1S5GY

Structure of scallop myosin s1 reveals a novel nucleotide conformation
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
142
structure length
142
Chain Sequence
PQKQIQEMKEAFSMIDVDRDGFVSKEDIKAISEQLGRAPDDKELTAMLKEAPGPLNFTMFLSIFSDKLSGTDSEETIRNAFAMFDEQETKKLNIEYIKDLLENMGDNFNKDEMRMTFKEAPVEGGKFDYVKFTAMIKGSGEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Myosin heavy chain, striated muscle
publication title Myosin subfragment 1 structures reveal a partially bound nucleotide and a complex salt bridge that helps couple nucleotide and actin binding.
pubmed doi rcsb
molecule tags Contractile protein
total genus 26
structure length 142
sequence length 142
ec nomenclature
pdb deposition date 2004-01-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Y PF13405 EF-hand_6 EF-hand domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1s5gY01
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1s5gY02
3O2PA 2K2FA 4GGNA 3TS5C 2BCAA 4GBAA 3NXAA 3SG5A 1SR6C 1YRUB 2LUXA 4M2QA 1XVJA 1SKTA 1U5IB 5KSZA 1JSAA 3SG3A 1WRLA 2LVVA 2ZN9A 2G2BA 2JT8A 1JBAA 4JQ0D 4USLA 3BUWB 2LMUA 1LA3A 3GK2A 1NX0A 2JNXA 2L5XB 4ICBA 2KGRA 5I8NA 1A29A 2HF5A 4PE4A 3FS7A 1Y6WA 2MLEC 2M7LA 4NDCA 5CSJA 1K94A 1W7JB 1EH2A 1KK7Y 3PM8A 1B4CA 1K93D 2K7BA 4ETOA 3VRPA 2BCXA 1CTRA 1K9PA 1RK9A 1XFWO 2KBMA 1K8UA 3BYAA 3SG2A 1NWDA 1RROA 1XFVO 5HKZA 4F0ZB 4NDBA 1LKJA 4GAOA 1J7OA 2K7CA 2KQ6A 2JZIA 3IQOA 4GGFA 1RFJA 3PFVA 2BBNA 2CCMA 1AVSA 2BECA 1JF0A 4OR9B 2AUCA 2BBMA 4YRUA 4AQJA 2CBLA 5KTYA 4JPZB 2F2OA 1QIVA 2LP3A 1AUIB 4PCWA 3MSEB 2O60A 3SG4A 2LP2A 1WRKA 2LANA 1IGVA 1TOPA 3I5HC 2Y5IA 4ZCVA 1CLBA 4GNKB 3FWBA 2A4JA 3KHEA 3PN7B 4YGBB 4DRWA 2L4IA 3BUNB 2ZNDA 3DVJA 3C1VA 1UHKA 1MHOA 4ORCB 2KFFA 1DGUA 3I5IC 1TRFA 1A4PA 2V53A 1AP4A 1SBJA 3JVTB 1FW4A 3BXKA 2LLSA 1TNPA 1R2UA 2JOJA 5HLVA 1XFXO 3VRRA 2QACA 2JPTA 2F3ZA 3ICBA 4E68A 1QX5B 2K7DA 2NZ0A 1KK7Z 2KAVA 4MSPA 2M49B 5I2OA 1QLKA 1PVAA 2AAOA 3KEVA 3AAJA 2I18A 3CR2A 1NCZA 2OPOA 4C0KA 2JNFA 4GPLB 3FWCA 1F4OA 1JWDA 2HQWA 1C7WA 4OCIA 2OS8B 4HREE 2ZFDA 3VRQA 2LLUA 5AXIA 3HCMA 2BE4A 5ER4X 5AERA 2WOSA 1M45A 4YI9A 3H4SE 1OSAA 1PSRA 1CKKA 1SCVA 2LV7A 3A8RA 2PALA 1J7QA 2LHLA 4UPGA 2NXQA 2Y1NA 5AANA 5GQQC 3CLNA 2LVIA 1S36A 2K8MB 1K2HA 1S3PA 4R1EA 1NX2A 1HT9A 1Q80A 2WC8A 4N1GA 2AMIA 1XK4C 2LNKA 4OV2A 5J3XA 3RLZA 3TDIA 1GQMA 1FPWA 1K96A 3CR5X 2RGIA 3FIAA 2LE9B 4L9MA 5ER5A 1BT6A 3NSKA 3SG7A 2M29A 3EK7A 3PN7C 1BG1A 1EJ3A 2F33A 2JT3A 4GUKA 3ZNIA 5DKRA 3DD4A 1TNQA 3WHUB 1IRJA 1S6JA 3NSOA 4YGCB 3CTNA 4WRIA 2KNEA 3EK4A 1YURA 3I5IB 5F6TA 1CFCA 1HQVA 1QIWA 1QV0A 3EKHA 3JVTC 2KHNA 1RTP1 2PVBA 4N5XA 1PSBA 3DVMA 3O6BA 1IH0A 1DF0A 1F4QA 2LCPA 2GGMA 5I2LA 3WHTB 4HSZA 1EL4A 4PHJA 5K89A 1OE9B 1F71A 1ZUZA 1YX8A 2L0PA 1V1GA 1IQ3A 2L2EA 5JOLA 2I7AA 4AQIA 1G4YR 1IG5A 1MQ1A 1KSMA 3A4UB 1CFPA 4QJ4B 2BCBA 2PSRA 3I5GB 1UUSA 1A03A 2MBXA 3SIAA 1ZMZA 2F8PA 1KWOC 1QJTA 1DMOA 1RJVA 3CS1A 4M2PA 1NPQA 1JFKA 2JU0A 2OS8C 2JRFA 3TDUA 1VRKA 3GK1A 1SL9A 1M39A 1ODBA 1V1FA 2LLTA 1CLMA 4YBHB 1PALA 4CLNA 4I5JA 1B47A 1MXEA 1F8HA 4YGDB 4QJ5B 1UHHA 1J1DA 1AJ4A 2HETA 2IS9A 3NSIA 2LVJA 4C0LA 1MWNA 3BQ3A 1LXFC 4NQGA 1C07A 2JQ6A 2KBIA 2H2KA 1FI6A 3DF0A 1XO5A 2M97A 3K21A 4GGFC 2HQ8A 1NCYA 1QTXA 2KFHA 5HYDA 4NDDA 1DJGA 2M1KB 1Y1XA 3BOWB 1SMGA 4HRHA 4MLWA 2EHBA 4XYNA 1H8BA 1NP8A 1LINA 3LK1A 4I5LB 4BY5A 1AJ5A 1XA5A 4MN0A 2KSPA 1UP5A 2L4HA 1CDPA 1M31A 1QX7A 1B7TY 1PULA 2M7NA 1FI5A 1BJFA 2NCOA 3OB1B 1J7PA 1J55A 2QPTA 5HKWA 3RM1A 3PALA 1DJZA 1QVIZ 3PSRA 3PLFB 4MVFA 3LL8B 2KQYA 4AOMA 4IL1A 2GGZA 3VRNA 2SCPA 4YGAA 2LVKA 2VRGA 1BR4B 2P6BB 1XYDA 1H4BA 1DF0B 1YUSA 2FOTA 3I5GC 1TIZA 4OKHA 4PE1A 1K95A 4OVNF 2LHIA 2Q4UA 1BU3A 4PHKA 2JTZA 2MRDA 1G33A 1QS7A 1B1GA 3D10A 3BUXB 5I2QA 3TUYB 1FBVA 1KWOB 2M9GA 1ALWA 4HRGA 1EG3A 1QXPA 2GV5A 3KF9A 1TN4A 1SY9A 1R6PA 1WDCB 1IJ5A 2KYFA 2MHHA 1A75A 2Y1MA 1W7IB 1M63B 3OP0A 1IKUA 1IJ6A 3WNXB 1KFXS 2DOQA 2G9BA 2JT0A 2F3YA 4PALA 1DT7B 2FCDA 2K0JA 1KQVA 1NX3A 4XJKA 1PVBA 2LAPA 4D1EA 3VROA 1PK0D 1WLMA 2F2PA 1XFZO 3KPXA 1DJXA 2Q91A 4MZKA 1S1EA 2WCEA 4MBEA 3SIBA 5B8IB 2KI6C 1NIWA 2ISDA 3JTDC 2OTGB 3AKBA 3O78A 1KSOA 1B7TZ 1OMRA 1BF5A 1YUUA 4I5KA 1CM1A 3OX6A 1K9UA 4ORAB 1DJYA 3DF0B 3OB2B 2R2IA 1SW8A 5JJGA 1AHRA 1QASA 2JULA 2PASA 5PALA 4PDZA 3DVEA 1B9AA 2ZRTA 1KQMB 5FYXA 2NCPA 1WY9A 1KCYA 3TZ1A 3AAKA 1K90D 4MEWA 2KDHA 3IF7A 4C0JA 2WCFA 1QVIY 4PHNA 2LM5A 1YTZC 2MAZA 2KI4B 1UHJA 4U8DA 2LMVA 1OZOA 1TNWA 2PMYA 2TN4A 4CFRA 3EVUA 1SRAA 2CXJA 1TCFA 1KFXL 1K9KA 5AEQA 3M0WA 2KGBC 2BKHB 2I2RE 5DKNA 4CIDA 3TUYC 1KK8B 2HPSA 1S5GZ 1Y0VH 2H61A 1CMGA 1NX1A 1N2DA 1NCXA 5HKYA 1S6CA 2JXLA 1WDCC 1ZOTB 1CFDA 3I5FB 1JUOA 1BOCA 1EG4A 1S26D 4N1FA 4A4CA 2PRUA 2KAXA 4DCKA 1LVCD 4M2OA 1OZSA 2ZKMX 1GJYA 1MR8A 2D8NA 2H61C 5BPJA 3CGAA 1TNXA 4WQ2A 1YUTA 1SCMB 1TCOB 2EC6B 1E8AA 1ZFSA 1CM4A 3IQQA 4P2YB 5IBWA 3SG6A 1A75B 1PRWA 2M3WA 2LMTA 2KYCA 2LC5A 1N0YA 4MRYA 3SJSA 1UHIA 2JWWA 1YVHA 1YX7A 4TNCA 2OTGC 1YRTB 2WCBA 4I5NB 2B1UA 3JTDB 2L50A 4DUQA 3LK0A 1DJWA 4XJKB 3NSLA 4JWQA 1JC2A 5CSFA 3D0YA 1CLLA 5TNCA 3AKAA 1YR5A 2MA2A 1GGZA 4FQOA 2KAYA 5CSIA 4ZCUA 1KQMC 5KU1A 4GFTA 1CDNA 2I94A 1L2OB 1SL8A 2M1UA 2ZNEA 4CPVA 2JTTA 3BUOB 2BL0B 3HX4A 1BR1B 1X02A 1IWQA 2NLNA 5DKQA 1G8IA 1OMDA 2MLFC 3BUMB 4ORBB 1QV1A 1EXRA 2KI4C 1M46A 1CDMA 2ZN8A 1Y1AA 2BE6A 1JFJA 2FJUB 3GK4X 5HLOA 1XFUO 1U5IA 4Q04A 2KI6D 2JC2A 2MJWB 5CPVA 1BLQA 1MF8B 1OQPA 1SPYA 1Y1UA 4PE0A 2CNPA 1CMFA 1KK8C 5G08A 3PATA 4MZJA 