A 3R1PA 1IG5A 3VRPA 3OB1B 3OBVA 4WRIA 3CR4X 1DF0A 1IQ5A 1OOIX 3K1EA 2L2EA 3FWBA 2OTGC 2M7LA 2L5XB 3CLNA 4N5XA 1BMOA 5FI6A 2L5YA 1F55A 1Z2CB 4GNKB 1AVSA 1OZOA 3EK7A 3NSOA 3B86A 4HRHA 1OSAA 1NPQA 1K93D 2K7DA 2M8UA 1T14A 3PLFB 1DTLA 2LVVA 2E6WA 2LLSA 2L0PA 4OCIA 5CSIA 2BNXA 3TS5B 1MQ1A 4OR9B 1JUOA 2HF5A 1IQ3A 2LC5A 1S26D 1K9PA 1J7OA 2ZRSA 5GQQC 2SCPA 1RTP1 1DQEA 4AQJA 1QASA 1EG4A 1KQVA 3GK4X 1DEKA 4PALA 3WXAA 1MXEA 1SR6C 1ALWA 1B7TZ 1NUBA 4IL1A 4WQ2A 1DJWA 1SSEB 2JOJA 2M97A 1C7WA 3OX5A 1KSOA 1GJYA 4A4CA 1JSAA 2FCEA 2H8VA 2M1KB 4E68A 1J1DA 3DF0A 1SCMB 2LMTA 1Z4HA 2K0JA 2WC6A 4OVNF 2BCXA 1KK8B 1F4QA 2CNPA 3DZTA 3D0YA 2Y1MA 3I5GB 3CZ2A 1CDPA 1G8IA 1RJVA 3BUOB 3OHMB 2EGDA 1KQMC 5AFPA 2JT0A 1IJ5A 4PT1A 4ORBB 1J1EA 3BQ3A 1QTXA 2WCBA 1OOGA 2JNFA 1JF2A 2HPSA 2Q91A 1WRLA 3DXLA 3KO0A 1TCFA 2K2FA 1DJGA 4MBEA 3CR5X 3NSLA 1IRJA 3CZ1A 3OX6A 1F70A 1G4YR 3BFBA 2Y5IA 1S36A 1GGWA 3L4LA 1OE9B 5HL1A 1A4PA 1YRUB 4JKTA 1A75B 1L2OB 1K96A 2YGUA 4GPLB 4CFQA 2BE6A 4M2QA 1F8HA 2GGZA 3SG2A 2JTTA 1UHJA 1XK4A 4MZJA 1SY9A 4MZLA 1OOFA 1IGVA 4AOMA 5DKQA 4XYNA 1SW8A 3CS1A 2JT3A 4UPGA 5HKYA 3IVTA 2BKHB 2QDIA 1DT7B 1R2UA 2WCFA 3OB2B 3NSKA 2HQ8A 1BOCA 1N65A 3CWGA 4MEWA 1KCYA 4GGFC 1M45A 2QACA 1D1OA 5K89A 1NX1A 1NX3A 2H61C 3BOWB 2QEVA 1HQVA 4F0ZB 1AJ4A 2RGIA 3VGOA 1BG1A 3QRXA 2QEBA 5DKRA 2JT8A 3BOWA 1CMFA 1K90D 1KFUL 4PE4A 1SNLA 2LANA 3F45A 4IJ7A 1N0YA 3PM2A 3EK4A 1AJ5A 1CFDA 1XVJA 3DY9A 4GBAA 2JULA 4YGAA 2BL0B 3HCMA 2BBNA 3SG6A 3SG4A 2CCMA 2K61A 2LLTA 1B8CA 1KWOB 1V1GA 1DMOA 4M2PA 1QATA 2M9GA 1TIZA 3RZSA 1IIOA 1R6PA 1OMRA 1YRTB 1QJTA 4ZCVA 2BKIB 5HLVA 1SRAA 4ICBA 2ZFDA 1IWQA 1LKJA 5HKWA 5EL2A 1JFJA 2BL0C 1CDLA 4GAOA 3WHTB 1CLLA 2E30A 2ERBA 3BXKA 4PDZA 3S0AA 4PE0A 5B8IB 4PHMA 3AAKA 3EKHA 3EVUA 4M2OA 3FE8A 4YGEB 4OKHA 1QVIY 4WQ3A 2CTNA 1OZSA 1Y1XA 2JNXA 2P71A 2HQWA 5BPJA 4YI9A 2ISDA 1J7PA 1GQMA 3NSIA 2WCMA 2BECA 1QV1A 1TUZA 1UUSA 4F7FA 1N2DA 3FS7A 4XJKB 1AP4A 2F2PA 2AMIA 1EG3A 1LINA 2H2KA 3I5IC 2AAOA 2L2CA 1WLZA 3EKJA 3E3RA 3S0GA 1NX0A 2JXLA 2P6BB 3O2PA 1FI6A 1XO5A 2BCAA 1B47A 2CBLA 3SG3A 4I5NB 3ZNIA 2M7NA 4I5KA 1DC1A 1CDNA 1RFJA 1S6IA 3D74A 4MSPA 4KYNA 1OW4A 2HETA 4PE1A 1QIWA 1LS8A 1AHRA 1QV0A 5I2QA 5AEQA 5HYDA 2QPTA 2LNKA 3BUWB 1GGZA 2D8NA 1S5GY 1C07A 1SYMA 1RECA 2Y4QA 1WRZA 2O60A 4JPZB 4C0KA 4PHJA 3LK1A 5CPVA 3VB1A 1EJ3A 3NGVA 2GV5A 3GOFA 4MRXA 2M1UA 3VRNA 1UHIA 4MN0A 1BT6A 2KPHA 4BY5A 1BU3A 1OMVA 1KFXL 1F4OA 1PK0D 1YUTA 2L4HA 2LMUA 3CZ0A 3GK2A 4PE7A 1DVIA 2BCBA 4QJ5B 1QX2A 2OPOA 1ZFSA 3AKBA 2B1UA 2BBMA 4MZKA 2KFFA 4JQ0D 4PHNA 2F2OA 3DD4A 5FI7A 2EHBA 2KOTA 1MR8A 3DYEA 3PSRA 4OV2A 1B9AA 4GUKA 3WNXB 4JD9A 3NXAA 4TNCA 1FI5A 2JPTA 1MUXA 1RWYA 1H4BA 4FQTA 2LP2A 1QLSA 1B7TY 2WORA 3S0BA 3SG7A 1CFPA 1NIWA 2ZNEA 3CZTX 1TN4A 5HLOA 5AERA 1GM0A 2KAXA 3L47A 2WNDA 4MLWA 1M63B 1J7RA 1NSHA 3BUMB 1SK6D 3NHIA 2KI6D 4L9MA 1MXLC 1Y1UA 1K9UA 2PQLA 2KGBC 3MSEB 4QJ3B 3TS5C 2KBIA 2FOTA 2GTEA 3DVMA 4D1EA 1E8AA 1K8UA 1XFXO 3JVTC 5J3XA 2P70A 1G33A 4DIRA 1F54A 2MLEC 1UHNA 1YVHA 2H61A 3Q8IA 1CFCA 1CKKA 1PULA 1P28A 2NZ0A 1W7JB 1MHOA 3B88A 5D3OA 1ZACA 4YGCB 1JFKA 2LV7A 1ORGA 2EC6C 1KWOC 3B7AA 2KLEA 5I2LA 1YX8A 1A29A 1L7ZA 2R2IA 3RM1A 4CPVA 2JTZA 3LCPC 1TNWA 1SCMC 2ZN8A 2ZRTA 1S5GZ 2LUXA 1S3PA 4AQIA 1AK8A 4MVFA 3SIBA 1NCYA 2K60A 5CSNA 3EG5B 3BFHA 1YURA 1ZUZA 2KHNA 4GFTA 2LCPA 2KBMA 1BR4B 1SL7A 3S0DA 3PM8A 1FPWA 3I5IB 2LLUA 3L4AA 5AANA 3B6XA 4YBHB 1OMDA 2GGMA 5IBWA 1UHKA 2M29A 1KFUS 1F71A 1SPYA 3FE6A 1YTZC 1UHHA 2KYFA 1EL4A 2OS8B 5DKNA 2A4JA 5JOLA
chains in the Genus database with same CATH topology
1KK7Z 2F33A 3KEVA 3DVKA 1XFVO 5KU1A 1SL9A 3RLZA 2MJWB 2PRUA 2L51A 4R1EA 3CTNA 3ZWHA 4CIDA 1A03A 1S6CA 2JC2A 1JBAA 1XFYO 1S6JA 1B1GA 1LXFC 1Y1AA 2K2AA 2FCDA 2MAZA 2WCEA 2K7BA 2M3WA 1YX7A 3IF7A 4BY4A 2ZKMX 2NCOA 2M0RA 4XJKA 1M31A 1CLMA 1B8LA 1JF0A 2PASA 2ZNDA 3C1VA 2F8PA 2NXQA 3JTDB 1CM1A 2JWWA 2KFHA 5JJGA 1FW4A 2JXCA 2PSRA 1QXPA 1PSRA 3IQQA 1CMGA 1DGUA 2CT9A 2I2RE 1J55A 4YGBB 2LVKA 5KSZA 2KAYA 2WC8A 2L4IA 1BF5A 1YVLA 4ZCUA 1A2XA 2K7CA 4N1FA 2OTGB 4DUQA 1JC2A 2WOSA 4YGDB 4I5LB 2KNEA 1NCXA 1SKTA 1TCOB 3VRRA 1YR5A 1PSBA 1NWDA 1RK9A 1BJFA 2KFGA 4DS7A 1DJZA 3O78A 1SBJA 1V1FA 3TZ1A 3OP0A 5AXIA 5FYXA 2JZIA 3BUXB 1K95A 2I18A 4PCWA 1TTXA 1C7VA 2PALA 1J7QA 1TNPA 3BUNB 3DVEA 1XA5A 2G9BA 2Y1NA 3I5FC 1M39A 2PMYA 1X02A 