1BR1B

Smooth muscle myosin motor domain-essential light chain complex with mgadp.alf4 bound at the active site
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
148
structure length
148
Chain Sequence
FSEEQTAEFKEAFQLFDRTGDGKILYSQCGDVMRALGQNPTNAEVMKVLGNPKSDEMNLKTLKFEQFLPMMQTIAKNKDQGCFEDYVEGLRVFDKEGNGTVMGAEIRHVLVTLGEKMTEEEVEQLVAGHEDSNGCINYEELVRMVLSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Muscle protein
molecule keywords MYOSIN
publication title Crystal structure of a vertebrate smooth muscle myosin motor domain and its complex with the essential light chain: visualization of the pre-power stroke state.
pubmed doi rcsb
source organism Gallus gallus
total genus 38
structure length 148
sequence length 148
chains with identical sequence D, F, H
ec nomenclature ec 3.6.1.32: Transferred entry: 5.6.1.8.
pdb deposition date 1998-08-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1br1B02
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1br1B01
1LA3A 2LLUA 1S36A 1W7IB 3CGAA 1ZUZA 1QVIY 4D1EA 3DVJA 3OX6A 2COLB 1BMOA 2JOJA 3IQOA 1IJ5A 4CLNA 2LVIA 3CZTX 3VRRA 2MA2A 2MHHA 2PASA 5PALA 2LHLA 3VROA 2OS8C 2CBLA 3BUWB 4I5LB 5G08A 2GGMA 1KFUS 1YRUB 2KI4C 4MRXA 3KF9A 1LINA 2FOTA 2KFFA 4ORBB 4WRIA 4M2OA 1K9PA 1F70A 1RWYA 1BODA 1QJTA 4ZCUA 2JTZA 1U5IB 2P6BB 1CB1A 2HF5A 4C0KA 4HRHA 1V1GA 1Y1AA 1KQMB 1WRZA 2LE9B 2KDHA 1KK8B 3BOWB 4CPVA 1WLZA 3I5FC 2JT8A 1M31A 2BCAA 1QS7A 2Q91A 3OX5A 1CKKA 1TNQA 2E30A 5HLOA 3SJSA 2ZN8A 1PSRA 2K7OA 3PFVA 1YX7A 1ALWA 2M49B 3BXKA 1HQVA 1XK4C 1B7TZ 1K95A 4HRGA 1CLLA 1S1EA 3PATA 3VRNA 1F4OA 3GK2A 1YR5A 3GOFA 4PE7A 2EC6C 2NXQA 1SPYA 1QVIZ 4P2YB 2K2AA 3CWGA 1BF5A 1SCMB 1YVHA 1JFKA 4YGCB 5KU1A 3DVEA 1Y1XA 1CTRA 3I5GB 4QJ5B 3SIAA 4AQIA 2F33A 3LCPC 3VRQA 4ICBA 4AOMA 2ZNDA 1TNXA 3D10A 5FYXA 1F8HA 3SG3A 1AHRA 4OCIA 4C0LA 4F0ZB 1IQ5A 3GK4X 4MZKA 1JSAA 2M1UA 1MR8A 2LV7A 2IS9A 2JC2A 1SR6C 1QASA 2I7AA 4DIRA 3D0YA 1DMOA 1DTLA 1RROA 1TN4A 4QJ3B 4YBHB 2KBMA 2Q4UA 4M2QA 4N1GA 4MN0A 4N1FA 4YRUA 3GK1A 1K90D 2M7LA 2BL0C 4MSPA 4ZCVA 4PHNA 2KHNA 5CSNA 1BLQA 3C1VA 3RLZA 5HKWA 2I18A 1MF8B 1WDCC 1NPQA 1AVSA 1UURA 1SRAA 1AP4A 1HT9A 2ZRTA 3IQQA 2LM5A 1DF0A 1H4BA 1XA5A 1MHOA 1CLMA 2L98A 2JWWA 1CFFA 2KSPA 2M7NA 2KFGA 4I5KA 2OTGB 2KBIA 4A4CA 3EVVA 4WQ3A 1EXRA 1A2XA 1L2OC 3AAKA 2KAYA 4OV2A 5I2QA 2BCBA 1CLBA 1EG3A 1KQVA 3TDUA 1WY9A 4I5NB 2CNPA 1CDMA 1FBVA 4YGDB 4P5OE 2HPSA 3JTDB 4XJKB 5BPJA 5AFPA 1XFZO 1A75B 2K7CA 2K2FA 1K94A 2KOTA 1FW4A 1JF0A 1QXPA 1Y6WA 4YGBB 2BE6A 2KQYA 1PSBA 2BBNA 5J3XA 3BYAA 2BE4A 1BR4B 1W7JB 2LVJA 2MRDA 5JOLA 4IL1A 1AUIB 1F4QA 1KWOB 1YUSA 1K9UA 2H61A 3IF7A 1FI6A 4PE0A 3EK4A 3BUNB 5CPVA 4JQ0D 1KQMC 1BJFA 4DRWA 3OB1B 2L0PA 1UWOA 1YUUA 1KK8C 1DJHA 1SW8A 2Y1NA 1MQ1A 3KPXA 2O5GA 1B4CA 1OQPA 3PALA 2LP2A 2R2IA 2Y5IA 5HKZA 1TOPA 3CLNA 2H61C 4OR9B 3KEVA 5I2OA 1TCOB 1RTP1 1JC2A 4DCKA 1BOCA 3O4YA 1PULA 2NCOA 3QRXA 1J7OA 3O6BA 5HKYA 2KI6D 2HQWA 2M29A 3VRPA 4N5XA 1SCVA 3O78A 3BUXB 1N65A 2F2OA 2LCPA 2LLSA 3M0WA 1SCMC 2LUCA 3EKJA 1UHJA 1OZOA 1YURA 4YGAA 1M46A 1LA0A 2KAXA 1KFUL 2MAZA 1RECA 2CCMA 1SNLA 1XK4A 1F55A 2ISDA 1DJXA 2L4HA 3DF0B 4GPLB 1D1OA 4HSZA 1A03A 1FF1A 2LNKA 3EKHA 1OMDA 1ZFSA 5HLVA 5DKNA 4PHMA 3LLEA 4E68A 1SBJA 2BKIB 2JXLA 3ZWHA 4WQ2A 4MRYA 4MBEA 2TN4A 4JPZB 2BKHB 4MEWA 3WHTB 1UUSA 1S6JA 1CNPA 1E8AA 2JZIA 1CDLA 2LVVA 1XFWO 2JQ6A 3A4UB 3SIBA 2L4IA 3SG2A 3DVMA 1JWDA 1JFJA 1TNPA 1NUBA 2L50A 4OVNF 2KNEA 5CSJA 3NSLA 1IG5A 2E6WA 3EVUA 4TNCA 4DUQA 3TS5B 1ALVA 2K0JA 1XYDA 1CFCA 5I8NA 1EG4A 1MXEA 3SG7A 1N2DA 2PMYA 1CM4A 1ODBA 3E3RA 2JNFA 1TTXA 3TUYB 3I5HC 1CM1A 2OTGC 3AAJA 2A4JA 1DJWA 2MLFC 2KFHA 1XVJA 1KK7Y 1QX2A 1F71A 1KSMA 1X02A 4PHKA 4OKHA 2L5XB 2LC5A 2I94A 3PM8A 1NSHA 1LVCD 1XFVO 1KSOA 1S26D 4A4BA 1B8CA 1R2UA 1TCFA 3HX4A 4YGEB 1NX3A 1NWDA 1NYAA 4ORAB 3ZNIA 4YI9A 1KCYA 1NCXA 1ZMZA 3OP0A 5ER4X 2AMIA 1J7PA 2V53A 1KWOC 4CFRA 4GNKB 3FWCA 1SK6D 2QACA 1KFXS 4U8DA 1OMVA 1J7RA 1WRLA 1TRFA 1B8RA 1J55A 2WCFA 1AJ4A 1QLSA 3K21A 2M8UA 3LL8B 3OB2B 1G8IA 1QX7A 1KFXL 1WLMA 1EL4A 3DVKA 1XFYO 4PE1A 2WORA 2M1KB 5IBWA 1CMGA 1EJ3A 1U5IA 2LLTA 2OPOA 2NCPA 5AANA 1DJYA 2MLEC 1PVBA 1TIZA 3AKBA 5DKRA 5AEQA 1UHKA 2LUXA 1RK9A 2M0RA 1NIWA 5GQQC 2K7BA 1S5GY 1ZACA 3BOWA 1DJGA 5KTYA 2JRFA 2M97A 3FS7A 5I2LA 1C07A 1KK7Z 3VGOA 2PALA 2JNXA 1K9KA 1GQMA 3O2PA 2SASA 5B8IB 5D69A 1B8LA 1QLKA 2G2BA 3PN7B 2B1UA 1BG1A 1SKTA 1PRWA 1QX5B 3KO0A 2BECA 3PSRA 3SG5A 1Y0VH 2O60A 4M2PA 1IQ3A 1BT6A 3I5IB 4GFTA 4PHJA 1JBAA 2I2RE 1S6CA 2JT3A 2WCBA 4MLWA 5ER5A 2JTTA 1FI5A 5JJGA 4QJ4B 4JWQA 3JVTB 2Y1MA 2LANA 3CR4X 2KI6C 2JU0A 2VRGA 2LMUA 3EVRA 2HETA 2MJWB 1AK8A 1DGUA 2GGZA 3I5GC 1C7VA 5K89A 1MXLC 1SY9A 1C7WA 1DF0B 4R1EA 1GGZA 3TS5C 1XFXO 2L51A 2AAOA 2FCEA 2LVKA 1YRTB 5KSZA 1S5GZ 3BUOB 4PCWA 2BBMA 2JULA 1H8BA 3EK8A 1K96A 1PVAA 2K7DA 2KYFA 3SG6A 2G9BA 2F3YA 3KHEA 2PVBA 3CTNA 1OSAA 1SL8A 4BY4A 3TDZA 2WNDA 3TUYC 4MZLA 1UHHA 2F8PA 2EHBA 2WC8A 4USLA 2WCEA 1J1EA 4FQOA 1M63B 3CR5X 1V1FA 1K8UA 1TNWA 1UHNA 2LP3A 2SCPA 3BQ3A 3CS1A 4GBAA 1LXFC 1MWNA 1YTZC 2M3WA 1FPWA 2CXJA 2LHIA 2K61A 4FTGA 1DVIA 1QTXA 1R6PA 5F6TA 2HQ8A 3CR2A 4MVFA 1QATA 1GJYA 1VRKA 4GGFA 2KAVA 1B9AA 2F3ZA 1YUTA 2K8MB 4PE4A 