1XFYO 3EK8A 1F55A 1NUBA 3TS5B 1LA0A 1SR6B 1KFUS 3OX5A 3F45A 3ZWHA 1QLSA 3WXAA 1J1EA 1B8LA 1DVIA 1ZACA 2K61A 3I5FC 2CT9A 4MZLA 4QJ3B 2COLB 1S5GY 1CFFA 3VGOA 1SK6D 4MRXA 1OMVA 1BMOA 3QRXA 4YGEB 2L51A 2L98A 1FF1A 3GOFA 4DS7A 1C7VA 1MUXA 4PHMA 1SL7A 4DIRA 1SYMA 1SCMC 2EGDA 1DJIA 2EC6C 1NYAA 4CFQA 1B8CA 1OOJA 2WORA 4P5OE 5CSNA 1F54A 5D7FA 4YI8A 2E6WA 2FCEA 1QX2A 1TTXA 1S6IA 4FTGA 2E30A 3EKJA 2KFGA 1ALVA 1NSHA 1UURA 1CNPA 3DVKA 3OHMB 2K2AA 1QATA 1CDLA 4PE7A 3EVVA 1XK4A 1YVLA 1D1OA 3BOWA 1B8RA 1RWYA 1UHNA 1UWOA 1N65A 3O4YA 1BODA 1RECA 1J7RA 1GGWA 1AK8A 2JXCA 2Y4QA 1L2OC 2O5GA 2WNDA 2M8UA 1A2XA 1DJHA 2BKIB 3TDZA 4A4BA 2BL0C 2SASA 1IQ5A 1F70A 2LUCA 3EVRA 3D0YB 1SNLA 3E3RA 1JF2A 3KO0A 3LCPC 3I5HB 2ZRSA 1KFUL 4WQ3A 5D69A 3CWGA 1CB1A 1WLZA 2M0RA 1WRZA 3CR4X 1L7ZA 2KOTA 2K7OA 1MXLC 4BY4A 3CZTX 1DTLA 3LLEA 2CTNA 1DGVA 5AFPA
chains in the Genus database with same CATH superfamily
5EL2A 3O2PA 2K2FA 4GGNA 2QEOA 3TS5C 2BCAA 4GBAA 3NXAA 3SG5A 1SR6C 1YRUB 2LUXA 2KLDA 1XVJA 4M2QA 1SKTA 1U5IB 5KSZA 1JSAA 3SG3A 1WRLA 2LVVA 2ZN9A 2G2BA 2JT8A 1JBAA 4JQ0D 3L4LA 1OW4A 4USLA 3BUWB 2LMUA 1LA3A 3GK2A 3QMEA 3B88A 1NX0A 2JNXA 2L5XB 4ICBA 2KGRA 5I8NA 1A29A 2HF5A 4PE4A 3FS7A 3D73A 1Y6WA 2MLEC 2M7LA 4NDCA 5CSJA 1K94A 1W7JB 3S0EA 1EH2A 1KK7Y 3PM8A 1B4CA 1K93D 2K7BA 4ETOA 3VRPA 2BCXA 1CTRA 1K9PA 1RK9A 1XFWO 2KBMA 1K8UA 3BYAA 3SG2A 1NWDA 1RROA 1XFVO 5HKZA 4F0ZB 4NDBA 2L2CA 1LKJA 4GAOA 1J7OA 2K7CA 2KQ6A 2JZIA 3B87A 3IQOA 4GGFA 1RFJA 3PFVA 2BBNA 2CCMA 5FI6A 1AVSA 2BECA 1JF0A 4OR9B 2AUCA 2BBMA 4YRUA 4PT1A 4AQJA 2CBLA 5KTYA 4JPZB 3UO9A 2F2OA 1QIVA 2LP3A 1AUIB 2ERBA 4PCWA 3B6XA 3MSEB 2O60A 3SG4A 2LP2A 1WRKA 2LANA 1IGVA 1TOPA 3I5HC 1IIOA 2Y5IA 4ZCVA 1CLBA 4GNKB 3FWBA 2A4JA 3KHEA 3PN7B 3VB1A 5I94A 4YGBB 2QEBA 4DRWA 2L4IA 3BUNB 2ZNDA 3DVJA 3C1VA 1UHKA 3BFAA 1MHOA 4ORCB 2QEHA 2KFFA 1DGUA 3I5IC 1TRFA 1A4PA 2V53A 1AP4A 2KLEA 1SBJA 3JVTB 1FW4A 3BXKA 2LLSA 1TNPA 1R2UA 2JOJA 2KPHA 5HLVA 1XFXO 3VRRA 2QACA 2JPTA 5DICA 3DZTA 2F3ZA 3ICBA 4E68A 1QX5B 2K7DA 2NZ0A 1KK7Z 2KAVA 4MSPA 2M49B 5I2OA 3SS4A 1QLKA 1PVAA 2AAOA 3KEVA 2WC6A 3AAJA 1DQEA 2I18A 3CR2A 1NCZA 2OPOA 4C0KA 2JNFA 4GPLB 3FWCA 1F4OA 1JWDA 2HQWA 1C7WA 3L47A 4OCIA 1XFRA 2OS8B 4HREE 2ZFDA 3VRQA 2YGUA 2LLUA 2WCJA 3HCMA 2BE4A 5ER4X 5FI2A 5AXIA 5AERA 1TUZA 2WOSA 1M45A 4YI9A 3H4SE 1OSAA 3PM2A 1PSRA 3OBVA 1SCVA 2LV7A 3A8RA 1CKKA 2PALA 1J7QA 2LHLA 4UPGA 2NXQA 2Y1NA 3CABA 5AANA 5GQQC 3CLNA 3D76A 1OOHA 2BAPA 2LVIA 1S36A 2K8MB 1K2HA 1S3PA 4R1EA 1NX2A 1HT9A 1Q80A 2WC8A 4N1GA 2AMIA 1XK4C 2LNKA 4OV2A 4OZDA 3OGNA 5J3XA 1GQMA 3TDIA 1FPWA 1K96A 3CR5X 2RGIA 3FIAA 2LE9B 4KYNA 4L9MA 5ER5A 1BT6A 3NSKA 3SG7A 2M29A 3EK7A 3PN7C 1BG1A 2QDIA 4INXA 1EJ3A 1TWOA 2F33A 2JT3A 4GUKA 3ZNIA 5DKRA 3DD4A 1TNQA 3B86A 3WHUB 1IRJA 1S6JA 3NSOA 4YGCB 5HL1A 3CTNA 4WRIA 2KNEA 3EK4A 1YURA 3I5IB 5F6TA 1CFCA 1HQVA 1QIWA 1QV0A 3EKHA 3JVTC 2KHNA 1RTP1 2PVBA 4N5XA 1PSBA 3DVMA 3O6BA 1IH0A 1DF0A 1F4QA 2LCPA 2GGMA 5I2LA 3WHTB 4HSZA 1EL4A 4PHJA 5K89A 1OE9B 1F71A 1ZUZA 3DYEA 1YX8A 2L0PA 1V1GA 1IQ3A 2L2EA 5JOLA 2I7AA 2JPOA 4AQIA 1G4YR 1IG5A 1MQ1A 1KSMA 3A4UB 1CFPA 4QJ4B 2BCBA 2PSRA 3I5GB 1UUSA 1A03A 3R72A 3FE6A 2MBXA 3SIAA 1ZMZA 2F8PA 1KWOC 1QJTA 1DMOA 1RJVA 3CS1A 4M2PA 1NPQA 1JFKA 2JU0A 2OS8C 2JRFA 3TDUA 1VRKA 4IJ7A 3GK1A 1SL9A 1M39A 1ODBA 1V1FA 2LLTA 1CLMA 4YBHB 1PALA 4CLNA 4I5JA 1B47A 1MXEA 1F8HA 4YGDB 4QJ5B 3CDNA 1UHHA 1OOFA 1J1DA 1AJ4A 2HETA 2IS9A 3NSIA 4FQTA 2LVJA 4C0LA 1MWNA 3BQ3A 1LXFC 4NQGA 3RZSA 1C07A 2JQ6A 2KBIA 2H2KA 1FI6A 3DF0A 1XO5A 2M97A 3K21A 4GGFC 3S0BA 2HQ8A 1NCYA 1QTXA 2KFHA 2WCMA 4NDDA 1DJGA 2M1KB 1Y1XA 3BOWB 5HYDA 3O4XA 1QWVA 1SMGA 2GTEA 4JD9A 4HRHA 4MLWA 2EHBA 1W9ZA 4XYNA 4INWA 1H8BA 1NP8A 1LINA 3LK1A 4I5LB 4BY5A 1AJ5A 1XA5A 4MN0A 2KSPA 1UP5A 2L4HA 1CDPA 2P71A 3BJHA 1M31A 1QX7A 1B7TY 1PULA 2M7NA 1FI5A 1BJFA 2NCOA 3DXLA 3OB1B 1J7PA 1J55A 2QPTA 5HKWA 3RM1A 3PALA 1DJZA 1QVIZ 2K60A 3PSRA 3V2LA 1C3YA 3PLFB 4MVFA 3LL8B 1T14A 2KQYA 4AOMA 4IL1A 2PYQA 2GGZA 3VRNA 1DELA 2SCPA 4YGAA 2LVKA 2VRGA 1BR4B 2P6BB 1XYDA 1H4BA 1DF0B 1YUSA 2FOTA 3I5GC 1TIZA 4OKHA 4PE1A 1K95A 4OVNF 2LHIA 2Q4UA 1BU3A 4PHKA 2JTZA 2MRDA 1G33A 1QS7A 1B1GA 3D10A 3BUXB 5I2QA 5D3OA 3TUYB 3EG5B 1FBVA 1KWOB 2M9GA 1ALWA 4HRGA 1EG3A 1QXPA 2GV5A 2WCKA 3KF9A 1TN4A 1SY9A 1R6PA 1WDCB 1IJ5A 3NHIA 3CZ2A 2KYFA 2MHHA 1A75A 2Y1MA 1W7IB 1M63B 3OP0A 3D74A 1IKUA 1IJ6A 3WNXB 1KFXS 2DOQA 2G9BA 2JT0A 2F3YA 4PALA 1DT7B 2FCDA 2K0JA 3UNWA 1KQVA 1NX3A 4XJKA 1PVBA 2LAPA 4D1EA 3VROA 1PK0D 1TUJA 1WLMA 1XFZO 2F2PA 3KPXA 1DJXA 2Q91A 4MZKA 1S1EA 2WCEA 4MBEA 3SIBA 5B8IB 2KI6C 1NIWA 2ISDA 3R1VA 3JTDC 2OTGB 3AKBA 3O78A 1KSOA 3N7HA 1B7TZ 1OMRA 3DY9A 1BF5A 1YUUA 4I5KA 1CM1A 3OX6A 3Q8IA 1K9UA 4ORAB 3CZ0A 1DJYA 3DF0B 3OB2B 2R2IA 1SW8A 5JJGA 1AHRA 1QASA 2JULA 1ORGA 2PASA 2WC5A 5PALA 1Z4HA 4PDZA 3DVEA 1B9AA 2ZRTA 1KQMB 5FYXA 2NCPA 1WY9A 1KCYA 3TZ1A 3AAKA 2WCLA 3BFBA 1K90D 4MEWA 2KDHA 3IF7A 4C0JA 2WCFA 1QVIY 4PHNA 3B7AA 2LM5A 1YTZC 2MAZA 3S0FA 2KI4B 1UHJA 4U8DA 2LMVA 1OZOA 1TNWA 2PMYA 2TN4A 4CFRA 3EVUA 1SRAA 2CXJA 1TCFA 1P28A 1KFXL 1K9KA 5AEQA 3M0WA 2KGBC 2BKHB 2I2RE 5DKNA 4CIDA 3TUYC 1KK8B 1SSEB 2HPSA 1S5GZ 1Y0VH 2H61A 1CMGA 1NX1A 1N2DA 3S0DA 1NCXA 1OOIX 3IVTA 5HKYA 1S6CA 2JXLA 2L5YA 1WDCC 1ZOTB 1CFDA 3I5FB 1JUOA 1BOCA 1EG4A 1S26D 4N1FA 4A4CA 2PRUA 2KAXA 4DCKA 1LVCD 4M2OA 1OZSA 2ZKMX 1GJYA 1MR8A 2D8NA 2H61C 5BPJA 3CGAA 1TNXA 4WQ2A 1YUTA 1SCMB 1TCOB 2EC6B 1E8AA 1ZFSA 1CM4A 3D78A 3IQQA 4P2YB 5IBWA 3SG6A 