2G2BA 3D10A 1UP5A 1XK4C 4CLNA 1QX5B 2KGRA 5D7FA 3LK0A 1U5IA 1XFZO 2JRFA 1WDCC 3O4YA 4MRYA 1BODA 1UWOA 1NX2A 3PN7C 2LVJA 1MF8B 3KPXA 3SG5A 2MBXA 2JQ6A 4C0LA 1NYAA 2LMVA 3K21A 3FWCA 4NDCA 1ALVA 3HX4A 1WY9A 1NP8A 2LUCA 1CNPA 3GK1A 4A4BA 2KSPA 5CSFA 1L2OC 3PALA 1Y0VH 3AKAA 2LE9B 1WRKA 5I8NA 4FQOA 2LM5A 3WHUB 4I5JA 4FTGA 1W7IB 2LHIA 1KQMB 2K7OA 2O5GA 5ER5A 1S1EA 1QLKA 2AUCA 4DRWA 5CSJA 4QJ4B 1DF0B 1OOJA 1XFWO 3DVJA 5ER4X 3EK8A 4Q04A 1K2HA 5G08A 3I5HC 1TNXA 3TUYC 3PATA 2IS9A 4ORCB 5F6TA 4JWQA 2MA2A 3DF0B 4HRGA 1PRWA 1QS7A 1SL8A 2KI6C 1H8BA 1SR6B 2L50A 2KI4B 1M46A 3O6BA 1SMGA 2KAVA 5TNCA 5D69A 1DJXA 4U8DA 5I2OA 1QVIZ 2NCPA 1BR1B 2MHHA 4PHKA 2VRGA 1QX7A 2MLFC 2NLNA 2JU0A 3PFVA 1Q80A 5KTYA 1DGVA 1WLMA 3KF9A 1SCVA 1MWNA 1KK8C 3I5GC 3EVRA 2KQYA 2FJUB 1DJYA 3TDIA 3IQOA 4P5OE 3EVVA 2OS8C 2TN4A 3I5HB 4GGFA 4HREE 4YI8A 3LLEA 4ORAB 4P2YB 1PVAA 1A75A 3JVTB 4NDBA 1RROA 1Y6WA 3VROA 1WDCB 1K94A 1CTRA 4DCKA 1EH2A 2ZN9A 4NDDA 2DOQA 1PALA 3M0WA 3SJSA 4CFRA 4USLA 2V53A 2K8MB 3H4SE 4N1GA 4YRUA 5PALA 1TRFA 1KFXS 2KDHA 3CR2A 1NCZA 3KHEA 3TDUA 1QIVA 1YUUA 2MRDA 2LVIA 2F3ZA 1FF1A 1IH0A 4NQGA 1CDMA 2KI4C 1IJ6A 1XYDA 1DJHA 1VRKA 4GGNA 3A4UB 2KYCA 3JTDC 1UURA 2LHLA 2L98A 1ODBA 3BYAA 3TUYB 1TNQA 3D0YB 3VRQA 1KSMA 1U5IB 1AUIB 2LAPA 3ICBA 3LL8B 1CFFA 1JWDA 2I7AA 3FIAA 3TDZA 1HT9A 1LA0A 1PVBA 3SIAA 4ETOA 4HSZA 1OQPA 2CXJA 3CGAA 1B4CA 1CB1A 3A8RA 1LVCD 2EC6B 4C0JA 1KK7Y 1B8RA 1ZMZA 2F3YA 2I94A 1XFUO 5HKZA 2M49B 2SASA 1DJIA 1K9KA 2PVBA 1FBVA 1LA3A 1IKUA 2COLB 3AAJA 2BE4A 3I5FB 1CLBA 3PN7B 1CM4A 1BLQA 2KQ6A 2Q4UA 1ZOTB 1TOPA 1YUSA 1EXRA 2LP3A 1IG5A 3VRPA 3OB1B 4WRIA 3CR4X 1DF0A 1IQ5A 2L2EA 3FWBA 2OTGC 2M7LA 2L5XB 3CLNA 4N5XA 1BMOA 1F55A 4GNKB 1AVSA 1OZOA 3EK7A 3NSOA 4HRHA 1OSAA 1NPQA 1K93D 2K7DA 2M8UA 3PLFB 1DTLA 2LVVA 2E6WA 2LLSA 2L0PA 4OCIA 5CSIA 3TS5B 1MQ1A 4OR9B 2HF5A 1JUOA 1IQ3A 2LC5A 1S26D 1K9PA 1J7OA 2ZRSA 5GQQC 2SCPA 1RTP1 4AQJA 1QASA 1EG4A 1KQVA 3GK4X 4PALA 3WXAA 1MXEA 1SR6C 1ALWA 1B7TZ 1NUBA 4IL1A 4WQ2A 1DJWA 2JOJA 2M97A 1C7WA 3OX5A 1KSOA 1GJYA 4A4CA 1JSAA 2FCEA 2M1KB 4E68A 1J1DA 3DF0A 1SCMB 2LMTA 2K0JA 4OVNF 2BCXA 1KK8B 1F4QA 2CNPA 3I5GB 3D0YA 2Y1MA 1CDPA 1G8IA 1RJVA 3BUOB 3OHMB 2EGDA 1KQMC 5AFPA 2JT0A 1IJ5A 4ORBB 1J1EA 3BQ3A 1QTXA 2WCBA 2JNFA 1JF2A 2HPSA 2Q91A 1WRLA 3KO0A 1TCFA 2K2FA 1DJGA 4MBEA 3CR5X 3NSLA 1IRJA 3OX6A 1F70A 1G4YR 2Y5IA 1S36A 1GGWA 1OE9B 1A4PA 1YRUB 1A75B 1L2OB 1K96A 4CFQA 4GPLB 1F8HA 2BE6A 4M2QA 2GGZA 3SG2A 2JTTA 1UHJA 1XK4A 4MZJA 1SY9A 4MZLA 1IGVA 4AOMA 5DKQA 4XYNA 1SW8A 3CS1A 2JT3A 4UPGA 5HKYA 2BKHB 1DT7B 1R2UA 2WCFA 3OB2B 3NSKA 2HQ8A 1BOCA 1N65A 3CWGA 4MEWA 1KCYA 4GGFC 1M45A 2QACA 1D1OA 5K89A 1NX1A 1NX3A 2H61C 3BOWB 4F0ZB 1HQVA 1BG1A 1AJ4A 2RGIA 3VGOA 3QRXA 5DKRA 2JT8A 3BOWA 1CMFA 1K90D 1KFUL 4PE4A 1SNLA 2LANA 3F45A 1N0YA 3EK4A 1AJ5A 1CFDA 1XVJA 4GBAA 2JULA 4YGAA 2BL0B 3HCMA 2BBNA 3SG6A 3SG4A 2CCMA 2K61A 2LLTA 1B8CA 1KWOB 1V1GA 1DMOA 4M2PA 1QATA 2M9GA 1TIZA 1R6PA 1OMRA 1YRTB 1QJTA 4ZCVA 2BKIB 5HLVA 1SRAA 4ICBA 2ZFDA 1IWQA 1LKJA 5HKWA 1JFJA 2BL0C 1CDLA 4GAOA 3WHTB 1CLLA 2E30A 4PDZA 3BXKA 4PE0A 5B8IB 4PHMA 3AAKA 3EKHA 3EVUA 4M2OA 4YGEB 4OKHA 1QVIY 4WQ3A 2CTNA 1OZSA 1Y1XA 2JNXA 2HQWA 5BPJA 4YI9A 2ISDA 1J7PA 1GQMA 3NSIA 2BECA 1QV1A 1UUSA 1N2DA 3FS7A 4XJKB 1AP4A 2F2PA 2AMIA 1EG3A 1LINA 2H2KA 3I5IC 2AAOA 3EKJA 1WLZA 3E3RA 1NX0A 2JXLA 2P6BB 3O2PA 1FI6A 1XO5A 2BCAA 1B47A 2CBLA 3SG3A 4I5NB 3ZNIA 2M7NA 4I5KA 1CDNA 1RFJA 1S6IA 4MSPA 2HETA 4PE1A 1QIWA 1AHRA 1QV0A 5I2QA 5AEQA 5HYDA 2QPTA 2LNKA 3BUWB 1GGZA 2D8NA 1S5GY 1C07A 1SYMA 1RECA 2Y4QA 1WRZA 2O60A 4JPZB 4C0KA 4PHJA 3LK1A 5CPVA 1EJ3A 2GV5A 3GOFA 4MRXA 2M1UA 3VRNA 1UHIA 4MN0A 1BT6A 4BY5A 1BU3A 1OMVA 1KFXL 1F4OA 1PK0D 1YUTA 2L4HA 2LMUA 3GK2A 4PE7A 1DVIA 2BCBA 4QJ5B 1QX2A 2OPOA 1ZFSA 3AKBA 2B1UA 2BBMA 4MZKA 2KFFA 4JQ0D 4PHNA 2F2OA 3DD4A 2EHBA 2KOTA 1MR8A 3PSRA 4OV2A 1B9AA 4GUKA 3WNXB 3NXAA 4TNCA 1FI5A 2JPTA 1MUXA 1RWYA 1H4BA 2LP2A 1QLSA 1B7TY 2WORA 3SG7A 1CFPA 1NIWA 2ZNEA 3CZTX 1TN4A 5HLOA 5AERA 2KAXA 2WNDA 4MLWA 1M63B 1J7RA 1NSHA 3BUMB 1SK6D 4L9MA 2KI6D 4QJ3B 1MXLC 1Y1UA 1K9UA 3TS5C 2KGBC 3MSEB 2KBIA 2FOTA 3DVMA 4D1EA 1E8AA 1K8UA 1XFXO 3JVTC 5J3XA 4DIRA 1G33A 1F54A 2MLEC 1UHNA 1YVHA 2H61A 1CFCA 1CKKA 1PULA 2NZ0A 1W7JB 1MHOA 1ZACA 4YGCB 1JFKA 2LV7A 2EC6C 1KWOC 5I2LA 1YX8A 1A29A 1L7ZA 2R2IA 3RM1A 4CPVA 