4CIDA 5HYDA 2OS8B 4I5JA 2KGBC 1DT7B 4Q04A 1F54A 4XJKA 1Y1UA 5CSFA 2KI4B 1A75A 2BCXA 1WRKA 3NSKA 4NQGA 4YI8A 1IJ6A 1JF2A 3WNXB 1NCZA 3TDIA 4CFQA 1IGVA 1NX1A 2F2PA 4GGFC 3HCMA 1NX2A 4GAOA 5TNCA 5CSIA 1EH2A 2FCDA 2Y4QA 2H2KA 2PRUA 2D8NA 1BR1B 2ZKMX 3JTDC 4HREE 1UHIA 1A29A 3PLFB 3NXAA 3I5FB 3RM1A 1DJZA 3WHUB 4NDDA 3AKAA 2CTNA 1GGWA 3WXAA 1L7ZA 1B47A 2ZRSA 2MBXA 5DKQA 2LAPA 1QV1A 2NLNA 1K93D 1B1GA 1J1DA 1PALA 4L9MA 1S3PA 4XYNA 4UPGA 2KQ6A 2KGRA 1SL9A 3BUMB 4ORCB 1QIVA 2M9GA 1BU3A 4GGNA 2EC6B 1M45A 4GUKA 5AERA 3DD4A 1NP8A 1XFUO 2JT0A 3PN7C 1NCYA 4AQJA 1IWQA 1DGVA 3NSOA 1A4PA 1K2HA 1LKJA 3LK0A 3LK1A 1OOJA 3H4SE 1YVLA 1XO5A 3MSEB 3SG4A 3I5IC 1RJVA 1CFPA 4ETOA 4DS7A 1G33A 1RFJA 4BY5A 2EGDA 1SYMA 1QIWA 1S6IA 1SL7A 2FJUB 2PSRA 1MUXA 4C0JA 2NZ0A 1OMRA 2ZFDA 4NDBA 3DF0A 1JUOA 3F45A 3I5HB 3JVTC 1SR6B 1YX8A 3FWBA 1ZOTB 2GV5A 2L2EA 2CT9A 1OE9B 2DOQA 2ZNEA 4PDZA 1IH0A 3NSIA 1OZSA 1J7QA 3A8RA 2LMVA 2QPTA 2AUCA 1CMFA 2BL0B 2KYCA 2ZN9A 1M39A 3D0YB 1G4YR 2JPTA 1IKUA 1UP5A 1WDCB 1IRJA 1N0YA 5AXIA 1CDPA 1Q80A 4NDCA 3ICBA 1PK0D 4MZJA 5D7FA 3OHMB 3EK7A 3FIAA 2LMTA 4PALA 1NX0A 2RGIA 1CDNA 1QV0A 2WOSA 1AJ5A 1B7TY 1SMGA 2JXCA 1DJIA 3TZ1A 1CFDA 1L2OB
chains in the Genus database with same CATH superfamily
1LA3A 2LLUA 1OOGA 1S36A 1W7IB 3CGAA 3V2LA 1ZUZA 1QVIY 3CDNA 4D1EA 3DVJA 3OX6A 2COLB 1BMOA 2JOJA 3IQOA 1IJ5A 4CLNA 2LVIA 3CZTX 3VRRA 2MA2A 2MHHA 2PASA 5PALA 2LHLA 3VROA 2OS8C 2CBLA 3BUWB 4I5LB 5G08A 2GGMA 1KFUS 1YRUB 2KI4C 4MRXA 3KF9A 1LINA 2FOTA 2KFFA 4ORBB 4WRIA 4M2OA 1K9PA 1F70A 1RWYA 1BODA 1QJTA 4ZCUA 2JTZA 1U5IB 2P6BB 1CB1A 2HF5A 4C0KA 4HRHA 1V1GA 1Y1AA 2BNXA 1KQMB 1WRZA 2LE9B 2KDHA 1KK8B 3BOWB 4CPVA 1WLZA 2K60A 3I5FC 2JT8A 1M31A 2BCAA 1QS7A 2Q91A 3OX5A 1CKKA 1TNQA 2E30A 5HLOA 3SJSA 3SS3A 2ZN8A 1PSRA 2K7OA 3PFVA 1GM0A 1YX7A 1ALWA 2KLEA 2M49B 2QEHA 3BXKA 1HQVA 1XK4C 1B7TZ 1K95A 4HRGA 1CLLA 1S1EA 3PATA 3VRNA 3S0FA 1F4OA 3GK2A 1YR5A 3GOFA 4IJ7A 4PE7A 2EC6C 2NXQA 1SPYA 1QVIZ 3B88A 2YGUA 2K2AA 3CWGA 4P2YB 3UNWA 1SCMB 1BF5A 1YVHA 1JFKA 4YGCB 5KU1A 3DVEA 1Y1XA 1CTRA 3CZ0A 3I5GB 4QJ5B 3SIAA 4AQIA 2F33A 3LCPC 3B7AA 3VRQA 4ICBA 4AOMA 2ZNDA 1TNXA 3D10A 5FYXA 1F8HA 3PM2A 3SG3A 1AHRA 4OCIA 4C0LA 4F0ZB 1IQ5A 3GK4X 4MZKA 1JSAA 2M1UA 1MR8A 2LV7A 3R1VA 2IS9A 2JC2A 1SR6C 1QASA 2I7AA 4DIRA 3D0YA 2P71A 1QWVA 1DMOA 1DTLA 3DXLA 5FI7A 1RROA 1TN4A 4QJ3B 4YBHB 3FE9A 2KBMA 2Q4UA 4INWA 3CABA 4M2QA 5EL2A 4N1GA 4MN0A 4N1FA 4YRUA 3GK1A 1K90D 2M7LA 2BL0C 4MSPA 1OOIX 4ZCVA 4PHNA 2KHNA 5CSNA 5DICA 1BLQA 3C1VA 3S0EA 3RLZA 5HKWA 2I18A 1MF8B 1WDCC 1NPQA 1AVSA 1UURA 1SRAA 1AP4A 1HT9A 2ZRTA 3IQQA 2LM5A 3BFBA 1OOFA 3N7HA 1DF0A 1H4BA 1XA5A 1MHOA 1CLMA 2L98A 2JWWA 1CFFA 2KSPA 2L5YA 1Z2CB 2KFGA 2M7NA 4I5KA 1XFRA 2OTGB 2KBIA 3OGNA 4A4CA 3DYEA 3EVVA 4WQ3A 1EXRA 1A2XA 1L2OC 3AAKA 2KAYA 4JD9A 4OV2A 2BCBA 5I2QA 1CLBA 1EG3A 1KQVA 3TDUA 1WY9A 4I5NB 2CNPA 1CDMA 1FBVA 4YGDB 4P5OE 2HPSA 3D74A 3JTDB 4XJKB 5BPJA 5AFPA 1XFZO 1A75B 2K7CA 2K2FA 1K94A 2KOTA 3IVTA 1FW4A 1JF0A 1QXPA 3RZSA 1Y6WA 3D78A 4YGBB 2BE6A 2KQYA 1PSBA 2BBNA 5J3XA 3BFAA 3BYAA 2BE4A 1BR4B 1W7JB 2LVJA 2MRDA 5JOLA 4IL1A 1AUIB 1F4QA 1KWOB 1YUSA 3S0DA 1K9UA 2H61A 3IF7A 1FI6A 4PE0A 3EK4A 3BUNB 5CPVA 2FJYA 4JQ0D 1KQMC 1BJFA 4DRWA 3OB1B 2L0PA 1UWOA 1YUUA 1KK8C 1DJHA 1SW8A 2Y1NA 1MQ1A 3KPXA 2O5GA 1B4CA 1OQPA 3PALA 2LP2A 2R2IA 2Y5IA 5HKZA 1TOPA 3CLNA 2H61C 4OR9B 1P28A 3KEVA 3L4LA 5I2OA 1TCOB 1RTP1 1JC2A 4DCKA 1BOCA 3O4YA 5FI6A 1PULA 2NCOA 3QRXA 1J7OA 3O6BA 5HKYA 2KI6D 2HQWA 2M29A 3VRPA 4N5XA 1SCVA 3O78A 1W9ZA 3BUXB 1N65A 2BAPA 2F2OA 2LCPA 2LLSA 3M0WA 1SCMC 2LUCA 3EKJA 3Q8IA 1UHJA 2L2CA 1OZOA 1YURA 3D75A 4YGAA 1M46A 1LA0A 2KAXA 1KFUL 2MAZA 1RECA 2CCMA 3CYZA 3R1PA 1SNLA 1XK4A 2QDIA 1F55A 2ISDA 1DJXA 2L4HA 3DF0B 4GPLB 1D1OA 4HSZA 3DY9A 1DQEA 1A03A 1FF1A 2LNKA 3EKHA 1C3YA 1OMDA 1ZFSA 3R72A 5HLVA 5DKNA 4PHMA 3LLEA 1OW4A 1SBJA 4E68A 2BKIB 2JXLA 3ZWHA 4WQ2A 2P70A 4MRYA 4MBEA 2TN4A 4JPZB 2BKHB 4MEWA 3WHTB 1UUSA 1S6JA 1CNPA 1E8AA 2JZIA 1CDLA 2LVVA 1XFWO 3SS4A 2JQ6A 1OOHA 3A4UB 3SIBA 2L4IA 3SG2A 3D76A 3DVMA 3D77A 1JWDA 1JFJA 1TNPA 1NUBA 2L50A 3VB1A 4OVNF 2KNEA 5CSJA 3NSLA 1IG5A 2E6WA 3EVUA 4TNCA 4DUQA 1TUZA 3TS5B 1ALVA 2K0JA 1XYDA 1CFCA 5I8NA 1EG4A 1MXEA 3SG7A 5HL1A 1N2DA 2PMYA 2WC6A 1CM4A 1ODBA 3E3RA 2JNFA 1TTXA 3TUYB 3I5HC 1CM1A 2OTGC 3AAJA 2A4JA 1DJWA 1TUJA 2MLFC 3QMEA 2KFHA 2KLDA 1XVJA 1KK7Y 1QX2A 1F71A 1KSMA 1X02A 4PHKA 4OKHA 2L5XB 1IIOA 2LC5A 2I94A 3PM8A 1NSHA 1LVCD 1XFVO 1KSOA 1S26D 4A4BA 1B8CA 1R2UA 1TCFA 3HX4A 4YGEB 1NX3A 1NWDA 1NYAA 4ORAB 3ZNIA 4YI9A 1KCYA 1NCXA 1ZMZA 3OP0A 5ER4X 2AMIA 1J7PA 2V53A 1KWOC 4CFRA 4GNKB 3FWCA 1SK6D 2QACA 1KFXS 4U8DA 1OMVA 1TWOA 1J7RA 1WRLA 1SSEB 1TRFA 1B8RA 1C3ZA 1J55A 1DEKA 1AJ4A 2WCFA 1QLSA 1Z4HA 2M8UA 3K21A 3LL8B 2JPOA 3OB2B 1G8IA 1QX7A 1KFXL 1WLMA 1EL4A 3DVKA 1XFYO 4PE1A 4KYNA 2WORA 2M1KB 5IBWA 1CMGA 1EJ3A 1U5IA 2LLTA 3B6XA 2OPOA 2NCPA 5AANA 1DJYA 2MLEC 1PVBA 1TIZA 3AKBA 5DKRA 5AEQA 1UHKA 2LUXA 4OZDA 1RK9A 2M0RA 1NIWA 5GQQC 2K7BA 1S5GY 1ZACA 3BOWA 1DJGA 5KTYA 1LS8A 2JRFA 2M97A 3FS7A 5I2LA 1C07A 1KK7Z 2PQLA 3VGOA 3FE8A 2PALA 2JNXA 1K9KA 1GQMA 2WC5A 3O2PA 2SASA 5B8IB 5D69A 1B8LA 1QLKA 2G2BA 3PN7B 2B1UA 1BG1A 1SKTA 1PRWA 1QX5B 2WCJA 3FE6A 3KO0A 2BECA 3PSRA 3SG5A 1Y0VH 2O60A 4M2PA 1IQ3A 1BT6A 3I5IB 3DZTA 4GFTA 4PHJA 1JBAA 2I2RE 1S6CA 2JT3A 2WCBA 4MLWA 5ER5A 2JTTA 1FI5A 5JJGA 4QJ4B 4JWQA 2ERBA 3JVTB 2Y1MA 2LANA 3CR4X 2KI6C 2JU0A 5FI2A 2VRGA 2LMUA 3EVRA 2HETA 2MJWB 4F7FA 1AK8A 1DGUA 2GGZA 2GTEA 3I5GC 5K89A 1C7VA 1MXLC 1SY9A 1C7WA 1DF0B 3B86A 4R1EA 3SS5A 1GGZA 3L47A 1XFXO 2L51A 3D73A 3TS5C 2AAOA 2FCEA 2LVKA 1YRTB 5KSZA 3S0AA 1S5GZ 3BUOB 4PCWA 2BBMA 2JULA 1H8BA 3EK8A 1K96A 1PVAA 2K7DA 2KYFA 3SG6A 2G9BA 2F3YA 3KHEA 2PVBA 3CTNA 1OSAA 1SL8A 4BY4A 3TDZA 3EG5B 2WNDA 3TUYC 4MZLA 1UHHA 2F8PA 2EHBA 2WC8A 4USLA 4INXA 2WCEA 1J1EA 4FQOA 3CZ2A 1M63B 3CR5X 1V1FA 1K8UA 1TNWA 1UHNA 2LP3A 2SCPA 3BQ3A 3CS1A 4GBAA 1LXFC 1MWNA 1YTZC 2M3WA 5D3OA 2CXJA 2LHIA 2K61A 2QEOA 4FTGA 1DVIA 1QTXA 1R6PA 4PT1A 5F6TA 2HQ8A 3CR2A 4MVFA 3UO9A 1QATA 1GJYA 1VRKA 4GGFA 2KAVA 1B9AA 2F3ZA 1YUTA 2K8MB 4PE4A 4CIDA 5HYDA 2OS8B 4I5JA 2KGBC 1DT7B 4Q04A 1F54A 4XJKA 1Y1UA 5CSFA 2KI4B 1A75A 4FQTA 2BCXA 1WRKA 4JKTA 3NSKA 4NQGA 4YI8A 1IJ6A 2H8VA 1JF2A 3WNXB 1NCZA 2KPHA 3TDIA 4CFQA 1IGVA 1NX1A 2F2PA 4GGFC 3HCMA 1NX2A 4GAOA 5TNCA 2PYQA 3PJIA 3OBVA 5CSIA 3S0GA 2FCDA 1EH2A 2Y4QA 2H2KA 2PRUA 2D8NA 3NHIA 1BR1B 2ZKMX 3JTDC 4HREE 1UHIA 1A29A 3PLFB 3NXAA 3I5FB 3BFHA 3RM1A 1DJZA 3BJHA 3WHUB 4NDDA 3AKAA 2CTNA 1GGWA 3WXAA 1L7ZA 1B47A 2ZRSA 2MBXA 5DKQA 2LAPA 1QV1A 2NLNA 1K93D 1B1GA 1J1DA 1PALA 4L9MA 1S3PA 4XYNA 4UPGA 2KQ6A 2KGRA 1SL9A 2QEVA 3BUMB 3R1OA 4ORCB 1QIVA 2M9GA 3L4AA 1BU3A 2QEBA 4GGNA 2EC6B 1M45A 4GUKA 5AERA 1DELA 3DD4A 3S0BA 1NP8A 1XFUO 2JT0A 3PN7C 1NCYA 4AQJA 3NGVA 1DC1A 1IWQA 1DGVA 3NSOA 1A4PA 2WCMA 1K2HA 1LKJA 3LK0A 3LK1A 3K1EA 1OOJA 3H4SE 1YVLA 1XO5A 3MSEB 2WCLA 3SG4A 3I5IC 1RJVA 1CFPA 1T14A 4ETOA 4DS7A 1G33A 1RFJA 4BY5A 2EGDA 1SYMA 1QIWA 1S6IA 1SL7A 2FJUB 2PSRA 1MUXA 4C0JA 2NZ0A 1OMRA 2ZFDA 4NDBA 3DF0A 3CZ1A 1JUOA 3F45A 3I5HB 3JVTC 1SR6B 3NHTA 1YX8A 3FWBA 1ZOTB 2GV5A 2L2EA 2CT9A 1OE9B 2DOQA 2ZNEA 1ORGA 4PDZA 1IH0A 3NSIA 1OZSA 5I94A 1J7QA 2WCHA 3A8RA 2LMVA 2QPTA 2AUCA 1CMFA 2BL0B 2KYCA 2ZN9A 1M39A 3D0YB 1G4YR 2JPTA 1IKUA 1UP5A 1WDCB 1IRJA 1N0YA 5AXIA 3B87A 1CDPA 1Q80A 4NDCA 3ICBA 1FPWA 1PK0D 4MZJA 5D7FA 3OHMB 3EK7A 3FIAA 2LMTA 4PALA 1NX0A 2RGIA 3O4XA 1QV0A 2WOSA 1CDNA 1AJ5A 1B7TY 1SMGA 2JXCA 1DJIA 3TZ1A 2WCKA 1CFDA 1L2OB
chains in the Genus database with same CATH topology
1LA3A 2LLUA 1S36A 1W7IB 3CGAA 1ZUZA 1QVIY 4D1EA 3DVJA 3OX6A 2COLB 1BMOA 2JOJA 3IQOA 1IJ5A 4CLNA 2LVIA 3CZTX 3VRRA 2MA2A 2MHHA 2PASA 5PALA 2LHLA 3VROA 2OS8C 2CBLA 3BUWB 4I5LB 5G08A 2GGMA 1KFUS 1YRUB 2KI4C 4MRXA 3KF9A 1LINA 2FOTA 2KFFA 4ORBB 4WRIA 4M2OA 1K9PA 1F70A 1RWYA 1BODA 1QJTA 4ZCUA 2JTZA 1U5IB 2P6BB 1CB1A 2HF5A 4C0KA 4HRHA 1V1GA 1Y1AA 1KQMB 1WRZA 2LE9B 2KDHA 1KK8B 3BOWB 4CPVA 1WLZA 3I5FC 2JT8A 1M31A 2BCAA 1QS7A 2Q91A 3OX5A 1CKKA 1TNQA 2E30A 5HLOA 3SJSA 2ZN8A 1PSRA 2K7OA 3PFVA 1YX7A 1ALWA 2M49B 3BXKA 1HQVA 1XK4C 1B7TZ 1K95A 4HRGA 1CLLA 1S1EA 3PATA 3VRNA 1F4OA 3GK2A 1YR5A 3GOFA 4PE7A 2EC6C 2NXQA 1SPYA 1QVIZ 4P2YB 2K2AA 3CWGA 1BF5A 1SCMB 1YVHA 1JFKA 4YGCB 5KU1A 3DVEA 1Y1XA 1CTRA 3I5GB 4QJ5B 3SIAA 4AQIA 2F33A 3LCPC 3VRQA 4ICBA 4AOMA 2ZNDA 1TNXA 3D10A 5FYXA 1F8HA 3SG3A 1AHRA 4OCIA 4C0LA 4F0ZB 1IQ5A 3GK4X 4MZKA 1JSAA 2M1UA 1MR8A 2LV7A 2IS9A 2JC2A 1SR6C 1QASA 2I7AA 4DIRA 3D0YA 1DMOA 1DTLA 1RROA 1TN4A 4QJ3B 4YBHB 2KBMA 2Q4UA 4M2QA 4N1GA 4MN0A 4N1FA 4YRUA 3GK1A 1K90D 2M7LA 2BL0C 4MSPA 4ZCVA 4PHNA 2KHNA 5CSNA 1BLQA 3C1VA 3RLZA 5HKWA 2I18A 1MF8B 1WDCC 1NPQA 1AVSA 1UURA 1SRAA 1AP4A 1HT9A 2ZRTA 3IQQA 2LM5A 1DF0A 1H4BA 1XA5A 1MHOA 1CLMA 2L98A 2JWWA 1CFFA 2KSPA 2M7NA 2KFGA 4I5KA 2OTGB 2KBIA 4A4CA 3EVVA 4WQ3A 1EXRA 1A2XA 1L2OC 3AAKA 2KAYA 4OV2A 5I2QA 2BCBA 1CLBA 1EG3A 1KQVA 3TDUA 1WY9A 4I5NB 2CNPA 1CDMA 1FBVA 4YGDB 4P5OE 2HPSA 3JTDB 4XJKB 5BPJA 5AFPA 1XFZO 1A75B 2K7CA 2K2FA 1K94A 2KOTA 1FW4A 1JF0A 1QXPA 1Y6WA 4YGBB 2BE6A 2KQYA 1PSBA 2BBNA 5J3XA 3BYAA 2BE4A 1BR4B 1W7JB 2LVJA 2MRDA 5JOLA 4IL1A 1AUIB 1F4QA 1KWOB 1YUSA 1K9UA 2H61A 3IF7A 1FI6A 4PE0A 3EK4A 3BUNB 5CPVA 4JQ0D 1KQMC 1BJFA 4DRWA 3OB1B 2L0PA 1UWOA 1YUUA 1KK8C 1DJHA 1SW8A 2Y1NA 1MQ1A 3KPXA 2O5GA 1B4CA 1OQPA 3PALA 2LP2A 2R2IA 2Y5IA 5HKZA 1TOPA 3CLNA 2H61C 4OR9B 3KEVA 5I2OA 1TCOB 1RTP1 1JC2A 4DCKA 1BOCA 3O4YA 1PULA 2NCOA 3QRXA 1J7OA 3O6BA 5HKYA 2KI6D 2HQWA 2M29A 3VRPA 4N5XA 1SCVA 3O78A 3BUXB 1N65A 2F2OA 2LCPA 2LLSA 3M0WA 1SCMC 2LUCA 3EKJA 1UHJA 1OZOA 1YURA 4YGAA 1M46A 1LA0A 2KAXA 1KFUL 2MAZA 1RECA 2CCMA 1SNLA 1XK4A 1F55A 2ISDA 1DJXA 2L4HA 3DF0B 4GPLB 1D1OA 4HSZA 1A03A 1FF1A 2LNKA 3EKHA 1OMDA 1ZFSA 5HLVA 5DKNA 4PHMA 3LLEA 4E68A 1SBJA 2BKIB 2JXLA 3ZWHA 4WQ2A 4MRYA 4MBEA 2TN4A 4JPZB 2BKHB 4MEWA 3WHTB 1UUSA 1S6JA 1CNPA 1E8AA 2JZIA 1CDLA 2LVVA 1XFWO 2JQ6A 3A4UB 3SIBA 2L4IA 3SG2A 3DVMA 1JWDA 1JFJA 1TNPA 1NUBA 2L50A 4OVNF 2KNEA 5CSJA 3NSLA 1IG5A 2E6WA 3EVUA 4TNCA 4DUQA 3TS5B 1ALVA 2K0JA 1XYDA 1CFCA 5I8NA 1EG4A 1MXEA 3SG7A 1N2DA 2PMYA 1CM4A 1ODBA 3E3RA 2JNFA 1TTXA 3TUYB 3I5HC 1CM1A 2OTGC 3AAJA 2A4JA 1DJWA 2MLFC 2KFHA 1XVJA 1KK7Y 1QX2A 1F71A 1KSMA 1X02A 4PHKA 4OKHA 2L5XB 2LC5A 2I94A 3PM8A 1NSHA 1LVCD 1XFVO 1KSOA 1S26D 4A4BA 1B8CA 1R2UA 1TCFA 3HX4A 4YGEB 1NX3A 1NWDA 1NYAA 4ORAB 3ZNIA 4YI9A 1KCYA 1NCXA 