1A75B 1PRWA 2M3WA 2LMTA 2KYCA 2LC5A 1N0YA 4MRYA 3SJSA 1UHIA 2JWWA 1YVHA 1YX7A 4TNCA 2FJYA 2OTGC 1YRTB 2WCBA 4I5NB 2B1UA 3JTDB 3D77A 2L50A 4DUQA 3LK0A 1DJWA 4XJKB 4F7FA 3FE9A 3NSLA 4JWQA 1JC2A 1GM0A 5CSFA 3D0YA 1CLLA 3R1PA 5TNCA 3AKAA 1YR5A 2MA2A 1GGZA 4FQOA 2KAYA 5CSIA 4ZCUA 1KQMC 5KU1A 4GFTA 1CDNA 2I94A 1L2OB 1SL8A 2M1UA 2ZNEA 4CPVA 2JTTA 3BUOB 2BL0B 1C3ZA 1BR1B 3FE8A 3HX4A 1X02A 1IWQA 2NLNA 2P70A 2PQLA 5DKQA 1G8IA 1OMDA 2MLFC 3BUMB 4ORBB 3S0AA 1QV1A 1EXRA 2KI4C 1M46A 1CDMA 2ZN8A 1Y1AA 3K1EA 2BE6A 1JFJA 3BFHA 2FJUB 3GK4X 5HLOA 1XFUO 1U5IA 4Q04A 3S0GA 2KI6D 2H8VA 2JC2A 2MJWB 5CPVA 2WCHA 1BLQA 1MF8B 1OQPA 1SPYA 1Y1UA 4PE0A 2CNPA 1CMFA 1KK8C 5G08A 2QEVA 3PATA 1DEKA 4MZJA 1XFYO 3EK8A 1F55A 1NUBA 3TS5B 1LA0A 1SR6B 1KFUS 3OX5A 3F45A 3ZWHA 1QLSA 3WXAA 1J1EA 1B8LA 1DVIA 1ZACA 2K61A 3I5FC 2CT9A 4MZLA 4QJ3B 2COLB 1S5GY 3CYZA 1CFFA 3VGOA 1SK6D 4MRXA 1OMVA 1BMOA 3QRXA 4YGEB 2L51A 3D75A 2L98A 1FF1A 3GOFA 5FI7A 4DS7A 1C7VA 1MUXA 4PHMA 1SL7A 4DIRA 1SYMA 1SCMC 2EGDA 1DJIA 2EC6C 1NYAA 4CFQA 3CZ1A 1B8CA 1OOJA 2WORA 4P5OE 5CSNA 1F54A 5D7FA 4YI8A 2E6WA 2FCEA 1QX2A 2BNXA 4JKTA 1TTXA 1S6IA 4FTGA 2E30A 3SS5A 3EKJA 2KFGA 1ALVA 1NSHA 1UURA 1CNPA 3DVKA 1DC1A 3OHMB 2K2AA 1QATA 1CDLA 3SS3A 4PE7A 1Z2CB 3EVVA 1XK4A 1YVLA 3NGVA 3BOWA 1D1OA 1B8RA 1RWYA 1UHNA 1UWOA 1N65A 3O4YA 1BODA 1OOGA 1RECA 1J7RA 1GGWA 1LS8A 2JXCA 2Y4QA 1L2OC 3RLZA 2O5GA 2WNDA 1AK8A 2M8UA 3PJIA 1A2XA 1DJHA 3R1OA 2BKIB 3TDZA 4A4BA 2BL0C 2SASA 1IQ5A 1F70A 3NHTA 2LUCA 3EVRA 3D0YB 1SNLA 3E3RA 1JF2A 3KO0A 3LCPC 3I5HB 2ZRSA 1KFUL 4WQ3A 5D69A 3CWGA 1CB1A 1WLZA 2M0RA 1WRZA 3CR4X 1L7ZA 2KOTA 3L4AA 2K7OA 1MXLC 4BY4A 3CZTX 1DTLA 3LLEA 2CTNA 1DGVA 5AFPA
chains in the Genus database with same CATH topology
3O2PA 2K2FA 4GGNA 3TS5C 2BCAA 4GBAA 3NXAA 3SG5A 1SR6C 1YRUB 2LUXA 4M2QA 1XVJA 1SKTA 1U5IB 5KSZA 1JSAA 3SG3A 1WRLA 2LVVA 2ZN9A 2G2BA 2JT8A 1JBAA 4JQ0D 4USLA 3BUWB 2LMUA 1LA3A 3GK2A 1NX0A 2JNXA 2L5XB 4ICBA 2KGRA 5I8NA 1A29A 2HF5A 4PE4A 3FS7A 1Y6WA 2MLEC 2M7LA 4NDCA 5CSJA 1K94A 1W7JB 1EH2A 1KK7Y 3PM8A 1B4CA 1K93D 2K7BA 4ETOA 3VRPA 2BCXA 1CTRA 1K9PA 1RK9A 1XFWO 2KBMA 1K8UA 3BYAA 3SG2A 1NWDA 1RROA 1XFVO 5HKZA 4F0ZB 4NDBA 1LKJA 4GAOA 1J7OA 2K7CA 2KQ6A 2JZIA 3IQOA 4GGFA 1RFJA 3PFVA 2BBNA 2CCMA 1AVSA 2BECA 1JF0A 4OR9B 2AUCA 2BBMA 4YRUA 4AQJA 2CBLA 5KTYA 4JPZB 2F2OA 1QIVA 2LP3A 1AUIB 4PCWA 3MSEB 2O60A 3SG4A 2LP2A 1WRKA 2LANA 1IGVA 1TOPA 3I5HC 2Y5IA 4ZCVA 1CLBA 4GNKB 3FWBA 2A4JA 3KHEA 3PN7B 4YGBB 4DRWA 2L4IA 3BUNB 2ZNDA 3DVJA 3C1VA 1UHKA 1MHOA 4ORCB 2KFFA 1DGUA 3I5IC 1TRFA 1A4PA 2V53A 1AP4A 1SBJA 3JVTB 1FW4A 3BXKA 2LLSA 1TNPA 1R2UA 2JOJA 5HLVA 1XFXO 3VRRA 2QACA 2JPTA 2F3ZA 3ICBA 4E68A 1QX5B 2K7DA 2NZ0A 1KK7Z 2KAVA 4MSPA 2M49B 5I2OA 1QLKA 1PVAA 2AAOA 3KEVA 3AAJA 2I18A 3CR2A 1NCZA 2OPOA 4C0KA 2JNFA 4GPLB 3FWCA 1F4OA 1JWDA 2HQWA 1C7WA 4OCIA 2OS8B 4HREE 2ZFDA 3VRQA 2LLUA 5AXIA 3HCMA 2BE4A 5ER4X 5AERA 2WOSA 1M45A 4YI9A 3H4SE 1OSAA 1PSRA 1CKKA 1SCVA 2LV7A 3A8RA 2PALA 1J7QA 2LHLA 4UPGA 2NXQA 2Y1NA 5AANA 5GQQC 3CLNA 2LVIA 1S36A 2K8MB 1K2HA 1S3PA 4R1EA 1NX2A 1HT9A 1Q80A 2WC8A 4N1GA 2AMIA 1XK4C 2LNKA 4OV2A 5J3XA 3RLZA 3TDIA 1GQMA 1FPWA 1K96A 3CR5X 2RGIA 3FIAA 2LE9B 4L9MA 5ER5A 1BT6A 3NSKA 3SG7A 2M29A 3EK7A 3PN7C 1BG1A 1EJ3A 2F33A 2JT3A 4GUKA 3ZNIA 5DKRA 3DD4A 1TNQA 3WHUB 1IRJA 1S6JA 3NSOA 4YGCB 3CTNA 4WRIA 2KNEA 3EK4A 1YURA 3I5IB 5F6TA 1CFCA 1HQVA 1QIWA 1QV0A 3EKHA 3JVTC 2KHNA 1RTP1 2PVBA 4N5XA 1PSBA 3DVMA 3O6BA 1IH0A 1DF0A 1F4QA 2LCPA 2GGMA 5I2LA 3WHTB 4HSZA 1EL4A 4PHJA 5K89A 1OE9B 1F71A 1ZUZA 1YX8A 2L0PA 1V1GA 1IQ3A 2L2EA 5JOLA 2I7AA 4AQIA 1G4YR 1IG5A 1MQ1A 1KSMA 3A4UB 1CFPA 4QJ4B 2BCBA 2PSRA 3I5GB 1UUSA 1A03A 2MBXA 3SIAA 1ZMZA 2F8PA 1KWOC 1QJTA 1DMOA 1RJVA 3CS1A 4M2PA 1NPQA 1JFKA 2JU0A 2OS8C 2JRFA 3TDUA 1VRKA 3GK1A 1SL9A 1M39A 1ODBA 1V1FA 2LLTA 1CLMA 4YBHB 1PALA 4CLNA 4I5JA 1B47A 1MXEA 1F8HA 4YGDB 4QJ5B 1UHHA 1J1DA 1AJ4A 2HETA 2IS9A 3NSIA 2LVJA 4C0LA 1MWNA 3BQ3A 1LXFC 4NQGA 1C07A 2JQ6A 2KBIA 2H2KA 1FI6A 3DF0A 1XO5A 2M97A 3K21A 4GGFC 2HQ8A 1NCYA 1QTXA 2KFHA 5HYDA 4NDDA 1DJGA 2M1KB 1Y1XA 3BOWB 1SMGA 4HRHA 4MLWA 2EHBA 4XYNA 1H8BA 1NP8A 1LINA 3LK1A 4I5LB 4BY5A 1AJ5A 1XA5A 4MN0A 2KSPA 1UP5A 2L4HA 1CDPA 1M31A 1QX7A 1B7TY 1PULA 2M7NA 1FI5A 1BJFA 2NCOA 3OB1B 1J7PA 1J55A 2QPTA 5HKWA 3RM1A 3PALA 1DJZA 1QVIZ 3PSRA 3PLFB 4MVFA 3LL8B 2KQYA 4AOMA 4IL1A 2GGZA 3VRNA 2SCPA 4YGAA 2LVKA 2VRGA 1BR4B 2P6BB 1XYDA 1H4BA 1DF0B 1YUSA 2FOTA 3I5GC 1TIZA 4OKHA 4PE1A 1K95A 4OVNF 2LHIA 2Q4UA 1BU3A 4PHKA 2JTZA 2MRDA 1G33A 1QS7A 1B1GA 3D10A 3BUXB 5I2QA 3TUYB 1FBVA 1KWOB 2M9GA 1ALWA 4HRGA 1EG3A 1QXPA 2GV5A 3KF9A 1TN4A 1SY9A 1R6PA 1WDCB 1IJ5A 2KYFA 2MHHA 1A75A 2Y1MA 1W7IB 1M63B 3OP0A 1IKUA 1IJ6A 3WNXB 1KFXS 2DOQA 2G9BA 2JT0A 2F3YA 4PALA 1DT7B 2FCDA 2K0JA 1KQVA 1NX3A 4XJKA 1PVBA 2LAPA 4D1EA 3VROA 1PK0D 1WLMA 2F2PA 1XFZO 3KPXA 1DJXA 2Q91A 4MZKA 1S1EA 2WCEA 4MBEA 3SIBA 5B8IB 2KI6C 1NIWA 2ISDA 3JTDC 2OTGB 3AKBA 3O78A 1KSOA 1B7TZ 1OMRA 1BF5A 1YUUA 4I5KA 1CM1A 3OX6A 1K9UA 4ORAB 1DJYA 3DF0B 3OB2B 2R2IA 1SW8A 5JJGA 1AHRA 1QASA 2JULA 2PASA 5PALA 4PDZA 3DVEA 1B9AA 2ZRTA 1KQMB 5FYXA 2NCPA 1WY9A 1KCYA 3TZ1A 3AAKA 1K90D 4MEWA 2KDHA 3IF7A 4C0JA 2WCFA 1QVIY 4PHNA 2LM5A 1YTZC 2MAZA 2KI4B 1UHJA 4U8DA 2LMVA 1OZOA 1TNWA 2PMYA 2TN4A 4CFRA 3EVUA 1SRAA 2CXJA 1TCFA 1KFXL 1K9KA 5AEQA 3M0WA 2KGBC 2BKHB 2I2RE 5DKNA 4CIDA 3TUYC 1KK8B 2HPSA 1S5GZ 1Y0VH 2H61A 1CMGA 1NX1A 1N2DA 1NCXA 5HKYA 1S6CA 2JXLA 1WDCC 1ZOTB 1CFDA 3I5FB 1JUOA 1BOCA 1EG4A 