2JTZA 3LCPC 1TNWA 1SCMC 2ZN8A 2ZRTA 1S5GZ 2LUXA 1S3PA 4AQIA 1AK8A 4MVFA 3SIBA 1NCYA 5CSNA 1YURA 1ZUZA 2KHNA 4GFTA 2LCPA 2KBMA 1BR4B 1SL7A 1FPWA 3PM8A 3I5IB 2LLUA 5AANA 4YBHB 1OMDA 2GGMA 5IBWA 1UHKA 2M29A 1KFUS 1F71A 1SPYA 1YTZC 1UHHA 2KYFA 1EL4A 2OS8B 5DKNA 2A4JA 5JOLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KK7 Z;  2F33 A;  3KEV A;  3DVK A;  1XFV O;  5KU1 A;  1SL9 A;  3RLZ A;  2MJW B;  2PRU A;  2L51 A;  4R1E A;  3CTN A;  3ZWH A;  4CID A;  1A03 A;  1S6C A;  2JC2 A;  1JBA A;  1XFY O;  1S6J A;  1B1G A;  1LXF C;  1Y1A A;  2K2A A;  2FCD A;  2MAZ A;  2WCE A;  2K7B A;  2M3W A;  1YX7 A;  3IF7 A;  4BY4 A;  2ZKM X;  2NCO A;  2M0R A;  4XJK A;  1M31 A;  1CLM A;  1B8L A;  1JF0 A;  2PAS A;  2ZND A;  3C1V A;  2F8P A;  2NXQ A;  3JTD B;  1CM1 A;  2JWW A;  2KFH A;  5JJG A;  1FW4 A;  2JXC A;  2PSR A;  1QXP A;  1PSR A;  3IQQ A;  1CMG A;  1DGU A;  2CT9 A;  2I2R E;  1J55 A;  4YGB B;  2LVK A;  5KSZ A;  2KAY A;  2WC8 A;  2L4I A;  1BF5 A;  1YVL A;  4ZCU A;  1A2X A;  2K7C A;  4N1F A;  2OTG B;  4DUQ A;  1JC2 A;  2WOS A;  4YGD B;  4I5L B;  2KNE A;  1NCX A;  1SKT A;  1TCO B;  3VRR A;  1YR5 A;  1PSB A;  1NWD A;  1RK9 A;  1BJF A;  2KFG A;  4DS7 A;  1DJZ A;  3O78 A;  1SBJ A;  1V1F A;  3TZ1 A;  3OP0 A;  5AXI A;  5FYX A;  2JZI A;  3BUX B;  1K95 A;  2I18 A;  4PCW A;  1TTX A;  1C7V A;  2PAL A;  1J7Q A;  1TNP A;  3BUN B;  3DVE A;  1XA5 A;  2G9B A;  2Y1N A;  3I5F C;  1M39 A;  2PMY A;  1X02 A;  2G2B A;  3D10 A;  1UP5 A;  1XK4 C;  4CLN A;  1QX5 B;  2KGR A;  5D7F A;  3LK0 A;  1U5I A;  1XFZ O;  2JRF A;  1WDC C;  3O4Y A;  4MRY A;  1BOD A;  1UWO A;  1NX2 A;  3PN7 C;  2LVJ A;  1MF8 B;  3KPX A;  3SG5 A;  2MBX A;  2JQ6 A;  4C0L A;  1NYA A;  2LMV A;  3K21 A;  3FWC A;  4NDC A;  1ALV A;  3HX4 A;  1WY9 A;  1NP8 A;  2LUC A;  1CNP A;  3GK1 A;  4A4B A;  2KSP A;  5CSF A;  1L2O C;  3PAL A;  1Y0V H;  3AKA A;  2LE9 B;  1WRK A;  5I8N A;  4FQO A;  2LM5 A;  3WHU B;  4I5J A;  4FTG A;  1W7I B;  2LHI A;  1KQM B;  2K7O A;  2O5G A;  5ER5 A;  1S1E A;  1QLK A;  2AUC A;  4DRW A;  5CSJ A;  4QJ4 B;  1DF0 B;  1OOJ A;  1XFW O;  3DVJ A;  5ER4 X;  3EK8 A;  4Q04 A;  1K2H A;  5G08 A;  3I5H C;  1TNX A;  3TUY C;  3PAT A;  2IS9 A;  4ORC B;  5F6T A;  4JWQ A;  2MA2 A;  3DF0 B;  4HRG A;  1PRW A;  1QS7 A;  1SL8 A;  2KI6 C;  1H8B A;  1SR6 B;  2L50 A;  2KI4 B;  1M46 A;  3O6B A;  1SMG A;  2KAV A;  5TNC A;  5D69 A;  1DJX A;  4U8D A;  5I2O A;  1QVI Z;  2NCP A;  1BR1 B;  2MHH A;  4PHK A;  2VRG A;  1QX7 A;  2MLF C;  2NLN A;  2JU0 A;  3PFV A;  1Q80 A;  5KTY A;  1DGV A;  1WLM A;  3KF9 A;  1SCV A;  1MWN A;  1KK8 C;  3I5G C;  3EVR A;  2KQY A;  2FJU B;  1DJY A;  3TDI A;  3IQO A;  4P5O E;  3EVV A;  2OS8 C;  2TN4 A;  3I5H B;  4GGF A;  4HRE E;  4YI8 A;  3LLE A;  4ORA B;  4P2Y B;  1PVA A;  1A75 A;  3JVT B;  4NDB A;  1RRO A;  1Y6W A;  3VRO A;  1WDC B;  1K94 A;  1CTR A;  4DCK A;  1EH2 A;  2ZN9 A;  4NDD A;  2DOQ A;  1PAL A;  3M0W A;  3SJS A;  4CFR A;  4USL A;  2V53 A;  2K8M B;  3H4S E;  4N1G A;  4YRU A;  5PAL A;  1TRF A;  1KFX S;  2KDH A;  3CR2 A;  1NCZ A;  3KHE A;  3TDU A;  1QIV A;  1YUU A;  2MRD A;  2LVI A;  2F3Z A;  1FF1 A;  1IH0 A;  4NQG A;  1CDM A;  2KI4 C;  1IJ6 A;  1XYD A;  1DJH A;  1VRK A;  4GGN A;  3A4U B;  2KYC A;  3JTD C;  1UUR A;  2LHL A;  2L98 A;  1ODB A;  3BYA A;  3TUY B;  1TNQ A;  3D0Y B;  3VRQ A;  1KSM A;  1U5I B;  1AUI B;  2LAP A;  3ICB A;  3LL8 B;  1CFF A;  1JWD A;  2I7A A;  3FIA A;  3TDZ A;  1HT9 A;  1LA0 A;  1PVB A;  3SIA A;  4ETO A;  4HSZ A;  1OQP A;  2CXJ A;  3CGA A;  1B4C A;  1CB1 A;  3A8R A;  1LVC D;  2EC6 B;  4C0J A;  1KK7 Y;  1B8R A;  1ZMZ A;  2F3Y A;  2I94 A;  1XFU O;  5HKZ A;  2M49 B;  2SAS A;  1DJI A;  1K9K A;  2PVB A;  1FBV A;  1LA3 A;  1IKU A;  2COL B;  3AAJ A;  2BE4 A;  3I5F B;  1CLB A;  3PN7 B;  1CM4 A;  1BLQ A;  2KQ6 A;  2Q4U A;  1ZOT B;  1TOP A;  1YUS A;  1EXR A;  2LP3 A;  1IG5 A;  3VRP A;  3OB1 B;  4WRI A;  3CR4 X;  1DF0 A;  1IQ5 A;  2L2E A;  3FWB A;  2OTG C;  2M7L A;  2L5X B;  3CLN A;  4N5X A;  1BMO A;  1F55 A;  4GNK B;  1AVS A;  1OZO A;  3EK7 A;  3NSO A;  4HRH A;  1OSA A;  1NPQ A;  1K93 D;  2K7D A;  2M8U A;  3PLF B;  1DTL A;  2LVV A;  2E6W A;  2LLS A;  2L0P A;  4OCI A;  5CSI A;  3TS5 B;  1MQ1 A;  4OR9 B;  2HF5 A;  1JUO A;  1IQ3 A;  2LC5 A;  1S26 D;  1K9P A;  1J7O A;  2ZRS A;  5GQQ C;  2SCP A;  1RTP 1;  4AQJ A;  1QAS A;  1EG4 A;  1KQV A;  3GK4 X;  4PAL A;  3WXA A;  1MXE A;  1SR6 C;  1ALW A;  1B7T Z;  1NUB A;  4IL1 A;  4WQ2 A;  1DJW A;  2JOJ A;  2M97 A;  1C7W A;  3OX5 A;  1KSO A;  1GJY A;  4A4C A;  1JSA A;  2FCE A;  2M1K B;  4E68 A;  1J1D A;  3DF0 A;  1SCM B;  2LMT A;  2K0J A;  4OVN F;  2BCX A;  1KK8 B;  1F4Q A;  2CNP A;  3I5G B;  3D0Y A;  2Y1M A;  1CDP A;  1G8I A;  1RJV A;  3BUO B;  3OHM B;  2EGD A;  1KQM C;  5AFP A;  2JT0 A;  1IJ5 A;  4ORB B;  1J1E A;  3BQ3 A;  1QTX A;  2WCB A;  2JNF A;  1JF2 A;  2HPS A;  2Q91 A;  1WRL A;  3KO0 A;  1TCF A;  2K2F A;  1DJG A;  4MBE A;  3CR5 X;  3NSL A;  1IRJ A;  3OX6 A;  1F70 A;  1G4Y R;  2Y5I A;  1S36 A;  1GGW A;  1OE9 B;  1A4P A;  1YRU B;  1A75 B;  1L2O B;  1K96 A;  4CFQ A;  4GPL B;  1F8H A;  2BE6 A;  4M2Q A;  2GGZ A;  3SG2 A;  2JTT A;  1UHJ A;  1XK4 A;  4MZJ A;  1SY9 A;  4MZL A;  1IGV A;  4AOM A;  5DKQ A;  4XYN A;  1SW8 A;  3CS1 A;  2JT3 A;  4UPG A;  5HKY A;  2BKH B;  1DT7 B;  1R2U A;  2WCF A;  3OB2 B;  3NSK A;  2HQ8 A;  1BOC A;  1N65 A;  3CWG A;  4MEW A;  1KCY A;  4GGF C;  1M45 A;  2QAC A;  1D1O A;  5K89 A;  1NX1 A;  1NX3 A;  2H61 C;  3BOW B;  4F0Z B;  1HQV A;  1BG1 A;  1AJ4 A;  2RGI A;  3VGO A;  3QRX A;  5DKR A;  2JT8 A;  3BOW A;  1CMF A;  1K90 D;  1KFU L;  4PE4 A;  1SNL A;  2LAN A;  3F45 A;  1N0Y A;  3EK4 A;  1AJ5 A;  1CFD A;  1XVJ A;  4GBA A;  2JUL A;  4YGA A;  2BL0 B;  3HCM A;  2BBN A;  3SG6 A;  3SG4 A;  2CCM A;  2K61 A;  2LLT A;  1B8C A;  1KWO B;  1V1G A;  1DMO A;  4M2P A;  1QAT A;  2M9G A;  1TIZ A;  1R6P A;  1OMR A;  1YRT B;  1QJT A;  4ZCV A;  2BKI B;  5HLV A;  1SRA A;  4ICB A;  2ZFD A;  1IWQ A;  1LKJ A;  5HKW A;  1JFJ A;  2BL0 C;  1CDL A;  4GAO A;  3WHT B;  1CLL A;  2E30 A;  4PDZ A;  3BXK A;  4PE0 A;  5B8I B;  4PHM A;  3AAK A;  3EKH A;  3EVU A;  4M2O A;  4YGE B;  4OKH A;  1QVI Y;  4WQ3 A;  2CTN A;  1OZS A;  1Y1X A;  2JNX A;  2HQW A;  5BPJ A;  4YI9 A;  2ISD A;  1J7P A;  1GQM A;  3NSI A;  2BEC A;  1QV1 A;  1UUS A;  1N2D A;  3FS7 A;  4XJK B;  1AP4 A;  2F2P A;  2AMI A;  1EG3 A;  1LIN A;  2H2K A;  3I5I C;  2AAO A;  3EKJ A;  1WLZ A;  3E3R A;  1NX0 A;  2JXL A;  2P6B B;  3O2P A;  1FI6 A;  1XO5 A;  2BCA A;  1B47 A;  2CBL A;  3SG3 A;  4I5N B;  3ZNI A;  2M7N A;  4I5K A;  1CDN A;  1RFJ A;  1S6I A;  4MSP A;  2HET A;  4PE1 A;  1QIW A;  1AHR A;  1QV0 A;  5I2Q A;  5AEQ A;  5HYD A;  2QPT A;  2LNK A;  3BUW B;  1GGZ A;  2D8N A;  1S5G Y;  1C07 A;  1SYM A;  1REC A;  2Y4Q A;  1WRZ A;  2O60 A;  4JPZ B;  4C0K A;  4PHJ A;  3LK1 A;  5CPV A;  1EJ3 A;  2GV5 A;  3GOF A;  4MRX A;  2M1U A;  3VRN A;  1UHI A;  4MN0 A;  1BT6 A;  4BY5 A;  1BU3 A;  1OMV A;  1KFX L;  1F4O A;  1PK0 D;  1YUT A;  2L4H A;  2LMU A;  3GK2 A;  4PE7 A;  1DVI A;  2BCB A;  4QJ5 B;  1QX2 A;  2OPO A;  1ZFS A;  3AKB A;  2B1U A;  2BBM A;  4MZK A;  2KFF A;  4JQ0 D;  4PHN A;  2F2O A;  3DD4 A;  2EHB A;  2KOT A;  1MR8 A;  3PSR A;  4OV2 A;  1B9A A;  4GUK A;  3WNX B;  3NXA A;  4TNC A;  1FI5 A;  2JPT A;  1MUX A;  1RWY A;  1H4B A;  2LP2 A;  1QLS A;  1B7T Y;  2WOR A;  3SG7 A;  1CFP A;  1NIW A;  2ZNE A;  3CZT X;  1TN4 A;  5HLO A;  5AER A;  2KAX A;  2WND A;  4MLW A;  1M63 B;  1J7R A;  1NSH A;  3BUM B;  1SK6 D;  4L9M A;  2KI6 D;  4QJ3 B;  1MXL C;  1Y1U A;  1K9U A;  3TS5 C;  2KGB C;  3MSE B;  2KBI A;  2FOT A;  3DVM A;  4D1E A;  1E8A A;  1K8U A;  1XFX O;  3JVT C;  5J3X A;  4DIR A;  1G33 A;  1F54 A;  2MLE C;  1UHN A;  1YVH A;  2H61 A;  1CFC A;  1CKK A;  1PUL A;  2NZ0 A;  1W7J B;  1MHO A;  1ZAC A;  4YGC B;  1JFK A;  2LV7 A;  2EC6 C;  1KWO C;  5I2L A;  1YX8 A;  1A29 A;  1L7Z A;  2R2I A;  3RM1 A;  4CPV A;  2JTZ A;  3LCP C;  1TNW A;  1SCM C;  2ZN8 A;  2ZRT A;  1S5G Z;  2LUX A;  1S3P A;  4AQI A;  1AK8 A;  4MVF A;  3SIB A;  1NCY A;  5CSN A;  1YUR A;  1ZUZ A;  2KHN A;  4GFT A;  2LCP A;  2KBM A;  1BR4 B;  1SL7 A;  1FPW A;  3PM8 A;  3I5I B;  2LLU A;  5AAN A;  4YBH B;  1OMD A;  2GGM A;  5IBW A;  1UHK A;  2M29 A;  1KFU S;  1F71 A;  1SPY A;  1YTZ C;  1UHH A;  2KYF A;  1EL4 A;  2OS8 B;  5DKN A;  2A4J A;  5JOL A; 
#chains in the Genus database with same CATH topology