1ZMZA 3OP0A 5ER4X 2AMIA 1J7PA 2V53A 1KWOC 4CFRA 4GNKB 3FWCA 1SK6D 2QACA 1KFXS 4U8DA 1OMVA 1J7RA 1WRLA 1TRFA 1B8RA 1J55A 2WCFA 1AJ4A 1QLSA 3K21A 2M8UA 3LL8B 3OB2B 1G8IA 1QX7A 1KFXL 1WLMA 1EL4A 3DVKA 1XFYO 4PE1A 2WORA 2M1KB 5IBWA 1CMGA 1EJ3A 1U5IA 2LLTA 2OPOA 2NCPA 5AANA 1DJYA 2MLEC 1PVBA 1TIZA 3AKBA 5DKRA 5AEQA 1UHKA 2LUXA 1RK9A 2M0RA 1NIWA 5GQQC 2K7BA 1S5GY 1ZACA 3BOWA 1DJGA 5KTYA 2JRFA 2M97A 3FS7A 5I2LA 1C07A 1KK7Z 3VGOA 2PALA 2JNXA 1K9KA 1GQMA 3O2PA 2SASA 5B8IB 5D69A 1B8LA 1QLKA 2G2BA 3PN7B 2B1UA 1BG1A 1SKTA 1PRWA 1QX5B 3KO0A 2BECA 3PSRA 3SG5A 1Y0VH 2O60A 4M2PA 1IQ3A 1BT6A 3I5IB 4GFTA 4PHJA 1JBAA 2I2RE 1S6CA 2JT3A 2WCBA 4MLWA 5ER5A 2JTTA 1FI5A 5JJGA 4QJ4B 4JWQA 3JVTB 2Y1MA 2LANA 3CR4X 2KI6C 2JU0A 2VRGA 2LMUA 3EVRA 2HETA 2MJWB 1AK8A 1DGUA 2GGZA 3I5GC 1C7VA 5K89A 1MXLC 1SY9A 1C7WA 1DF0B 4R1EA 1GGZA 3TS5C 1XFXO 2L51A 2AAOA 2FCEA 2LVKA 1YRTB 5KSZA 1S5GZ 3BUOB 4PCWA 2BBMA 2JULA 1H8BA 3EK8A 1K96A 1PVAA 2K7DA 2KYFA 3SG6A 2G9BA 2F3YA 3KHEA 2PVBA 3CTNA 1OSAA 1SL8A 4BY4A 3TDZA 2WNDA 3TUYC 4MZLA 1UHHA 2F8PA 2EHBA 2WC8A 4USLA 2WCEA 1J1EA 4FQOA 1M63B 3CR5X 1V1FA 1K8UA 1TNWA 1UHNA 2LP3A 2SCPA 3BQ3A 3CS1A 4GBAA 1LXFC 1MWNA 1YTZC 2M3WA 1FPWA 2CXJA 2LHIA 2K61A 4FTGA 1DVIA 1QTXA 1R6PA 5F6TA 2HQ8A 3CR2A 4MVFA 1QATA 1GJYA 1VRKA 4GGFA 2KAVA 1B9AA 2F3ZA 1YUTA 2K8MB 4PE4A 4CIDA 5HYDA 2OS8B 4I5JA 2KGBC 1DT7B 4Q04A 1F54A 4XJKA 1Y1UA 5CSFA 2KI4B 1A75A 2BCXA 1WRKA 3NSKA 4NQGA 4YI8A 1IJ6A 1JF2A 3WNXB 1NCZA 3TDIA 4CFQA 1IGVA 1NX1A 2F2PA 4GGFC 3HCMA 1NX2A 4GAOA 5TNCA 5CSIA 1EH2A 2FCDA 2Y4QA 2H2KA 2PRUA 2D8NA 1BR1B 2ZKMX 3JTDC 4HREE 1UHIA 1A29A 3PLFB 3NXAA 3I5FB 3RM1A 1DJZA 3WHUB 4NDDA 3AKAA 2CTNA 1GGWA 3WXAA 1L7ZA 1B47A 2ZRSA 2MBXA 5DKQA 2LAPA 1QV1A 2NLNA 1K93D 1B1GA 1J1DA 1PALA 4L9MA 1S3PA 4XYNA 4UPGA 2KQ6A 2KGRA 1SL9A 3BUMB 4ORCB 1QIVA 2M9GA 1BU3A 4GGNA 2EC6B 1M45A 4GUKA 5AERA 3DD4A 1NP8A 1XFUO 2JT0A 3PN7C 1NCYA 4AQJA 1IWQA 1DGVA 3NSOA 1A4PA 1K2HA 1LKJA 3LK0A 3LK1A 1OOJA 3H4SE 1YVLA 1XO5A 3MSEB 3SG4A 3I5IC 1RJVA 1CFPA 4ETOA 4DS7A 1G33A 1RFJA 4BY5A 2EGDA 1SYMA 1QIWA 1S6IA 1SL7A 2FJUB 2PSRA 1MUXA 4C0JA 2NZ0A 1OMRA 2ZFDA 4NDBA 3DF0A 1JUOA 3F45A 3I5HB 3JVTC 1SR6B 1YX8A 3FWBA 1ZOTB 2GV5A 2L2EA 2CT9A 1OE9B 2DOQA 2ZNEA 4PDZA 1IH0A 3NSIA 1OZSA 1J7QA 3A8RA 2LMVA 2QPTA 2AUCA 1CMFA 2BL0B 2KYCA 2ZN9A 1M39A 3D0YB 1G4YR 2JPTA 1IKUA 1UP5A 1WDCB 1IRJA 1N0YA 5AXIA 1CDPA 1Q80A 4NDCA 3ICBA 1PK0D 4MZJA 5D7FA 3OHMB 3EK7A 3FIAA 2LMTA 4PALA 1NX0A 2RGIA 1CDNA 1QV0A 2WOSA 1AJ5A 1B7TY 1SMGA 2JXCA 1DJIA 3TZ1A 1CFDA 1L2OB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LA3 A;  2LLU A;  1S36 A;  1W7I B;  3CGA A;  1ZUZ A;  1QVI Y;  4D1E A;  3DVJ A;  3OX6 A;  2COL B;  1BMO A;  2JOJ A;  3IQO A;  1IJ5 A;  4CLN A;  2LVI A;  3CZT X;  3VRR A;  2MA2 A;  2MHH A;  2PAS A;  5PAL A;  2LHL A;  3VRO A;  2OS8 C;  2CBL A;  3BUW B;  4I5L B;  5G08 A;  2GGM A;  1KFU S;  1YRU B;  2KI4 C;  4MRX A;  3KF9 A;  1LIN A;  2FOT A;  2KFF A;  4ORB B;  4WRI A;  4M2O A;  1K9P A;  1F70 A;  1RWY A;  1BOD A;  1QJT A;  4ZCU A;  2JTZ A;  1U5I B;  2P6B B;  1CB1 A;  2HF5 A;  4C0K A;  4HRH A;  1V1G A;  1Y1A A;  1KQM B;  1WRZ A;  2LE9 B;  2KDH A;  1KK8 B;  3BOW B;  4CPV A;  1WLZ A;  3I5F C;  2JT8 A;  1M31 A;  2BCA A;  1QS7 A;  2Q91 A;  3OX5 A;  1CKK A;  1TNQ A;  2E30 A;  5HLO A;  3SJS A;  2ZN8 A;  1PSR A;  2K7O A;  3PFV A;  1YX7 A;  1ALW A;  2M49 B;  3BXK A;  1HQV A;  1XK4 C;  1B7T Z;  1K95 A;  4HRG A;  1CLL A;  1S1E A;  3PAT A;  3VRN A;  1F4O A;  3GK2 A;  1YR5 A;  3GOF A;  4PE7 A;  2EC6 C;  2NXQ A;  1SPY A;  1QVI Z;  4P2Y B;  2K2A A;  3CWG A;  1BF5 A;  1SCM B;  1YVH A;  1JFK A;  4YGC B;  5KU1 A;  3DVE A;  1Y1X A;  1CTR A;  3I5G B;  4QJ5 B;  3SIA A;  4AQI A;  2F33 A;  3LCP C;  3VRQ A;  4ICB A;  4AOM A;  2ZND A;  1TNX A;  3D10 A;  5FYX A;  1F8H A;  3SG3 A;  1AHR A;  4OCI A;  4C0L A;  4F0Z B;  1IQ5 A;  3GK4 X;  4MZK A;  1JSA A;  2M1U A;  1MR8 A;  2LV7 A;  2IS9 A;  2JC2 A;  1SR6 C;  1QAS A;  2I7A A;  4DIR A;  3D0Y A;  1DMO A;  1DTL A;  1RRO A;  1TN4 A;  4QJ3 B;  4YBH B;  2KBM A;  2Q4U A;  4M2Q A;  4N1G A;  4MN0 A;  4N1F A;  4YRU A;  3GK1 A;  1K90 D;  2M7L A;  2BL0 C;  4MSP A;  4ZCV A;  4PHN A;  2KHN A;  5CSN A;  1BLQ A;  3C1V A;  3RLZ A;  5HKW A;  2I18 A;  1MF8 B;  1WDC C;  1NPQ A;  1AVS A;  1UUR A;  1SRA A;  1AP4 A;  1HT9 A;  2ZRT A;  3IQQ A;  2LM5 A;  1DF0 A;  1H4B A;  1XA5 A;  1MHO A;  1CLM A;  2L98 A;  2JWW A;  1CFF A;  2KSP A;  2M7N A;  2KFG A;  4I5K A;  2OTG B;  2KBI A;  4A4C A;  3EVV A;  4WQ3 A;  1EXR A;  1A2X A;  1L2O C;  3AAK A;  2KAY A;  4OV2 A;  5I2Q A;  2BCB A;  1CLB A;  1EG3 A;  1KQV A;  3TDU A;  1WY9 A;  4I5N B;  2CNP A;  1CDM A;  1FBV A;  4YGD B;  4P5O E;  2HPS A;  3JTD B;  4XJK B;  5BPJ A;  5AFP A;  1XFZ O;  1A75 B;  2K7C A;  2K2F A;  1K94 A;  2KOT A;  1FW4 A;  1JF0 A;  1QXP A;  1Y6W A;  4YGB B;  2BE6 A;  2KQY A;  1PSB A;  2BBN A;  5J3X A;  3BYA A;  2BE4 A;  1BR4 B;  1W7J B;  2LVJ A;  2MRD A;  5JOL A;  4IL1 A;  1AUI B;  1F4Q A;  1KWO B;  1YUS A;  1K9U A;  2H61 A;  3IF7 A;  1FI6 A;  4PE0 A;  3EK4 A;  3BUN B;  5CPV A;  4JQ0 D;  1KQM C;  1BJF A;  4DRW A;  3OB1 B;  2L0P A;  1UWO A;  1YUU A;  1KK8 C;  1DJH A;  1SW8 