1S26D 4N1FA 4A4CA 2PRUA 2KAXA 4DCKA 1LVCD 4M2OA 1OZSA 2ZKMX 1GJYA 1MR8A 2D8NA 2H61C 5BPJA 3CGAA 1TNXA 4WQ2A 1YUTA 1SCMB 1TCOB 2EC6B 1E8AA 1ZFSA 1CM4A 3IQQA 4P2YB 5IBWA 3SG6A 1A75B 1PRWA 2M3WA 2LMTA 2KYCA 2LC5A 1N0YA 4MRYA 3SJSA 1UHIA 2JWWA 1YVHA 1YX7A 4TNCA 2OTGC 1YRTB 2WCBA 4I5NB 2B1UA 3JTDB 2L50A 4DUQA 3LK0A 1DJWA 4XJKB 3NSLA 4JWQA 1JC2A 5CSFA 3D0YA 1CLLA 5TNCA 3AKAA 1YR5A 2MA2A 1GGZA 4FQOA 2KAYA 5CSIA 4ZCUA 1KQMC 5KU1A 4GFTA 1CDNA 2I94A 1L2OB 1SL8A 2M1UA 2ZNEA 4CPVA 2JTTA 3BUOB 2BL0B 3HX4A 1BR1B 1X02A 1IWQA 2NLNA 5DKQA 1G8IA 1OMDA 2MLFC 3BUMB 4ORBB 1QV1A 1EXRA 2KI4C 1M46A 1CDMA 2ZN8A 1Y1AA 2BE6A 1JFJA 2FJUB 3GK4X 5HLOA 1XFUO 1U5IA 4Q04A 2KI6D 2JC2A 2MJWB 5CPVA 1BLQA 1MF8B 1OQPA 1SPYA 1Y1UA 4PE0A 2CNPA 1CMFA 1KK8C 5G08A 3PATA 4MZJA 1XFYO 3EK8A 1F55A 1NUBA 3TS5B 1LA0A 1SR6B 1KFUS 3OX5A 3F45A 3ZWHA 1QLSA 3WXAA 1J1EA 1B8LA 1DVIA 1ZACA 2K61A 3I5FC 2CT9A 4MZLA 4QJ3B 2COLB 1S5GY 1CFFA 3VGOA 1SK6D 4MRXA 1OMVA 1BMOA 3QRXA 4YGEB 2L51A 2L98A 1FF1A 3GOFA 4DS7A 1C7VA 1MUXA 4PHMA 1SL7A 4DIRA 1SYMA 1SCMC 2EGDA 1DJIA 2EC6C 1NYAA 4CFQA 1B8CA 1OOJA 2WORA 4P5OE 5CSNA 1F54A 5D7FA 4YI8A 2E6WA 2FCEA 1QX2A 1TTXA 1S6IA 4FTGA 2E30A 3EKJA 2KFGA 1ALVA 1NSHA 1UURA 1CNPA 3DVKA 3OHMB 2K2AA 1QATA 1CDLA 4PE7A 3EVVA 1XK4A 1YVLA 1D1OA 3BOWA 1B8RA 1RWYA 1UHNA 1UWOA 1N65A 3O4YA 1BODA 1RECA 1J7RA 1GGWA 1AK8A 2JXCA 2Y4QA 1L2OC 2O5GA 2WNDA 2M8UA 1A2XA 1DJHA 2BKIB 3TDZA 4A4BA 2BL0C 2SASA 1IQ5A 1F70A 2LUCA 3EVRA 3D0YB 1SNLA 3E3RA 1JF2A 3KO0A 3LCPC 3I5HB 2ZRSA 1KFUL 4WQ3A 5D69A 3CWGA 1CB1A 1WLZA 2M0RA 1WRZA 3CR4X 1L7ZA 2KOTA 2K7OA 1MXLC 4BY4A 3CZTX 1DTLA 3LLEA 2CTNA 1DGVA 5AFPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3O2P A;  2K2F A;  4GGN A;  3TS5 C;  2BCA A;  4GBA A;  3NXA A;  3SG5 A;  1SR6 C;  1YRU B;  2LUX A;  4M2Q A;  1XVJ A;  1SKT A;  1U5I B;  5KSZ A;  1JSA A;  3SG3 A;  1WRL A;  2LVV A;  2ZN9 A;  2G2B A;  2JT8 A;  1JBA A;  4JQ0 D;  4USL A;  3BUW B;  2LMU A;  1LA3 A;  3GK2 A;  1NX0 A;  2JNX A;  2L5X B;  4ICB A;  2KGR A;  5I8N A;  1A29 A;  2HF5 A;  4PE4 A;  3FS7 A;  1Y6W A;  2MLE C;  2M7L A;  4NDC A;  5CSJ A;  1K94 A;  1W7J B;  1EH2 A;  1KK7 Y;  3PM8 A;  1B4C A;  1K93 D;  2K7B A;  4ETO A;  3VRP A;  2BCX A;  1CTR A;  1K9P A;  1RK9 A;  1XFW O;  2KBM A;  1K8U A;  3BYA A;  3SG2 A;  1NWD A;  1RRO A;  1XFV O;  5HKZ A;  4F0Z B;  4NDB A;  1LKJ A;  4GAO A;  1J7O A;  2K7C A;  2KQ6 A;  2JZI A;  3IQO A;  4GGF A;  1RFJ A;  3PFV A;  2BBN A;  2CCM A;  1AVS A;  2BEC A;  1JF0 A;  4OR9 B;  2AUC A;  2BBM A;  4YRU A;  4AQJ A;  2CBL A;  5KTY A;  4JPZ B;  2F2O A;  1QIV A;  2LP3 A;  1AUI B;  4PCW A;  3MSE B;  2O60 A;  3SG4 A;  2LP2 A;  1WRK A;  2LAN A;  1IGV A;  1TOP A;  3I5H C;  2Y5I A;  4ZCV A;  1CLB A;  4GNK B;  3FWB A;  2A4J A;  3KHE A;  3PN7 B;  4YGB B;  4DRW A;  2L4I A;  3BUN B;  2ZND A;  3DVJ A;  3C1V A;  1UHK A;  1MHO A;  4ORC B;  2KFF A;  1DGU A;  3I5I C;  1TRF A;  1A4P A;  2V53 A;  1AP4 A;  1SBJ A;  3JVT B;  1FW4 A;  3BXK A;  2LLS A;  1TNP A;  1R2U A;  2JOJ A;  5HLV A;  1XFX O;  3VRR A;  2QAC A;  2JPT A;  2F3Z A;  3ICB A;  4E68 A;  1QX5 B;  2K7D A;  2NZ0 A;  1KK7 Z;  2KAV A;  4MSP A;  2M49 B;  5I2O A;  1QLK A;  1PVA A;  2AAO A;  3KEV A;  3AAJ A;  2I18 A;  3CR2 A;  1NCZ A;  2OPO A;  4C0K A;  2JNF A;  4GPL B;  3FWC A;  1F4O A;  1JWD A;  2HQW A;  1C7W A;  4OCI A;  2OS8 B;  4HRE E;  2ZFD A;  3VRQ A;  2LLU A;  5AXI A;  3HCM A;  2BE4 A;  5ER4 X;  5AER A;  2WOS A;  1M45 A;  4YI9 A;  3H4S E;  1OSA A;  1PSR A;  1CKK A;  1SCV A;  2LV7 A;  3A8R A;  2PAL A;  1J7Q A;  2LHL A;  4UPG A;  2NXQ A;  2Y1N A;  5AAN A;  5GQQ C;  3CLN A;  2LVI A;  1S36 A;  2K8M B;  1K2H A;  1S3P A;  4R1E A;  1NX2 A;  1HT9 A;  1Q80 A;  2WC8 A;  4N1G A;  2AMI A;  1XK4 C;  2LNK A;  4OV2 A;  5J3X A;  3RLZ A;  3TDI A;  1GQM A;  1FPW A;  1K96 A;  3CR5 X;  2RGI A;  3FIA A;  2LE9 B;  4L9M A;  5ER5 A;  1BT6 A;  3NSK A;  3SG7 A;  2M29 A;  3EK7 A;  3PN7 C;  1BG1 A;  1EJ3 A;  2F33 A;  2JT3 A;  4GUK A;  3ZNI A;  5DKR A;  3DD4 A;  1TNQ A;  3WHU B;  1IRJ A;  1S6J A;  3NSO A;  4YGC B;  3CTN A;  4WRI A;  2KNE A;  3EK4 A;  1YUR A;  3I5I B;  5F6T A;  1CFC A;  1HQV A;  1QIW A;  1QV0 A;  3EKH A;  3JVT C;  2KHN A;  1RTP 1;  2PVB A;  4N5X A;  1PSB A;  3DVM A;  3O6B A;  1IH0 A;  1DF0 A;  1F4Q A;  2LCP A;  2GGM A;  5I2L A;  3WHT B;  4HSZ A;  1EL4 A;  4PHJ A;  5K89 A;  1OE9 B;  1F71 A;  1ZUZ A;  1YX8 A;  2L0P A;  1V1G A;  1IQ3 A;  2L2E A;  5JOL A;  2I7A A;  4AQI A;  1G4Y R;  1IG5 A;  1MQ1 A;  1KSM A;  3A4U B;  1CFP A;  4QJ4 B;  2BCB A;  2PSR A;  3I5G B;  1UUS A;  1A03 A;  2MBX A;  3SIA A;  1ZMZ A;  2F8P A;  1KWO C;  1QJT A;  1DMO A;  1RJV A;  3CS1 A;  4M2P A;  1NPQ A;  1JFK A;  2JU0 A;  2OS8 C;  2JRF A;  3TDU A;  1VRK A;  3GK1 A;  1SL9 A;  1M39 A;  1ODB A;  1V1F A;  2LLT A;  1CLM A;  4YBH B;  1PAL A;  4CLN A;  4I5J A;  1B47 A;  1MXE A;  1F8H A;  4YGD B;  4QJ5 B;  1UHH A;  1J1D A;  1AJ4 A;  2HET A;  2IS9 A;  3NSI A;  2LVJ A;  4C0L A;  1MWN A;  3BQ3 A;  1LXF C;  4NQG A;  1C07 A;  2JQ6 A;  2KBI A;  2H2K A;  1FI6 A;  3DF0 A;  1XO5 A;  2M97 A;  3K21 A;  4GGF C;  2HQ8 A;  1NCY A;  1QTX A;  2KFH A;  5HYD A;  4NDD A;  1DJG A;  2M1K B;  1Y1X A;  3BOW B;  1SMG A;  4HRH A;  4MLW A;  2EHB A;  4XYN A;  1H8B A;  1NP8 A;  1LIN A;  3LK1 A;  4I5L B;  4BY5 A;  1AJ5 A;  1XA5 A;  4MN0 A;  2KSP A;  1UP5 A;  2L4H A;  1CDP A;  1M31 A;  1QX7 A;  1B7T Y;  1PUL A;  2M7N A;  1FI5 A;  1BJF A;  2NCO A;  3OB1 B;  1J7P