 1KK7 Z;  2F33 A;  3KEV A;  3DVK A;  1XFV O;  3PJI A;  1SL9 A;  5KU1 A;  3RLZ A;  2MJW B;  2PRU A;  2L51 A;  4R1E A;  3CTN A;  3ZWH A;  4CID A;  1A03 A;  1S6C A;  2JC2 A;  1JBA A;  4INX A;  3SS5 A;  1XFY O;  1S6J A;  1B1G A;  1LXF C;  1Y1A A;  2K2A A;  2FCD A;  2MAZ A;  2WCE A;  2K7B A;  2M3W A;  1YX7 A;  3IF7 A;  4BY4 A;  2ZKM X;  2NCO A;  2M0R A;  4XJK A;  1M31 A;  1CLM A;  1B8L A;  1JF0 A;  2PAS A;  2ZND A;  3C1V A;  2F8P A;  2NXQ A;  2WCK A;  1CM1 A;  2JWW A;  2KFH A;  3JTD B;  5JJG A;  1FW4 A;  3D75 A;  2JXC A;  2PSR A;  1QXP A;  1PSR A;  2QEO A;  3IQQ A;  1CMG A;  1DGU A;  2CT9 A;  2I2R E;  1J55 A;  4YGB B;  2LVK A;  5KSZ A;  2KAY A;  2WC8 A;  2L4I A;  1BF5 A;  1YVL A;  4ZCU A;  1A2X A;  2K7C A;  4N1F A;  2OTG B;  4DUQ A;  3SS3 A;  1JC2 A;  2WOS A;  4YGD B;  4I5L B;  2KNE A;  3R1V A;  1NCX A;  1XFR A;  1SKT A;  3D77 A;  1TCO B;  3VRR A;  1YR5 A;  1PSB A;  1NWD A;  1RK9 A;  1BJF A;  2KFG A;  4DS7 A;  1DJZ A;  3O78 A;  1SBJ A;  4INW A;  1V1F A;  3TZ1 A;  3OP0 A;  5AXI A;  2QEH A;  5FYX A;  2JZI A;  3BUX B;  1K95 A;  2I18 A;  4PCW A;  1TTX A;  1C3Y A;  1C7V A;  2PAL A;  1J7Q A;  1TNP A;  3BUN B;  3DVE A;  1XA5 A;  2G9B A;  3D73 A;  2Y1N A;  3I5F C;  3CDN A;  3D76 A;  1M39 A;  3CAB A;  2PMY A;  1X02 A;  2G2B A;  3D10 A;  1UP5 A;  1XK4 C;  4CLN A;  1QX5 B;  2KGR A;  5D7F A;  5FI2 A;  3LK0 A;  1U5I A;  1XFZ O;  2JRF A;  1WDC C;  3O4Y A;  4MRY A;  1BOD A;  1UWO A;  2PYQ A;  1NX2 A;  3PN7 C;  2LVJ A;  1MF8 B;  1TUJ A;  3KPX A;  2BAP A;  2MBX A;  3SG5 A;  2JQ6 A;  4C0L A;  1NYA A;  2LMV A;  3K21 A;  3FWC A;  4NDC A;  3R72 A;  1ALV A;  3HX4 A;  1WY9 A;  1NP8 A;  2LUC A;  1CNP A;  5DIC A;  3GK1 A;  4A4B A;  2KSP A;  5CSF A;  1L2O C;  3PAL A;  1Y0V H;  3AKA A;  2LE9 B;  1WRK A;  5I8N A;  4FQO A;  2LM5 A;  3WHU B;  4I5J A;  4FTG A;  1W7I B;  2LHI A;  1KQM B;  2K7O A;  2O5G A;  5ER5 A;  1S1E A;  1QLK A;  2AUC A;  4DRW A;  5CSJ A;  4QJ4 B;  1DF0 B;  1OOJ A;  1XFW O;  3DVJ A;  5ER4 X;  3V2L A;  3EK8 A;  3O4X A;  4Q04 A;  1K2H A;  5G08 A;  3I5H C;  1TNX A;  3UO9 A;  3TUY C;  3PAT A;  2IS9 A;  2WC5 A;  1W9Z A;  4ORC B;  5F6T A;  4JWQ A;  2MA2 A;  3DF0 B;  4HRG A;  1PRW A;  3CYZ A;  1QS7 A;  1SL8 A;  2KI6 C;  1H8B A;  1SR6 B;  2L50 A;  2KI4 B;  1C3Z A;  1M46 A;  3O6B A;  1SMG A;  2KAV A;  5TNC A;  5D69 A;  3B87 A;  1DJX A;  4U8D A;  5I2O A;  1QVI Z;  2NCP A;  1BR1 B;  3UNW A;  2MHH A;  4PHK A;  2VRG A;  1QX7 A;  2MLF C;  2NLN A;  2JU0 A;  3PFV A;  3S0E A;  1Q80 A;  3QME A;  1DGV A;  1WLM A;  5KTY A;  3KF9 A;  2KLD A;  1SCV A;  1MWN A;  1KK8 C;  3I5G C;  1TWO A;  3EVR A;  2KQY A;  3BFA A;  3NHT A;  2FJU B;  1DJY A;  3TDI A;  3IQO A;  4P5O E;  3EVV A;  2OS8 C;  2TN4 A;  3I5H B;  4GGF A;  4HRE E;  4YI8 A;  2WCL A;  3LLE A;  4ORA B;  4P2Y B;  1PVA A;  1A75 A;  3JVT B;  4NDB A;  1RRO A;  1Y6W A;  5I94 A;  3VRO A;  1WDC B;  1K94 A;  1CTR A;  4OZD A;  4DCK A;  1EH2 A;  2ZN9 A;  4NDD A;  2DOQ A;  2FJY A;  1PAL A;  3M0W A;  3SJS A;  4CFR A;  4USL A;  2V53 A;  2K8M B;  3H4S E;  4N1G A;  4YRU A;  5PAL A;  1TRF A;  1KFX S;  2KDH A;  3CR2 A;  1NCZ A;  3KHE A;  3TDU A;  1QIV A;  1YUU A;  2MRD A;  2LVI A;  2F3Z A;  1FF1 A;  1IH0 A;  4NQG A;  3S0F A;  1CDM A;  2KI4 C;  1IJ6 A;  1XYD A;  1DJH A;  1VRK A;  4GGN A;  3A4U B;  2KYC A;  3JTD C;  1UUR A;  2LHL A;  2L98 A;  1ODB A;  3BYA A;  3TUY B;  3FE9 A;  1TNQ A;  3D0Y B;  3VRQ A;  1KSM A;  1U5I B;  1AUI B;  2LAP A;  3ICB A;  3LL8 B;  3OGN A;  1CFF A;  1JWD A;  3SS4 A;  2I7A A;  3FIA A;  3TDZ A;  1HT9 A;  1LA0 A;  1PVB A;  3SIA A;  4ETO A;  4HSZ A;  1OQP A;  1DEL A;  2CXJ A;  3N7H A;  3CGA A;  1B4C A;  1CB1 A;  3A8R A;  1OOH A;  1LVC D;  2EC6 B;  4C0J A;  1KK7 Y;  1B8R A;  1ZMZ A;  2F3Y A;  2I94 A;  1XFU O;  5HKZ A;  1QWV A;  2M49 B;  2SAS A;  1DJI A;  2WCH A;  1K9K A;  2PVB A;  1FBV A;  1LA3 A;  1IKU A;  3R1O A;  2COL B;  3AAJ A;  2BE4 A;  3I5F B;  1CLB A;  3PN7 B;  1CM4 A;  1BLQ A;  2KQ6 A;  3D78 A;  2Q4U A;  1ZOT B;  2JPO A;  3BJH A;  1TOP A;  2WCJ A;  1YUS A;  1EXR A;  2LP3 A;  3R1P A;  1IG5 A;  3VRP A;  3OB1 B;  3OBV A;  4WRI A;  3CR4 X;  1DF0 A;  1IQ5 A;  1OOI X;  3K1E A;  2L2E A;  3FWB A;  2OTG C;  2M7L A;  2L5X B;  3CLN A;  4N5X A;  1BMO A;  5FI6 A;  2L5Y A;  1F55 A;  1Z2C B;  4GNK B;  1AVS A;  1OZO A;  3EK7 A;  3NSO A;  3B86 A;  4HRH A;  1OSA A;  1NPQ A;  1K93 D;  2K7D A;  2M8U A;  1T14 A;  3PLF B;  1DTL A;  2LVV A;  2E6W A;  2LLS A;  2L0P A;  4OCI A;  5CSI A;  2BNX A;  3TS5 B;  1MQ1 A;  4OR9 B;  