A;  2Y1N A;  1MQ1 A;  3KPX A;  2O5G A;  1B4C A;  1OQP A;  3PAL A;  2LP2 A;  2R2I A;  2Y5I A;  5HKZ A;  1TOP A;  3CLN A;  2H61 C;  4OR9 B;  3KEV A;  5I2O A;  1TCO B;  1RTP 1;  1JC2 A;  4DCK A;  1BOC A;  3O4Y A;  1PUL A;  2NCO A;  3QRX A;  1J7O A;  3O6B A;  5HKY A;  2KI6 D;  2HQW A;  2M29 A;  3VRP A;  4N5X A;  1SCV A;  3O78 A;  3BUX B;  1N65 A;  2F2O A;  2LCP A;  2LLS A;  3M0W A;  1SCM C;  2LUC A;  3EKJ A;  1UHJ A;  1OZO A;  1YUR A;  4YGA A;  1M46 A;  1LA0 A;  2KAX A;  1KFU L;  2MAZ A;  1REC A;  2CCM A;  1SNL A;  1XK4 A;  1F55 A;  2ISD A;  1DJX A;  2L4H A;  3DF0 B;  4GPL B;  1D1O A;  4HSZ A;  1A03 A;  1FF1 A;  2LNK A;  3EKH A;  1OMD A;  1ZFS A;  5HLV A;  5DKN A;  4PHM A;  3LLE A;  4E68 A;  1SBJ A;  2BKI B;  2JXL A;  3ZWH A;  4WQ2 A;  4MRY A;  4MBE A;  2TN4 A;  4JPZ B;  2BKH B;  4MEW A;  3WHT B;  1UUS A;  1S6J A;  1CNP A;  1E8A A;  2JZI A;  1CDL A;  2LVV A;  1XFW O;  2JQ6 A;  3A4U B;  3SIB A;  2L4I A;  3SG2 A;  3DVM A;  1JWD A;  1JFJ A;  1TNP A;  1NUB A;  2L50 A;  4OVN F;  2KNE A;  5CSJ A;  3NSL A;  1IG5 A;  2E6W A;  3EVU A;  4TNC A;  4DUQ A;  3TS5 B;  1ALV A;  2K0J A;  1XYD A;  1CFC A;  5I8N A;  1EG4 A;  1MXE A;  3SG7 A;  1N2D A;  2PMY A;  1CM4 A;  1ODB A;  3E3R A;  2JNF A;  1TTX A;  3TUY B;  3I5H C;  1CM1 A;  2OTG C;  3AAJ A;  2A4J A;  1DJW A;  2MLF C;  2KFH A;  1XVJ A;  1KK7 Y;  1QX2 A;  1F71 A;  1KSM A;  1X02 A;  4PHK A;  4OKH A;  2L5X B;  2LC5 A;  2I94 A;  3PM8 A;  1NSH A;  1LVC D;  1XFV O;  1KSO A;  1S26 D;  4A4B A;  1B8C A;  1R2U A;  1TCF A;  3HX4 A;  4YGE B;  1NX3 A;  1NWD A;  1NYA A;  4ORA B;  3ZNI A;  4YI9 A;  1KCY A;  1NCX A;  1ZMZ A;  3OP0 A;  5ER4 X;  2AMI A;  1J7P A;  2V53 A;  1KWO C;  4CFR A;  4GNK B;  3FWC A;  1SK6 D;  2QAC A;  1KFX S;  4U8D A;  1OMV A;  1J7R A;  1WRL A;  1TRF A;  1B8R A;  1J55 A;  2WCF A;  1AJ4 A;  1QLS A;  3K21 A;  2M8U A;  3LL8 B;  3OB2 B;  1G8I A;  1QX7 A;  1KFX L;  1WLM A;  1EL4 A;  3DVK A;  1XFY O;  4PE1 A;  2WOR A;  2M1K B;  5IBW A;  1CMG A;  1EJ3 A;  1U5I A;  2LLT A;  2OPO A;  2NCP A;  5AAN A;  1DJY A;  2MLE C;  1PVB A;  1TIZ A;  3AKB A;  5DKR A;  5AEQ A;  1UHK A;  2LUX A;  1RK9 A;  2M0R A;  1NIW A;  5GQQ C;  2K7B A;  1S5G Y;  1ZAC A;  3BOW A;  1DJG A;  5KTY A;  2JRF A;  2M97 A;  3FS7 A;  5I2L A;  1C07 A;  1KK7 Z;  3VGO A;  2PAL A;  2JNX A;  1K9K A;  1GQM A;  3O2P A;  2SAS A;  5B8I B;  5D69 A;  1B8L A;  1QLK A;  2G2B A;  3PN7 B;  2B1U A;  1BG1 A;  1SKT A;  1PRW A;  1QX5 B;  3KO0 A;  2BEC A;  3PSR A;  3SG5 A;  1Y0V H;  2O60 A;  4M2P A;  1IQ3 A;  1BT6 A;  3I5I B;  4GFT A;  4PHJ A;  1JBA A;  2I2R E;  1S6C A;  2JT3 A;  2WCB A;  4MLW A;  5ER5 A;  2JTT A;  1FI5 A;  5JJG A;  4QJ4 B;  4JWQ A;  3JVT B;  2Y1M A;  2LAN A;  3CR4 X;  2KI6 C;  2JU0 A;  2VRG A;  2LMU A;  3EVR A;  2HET A;  2MJW B;  1AK8 A;  1DGU A;  2GGZ A;  3I5G C;  1C7V A;  5K89 A;  1MXL C;  1SY9 A;  1C7W A;  1DF0 B;  4R1E A;  1GGZ A;  3TS5 C;  1XFX O;  2L51 A;  2AAO A;  2FCE A;  2LVK A;  1YRT B;  5KSZ A;  1S5G Z;  3BUO B;  4PCW A;  2BBM A;  2JUL A;  1H8B A;  3EK8 A;  1K96 A;  1PVA A;  2K7D A;  2KYF A;  3SG6 A;  2G9B A;  2F3Y A;  3KHE A;  2PVB A;  3CTN A;  1OSA A;  1SL8 A;  4BY4 A;  3TDZ A;  2WND A;  3TUY C;  4MZL A;  1UHH A;  2F8P A;  2EHB A;  2WC8 A;  4USL A;  2WCE A;  1J1E A;  4FQO A;  1M63 B;  3CR5 X;  1V1F A;  1K8U A;  1TNW A;  1UHN A;  2LP3 A;  2SCP A;  3BQ3 A;  3CS1 A;  4GBA A;  1LXF C;  1MWN A;  1YTZ C;  2M3W A;  1FPW A;  2CXJ A;  2LHI A;  2K61 A;  4FTG A;  1DVI A;  1QTX A;  1R6P A;  5F6T A;  2HQ8 A;  3CR2 A;  4MVF A;  1QAT A;  1GJY A;  1VRK A;  4GGF A;  2KAV A;  1B9A A;  2F3Z A;  1YUT A;  2K8M B;  4PE4 A;  4CID A;  5HYD A;  2OS8 B;  4I5J A;  2KGB C;  1DT7 B;  4Q04 A;  1F54 A;  4XJK A;  1Y1U A;  5CSF A;  2KI4 B;  1A75 A;  2BCX A;  1WRK A;  3NSK A;  4NQG A;  4YI8 A;  1IJ6 A;  1JF2 A;  3WNX B;  1NCZ A;  3TDI A;  4CFQ A;  1IGV A;  1NX1 A;  2F2P A;  4GGF C;  3HCM A;  1NX2 A;  4GAO A;  5TNC A;  5CSI A;  1EH2 A;  2FCD A;  2Y4Q A;  2H2K A;  2PRU A;  2D8N A;  1BR1 B;  2ZKM X;  3JTD C;  4HRE E;  1UHI A;  1A29 A;  3PLF B;  3NXA A;  3I5F B;  3RM1 A;  1DJZ A;  3WHU B;  4NDD A;  3AKA A;  2CTN A;  1GGW A;  3WXA A;  1L7Z A;  1B47 A;  2ZRS A;  2MBX A;  5DKQ A;  2LAP A;  1QV1 A;  2NLN A;  1K93 D;  1B1G A;  1J1D A;  1PAL A;  4L9M A;  1S3P A;  4XYN A;  4UPG A;  2KQ6 A;  2KGR A;  1SL9 A;  3BUM B;  4ORC B;  1QIV A;  2M9G A;  1BU3 A;  4GGN A;  2EC6 B;  1M45 A;  4GUK A;  5AER A;  3DD4 A;  1NP8 A;  1XFU O;  2JT0 A;  3PN7 C;  1NCY A;  4AQJ A;  1IWQ A;  1DGV A;  3NSO A;  1A4P A;  1K2H A;  1LKJ A;  3LK0 A;  3LK1 A;  1OOJ A;  3H4S E;  1YVL A;  1XO5 A;  3MSE B;  3SG4 A;  3I5I C;  1RJV A;  1CFP A;  4ETO A;  4DS7 A;  1G33 A;  1RFJ A;  4BY5 A;  2EGD A;  1SYM A;  1QIW A;  1S6I A;  1SL7 A;  2FJU B;  2PSR A;  1MUX A;  4C0J A;  2NZ0 A;  1OMR A;  2ZFD A;  4NDB A;  3DF0 A;  1JUO A;  3F45 A;  3I5H B;  3JVT C;  1SR6 B;  1YX8 A;  3FWB A;  1ZOT B;  2GV5 A;  2L2E A;  2CT9 A;  1OE9 B;  2DOQ A;  2ZNE A;  4PDZ A;  1IH0 A;  3NSI A;  1OZS A;  1J7Q A;  3A8R A;  2LMV A;  2QPT A;  2AUC A;  1CMF A;  2BL0 B;  2KYC A;  2ZN9 A;  1M39 A;  3D0Y B;  1G4Y R;  2JPT A;  1IKU A;  1UP5 A;  1WDC B;  1IRJ A;  1N0Y A;  5AXI A;  1CDP A;  1Q80 A;  4NDC A;  3ICB A;  1PK0 D;  4MZJ A;  5D7F A;  3OHM B;  3EK7 A;  3FIA A;  2LMT A;  4PAL A;  1NX0 A;  2RGI A;  1CDN A;  1QV0 A;  2WOS A;  1AJ5 A;  1B7T Y;  1SMG A;  2JXC A;  1DJI A;  3TZ1 A;  1CFD A;  1L2O B; 