A;  1J55 A;  2QPT A;  5HKW A;  3RM1 A;  3PAL A;  1DJZ A;  1QVI Z;  3PSR A;  3PLF B;  4MVF A;  3LL8 B;  2KQY A;  4AOM A;  4IL1 A;  2GGZ A;  3VRN A;  2SCP A;  4YGA A;  2LVK A;  2VRG A;  1BR4 B;  2P6B B;  1XYD A;  1H4B A;  1DF0 B;  1YUS A;  2FOT A;  3I5G C;  1TIZ A;  4OKH A;  4PE1 A;  1K95 A;  4OVN F;  2LHI A;  2Q4U A;  1BU3 A;  4PHK A;  2JTZ A;  2MRD A;  1G33 A;  1QS7 A;  1B1G A;  3D10 A;  3BUX B;  5I2Q A;  3TUY B;  1FBV A;  1KWO B;  2M9G A;  1ALW A;  4HRG A;  1EG3 A;  1QXP A;  2GV5 A;  3KF9 A;  1TN4 A;  1SY9 A;  1R6P A;  1WDC B;  1IJ5 A;  2KYF A;  2MHH A;  1A75 A;  2Y1M A;  1W7I B;  1M63 B;  3OP0 A;  1IKU A;  1IJ6 A;  3WNX B;  1KFX S;  2DOQ A;  2G9B A;  2JT0 A;  2F3Y A;  4PAL A;  1DT7 B;  2FCD A;  2K0J A;  1KQV A;  1NX3 A;  4XJK A;  1PVB A;  2LAP A;  4D1E A;  3VRO A;  1PK0 D;  1WLM A;  2F2P A;  1XFZ O;  3KPX A;  1DJX A;  2Q91 A;  4MZK A;  1S1E A;  2WCE A;  4MBE A;  3SIB A;  5B8I B;  2KI6 C;  1NIW A;  2ISD A;  3JTD C;  2OTG B;  3AKB A;  3O78 A;  1KSO A;  1B7T Z;  1OMR A;  1BF5 A;  1YUU A;  4I5K A;  1CM1 A;  3OX6 A;  1K9U A;  4ORA B;  1DJY A;  3DF0 B;  3OB2 B;  2R2I A;  1SW8 A;  5JJG A;  1AHR A;  1QAS A;  2JUL A;  2PAS A;  5PAL A;  4PDZ A;  3DVE A;  1B9A A;  2ZRT A;  1KQM B;  5FYX A;  2NCP A;  1WY9 A;  1KCY A;  3TZ1 A;  3AAK A;  1K90 D;  4MEW A;  2KDH A;  3IF7 A;  4C0J A;  2WCF A;  1QVI Y;  4PHN A;  2LM5 A;  1YTZ C;  2MAZ A;  2KI4 B;  1UHJ A;  4U8D A;  2LMV A;  1OZO A;  1TNW A;  2PMY A;  2TN4 A;  4CFR A;  3EVU A;  1SRA A;  2CXJ A;  1TCF A;  1KFX L;  1K9K A;  5AEQ A;  3M0W A;  2KGB C;  2BKH B;  2I2R E;  5DKN A;  4CID A;  3TUY C;  1KK8 B;  2HPS A;  1S5G Z;  1Y0V H;  2H61 A;  1CMG A;  1NX1 A;  1N2D A;  1NCX A;  5HKY A;  1S6C A;  2JXL A;  1WDC C;  1ZOT B;  1CFD A;  3I5F B;  1JUO A;  1BOC A;  1EG4 A;  1S26 D;  4N1F A;  4A4C A;  2PRU A;  2KAX A;  4DCK A;  1LVC D;  4M2O A;  1OZS A;  2ZKM X;  1GJY A;  1MR8 A;  2D8N A;  2H61 C;  5BPJ A;  3CGA A;  1TNX A;  4WQ2 A;  1YUT A;  1SCM B;  1TCO B;  2EC6 B;  1E8A A;  1ZFS A;  1CM4 A;  3IQQ A;  4P2Y B;  5IBW A;  3SG6 A;  1A75 B;  1PRW A;  2M3W A;  2LMT A;  2KYC A;  2LC5 A;  1N0Y A;  4MRY A;  3SJS A;  1UHI A;  2JWW A;  1YVH A;  1YX7 A;  4TNC A;  2OTG C;  1YRT B;  2WCB A;  4I5N B;  2B1U A;  3JTD B;  2L50 A;  4DUQ A;  3LK0 A;  1DJW A;  4XJK B;  3NSL A;  4JWQ A;  1JC2 A;  5CSF A;  3D0Y A;  1CLL A;  5TNC A;  3AKA A;  1YR5 A;  2MA2 A;  1GGZ A;  4FQO A;  2KAY A;  5CSI A;  4ZCU A;  1KQM C;  5KU1 A;  4GFT A;  1CDN A;  2I94 A;  1L2O B;  1SL8 A;  2M1U A;  2ZNE A;  4CPV A;  2JTT A;  3BUO B;  2BL0 B;  3HX4 A;  1BR1 B;  1X02 A;  1IWQ A;  2NLN A;  5DKQ A;  1G8I A;  1OMD A;  2MLF C;  3BUM B;  4ORB B;  1QV1 A;  1EXR A;  2KI4 C;  1M46 A;  1CDM A;  2ZN8 A;  1Y1A A;  2BE6 A;  1JFJ A;  2FJU B;  3GK4 X;  5HLO A;  1XFU O;  1U5I A;  4Q04 A;  2KI6 D;  2JC2 A;  2MJW B;  5CPV A;  1BLQ A;  1MF8 B;  1OQP A;  1SPY A;  1Y1U A;  4PE0 A;  2CNP A;  1CMF A;  1KK8 C;  5G08 A;  3PAT A;  4MZJ A;  1XFY O;  3EK8 A;  1F55 A;  1NUB A;  3TS5 B;  1LA0 A;  1SR6 B;  1KFU S;  3OX5 A;  3F45 A;  3ZWH A;  1QLS A;  3WXA A;  1J1E A;  1B8L A;  1DVI A;  1ZAC A;  2K61 A;  3I5F C;  2CT9 A;  4MZL A;  4QJ3 B;  2COL B;  1S5G Y;  1CFF A;  3VGO A;  1SK6 D;  4MRX A;  1OMV A;  1BMO A;  3QRX A;  4YGE B;  2L51 A;  2L98 A;  1FF1 A;  3GOF A;  4DS7 A;  1C7V A;  1MUX A;  4PHM A;  1SL7 A;  4DIR A;  1SYM A;  1SCM C;  2EGD A;  1DJI A;  2EC6 C;  1NYA A;  4CFQ A;  1B8C A;  1OOJ A;  2WOR A;  4P5O E;  5CSN A;  1F54 A;  5D7F A;  4YI8 A;  2E6W A;  2FCE A;  1QX2 A;  1TTX A;  1S6I A;  4FTG A;  2E30 A;  3EKJ A;  2KFG A;  1ALV A;  1NSH A;  1UUR A;  1CNP A;  3DVK A;  3OHM B;  2K2A A;  1QAT A;  1CDL A;  4PE7 A;  3EVV A;  1XK4 A;  1YVL A;  1D1O A;  3BOW A;  1B8R A;  1RWY A;  1UHN A;  1UWO A;  1N65 A;  3O4Y A;  1BOD A;  1REC A;  1J7R A;  1GGW A;  1AK8 A;  2JXC A;  2Y4Q A;  1L2O C;  2O5G A;  2WND A;  2M8U A;  1A2X A;  1DJH A;  2BKI B;  3TDZ A;  4A4B A;  2BL0 C;  2SAS A;  1IQ5 A;  1F70 A;  2LUC A;  3EVR A;  3D0Y B;  1SNL A;  3E3R A;  1JF2 A;  3KO0 A;  3LCP C;  3I5H B;  2ZRS A;  1KFU L;  4WQ3 A;  5D69 A;  3CWG A;  1CB1 A;  1WLZ A;  2M0R A;  1WRZ A;  3CR4 X;  1L7Z A;  2KOT A;  2K7O A;  1MXL C;  4BY4 A;  3CZT X;  1DTL A;  3LLE A;  2CTN A;  1DGV A;  5AFP A; 
#chains in the Genus database with same CATH topology
 5EL2 A;  3O2P A;  2K2F A;  4GGN A;  2QEO A;  3TS5 C;  2BCA A;  4GBA A;  3NXA A;  3SG5 A;  1SR6 C;  1YRU B;  2LUX A;  2KLD A;  1XVJ A;  4M2Q A;  1SKT A;  1U5I B;  5KSZ A;  1JSA A;  3SG3 A;  1WRL A;  2LVV A;  2ZN9 A;  2G2B A;  2JT8 A;  1JBA A;  4JQ0 D;  3L4L A;  1OW4 A;  4USL A;  3BUW B;  2LMU A;  1LA3 A;  3GK2 A;  3QME A;  3B88 A;  1NX0 A;  2JNX A;  2L5X B;  4ICB A;  2KGR A;  5I8N A;  1A29 A;  2HF5 A;  4PE4 A;  3FS7 A;  3D73 A;  1Y6W A;  2MLE C;  2M7L A;  4NDC A;  5CSJ A;  1K94 A;  1W7J B;  3S0E A;  1EH2 A;  1KK7 Y;  3PM8 A;  1B4C A;  1K93 D;  2K7B A;  4ETO A;  3VRP A;  2BCX A;  1CTR A;  1K9P A;  1RK9 A;  1XFW O;  2KBM A;  1K8U A;  3BYA A;  3SG2 A;  1NWD A;  1RRO A;  1XFV O;  5HKZ A;  4F0Z B;  4NDB A;  2L2C A;  1LKJ A;  4GAO A;  1J7O A;  2K7C A;  2KQ6 A;  2JZI A;  3B87 A;  3IQO A;  4GGF A;  1RFJ A;  3PFV A;  2BBN A;  2CCM A;  5FI6 A;  1AVS A;  2BEC A;  1JF0 A;  4OR9 B;  2AUC A;  2BBM A;  4YRU A;  4PT1 A;  4AQJ A;  2CBL A;  5KTY A;  4JPZ B;  3UO9 A;  2F2O A;  1QIV A;  2LP3 A;  1AUI B;  2ERB A;  4PCW A;  3B6X A;  3MSE B;  2O60 A;  3SG4 A;  2LP2 