1JUO A;  2HF5 A;  1IQ3 A;  2LC5 A;  1S26 D;  1K9P A;  1J7O A;  2ZRS A;  5GQQ C;  2SCP A;  1RTP 1;  1DQE A;  4AQJ A;  1QAS A;  1EG4 A;  1KQV A;  3GK4 X;  1DEK A;  4PAL A;  3WXA A;  1MXE A;  1SR6 C;  1ALW A;  1B7T Z;  1NUB A;  4IL1 A;  4WQ2 A;  1DJW A;  1SSE B;  2JOJ A;  2M97 A;  1C7W A;  3OX5 A;  1KSO A;  1GJY A;  4A4C A;  1JSA A;  2FCE A;  2H8V A;  2M1K B;  4E68 A;  1J1D A;  3DF0 A;  1SCM B;  2LMT A;  1Z4H A;  2K0J A;  2WC6 A;  4OVN F;  2BCX A;  1KK8 B;  1F4Q A;  2CNP A;  3DZT A;  3D0Y A;  2Y1M A;  3I5G B;  3CZ2 A;  1CDP A;  1G8I A;  1RJV A;  3BUO B;  3OHM B;  2EGD A;  1KQM C;  5AFP A;  2JT0 A;  1IJ5 A;  4PT1 A;  4ORB B;  1J1E A;  3BQ3 A;  1QTX A;  2WCB A;  1OOG A;  2JNF A;  1JF2 A;  2HPS A;  2Q91 A;  1WRL A;  3DXL A;  3KO0 A;  1TCF A;  2K2F A;  1DJG A;  4MBE A;  3CR5 X;  3NSL A;  1IRJ A;  3CZ1 A;  3OX6 A;  1F70 A;  1G4Y R;  3BFB A;  2Y5I A;  1S36 A;  1GGW A;  3L4L A;  1OE9 B;  5HL1 A;  1A4P A;  1YRU B;  4JKT A;  1A75 B;  1L2O B;  1K96 A;  2YGU A;  4GPL B;  4CFQ A;  2BE6 A;  4M2Q A;  1F8H A;  2GGZ A;  3SG2 A;  2JTT A;  1UHJ A;  1XK4 A;  4MZJ A;  1SY9 A;  4MZL A;  1OOF A;  1IGV A;  4AOM A;  5DKQ A;  4XYN A;  1SW8 A;  3CS1 A;  2JT3 A;  4UPG A;  5HKY A;  3IVT A;  2BKH B;  2QDI A;  1DT7 B;  1R2U A;  2WCF A;  3OB2 B;  3NSK A;  2HQ8 A;  1BOC A;  1N65 A;  3CWG A;  4MEW A;  1KCY A;  4GGF C;  1M45 A;  2QAC A;  1D1O A;  5K89 A;  1NX1 A;  1NX3 A;  2H61 C;  3BOW B;  2QEV A;  1HQV A;  4F0Z B;  1AJ4 A;  2RGI A;  3VGO A;  1BG1 A;  3QRX A;  2QEB A;  5DKR A;  2JT8 A;  3BOW A;  1CMF A;  1K90 D;  1KFU L;  4PE4 A;  1SNL A;  2LAN A;  3F45 A;  4IJ7 A;  1N0Y A;  3PM2 A;  3EK4 A;  1AJ5 A;  1CFD A;  1XVJ A;  3DY9 A;  4GBA A;  2JUL A;  4YGA A;  2BL0 B;  3HCM A;  2BBN A;  3SG6 A;  3SG4 A;  2CCM A;  2K61 A;  2LLT A;  1B8C A;  1KWO B;  1V1G A;  1DMO A;  4M2P A;  1QAT A;  2M9G A;  1TIZ A;  3RZS A;  1IIO A;  1R6P A;  1OMR A;  1YRT B;  1QJT A;  4ZCV A;  2BKI B;  5HLV A;  1SRA A;  4ICB A;  2ZFD A;  1IWQ A;  1LKJ A;  5HKW A;  5EL2 A;  1JFJ A;  2BL0 C;  1CDL A;  4GAO A;  3WHT B;  1CLL A;  2E30 A;  2ERB A;  3BXK A;  4PDZ A;  3S0A A;  4PE0 A;  5B8I B;  4PHM A;  3AAK A;  3EKH A;  3EVU A;  4M2O A;  3FE8 A;  4YGE B;  4OKH A;  1QVI Y;  4WQ3 A;  2CTN A;  1OZS A;  1Y1X A;  2JNX A;  2P71 A;  2HQW A;  5BPJ A;  4YI9 A;  2ISD A;  1J7P A;  1GQM A;  3NSI A;  2WCM A;  2BEC A;  1QV1 A;  1TUZ A;  1UUS A;  4F7F A;  1N2D A;  3FS7 A;  4XJK B;  1AP4 A;  2F2P A;  2AMI A;  1EG3 A;  1LIN A;  2H2K A;  3I5I C;  2AAO A;  2L2C A;  1WLZ A;  3EKJ A;  3E3R A;  3S0G A;  1NX0 A;  2JXL A;  2P6B B;  3O2P A;  1FI6 A;  1XO5 A;  2BCA A;  1B47 A;  2CBL A;  3SG3 A;  4I5N B;  3ZNI A;  2M7N A;  4I5K A;  1DC1 A;  1CDN A;  1RFJ A;  1S6I A;  3D74 A;  4MSP A;  4KYN A;  1OW4 A;  2HET A;  4PE1 A;  1QIW A;  1LS8 A;  1AHR A;  1QV0 A;  5I2Q A;  5AEQ A;  5HYD A;  2QPT A;  2LNK A;  3BUW B;  1GGZ A;  2D8N A;  1S5G Y;  1C07 A;  1SYM A;  1REC A;  2Y4Q A;  1WRZ A;  2O60 A;  4JPZ B;  4C0K A;  4PHJ A;  3LK1 A;  5CPV A;  3VB1 A;  1EJ3 A;  3NGV A;  2GV5 A;  3GOF A;  4MRX A;  2M1U A;  3VRN A;  1UHI A;  4MN0 A;  1BT6 A;  2KPH A;  4BY5 A;  1BU3 A;  1OMV A;  1KFX L;  1F4O A;  1PK0 D;  1YUT A;  2L4H A;  2LMU A;  3CZ0 A;  3GK2 A;  4PE7 A;  1DVI A;  2BCB A;  4QJ5 B;  1QX2 A;  2OPO A;  1ZFS A;  3AKB A;  2B1U A;  2BBM A;  4MZK A;  2KFF A;  4JQ0 D;  4PHN A;  2F2O A;  3DD4 A;  5FI7 A;  2EHB A;  2KOT A;  1MR8 A;  3DYE A;  3PSR A;  4OV2 A;  1B9A A;  4GUK A;  3WNX B;  4JD9 A;  3NXA A;  4TNC A;  1FI5 A;  2JPT A;  1MUX A;  1RWY A;  1H4B A;  4FQT A;  2LP2 A;  1QLS A;  1B7T Y;  2WOR A;  3S0B A;  3SG7 A;  1CFP A;  1NIW A;  2ZNE A;  3CZT X;  1TN4 A;  5HLO A;  5AER A;  1GM0 A;  2KAX A;  3L47 A;  2WND A;  4MLW A;  1M63 B;  1J7R A;  1NSH A;  3BUM B;  1SK6 D;  3NHI A;  2KI6 D;  4L9M A;  1MXL C;  1Y1U A;  1K9U A;  2PQL A;  2KGB C;  3MSE B;  4QJ3 B;  3TS5 C;  2KBI A;  2FOT A;  2GTE A;  3DVM A;  4D1E A;  1E8A A;  1K8U A;  1XFX O;  3JVT C;  5J3X A;  2P70 A;  1G33 A;  4DIR A;  1F54 A;  2MLE C;  1UHN A;  1YVH A;  2H61 A;  3Q8I A;  1CFC A;  1CKK A;  1PUL A;  1P28 A;  2NZ0 A;  1W7J B;  1MHO A;  3B88 A;  5D3O A;  1ZAC A;  4YGC B;  1JFK A;  2LV7 A;  1ORG A;  2EC6 C;  1KWO C;  3B7A A;  2KLE A;  5I2L A;  1YX8 A;  1A29 A;  1L7Z A;  2R2I A;  3RM1 A;  4CPV A;  2JTZ A;  3LCP C;  1TNW A;  1SCM C;  2ZN8 A;  2ZRT A;  1S5G Z;  2LUX A;  1S3P A;  4AQI A;  1AK8 A;  4MVF A;  3SIB A;  1NCY A;  2K60 A;  5CSN A;  3EG5 B;  3BFH A;  1YUR A;  1ZUZ A;  2KHN A;  4GFT A;  2LCP A;  2KBM A;  1BR4 B;  1SL7 A;  3S0D A;  3PM8 A;  1FPW A;  3I5I B;  2LLU A;  3L4A A;  5AAN A;  3B6X A;  4YBH B;  1OMD A;  2GGM A;  5IBW A;  1UHK A;  2M29 A;  1KFU S;  1F71 A;  1SPY A;  3FE6 A;  1YTZ C;  1UHH A;  2KYF A;  1EL4 A;  2OS8 B;  5DKN A;  2A4J A;  5JOL A; 