#chains in the Genus database with same CATH topology
 1LA3 A;  2LLU A;  1OOG A;  1S36 A;  1W7I B;  3CGA A;  3V2L A;  1ZUZ A;  1QVI Y;  3CDN A;  4D1E A;  3DVJ A;  3OX6 A;  2COL B;  1BMO A;  2JOJ A;  3IQO A;  1IJ5 A;  4CLN A;  2LVI A;  3CZT X;  3VRR A;  2MA2 A;  2MHH A;  2PAS A;  5PAL A;  2LHL A;  3VRO A;  2OS8 C;  2CBL A;  3BUW B;  4I5L B;  5G08 A;  2GGM A;  1KFU S;  1YRU B;  2KI4 C;  4MRX A;  3KF9 A;  1LIN A;  2FOT A;  2KFF A;  4ORB B;  4WRI A;  4M2O A;  1K9P A;  1F70 A;  1RWY A;  1BOD A;  1QJT A;  4ZCU A;  2JTZ A;  1U5I B;  2P6B B;  1CB1 A;  2HF5 A;  4C0K A;  4HRH A;  1V1G A;  1Y1A A;  2BNX A;  1KQM B;  1WRZ A;  2LE9 B;  2KDH A;  1KK8 B;  3BOW B;  4CPV A;  1WLZ A;  2K60 A;  3I5F C;  2JT8 A;  1M31 A;  2BCA A;  1QS7 A;  2Q91 A;  3OX5 A;  1CKK A;  1TNQ A;  2E30 A;  5HLO A;  3SJS A;  3SS3 A;  2ZN8 A;  1PSR A;  2K7O A;  3PFV A;  1GM0 A;  1YX7 A;  1ALW A;  2KLE A;  2M49 B;  2QEH A;  3BXK A;  1HQV A;  1XK4 C;  1B7T Z;  1K95 A;  4HRG A;  1CLL A;  1S1E A;  3PAT A;  3VRN A;  3S0F A;  1F4O A;  3GK2 A;  1YR5 A;  3GOF A;  4IJ7 A;  4PE7 A;  2EC6 C;  2NXQ A;  1SPY A;  1QVI Z;  3B88 A;  2YGU A;  2K2A A;  3CWG A;  4P2Y B;  3UNW A;  1SCM B;  1BF5 A;  1YVH A;  1JFK A;  4YGC B;  5KU1 A;  3DVE A;  1Y1X A;  1CTR A;  3CZ0 A;  3I5G B;  4QJ5 B;  3SIA A;  4AQI A;  2F33 A;  3LCP C;  3B7A A;  3VRQ A;  4ICB A;  4AOM A;  2ZND A;  1TNX A;  3D10 A;  5FYX A;  1F8H A;  3PM2 A;  3SG3 A;  1AHR A;  4OCI A;  4C0L A;  4F0Z B;  1IQ5 A;  3GK4 X;  4MZK A;  1JSA A;  2M1U A;  1MR8 A;  2LV7 A;  3R1V A;  2IS9 A;  2JC2 A;  1SR6 C;  1QAS A;  2I7A A;  4DIR A;  3D0Y A;  2P71 A;  1QWV A;  1DMO A;  1DTL A;  3DXL A;  5FI7 A;  1RRO A;  1TN4 A;  4QJ3 B;  4YBH B;  3FE9 A;  2KBM A;  2Q4U A;  4INW A;  3CAB A;  4M2Q A;  5EL2 A;  4N1G A;  4MN0 A;  4N1F A;  4YRU A;  3GK1 A;  1K90 D;  2M7L A;  2BL0 C;  4MSP A;  1OOI X;  4ZCV A;  4PHN A;  2KHN A;  5CSN A;  5DIC A;  1BLQ A;  3C1V A;  3S0E A;  3RLZ A;  5HKW A;  2I18 A;  1MF8 B;  1WDC C;  1NPQ A;  1AVS A;  1UUR A;  1SRA A;  1AP4 A;  1HT9 A;  2ZRT A;  3IQQ A;  2LM5 A;  3BFB A;  1OOF A;  3N7H A;  1DF0 A;  1H4B A;  1XA5 A;  1MHO A;  1CLM A;  2L98 A;  2JWW A;  1CFF A;  2KSP A;  2L5Y A;  1Z2C B;  2KFG A;  2M7N A;  4I5K A;  1XFR A;  2OTG B;  2KBI A;  3OGN A;  4A4C A;  3DYE A;  3EVV A;  4WQ3 A;  1EXR A;  1A2X A;  1L2O C;  3AAK A;  2KAY A;  4JD9 A;  4OV2 A;  2BCB A;  5I2Q A;  1CLB A;  1EG3 A;  1KQV A;  3TDU A;  1WY9 A;  4I5N B;  2CNP A;  1CDM A;  1FBV A;  4YGD B;  4P5O E;  2HPS A;  3D74 A;  3JTD B;  4XJK B;  5BPJ A;  5AFP A;  1XFZ O;  1A75 B;  2K7C A;  2K2F A;  1K94 A;  2KOT A;  3IVT A;  1FW4 A;  1JF0 A;  1QXP A;  3RZS A;  1Y6W A;  3D78 A;  4YGB B;  2BE6 A;  2KQY A;  1PSB A;  2BBN A;  5J3X A;  3BFA A;  3BYA A;  2BE4 A;  1BR4 B;  1W7J B;  2LVJ A;  2MRD A;  5JOL A;  4IL1 A;  1AUI B;  1F4Q A;  1KWO B;  1YUS A;  3S0D A;  1K9U A;  2H61 A;  3IF7 A;  1FI6 A;  4PE0 A;  3EK4 A;  3BUN B;  5CPV A;  2FJY A;  4JQ0 D;  1KQM C;  1BJF A;  4DRW A;  3OB1 B;  2L0P A;  1UWO A;  1YUU A;  1KK8 C;  1DJH A;  1SW8 A;  2Y1N A;  1MQ1 A;  3KPX A;  2O5G A;  1B4C A;  1OQP A;  3PAL A;  2LP2 A;  2R2I A;  2Y5I A;  5HKZ A;  1TOP A;  3CLN A;  2H61 C;  4OR9 B;  1P28 A;  3KEV A;  3L4L A;  5I2O A;  1TCO B;  1RTP 1;  1JC2 A;  4DCK A;  1BOC A;  3O4Y A;  5FI6 A;  1PUL A;  2NCO A;  3QRX A;  1J7O A;  3O6B A;  5HKY A;  2KI6 D;  2HQW A;  2M29 A;  3VRP A;  4N5X A;  1SCV A;  3O78 A;  1W9Z A;  3BUX B;  1N65 A;  2BAP A;  2F2O A;  2LCP A;  2LLS A;  3M0W A;  1SCM C;  2LUC A;  3EKJ A;  3Q8I A;  1UHJ A;  2L2C A;  1OZO A;  1YUR A;  3D75 A;  4YGA A;  1M46 A;  1LA0 A;  2KAX A;  1KFU L;  2MAZ A;  1REC A;  2CCM A;  3CYZ A;  3R1P A;  1SNL A;  1XK4 A;  2QDI A;  1F55 A;  2ISD A;  1DJX A;  2L4H A;  3DF0 B;  4GPL B;  1D1O A;  4HSZ A;  3DY9 A;  1DQE A;  1A03 A;  1FF1 A;  2LNK A;  3EKH A;  1C3Y A;  1OMD A;  1ZFS A;  3R72 A;  5HLV A;  5DKN A;  4PHM A;  3LLE A;  1OW4 A;  1SBJ A;  4E68 A;  2BKI B;  2JXL A;  3ZWH A;  4WQ2 A;  2P70 A;  4MRY A;  4MBE A;  2TN4 A;  4JPZ B;  2BKH B;  4MEW A;  3WHT B;  1UUS A;  1S6J A;  1CNP A;  1E8A A;  2JZI A;  1CDL A;  2LVV A;  1XFW O;  3SS4 A;  2JQ6 A;  1OOH A;  3A4U B;  3SIB A;  2L4I A;  3SG2 A;  3D76 A;  3DVM A;  3D77 A;  1JWD A;  1JFJ A;  1TNP A;  1NUB A;  2L50 A;  3VB1 A;  4OVN F;  2KNE A;  5CSJ A;  3NSL A;  1IG5 A;  2E6W A;  3EVU A;  4TNC A;  4DUQ A;  1TUZ A;  3TS5 B;  1ALV A;  2K0J A;  1XYD A;  1CFC A;  5I8N A;  1EG4 A;  1MXE A;  3SG7 A;  5HL1 A;  1N2D A;  2PMY A;  2WC6 A;  1CM4 A;  1ODB A;  3E3R A;  2JNF A;  1TTX A;  3TUY B;  3I5H C;  1CM1 A;  2OTG C;  3AAJ A;  2A4J A;  1DJW A;  1TUJ A;  2MLF C;  3QME A;  2KFH A;  2KLD A;  1XVJ A;  1KK7 Y;  1QX2 A;  1F71 A;  1KSM A;  1X02 A;  4PHK A;  4OKH A;  2L5X B;  1IIO A;  2LC5 A;  2I94 A;  3PM8 A;  1NSH A;  1LVC D;  1XFV O;  1KSO A;  1S26 D;  4A4B A;  1B8C A;  1R2U A;  1TCF A;  3HX4 A;  4YGE B;  