A;  1WRK A;  2LAN A;  1IGV A;  1TOP A;  3I5H C;  1IIO A;  2Y5I A;  4ZCV A;  1CLB A;  4GNK B;  3FWB A;  2A4J A;  3KHE A;  3PN7 B;  3VB1 A;  5I94 A;  4YGB B;  2QEB A;  4DRW A;  2L4I A;  3BUN B;  2ZND A;  3DVJ A;  3C1V A;  1UHK A;  3BFA A;  1MHO A;  4ORC B;  2QEH A;  2KFF A;  1DGU A;  3I5I C;  1TRF A;  1A4P A;  2V53 A;  1AP4 A;  2KLE A;  1SBJ A;  3JVT B;  1FW4 A;  3BXK A;  2LLS A;  1TNP A;  1R2U A;  2JOJ A;  2KPH A;  5HLV A;  1XFX O;  3VRR A;  2QAC A;  2JPT A;  5DIC A;  3DZT A;  2F3Z A;  3ICB A;  4E68 A;  1QX5 B;  2K7D A;  2NZ0 A;  1KK7 Z;  2KAV A;  4MSP A;  2M49 B;  5I2O A;  3SS4 A;  1QLK A;  1PVA A;  2AAO A;  3KEV A;  2WC6 A;  3AAJ A;  1DQE A;  2I18 A;  3CR2 A;  1NCZ A;  2OPO A;  4C0K A;  2JNF A;  4GPL B;  3FWC A;  1F4O A;  1JWD A;  2HQW A;  1C7W A;  3L47 A;  4OCI A;  1XFR A;  2OS8 B;  4HRE E;  2ZFD A;  3VRQ A;  2YGU A;  2LLU A;  2WCJ A;  3HCM A;  2BE4 A;  5ER4 X;  5FI2 A;  5AXI A;  5AER A;  1TUZ A;  2WOS A;  1M45 A;  4YI9 A;  3H4S E;  1OSA A;  3PM2 A;  1PSR A;  3OBV A;  1SCV A;  2LV7 A;  3A8R A;  1CKK A;  2PAL A;  1J7Q A;  2LHL A;  4UPG A;  2NXQ A;  2Y1N A;  3CAB A;  5AAN A;  5GQQ C;  3CLN A;  3D76 A;  1OOH A;  2BAP A;  2LVI A;  1S36 A;  2K8M B;  1K2H A;  1S3P A;  4R1E A;  1NX2 A;  1HT9 A;  1Q80 A;  2WC8 A;  4N1G A;  2AMI A;  1XK4 C;  2LNK A;  4OV2 A;  4OZD A;  3OGN A;  5J3X A;  1GQM A;  3TDI A;  1FPW A;  1K96 A;  3CR5 X;  2RGI A;  3FIA A;  2LE9 B;  4KYN A;  4L9M A;  5ER5 A;  1BT6 A;  3NSK A;  3SG7 A;  2M29 A;  3EK7 A;  3PN7 C;  1BG1 A;  2QDI A;  4INX A;  1EJ3 A;  1TWO A;  2F33 A;  2JT3 A;  4GUK A;  3ZNI A;  5DKR A;  3DD4 A;  1TNQ A;  3B86 A;  3WHU B;  1IRJ A;  1S6J A;  3NSO A;  4YGC B;  5HL1 A;  3CTN A;  4WRI A;  2KNE A;  3EK4 A;  1YUR A;  3I5I B;  5F6T A;  1CFC A;  1HQV A;  1QIW A;  1QV0 A;  3EKH A;  3JVT C;  2KHN A;  1RTP 1;  2PVB A;  4N5X A;  1PSB A;  3DVM A;  3O6B A;  1IH0 A;  1DF0 A;  1F4Q A;  2LCP A;  2GGM A;  5I2L A;  3WHT B;  4HSZ A;  1EL4 A;  4PHJ A;  5K89 A;  1OE9 B;  1F71 A;  1ZUZ A;  3DYE A;  1YX8 A;  2L0P A;  1V1G A;  1IQ3 A;  2L2E A;  5JOL A;  2I7A A;  2JPO A;  4AQI A;  1G4Y R;  1IG5 A;  1MQ1 A;  1KSM A;  3A4U B;  1CFP A;  4QJ4 B;  2BCB A;  2PSR A;  3I5G B;  1UUS A;  1A03 A;  3R72 A;  3FE6 A;  2MBX A;  3SIA A;  1ZMZ A;  2F8P A;  1KWO C;  1QJT A;  1DMO A;  1RJV A;  3CS1 A;  4M2P A;  1NPQ A;  1JFK A;  2JU0 A;  2OS8 C;  2JRF A;  3TDU A;  1VRK A;  4IJ7 A;  3GK1 A;  1SL9 A;  1M39 A;  1ODB A;  1V1F A;  2LLT A;  1CLM A;  4YBH B;  1PAL A;  4CLN A;  4I5J A;  1B47 A;  1MXE A;  1F8H A;  4YGD B;  4QJ5 B;  3CDN A;  1UHH A;  1OOF A;  1J1D A;  1AJ4 A;  2HET A;  2IS9 A;  3NSI A;  4FQT A;  2LVJ A;  4C0L A;  1MWN A;  3BQ3 A;  1LXF C;  4NQG A;  3RZS A;  1C07 A;  2JQ6 A;  2KBI A;  2H2K A;  1FI6 A;  3DF0 A;  1XO5 A;  2M97 A;  3K21 A;  4GGF C;  3S0B A;  2HQ8 A;  1NCY A;  1QTX A;  2KFH A;  2WCM A;  4NDD A;  1DJG A;  2M1K B;  1Y1X A;  3BOW B;  5HYD A;  3O4X A;  1QWV A;  1SMG A;  2GTE A;  4JD9 A;  4HRH A;  4MLW A;  2EHB A;  1W9Z A;  4XYN A;  4INW A;  1H8B A;  1NP8 A;  1LIN A;  3LK1 A;  4I5L B;  4BY5 A;  1AJ5 A;  1XA5 A;  4MN0 A;  2KSP A;  1UP5 A;  2L4H A;  1CDP A;  2P71 A;  3BJH A;  1M31 A;  1QX7 A;  1B7T Y;  1PUL A;  2M7N A;  1FI5 A;  1BJF A;  2NCO A;  3DXL A;  3OB1 B;  1J7P A;  1J55 A;  2QPT A;  5HKW A;  3RM1 A;  3PAL A;  1DJZ A;  1QVI Z;  2K60 A;  3PSR A;  3V2L A;  1C3Y A;  3PLF B;  4MVF A;  3LL8 B;  1T14 A;  2KQY A;  4AOM A;  4IL1 A;  2PYQ A;  2GGZ A;  3VRN A;  1DEL A;  2SCP A;  4YGA A;  2LVK A;  2VRG A;  1BR4 B;  2P6B B;  1XYD A;  1H4B A;  1DF0 B;  1YUS A;  2FOT A;  3I5G C;  1TIZ A;  4OKH A;  4PE1 A;  1K95 A;  4OVN F;  2LHI A;  2Q4U A;  1BU3 A;  4PHK A;  2JTZ A;  2MRD A;  1G33 A;  1QS7 A;  1B1G A;  3D10 A;  3BUX B;  5I2Q A;  5D3O A;  3TUY B;  3EG5 B;  1FBV A;  1KWO B;  2M9G A;  1ALW A;  4HRG A;  1EG3 A;  1QXP A;  2GV5 A;  2WCK A;  3KF9 A;  1TN4 A;  1SY9 A;  1R6P A;  1WDC B;  1IJ5 A;  3NHI A;  3CZ2 A;  2KYF A;  2MHH A;  1A75 A;  2Y1M A;  1W7I B;  1M63 B;  3OP0 A;  3D74 A;  1IKU A;  1IJ6 A;  3WNX B;  1KFX S;  2DOQ A;  2G9B A;  2JT0 A;  2F3Y A;  4PAL A;  1DT7 B;  2FCD A;  2K0J A;  3UNW A;  1KQV A;  1NX3 A;  4XJK A;  1PVB A;  2LAP A;  4D1E A;  3VRO A;  1PK0 D;  1TUJ A;  1WLM A;  1XFZ O;  2F2P A;  3KPX A;  1DJX A;  2Q91 A;  4MZK A;  1S1E A;  2WCE A;  4MBE A;  3SIB A;  5B8I B;  2KI6 C;  1NIW A;  2ISD A;  3R1V A;  3JTD C;  2OTG B;  3AKB A;  3O78 A;  1KSO A;  3N7H A;  1B7T Z;  1OMR A;  3DY9 A;  1BF5 A;  1YUU A;  4I5K A;  1CM1 A;  3OX6 A;  3Q8I A;  1K9U A;  4ORA B;  3CZ0 A;  1DJY A;  3DF0 B;  3OB2 B;  2R2I A;  1SW8 A;  5JJG A;  1AHR A;  1QAS A;  2JUL A;  1ORG A;  2PAS A;  2WC5 A;  5PAL A;  1Z4H A;  4PDZ A;  3DVE A;  1B9A A;  2ZRT A;  1KQM B;  5FYX A;  2NCP A;  1WY9 A;  1KCY A;  3TZ1 A;  3AAK A;  2WCL A;  3BFB A;  1K90 D;  4MEW A;  2KDH A;  3IF7 A;  4C0J A;  2WCF A;  1QVI Y;  4PHN A;  3B7A A;  2LM5 A;  1YTZ C;  2MAZ A;  3S0F A;  2KI4 B;  1UHJ A;  4U8D A;  2LMV A;  1OZO A;  1TNW A;  2PMY A;  2TN4 A;  4CFR A;  3EVU A;  1SRA A;  2CXJ A;  1TCF A;  1P28 A;  1KFX L;  1K9K A;  5AEQ A;  3M0W A;  2KGB C;  2BKH B;  2I2R E;  5DKN A;  4CID A;  3TUY C;  1KK8 B;  1SSE B;  2HPS A;  1S5G Z;  1Y0V H;  2H61 A;  1CMG A;  1NX1 A;  1N2D A;  3S0D A;  1NCX A;  1OOI X;  3IVT A;  5HKY A;  1S6C A;  2JXL A;  2L5Y A;  1WDC C;  1ZOT B;  1CFD A;  3I5F B;  1JUO A;  1BOC A;  1EG4 A;  1S26 D;  4N1F A;  4A4C A;  2PRU A;  2KAX A;  4DCK A;  