#chains in the Genus database with same CATH homology
 1KK7 Z;  2F33 A;  3KEV A;  3DVK A;  1XFV O;  5KU1 A;  1SL9 A;  3RLZ A;  2MJW B;  2PRU A;  2L51 A;  4R1E A;  3CTN A;  3ZWH A;  4CID A;  1A03 A;  1S6C A;  2JC2 A;  1JBA A;  1XFY O;  1S6J A;  1B1G A;  1LXF C;  1Y1A A;  2K2A A;  2FCD A;  2MAZ A;  2WCE A;  2K7B A;  2M3W A;  1YX7 A;  3IF7 A;  4BY4 A;  2ZKM X;  2NCO A;  2M0R A;  4XJK A;  1M31 A;  1CLM A;  1B8L A;  1JF0 A;  2PAS A;  2ZND A;  3C1V A;  2F8P A;  2NXQ A;  3JTD B;  1CM1 A;  2JWW A;  2KFH A;  5JJG A;  1FW4 A;  2JXC A;  2PSR A;  1QXP A;  1PSR A;  3IQQ A;  1CMG A;  1DGU A;  2CT9 A;  2I2R E;  1J55 A;  4YGB B;  2LVK A;  5KSZ A;  2KAY A;  2WC8 A;  2L4I A;  1BF5 A;  1YVL A;  4ZCU A;  1A2X A;  2K7C A;  4N1F A;  2OTG B;  4DUQ A;  1JC2 A;  2WOS A;  4YGD B;  4I5L B;  2KNE A;  1NCX A;  1SKT A;  1TCO B;  3VRR A;  1YR5 A;  1PSB A;  1NWD A;  1RK9 A;  1BJF A;  2KFG A;  4DS7 A;  1DJZ A;  3O78 A;  1SBJ A;  1V1F A;  3TZ1 A;  3OP0 A;  5AXI A;  5FYX A;  2JZI A;  3BUX B;  1K95 A;  2I18 A;  4PCW A;  1TTX A;  1C7V A;  2PAL A;  1J7Q A;  1TNP A;  3BUN B;  3DVE A;  1XA5 A;  2G9B A;  2Y1N A;  3I5F C;  1M39 A;  2PMY A;  1X02 A;  2G2B A;  3D10 A;  1UP5 A;  1XK4 C;  4CLN A;  1QX5 B;  2KGR A;  5D7F A;  3LK0 A;  1U5I A;  1XFZ O;  2JRF A;  1WDC C;  3O4Y A;  4MRY A;  1BOD A;  1UWO A;  1NX2 A;  3PN7 C;  2LVJ A;  1MF8 B;  3KPX A;  3SG5 A;  2MBX A;  2JQ6 A;  4C0L A;  1NYA A;  2LMV A;  3K21 A;  3FWC A;  4NDC A;  1ALV A;  3HX4 A;  1WY9 A;  1NP8 A;  2LUC A;  1CNP A;  3GK1 A;  4A4B A;  2KSP A;  5CSF A;  1L2O C;  3PAL A;  1Y0V H;  3AKA A;  2LE9 B;  1WRK A;  5I8N A;  4FQO A;  2LM5 A;  3WHU B;  4I5J A;  4FTG A;  1W7I B;  2LHI A;  1KQM B;  2K7O A;  2O5G A;  5ER5 A;  1S1E A;  1QLK A;  2AUC A;  4DRW A;  5CSJ A;  4QJ4 B;  1DF0 B;  1OOJ A;  1XFW O;  3DVJ A;  5ER4 X;  3EK8 A;  4Q04 A;  1K2H A;  5G08 A;  3I5H C;  1TNX A;  3TUY C;  3PAT A;  2IS9 A;  4ORC B;  5F6T A;  4JWQ A;  2MA2 A;  3DF0 B;  4HRG A;  1PRW A;  1QS7 A;  1SL8 A;  2KI6 C;  1H8B A;  1SR6 B;  2L50 A;  2KI4 B;  1M46 A;  3O6B A;  1SMG A;  2KAV A;  5TNC A;  5D69 A;  1DJX A;  4U8D A;  5I2O A;  1QVI Z;  2NCP A;  1BR1 B;  2MHH A;  4PHK A;  2VRG A;  1QX7 A;  2MLF C;  2NLN A;  2JU0 A;  3PFV A;  1Q80 A;  5KTY A;  1DGV A;  1WLM A;  3KF9 A;  1SCV A;  1MWN A;  1KK8 C;  3I5G C;  3EVR A;  2KQY A;  2FJU B;  1DJY A;  3TDI A;  3IQO A;  4P5O E;  3EVV A;  2OS8 C;  2TN4 A;  3I5H B;  4GGF A;  4HRE E;  4YI8 A;  3LLE A;  4ORA B;  4P2Y B;  1PVA A;  1A75 A;  3JVT B;  4NDB A;  1RRO A;  1Y6W A;  3VRO A;  1WDC B;  1K94 A;  1CTR A;  4DCK A;  1EH2 A;  2ZN9 A;  4NDD A;  2DOQ A;  1PAL A;  3M0W A;  3SJS A;  4CFR A;  4USL A;  2V53 A;  2K8M B;  3H4S E;  4N1G A;  4YRU A;  5PAL A;  1TRF A;  1KFX S;  2KDH A;  3CR2 A;  1NCZ A;  3KHE A;  3TDU A;  1QIV A;  1YUU A;  2MRD A;  2LVI A;  2F3Z A;  1FF1 A;  1IH0 A;  4NQG A;  1CDM A;  2KI4 C;  1IJ6 A;  1XYD A;  1DJH A;  1VRK A;  4GGN A;  3A4U B;  2KYC A;  3JTD C;  1UUR A;  2LHL A;  2L98 A;  1ODB A;  3BYA A;  3TUY B;  1TNQ A;  3D0Y B;  3VRQ A;  1KSM A;  1U5I B;  1AUI B;  2LAP A;  3ICB A;  3LL8 B;  1CFF A;  1JWD A;  2I7A A;  3FIA A;  3TDZ A;  1HT9 A;  1LA0 A;  1PVB A;  3SIA A;  4ETO A;  4HSZ A;  1OQP A;  2CXJ A;  3CGA A;  1B4C A;  1CB1 A;  3A8R A;  1LVC D;  2EC6 B;  4C0J A;  1KK7 Y;  1B8R A;  1ZMZ A;  2F3Y A;  2I94 A;  1XFU O;  5HKZ A;  2M49 B;  2SAS A;  1DJI A;  1K9K A;  2PVB A;  1FBV A;  1LA3 A;  1IKU A;  2COL B;  3AAJ A;  2BE4 A;  3I5F B;  1CLB A;  3PN7 B;  1CM4 A;  1BLQ A;  2KQ6 A;  2Q4U A;  1ZOT B;  1TOP A;  1YUS A;  1EXR A;  2LP3 A;  1IG5 A;  3VRP A;  3OB1 B;  4WRI A;  3CR4 X;  1DF0 A;  1IQ5 A;  2L2E A;  3FWB A;  2OTG C;  2M7L A;  2L5X B;  3CLN A;  4N5X A;  1BMO A;  1F55 A;  4GNK B;  1AVS A;  1OZO A;  3EK7 A;  3NSO A;  4HRH A;  1OSA A;  1NPQ A;  1K93 