1NX3 A;  1NWD A;  1NYA A;  4ORA B;  3ZNI A;  4YI9 A;  1KCY A;  1NCX A;  1ZMZ A;  3OP0 A;  5ER4 X;  2AMI A;  1J7P A;  2V53 A;  1KWO C;  4CFR A;  4GNK B;  3FWC A;  1SK6 D;  2QAC A;  1KFX S;  4U8D A;  1OMV A;  1TWO A;  1J7R A;  1WRL A;  1SSE B;  1TRF A;  1B8R A;  1C3Z A;  1J55 A;  1DEK A;  1AJ4 A;  2WCF A;  1QLS A;  1Z4H A;  2M8U A;  3K21 A;  3LL8 B;  2JPO A;  3OB2 B;  1G8I A;  1QX7 A;  1KFX L;  1WLM A;  1EL4 A;  3DVK A;  1XFY O;  4PE1 A;  4KYN A;  2WOR A;  2M1K B;  5IBW A;  1CMG A;  1EJ3 A;  1U5I A;  2LLT A;  3B6X A;  2OPO A;  2NCP A;  5AAN A;  1DJY A;  2MLE C;  1PVB A;  1TIZ A;  3AKB A;  5DKR A;  5AEQ A;  1UHK A;  2LUX A;  4OZD A;  1RK9 A;  2M0R A;  1NIW A;  5GQQ C;  2K7B A;  1S5G Y;  1ZAC A;  3BOW A;  1DJG A;  5KTY A;  1LS8 A;  2JRF A;  2M97 A;  3FS7 A;  5I2L A;  1C07 A;  1KK7 Z;  2PQL A;  3VGO A;  3FE8 A;  2PAL A;  2JNX A;  1K9K A;  1GQM A;  2WC5 A;  3O2P A;  2SAS A;  5B8I B;  5D69 A;  1B8L A;  1QLK A;  2G2B A;  3PN7 B;  2B1U A;  1BG1 A;  1SKT A;  1PRW A;  1QX5 B;  2WCJ A;  3FE6 A;  3KO0 A;  2BEC A;  3PSR A;  3SG5 A;  1Y0V H;  2O60 A;  4M2P A;  1IQ3 A;  1BT6 A;  3I5I B;  3DZT A;  4GFT A;  4PHJ A;  1JBA A;  2I2R E;  1S6C A;  2JT3 A;  2WCB A;  4MLW A;  5ER5 A;  2JTT A;  1FI5 A;  5JJG A;  4QJ4 B;  4JWQ A;  2ERB A;  3JVT B;  2Y1M A;  2LAN A;  3CR4 X;  2KI6 C;  2JU0 A;  5FI2 A;  2VRG A;  2LMU A;  3EVR A;  2HET A;  2MJW B;  4F7F A;  1AK8 A;  1DGU A;  2GGZ A;  2GTE A;  3I5G C;  5K89 A;  1C7V A;  1MXL C;  1SY9 A;  1C7W A;  1DF0 B;  3B86 A;  4R1E A;  3SS5 A;  1GGZ A;  3L47 A;  1XFX O;  2L51 A;  3D73 A;  3TS5 C;  2AAO A;  2FCE A;  2LVK A;  1YRT B;  5KSZ A;  3S0A A;  1S5G Z;  3BUO B;  4PCW A;  2BBM A;  2JUL A;  1H8B A;  3EK8 A;  1K96 A;  1PVA A;  2K7D A;  2KYF A;  3SG6 A;  2G9B A;  2F3Y A;  3KHE A;  2PVB A;  3CTN A;  1OSA A;  1SL8 A;  4BY4 A;  3TDZ A;  3EG5 B;  2WND A;  3TUY C;  4MZL A;  1UHH A;  2F8P A;  2EHB A;  2WC8 A;  4USL A;  4INX A;  2WCE A;  1J1E A;  4FQO A;  3CZ2 A;  1M63 B;  3CR5 X;  1V1F A;  1K8U A;  1TNW A;  1UHN A;  2LP3 A;  2SCP A;  3BQ3 A;  3CS1 A;  4GBA A;  1LXF C;  1MWN A;  1YTZ C;  2M3W A;  5D3O A;  2CXJ A;  2LHI A;  2K61 A;  2QEO A;  4FTG A;  1DVI A;  1QTX A;  1R6P A;  4PT1 A;  5F6T A;  2HQ8 A;  3CR2 A;  4MVF A;  3UO9 A;  1QAT A;  1GJY A;  1VRK A;  4GGF A;  2KAV A;  1B9A A;  2F3Z A;  1YUT A;  2K8M B;  4PE4 A;  4CID A;  5HYD A;  2OS8 B;  4I5J A;  2KGB C;  1DT7 B;  4Q04 A;  1F54 A;  4XJK A;  1Y1U A;  5CSF A;  2KI4 B;  1A75 A;  4FQT A;  2BCX A;  1WRK A;  4JKT A;  3NSK A;  4NQG A;  4YI8 A;  1IJ6 A;  2H8V A;  1JF2 A;  3WNX B;  1NCZ A;  2KPH A;  3TDI A;  4CFQ A;  1IGV A;  1NX1 A;  2F2P A;  4GGF C;  3HCM A;  1NX2 A;  4GAO A;  5TNC A;  2PYQ A;  3PJI A;  3OBV A;  5CSI A;  3S0G A;  2FCD A;  1EH2 A;  2Y4Q A;  2H2K A;  2PRU A;  2D8N A;  3NHI A;  1BR1 B;  2ZKM X;  3JTD C;  4HRE E;  1UHI A;  1A29 A;  3PLF B;  3NXA A;  3I5F B;  3BFH A;  3RM1 A;  1DJZ A;  3BJH A;  3WHU B;  4NDD A;  3AKA A;  2CTN A;  1GGW A;  3WXA A;  1L7Z A;  1B47 A;  2ZRS A;  2MBX A;  5DKQ A;  2LAP A;  1QV1 A;  2NLN A;  1K93 D;  1B1G A;  1J1D A;  1PAL A;  4L9M A;  1S3P A;  4XYN A;  4UPG A;  2KQ6 A;  2KGR A;  1SL9 A;  2QEV A;  3BUM B;  3R1O A;  4ORC B;  1QIV A;  2M9G A;  3L4A A;  1BU3 A;  2QEB A;  4GGN A;  2EC6 B;  1M45 A;  4GUK A;  5AER A;  1DEL A;  3DD4 A;  3S0B A;  1NP8 A;  1XFU O;  2JT0 A;  3PN7 C;  1NCY A;  4AQJ A;  3NGV A;  1DC1 A;  1IWQ A;  1DGV A;  3NSO A;  1A4P A;  2WCM A;  1K2H A;  1LKJ A;  3LK0 A;  3LK1 A;  3K1E A;  1OOJ A;  3H4S E;  1YVL A;  1XO5 A;  3MSE B;  2WCL A;  3SG4 A;  3I5I C;  1RJV A;  1CFP A;  1T14 A;  4ETO A;  4DS7 A;  1G33 A;  1RFJ A;  4BY5 A;  2EGD A;  1SYM A;  1QIW A;  1S6I A;  1SL7 A;  2FJU B;  2PSR A;  1MUX A;  4C0J A;  2NZ0 A;  1OMR A;  2ZFD A;  4NDB A;  3DF0 A;  3CZ1 A;  1JUO A;  3F45 A;  3I5H B;  3JVT C;  1SR6 B;  3NHT A;  1YX8 A;  3FWB A;  1ZOT B;  2GV5 A;  2L2E A;  2CT9 A;  1OE9 B;  2DOQ A;  2ZNE A;  1ORG A;  4PDZ A;  1IH0 A;  3NSI A;  1OZS A;  5I94 A;  1J7Q A;  2WCH A;  3A8R A;  2LMV A;  2QPT A;  2AUC A;  1CMF A;  2BL0 B;  2KYC A;  2ZN9 A;  1M39 A;  3D0Y B;  1G4Y R;  2JPT A;  1IKU A;  1UP5 A;  1WDC B;  1IRJ A;  1N0Y A;  5AXI A;  3B87 A;  1CDP A;  1Q80 A;  4NDC A;  3ICB A;  1FPW A;  1PK0 D;  4MZJ A;  5D7F A;  3OHM B;  3EK7 A;  3FIA A;  2LMT A;  4PAL A;  1NX0 A;  2RGI A;  3O4X A;  1QV0 A;  2WOS A;  1CDN A;  1AJ5 A;  1B7T Y;  1SMG A;  2JXC A;  1DJI A;  3TZ1 A;  2WCK A;  1CFD A;  1L2O B; 
#chains in the Genus database with same CATH homology