1LVC D;  4M2O A;  1OZS A;  2ZKM X;  1GJY A;  1MR8 A;  2D8N A;  2H61 C;  5BPJ A;  3CGA A;  1TNX A;  4WQ2 A;  1YUT A;  1SCM B;  1TCO B;  2EC6 B;  1E8A A;  1ZFS A;  1CM4 A;  3D78 A;  3IQQ A;  4P2Y B;  5IBW A;  3SG6 A;  1A75 B;  1PRW A;  2M3W A;  2LMT A;  2KYC A;  2LC5 A;  1N0Y A;  4MRY A;  3SJS A;  1UHI A;  2JWW A;  1YVH A;  1YX7 A;  4TNC A;  2FJY A;  2OTG C;  1YRT B;  2WCB A;  4I5N B;  2B1U A;  3JTD B;  3D77 A;  2L50 A;  4DUQ A;  3LK0 A;  1DJW A;  4XJK B;  4F7F A;  3FE9 A;  3NSL A;  4JWQ A;  1JC2 A;  1GM0 A;  5CSF A;  3D0Y A;  1CLL A;  3R1P A;  5TNC A;  3AKA A;  1YR5 A;  2MA2 A;  1GGZ A;  4FQO A;  2KAY A;  5CSI A;  4ZCU A;  1KQM C;  5KU1 A;  4GFT A;  1CDN A;  2I94 A;  1L2O B;  1SL8 A;  2M1U A;  2ZNE A;  4CPV A;  2JTT A;  3BUO B;  2BL0 B;  1C3Z A;  1BR1 B;  3FE8 A;  3HX4 A;  1X02 A;  1IWQ A;  2NLN A;  2P70 A;  2PQL A;  5DKQ A;  1G8I A;  1OMD A;  2MLF C;  3BUM B;  4ORB B;  3S0A A;  1QV1 A;  1EXR A;  2KI4 C;  1M46 A;  1CDM A;  2ZN8 A;  1Y1A A;  3K1E A;  2BE6 A;  1JFJ A;  3BFH A;  2FJU B;  3GK4 X;  5HLO A;  1XFU O;  1U5I A;  4Q04 A;  3S0G A;  2KI6 D;  2H8V A;  2JC2 A;  2MJW B;  5CPV A;  2WCH A;  1BLQ A;  1MF8 B;  1OQP A;  1SPY A;  1Y1U A;  4PE0 A;  2CNP A;  1CMF A;  1KK8 C;  5G08 A;  2QEV A;  3PAT A;  1DEK A;  4MZJ A;  1XFY O;  3EK8 A;  1F55 A;  1NUB A;  3TS5 B;  1LA0 A;  1SR6 B;  1KFU S;  3OX5 A;  3F45 A;  3ZWH A;  1QLS A;  3WXA A;  1J1E A;  1B8L A;  1DVI A;  1ZAC A;  2K61 A;  3I5F C;  2CT9 A;  4MZL A;  4QJ3 B;  2COL B;  1S5G Y;  3CYZ A;  1CFF A;  3VGO A;  1SK6 D;  4MRX A;  1OMV A;  1BMO A;  3QRX A;  4YGE B;  2L51 A;  3D75 A;  2L98 A;  1FF1 A;  3GOF A;  5FI7 A;  4DS7 A;  1C7V A;  1MUX A;  4PHM A;  1SL7 A;  4DIR A;  1SYM A;  1SCM C;  2EGD A;  1DJI A;  2EC6 C;  1NYA A;  4CFQ A;  3CZ1 A;  1B8C A;  1OOJ A;  2WOR A;  4P5O E;  5CSN A;  1F54 A;  5D7F A;  4YI8 A;  2E6W A;  2FCE A;  1QX2 A;  2BNX A;  4JKT A;  1TTX A;  1S6I A;  4FTG A;  2E30 A;  3SS5 A;  3EKJ A;  2KFG A;  1ALV A;  1NSH A;  1UUR A;  1CNP A;  3DVK A;  1DC1 A;  3OHM B;  2K2A A;  1QAT A;  1CDL A;  3SS3 A;  4PE7 A;  1Z2C B;  3EVV A;  1XK4 A;  1YVL A;  3NGV A;  3BOW A;  1D1O A;  1B8R A;  1RWY A;  1UHN A;  1UWO A;  1N65 A;  3O4Y A;  1BOD A;  1OOG A;  1REC A;  1J7R A;  1GGW A;  1LS8 A;  2JXC A;  2Y4Q A;  1L2O C;  3RLZ A;  2O5G A;  2WND A;  1AK8 A;  2M8U A;  3PJI A;  1A2X A;  1DJH A;  3R1O A;  2BKI B;  3TDZ A;  4A4B A;  2BL0 C;  2SAS A;  1IQ5 A;  1F70 A;  3NHT A;  2LUC A;  3EVR A;  3D0Y B;  1SNL A;  3E3R A;  1JF2 A;  3KO0 A;  3LCP C;  3I5H B;  2ZRS A;  1KFU L;  4WQ3 A;  5D69 A;  3CWG A;  1CB1 A;  1WLZ A;  2M0R A;  1WRZ A;  3CR4 X;  1L7Z A;  2KOT A;  3L4A A;  2K7O A;  1MXL C;  4BY4 A;  3CZT X;  1DTL A;  3LLE A;  2CTN A;  1DGV A;  5AFP A; 
#chains in the Genus database with same CATH homology
 3O2P A;  2K2F A;  4GGN A;  3TS5 C;  2BCA A;  4GBA A;  3NXA A;  3SG5 A;  1SR6 C;  1YRU B;  2LUX A;  4M2Q A;  1XVJ A;  1SKT A;  1U5I B;  5KSZ A;  1JSA A;  3SG3 A;  1WRL A;  2LVV A;  2ZN9 A;  2G2B A;  2JT8 A;  1JBA A;  4JQ0 D;  4USL A;  3BUW B;  2LMU A;  1LA3 A;  3GK2 A;  1NX0 A;  2JNX A;  2L5X B;  4ICB A;  2KGR A;  5I8N A;  1A29 A;  2HF5 A;  4PE4 A;  3FS7 A;  1Y6W A;  2MLE C;  2M7L A;  4NDC A;  5CSJ A;  1K94 A;  1W7J B;  1EH2 A;  1KK7 Y;  3PM8 A;  1B4C A;  1K93 D;  2K7B A;  4ETO A;  3VRP A;  2BCX A;  1CTR A;  1K9P A;  1RK9 A;  1XFW O;  2KBM A;  1K8U A;  3BYA A;  3SG2 A;  1NWD A;  1RRO A;  1XFV O;  5HKZ A;  4F0Z B;  4NDB A;  1LKJ A;  4GAO A;  1J7O A;  2K7C A;  2KQ6 A;  2JZI A;  3IQO A;  4GGF A;  1RFJ A;  3PFV A;  2BBN A;  2CCM A;  1AVS A;  2BEC A;  1JF0 A;  4OR9 B;  2AUC A;  2BBM A;  4YRU A;  4AQJ A;  2CBL A;  5KTY A;  4JPZ B;  2F2O A;  1QIV A;  2LP3 A;  1AUI B;  4PCW A;  3MSE B;  2O60 A;  3SG4 A;  2LP2 A;  1WRK A;  2LAN A;  1IGV A;  1TOP A;  3I5H C;  2Y5I A;  4ZCV A;  1CLB A;  4GNK B;  3FWB A;  2A4J A;  3KHE A;  3PN7 B;  4YGB B;  4DRW A;  2L4I A;  3BUN B;  2ZND A;  3DVJ A;  3C1V A;  1UHK A;  1MHO A;  4ORC B;  2KFF A;  1DGU A;  3I5I C;  1TRF A;  1A4P A;  2V53 A;  1AP4 A;  1SBJ A;  3JVT B;  1FW4 A;  3BXK A;  2LLS A;  1TNP A;  1R2U A;  2JOJ A;  5HLV A;  1XFX O;  3VRR A;  2QAC A;  2JPT A;  2F3Z A;  3ICB A;  4E68 A;  1QX5 B;  2K7D A;  2NZ0 A;  1KK7 Z;  2KAV A;  4MSP A;  2M49 B;  5I2O A;  1QLK A;  1PVA A;  2AAO A;  3KEV A;  3AAJ A;  2I18 A;  3CR2 A;  1NCZ A;  2OPO A;  4C0K A;  2JNF A;  4GPL B;  3FWC A;  1F4O A;  1JWD A;  2HQW A;  1C7W A;  4OCI A;  2OS8 B;  4HRE E;  2ZFD A;  3VRQ A;  2LLU A;  5AXI A;  3HCM A;  2BE4 A;  5ER4 X;  5AER A;  2WOS A;  1M45 A;  4YI9 A;  3H4S E;  1OSA A;  1PSR A;  1CKK A;  1SCV A;  2LV7 A;  3A8R A;  2PAL A;  1J7Q A;  2LHL A;  4UPG A;  2NXQ A;  2Y1N A;  5AAN A;  5GQQ C;  3CLN A;  2LVI A;  1S36 A;  2K8M B;  1K2H A;  1S3P A;  4R1E A;  1NX2 A;  1HT9 A;  1Q80 A;  2WC8 A;  4N1G A;  2AMI A;  1XK4 C;  2LNK A;  4OV2 A;  5J3X A;  3RLZ A;  3TDI A;  1GQM A;  1FPW A;  1K96 A;  3CR5 X;  2RGI A;  3FIA A;  2LE9 B;  4L9M A;  5ER5 A;  1BT6 A;  3NSK A;  3SG7 A;  2M29 A;  3EK7 A;  3PN7 C;  1BG1 A;  1EJ3 A;  2F33 A;  2JT3 A;  4GUK A;  3ZNI A;  5DKR A;  3DD4 A;  1TNQ A;  3WHU B;  1IRJ A;  1S6J A;  3NSO A;  4YGC B;  3CTN A;  4WRI A;  2KNE A;  3EK4 A;  1YUR A;  3I5I B;  5F6T A;  1CFC A;  1HQV A;  1QIW A;  1QV0 A;  3EKH A;  3JVT C;  2KHN A;  1RTP 1;  2PVB A;  4N5X A;  1PSB A;  3DVM A;  3O6B A;  1IH0 A;  1DF0 A;  1F4Q A;  2LCP A;  2GGM A;  5I2L A;  3WHT B;  4HSZ A;  1EL4 