D;  2K7D A;  2M8U A;  3PLF B;  1DTL A;  2LVV A;  2E6W A;  2LLS A;  2L0P A;  4OCI A;  5CSI A;  3TS5 B;  1MQ1 A;  4OR9 B;  2HF5 A;  1JUO A;  1IQ3 A;  2LC5 A;  1S26 D;  1K9P A;  1J7O A;  2ZRS A;  5GQQ C;  2SCP A;  1RTP 1;  4AQJ A;  1QAS A;  1EG4 A;  1KQV A;  3GK4 X;  4PAL A;  3WXA A;  1MXE A;  1SR6 C;  1ALW A;  1B7T Z;  1NUB A;  4IL1 A;  4WQ2 A;  1DJW A;  2JOJ A;  2M97 A;  1C7W A;  3OX5 A;  1KSO A;  1GJY A;  4A4C A;  1JSA A;  2FCE A;  2M1K B;  4E68 A;  1J1D A;  3DF0 A;  1SCM B;  2LMT A;  2K0J A;  4OVN F;  2BCX A;  1KK8 B;  1F4Q A;  2CNP A;  3I5G B;  3D0Y A;  2Y1M A;  1CDP A;  1G8I A;  1RJV A;  3BUO B;  3OHM B;  2EGD A;  1KQM C;  5AFP A;  2JT0 A;  1IJ5 A;  4ORB B;  1J1E A;  3BQ3 A;  1QTX A;  2WCB A;  2JNF A;  1JF2 A;  2HPS A;  2Q91 A;  1WRL A;  3KO0 A;  1TCF A;  2K2F A;  1DJG A;  4MBE A;  3CR5 X;  3NSL A;  1IRJ A;  3OX6 A;  1F70 A;  1G4Y R;  2Y5I A;  1S36 A;  1GGW A;  1OE9 B;  1A4P A;  1YRU B;  1A75 B;  1L2O B;  1K96 A;  4CFQ A;  4GPL B;  1F8H A;  2BE6 A;  4M2Q A;  2GGZ A;  3SG2 A;  2JTT A;  1UHJ A;  1XK4 A;  4MZJ A;  1SY9 A;  4MZL A;  1IGV A;  4AOM A;  5DKQ A;  4XYN A;  1SW8 A;  3CS1 A;  2JT3 A;  4UPG A;  5HKY A;  2BKH B;  1DT7 B;  1R2U A;  2WCF A;  3OB2 B;  3NSK A;  2HQ8 A;  1BOC A;  1N65 A;  3CWG A;  4MEW A;  1KCY A;  4GGF C;  1M45 A;  2QAC A;  1D1O A;  5K89 A;  1NX1 A;  1NX3 A;  2H61 C;  3BOW B;  4F0Z B;  1HQV A;  1BG1 A;  1AJ4 A;  2RGI A;  3VGO A;  3QRX A;  5DKR A;  2JT8 A;  3BOW A;  1CMF A;  1K90 D;  1KFU L;  4PE4 A;  1SNL A;  2LAN A;  3F45 A;  1N0Y A;  3EK4 A;  1AJ5 A;  1CFD A;  1XVJ A;  4GBA A;  2JUL A;  4YGA A;  2BL0 B;  3HCM A;  2BBN A;  3SG6 A;  3SG4 A;  2CCM A;  2K61 A;  2LLT A;  1B8C A;  1KWO B;  1V1G A;  1DMO A;  4M2P A;  1QAT A;  2M9G A;  1TIZ A;  1R6P A;  1OMR A;  1YRT B;  1QJT A;  4ZCV A;  2BKI B;  5HLV A;  1SRA A;  4ICB A;  2ZFD A;  1IWQ A;  1LKJ A;  5HKW A;  1JFJ A;  2BL0 C;  1CDL A;  4GAO A;  3WHT B;  1CLL A;  2E30 A;  4PDZ A;  3BXK A;  4PE0 A;  5B8I B;  4PHM A;  3AAK A;  3EKH A;  3EVU A;  4M2O A;  4YGE B;  4OKH A;  1QVI Y;  4WQ3 A;  2CTN A;  1OZS A;  1Y1X A;  2JNX A;  2HQW A;  5BPJ A;  4YI9 A;  2ISD A;  1J7P A;  1GQM A;  3NSI A;  2BEC A;  1QV1 A;  1UUS A;  1N2D A;  3FS7 A;  4XJK B;  1AP4 A;  2F2P A;  2AMI A;  1EG3 A;  1LIN A;  2H2K A;  3I5I C;  2AAO A;  3EKJ A;  1WLZ A;  3E3R A;  1NX0 A;  2JXL A;  2P6B B;  3O2P A;  1FI6 A;  1XO5 A;  2BCA A;  1B47 A;  2CBL A;  3SG3 A;  4I5N B;  3ZNI A;  2M7N A;  4I5K A;  1CDN A;  1RFJ A;  1S6I A;  4MSP A;  2HET A;  4PE1 A;  1QIW A;  1AHR A;  1QV0 A;  5I2Q A;  5AEQ A;  5HYD A;  2QPT A;  2LNK A;  3BUW B;  1GGZ A;  2D8N A;  1S5G Y;  1C07 A;  1SYM A;  1REC A;  2Y4Q A;  1WRZ A;  2O60 A;  4JPZ B;  4C0K A;  4PHJ A;  3LK1 A;  5CPV A;  1EJ3 A;  2GV5 A;  3GOF A;  4MRX A;  2M1U A;  3VRN A;  1UHI A;  4MN0 A;  1BT6 A;  4BY5 A;  1BU3 A;  1OMV A;  1KFX L;  1F4O A;  1PK0 D;  1YUT A;  2L4H A;  2LMU A;  3GK2 A;  4PE7 A;  1DVI A;  2BCB A;  4QJ5 B;  1QX2 A;  2OPO A;  1ZFS A;  3AKB A;  2B1U A;  2BBM A;  4MZK A;  2KFF A;  4JQ0 D;  4PHN A;  2F2O A;  3DD4 A;  2EHB A;  2KOT A;  1MR8 A;  3PSR A;  4OV2 A;  1B9A A;  4GUK A;  3WNX B;  3NXA A;  4TNC A;  1FI5 A;  2JPT A;  1MUX A;  1RWY A;  1H4B A;  2LP2 A;  1QLS A;  1B7T Y;  2WOR A;  3SG7 A;  1CFP A;  1NIW A;  2ZNE A;  3CZT X;  1TN4 A;  5HLO A;  5AER A;  2KAX A;  2WND A;  4MLW A;  1M63 B;  1J7R A;  1NSH A;  3BUM B;  1SK6 D;  4L9M A;  2KI6 D;  4QJ3 B;  1MXL C;  1Y1U A;  1K9U A;  3TS5 C;  2KGB C;  3MSE B;  2KBI A;  2FOT A;  3DVM A;  4D1E A;  1E8A A;  1K8U A;  1XFX O;  3JVT C;  5J3X A;  4DIR A;  1G33 A;  1F54 A;  2MLE C;  1UHN A;  1YVH A;  2H61 A;  1CFC A;  1CKK A;  1PUL A;  2NZ0 A;  1W7J B;  1MHO A;  1ZAC A;  4YGC B;  1JFK A;  2LV7 A;  2EC6 C;  1KWO C;  5I2L A;  1YX8 A;  1A29 A;  1L7Z A;  2R2I A;  3RM1 A;  4CPV A;  2JTZ A;  3LCP C;  1TNW A;  1SCM C;  2ZN8 A;  2ZRT A;  1S5G Z;  2LUX A;  1S3P A;  4AQI A;  1AK8 A;  4MVF A;  3SIB A;  1NCY A;  5CSN A;  1YUR A;  1ZUZ A;  2KHN A;  4GFT A;  2LCP A;  2KBM A;  1BR4 B;  1SL7 A;  1FPW A;  3PM8 A;  3I5I B;  2LLU A;  5AAN A;  4YBH B;  1OMD A;  2GGM A;  5IBW A;  1UHK A;  2M29 A;  1KFU S;  1F71 A;  1SPY A;  1YTZ C;  1UHH A;  2KYF A;  1EL4 A;  2OS8 B;  5DKN A;  2A4J A;  5JOL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...