A;  4PHJ A;  5K89 A;  1OE9 B;  1F71 A;  1ZUZ A;  1YX8 A;  2L0P A;  1V1G A;  1IQ3 A;  2L2E A;  5JOL A;  2I7A A;  4AQI A;  1G4Y R;  1IG5 A;  1MQ1 A;  1KSM A;  3A4U B;  1CFP A;  4QJ4 B;  2BCB A;  2PSR A;  3I5G B;  1UUS A;  1A03 A;  2MBX A;  3SIA A;  1ZMZ A;  2F8P A;  1KWO C;  1QJT A;  1DMO A;  1RJV A;  3CS1 A;  4M2P A;  1NPQ A;  1JFK A;  2JU0 A;  2OS8 C;  2JRF A;  3TDU A;  1VRK A;  3GK1 A;  1SL9 A;  1M39 A;  1ODB A;  1V1F A;  2LLT A;  1CLM A;  4YBH B;  1PAL A;  4CLN A;  4I5J A;  1B47 A;  1MXE A;  1F8H A;  4YGD B;  4QJ5 B;  1UHH A;  1J1D A;  1AJ4 A;  2HET A;  2IS9 A;  3NSI A;  2LVJ A;  4C0L A;  1MWN A;  3BQ3 A;  1LXF C;  4NQG A;  1C07 A;  2JQ6 A;  2KBI A;  2H2K A;  1FI6 A;  3DF0 A;  1XO5 A;  2M97 A;  3K21 A;  4GGF C;  2HQ8 A;  1NCY A;  1QTX A;  2KFH A;  5HYD A;  4NDD A;  1DJG A;  2M1K B;  1Y1X A;  3BOW B;  1SMG A;  4HRH A;  4MLW A;  2EHB A;  4XYN A;  1H8B A;  1NP8 A;  1LIN A;  3LK1 A;  4I5L B;  4BY5 A;  1AJ5 A;  1XA5 A;  4MN0 A;  2KSP A;  1UP5 A;  2L4H A;  1CDP A;  1M31 A;  1QX7 A;  1B7T Y;  1PUL A;  2M7N A;  1FI5 A;  1BJF A;  2NCO A;  3OB1 B;  1J7P A;  1J55 A;  2QPT A;  5HKW A;  3RM1 A;  3PAL A;  1DJZ A;  1QVI Z;  3PSR A;  3PLF B;  4MVF A;  3LL8 B;  2KQY A;  4AOM A;  4IL1 A;  2GGZ A;  3VRN A;  2SCP A;  4YGA A;  2LVK A;  2VRG A;  1BR4 B;  2P6B B;  1XYD A;  1H4B A;  1DF0 B;  1YUS A;  2FOT A;  3I5G C;  1TIZ A;  4OKH A;  4PE1 A;  1K95 A;  4OVN F;  2LHI A;  2Q4U A;  1BU3 A;  4PHK A;  2JTZ A;  2MRD A;  1G33 A;  1QS7 A;  1B1G A;  3D10 A;  3BUX B;  5I2Q A;  3TUY B;  1FBV A;  1KWO B;  2M9G A;  1ALW A;  4HRG A;  1EG3 A;  1QXP A;  2GV5 A;  3KF9 A;  1TN4 A;  1SY9 A;  1R6P A;  1WDC B;  1IJ5 A;  2KYF A;  2MHH A;  1A75 A;  2Y1M A;  1W7I B;  1M63 B;  3OP0 A;  1IKU A;  1IJ6 A;  3WNX B;  1KFX S;  2DOQ A;  2G9B A;  2JT0 A;  2F3Y A;  4PAL A;  1DT7 B;  2FCD A;  2K0J A;  1KQV A;  1NX3 A;  4XJK A;  1PVB A;  2LAP A;  4D1E A;  3VRO A;  1PK0 D;  1WLM A;  2F2P A;  1XFZ O;  3KPX A;  1DJX A;  2Q91 A;  4MZK A;  1S1E A;  2WCE A;  4MBE A;  3SIB A;  5B8I B;  2KI6 C;  1NIW A;  2ISD A;  3JTD C;  2OTG B;  3AKB A;  3O78 A;  1KSO A;  1B7T Z;  1OMR A;  1BF5 A;  1YUU A;  4I5K A;  1CM1 A;  3OX6 A;  1K9U A;  4ORA B;  1DJY A;  3DF0 B;  3OB2 B;  2R2I A;  1SW8 A;  5JJG A;  1AHR A;  1QAS A;  2JUL A;  2PAS A;  5PAL A;  4PDZ A;  3DVE A;  1B9A A;  2ZRT A;  1KQM B;  5FYX A;  2NCP A;  1WY9 A;  1KCY A;  3TZ1 A;  3AAK A;  1K90 D;  4MEW A;  2KDH A;  3IF7 A;  4C0J A;  2WCF A;  1QVI Y;  4PHN A;  2LM5 A;  1YTZ C;  2MAZ A;  2KI4 B;  1UHJ A;  4U8D A;  2LMV A;  1OZO A;  1TNW A;  2PMY A;  2TN4 A;  4CFR A;  3EVU A;  1SRA A;  2CXJ A;  1TCF A;  1KFX L;  1K9K A;  5AEQ A;  3M0W A;  2KGB C;  2BKH B;  2I2R E;  5DKN A;  4CID A;  3TUY C;  1KK8 B;  2HPS A;  1S5G Z;  1Y0V H;  2H61 A;  1CMG A;  1NX1 A;  1N2D A;  1NCX A;  5HKY A;  1S6C A;  2JXL A;  1WDC C;  1ZOT B;  1CFD A;  3I5F B;  1JUO A;  1BOC A;  1EG4 A;  1S26 D;  4N1F A;  4A4C A;  2PRU A;  2KAX A;  4DCK A;  1LVC D;  4M2O A;  1OZS A;  2ZKM X;  1GJY A;  1MR8 A;  2D8N A;  2H61 C;  5BPJ A;  3CGA A;  1TNX A;  4WQ2 A;  1YUT A;  1SCM B;  1TCO B;  2EC6 B;  1E8A A;  1ZFS A;  1CM4 A;  3IQQ A;  4P2Y B;  5IBW A;  3SG6 A;  1A75 B;  1PRW A;  2M3W A;  2LMT A;  2KYC A;  2LC5 A;  1N0Y A;  4MRY A;  3SJS A;  1UHI A;  2JWW A;  1YVH A;  1YX7 A;  4TNC A;  2OTG C;  1YRT B;  2WCB A;  4I5N B;  2B1U A;  3JTD B;  2L50 A;  4DUQ A;  3LK0 A;  1DJW A;  4XJK B;  3NSL A;  4JWQ A;  1JC2 A;  5CSF A;  3D0Y A;  1CLL A;  5TNC A;  3AKA A;  1YR5 A;  2MA2 A;  1GGZ A;  4FQO A;  2KAY A;  5CSI A;  4ZCU A;  1KQM C;  5KU1 A;  4GFT A;  1CDN A;  2I94 A;  1L2O B;  1SL8 A;  2M1U A;  2ZNE A;  4CPV A;  2JTT A;  3BUO B;  2BL0 B;  3HX4 A;  1BR1 B;  1X02 A;  1IWQ A;  2NLN A;  5DKQ A;  1G8I A;  1OMD A;  2MLF C;  3BUM B;  4ORB B;  1QV1 A;  1EXR A;  2KI4 C;  1M46 A;  1CDM A;  2ZN8 A;  1Y1A A;  2BE6 A;  1JFJ A;  2FJU B;  3GK4 X;  5HLO A;  1XFU O;  1U5I A;  4Q04 A;  2KI6 D;  2JC2 A;  2MJW B;  5CPV A;  1BLQ A;  1MF8 B;  1OQP A;  1SPY A;  1Y1U A;  4PE0 A;  2CNP A;  1CMF A;  1KK8 C;  5G08 A;  3PAT A;  4MZJ A;  1XFY O;  3EK8 A;  1F55 A;  1NUB A;  3TS5 B;  1LA0 A;  1SR6 B;  1KFU S;  3OX5 A;  3F45 A;  3ZWH A;  1QLS A;  3WXA A;  1J1E A;  1B8L A;  1DVI A;  1ZAC A;  2K61 A;  3I5F C;  2CT9 A;  4MZL A;  4QJ3 B;  2COL B;  1S5G Y;  1CFF A;  3VGO A;  1SK6 D;  4MRX A;  1OMV A;  1BMO A;  3QRX A;  4YGE B;  2L51 A;  2L98 A;  1FF1 A;  3GOF A;  4DS7 A;  1C7V A;  1MUX A;  4PHM A;  1SL7 A;  4DIR A;  1SYM A;  1SCM C;  2EGD A;  1DJI A;  2EC6 C;  1NYA A;  4CFQ A;  1B8C A;  1OOJ A;  2WOR A;  4P5O E;  5CSN A;  1F54 A;  5D7F A;  4YI8 A;  2E6W A;  2FCE A;  1QX2 A;  1TTX A;  1S6I A;  4FTG A;  2E30 A;  3EKJ A;  2KFG A;  1ALV A;  1NSH A;  1UUR A;  1CNP A;  3DVK A;  3OHM B;  2K2A A;  1QAT A;  1CDL A;  4PE7 A;  3EVV A;  1XK4 A;  1YVL A;  1D1O A;  3BOW A;  1B8R A;  1RWY A;  1UHN A;  1UWO A;  1N65 A;  3O4Y A;  1BOD A;  1REC A;  1J7R A;  1GGW A;  1AK8 A;  2JXC A;  2Y4Q A;  1L2O C;  2O5G A;  2WND A;  2M8U A;  1A2X A;  1DJH A;  2BKI B;  3TDZ A;  4A4B A;  2BL0 C;  2SAS A;  1IQ5 A;  1F70 A;  2LUC A;  3EVR A;  3D0Y B;  1SNL A;  3E3R A;  1JF2 A;  3KO0 A;  3LCP C;  3I5H B;  2ZRS A;  1KFU L;  4WQ3 A;  5D69 A;  3CWG A;  1CB1 A;  1WLZ A;  2M0R A;  1WRZ A;  3CR4 X;  1L7Z A;  2KOT A;  2K7O A;  1MXL C;  4BY4 A;  3CZT X;  1DTL A;  3LLE A;  2CTN A;  1DGV A;  5AFP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...