 1LA3 A;  2LLU A;  1S36 A;  1W7I B;  3CGA A;  1ZUZ A;  1QVI Y;  4D1E A;  3DVJ A;  3OX6 A;  2COL B;  1BMO A;  2JOJ A;  3IQO A;  1IJ5 A;  4CLN A;  2LVI A;  3CZT X;  3VRR A;  2MA2 A;  2MHH A;  2PAS A;  5PAL A;  2LHL A;  3VRO A;  2OS8 C;  2CBL A;  3BUW B;  4I5L B;  5G08 A;  2GGM A;  1KFU S;  1YRU B;  2KI4 C;  4MRX A;  3KF9 A;  1LIN A;  2FOT A;  2KFF A;  4ORB B;  4WRI A;  4M2O A;  1K9P A;  1F70 A;  1RWY A;  1BOD A;  1QJT A;  4ZCU A;  2JTZ A;  1U5I B;  2P6B B;  1CB1 A;  2HF5 A;  4C0K A;  4HRH A;  1V1G A;  1Y1A A;  1KQM B;  1WRZ A;  2LE9 B;  2KDH A;  1KK8 B;  3BOW B;  4CPV A;  1WLZ A;  3I5F C;  2JT8 A;  1M31 A;  2BCA A;  1QS7 A;  2Q91 A;  3OX5 A;  1CKK A;  1TNQ A;  2E30 A;  5HLO A;  3SJS A;  2ZN8 A;  1PSR A;  2K7O A;  3PFV A;  1YX7 A;  1ALW A;  2M49 B;  3BXK A;  1HQV A;  1XK4 C;  1B7T Z;  1K95 A;  4HRG A;  1CLL A;  1S1E A;  3PAT A;  3VRN A;  1F4O A;  3GK2 A;  1YR5 A;  3GOF A;  4PE7 A;  2EC6 C;  2NXQ A;  1SPY A;  1QVI Z;  4P2Y B;  2K2A A;  3CWG A;  1BF5 A;  1SCM B;  1YVH A;  1JFK A;  4YGC B;  5KU1 A;  3DVE A;  1Y1X A;  1CTR A;  3I5G B;  4QJ5 B;  3SIA A;  4AQI A;  2F33 A;  3LCP C;  3VRQ A;  4ICB A;  4AOM A;  2ZND A;  1TNX A;  3D10 A;  5FYX A;  1F8H A;  3SG3 A;  1AHR A;  4OCI A;  4C0L A;  4F0Z B;  1IQ5 A;  3GK4 X;  4MZK A;  1JSA A;  2M1U A;  1MR8 A;  2LV7 A;  2IS9 A;  2JC2 A;  1SR6 C;  1QAS A;  2I7A A;  4DIR A;  3D0Y A;  1DMO A;  1DTL A;  1RRO A;  1TN4 A;  4QJ3 B;  4YBH B;  2KBM A;  2Q4U A;  4M2Q A;  4N1G A;  4MN0 A;  4N1F A;  4YRU A;  3GK1 A;  1K90 D;  2M7L A;  2BL0 C;  4MSP A;  4ZCV A;  4PHN A;  2KHN A;  5CSN A;  1BLQ A;  3C1V A;  3RLZ A;  5HKW A;  2I18 A;  1MF8 B;  1WDC C;  1NPQ A;  1AVS A;  1UUR A;  1SRA A;  1AP4 A;  1HT9 A;  2ZRT A;  3IQQ A;  2LM5 A;  1DF0 A;  1H4B A;  1XA5 A;  1MHO A;  1CLM A;  2L98 A;  2JWW A;  1CFF A;  2KSP A;  2M7N A;  2KFG A;  4I5K A;  2OTG B;  2KBI A;  4A4C A;  3EVV A;  4WQ3 A;  1EXR A;  1A2X A;  1L2O C;  3AAK A;  2KAY A;  4OV2 A;  5I2Q A;  2BCB A;  1CLB A;  1EG3 A;  1KQV A;  3TDU A;  1WY9 A;  4I5N B;  2CNP A;  1CDM A;  1FBV A;  4YGD B;  4P5O E;  2HPS A;  3JTD B;  4XJK B;  5BPJ A;  5AFP A;  1XFZ O;  1A75 B;  2K7C A;  2K2F A;  1K94 A;  2KOT A;  1FW4 A;  1JF0 A;  1QXP A;  1Y6W A;  4YGB B;  2BE6 A;  2KQY A;  1PSB A;  2BBN A;  5J3X A;  3BYA A;  2BE4 A;  1BR4 B;  1W7J B;  2LVJ A;  2MRD A;  5JOL A;  4IL1 A;  1AUI B;  1F4Q A;  1KWO B;  1YUS A;  1K9U A;  2H61 A;  3IF7 A;  1FI6 A;  4PE0 A;  3EK4 A;  3BUN B;  5CPV A;  4JQ0 D;  1KQM C;  1BJF A;  4DRW A;  3OB1 B;  2L0P A;  1UWO A;  1YUU A;  1KK8 C;  1DJH A;  1SW8 A;  2Y1N A;  1MQ1 A;  3KPX A;  2O5G A;  1B4C A;  1OQP A;  3PAL A;  2LP2 A;  2R2I A;  2Y5I A;  5HKZ A;  1TOP A;  3CLN A;  2H61 C;  4OR9 B;  3KEV A;  5I2O A;  1TCO B;  1RTP 1;  1JC2 A;  4DCK A;  1BOC A;  3O4Y A;  1PUL A;  2NCO A;  3QRX A;  1J7O A;  3O6B A;  5HKY A;  2KI6 D;  2HQW A;  2M29 A;  3VRP A;  4N5X A;  1SCV A;  3O78 A;  3BUX B;  1N65 A;  2F2O A;  2LCP A;  2LLS A;  3M0W A;  1SCM C;  2LUC A;  3EKJ A;  1UHJ A;  1OZO A;  1YUR A;  4YGA A;  1M46 A;  1LA0 A;  2KAX A;  1KFU L;  2MAZ A;  1REC A;  2CCM A;  1SNL A;  1XK4 A;  1F55 A;  2ISD A;  1DJX A;  2L4H A;  3DF0 B;  4GPL B;  1D1O A;  4HSZ A;  1A03 A;  1FF1 A;  2LNK A;  3EKH A;  1OMD A;  1ZFS A;  5HLV A;  5DKN A;  4PHM A;  3LLE A;  4E68 A;  1SBJ A;  2BKI B;  2JXL A;  3ZWH A;  4WQ2 A;  4MRY A;  4MBE A;  2TN4 A;  4JPZ B;  2BKH B;  4MEW A;  3WHT B;  1UUS A;  1S6J A;  1CNP A;  1E8A A;  2JZI A;  1CDL A;  2LVV A;  1XFW O;  2JQ6 A;  3A4U B;  3SIB A;  2L4I A;  3SG2 A;  3DVM A;  1JWD A;  1JFJ A;  1TNP A;  1NUB A;  2L50 A;  4OVN F;  2KNE A;  5CSJ A;  3NSL A;  1IG5 A;  2E6W A;  3EVU A;  4TNC A;  4DUQ A;  3TS5 B;  1ALV A;  2K0J A;  1XYD A;  1CFC A;  5I8N A;  1EG4 A;  1MXE A;  3SG7 A;  1N2D A;  2PMY A;  1CM4 A;  1ODB A;  3E3R A;  2JNF A;  1TTX A;  3TUY B;  3I5H C;  1CM1 A;  2OTG C;  3AAJ A;  2A4J A;  1DJW A;  2MLF C;  2KFH A;  1XVJ A;  1KK7 Y;  1QX2 A;  1F71 A;  1KSM A;  1X02 A;  4PHK A;  4OKH A;  2L5X B;  2LC5 A;  2I94 A;  3PM8 A;  1NSH A;  1LVC D;  1XFV O;  1KSO A;  1S26 D;  4A4B A;  1B8C A;  1R2U A;  1TCF A;  3HX4 A;  4YGE B;  1NX3 A;  1NWD A;  1NYA A;  4ORA B;  3ZNI A;  4YI9 A;  1KCY A;  1NCX A;  1ZMZ A;  3OP0 A;  5ER4 X;  2AMI A;  1J7P A;  2V53 A;  1KWO C;  4CFR A;  4GNK B;  3FWC A;  1SK6 D;  2QAC A;  1KFX S;  4U8D A;  1OMV A;  1J7R A;  1WRL A;  1TRF A;  1B8R A;  1J55 A;  2WCF A;  1AJ4 A;  1QLS A;  3K21 A;  2M8U A;  3LL8 B;  3OB2 B;  1G8I A;  1QX7 A;  1KFX L;  1WLM A;  1EL4 A;  3DVK A;  1XFY O;  4PE1 A;  2WOR A;  2M1K B;  5IBW A;  1CMG A;  1EJ3 A;  1U5I A;  2LLT A;  2OPO A;  2NCP A;  5AAN A;  1DJY A;  2MLE C;  1PVB A;  1TIZ A;  3AKB A;  5DKR A;  5AEQ A;  1UHK A;  2LUX A;  1RK9 A;  2M0R A;  1NIW A;  5GQQ C;  2K7B A;  1S5G Y;  1ZAC A;  3BOW A;  1DJG A;  5KTY A;  2JRF A;  2M97 A;  3FS7 A;  5I2L A;  1C07 A;  1KK7 Z;  3VGO A;  2PAL A;  2JNX A;  1K9K A;  1GQM A;  3O2P A;  2SAS A;  5B8I B;  5D69 A;  1B8L A;  1QLK A;  2G2B A;  3PN7 B;  2B1U A;  1BG1 A;  1SKT A;  1PRW A;  1QX5 B;  3KO0 A;  2BEC A;  3PSR A;  3SG5 A;  1Y0V H;  2O60 A;  4M2P A;  1IQ3 A;  1BT6 A;  3I5I B;  4GFT A;  4PHJ A;  1JBA A;  2I2R E;  1S6C A;  2JT3 A;  2WCB A;  4MLW A;  5ER5 A;  2JTT A;  1FI5 A;  5JJG A;  4QJ4 B;  4JWQ A;  3JVT B;  2Y1M A;  2LAN A;  3CR4 X;  2KI6 C;  2JU0 A;  2VRG A;  2LMU A;  3EVR A;  2HET A;  2MJW B;  1AK8 A;  1DGU A;  2GGZ A;  3I5G C;  1C7V A;  5K89 A;  1MXL C;  1SY9 A;  1C7W A;  1DF0 B;  4R1E A;  1GGZ A;  3TS5 C;  1XFX O;  2L51 A;  2AAO A;  2FCE A;  2LVK A;  1YRT B;  5KSZ A;  1S5G Z;  3BUO B;  4PCW A;  2BBM A;  2JUL A;  1H8B A;  3EK8 A;  1K96 A;  1PVA A;  2K7D A;  2KYF A;  3SG6 A;  2G9B A;  2F3Y A;  3KHE A;  2PVB A;  3CTN A;  1OSA A;  1SL8 A;  4BY4 A;  3TDZ A;  2WND A;  3TUY C;  4MZL A;  1UHH A;  2F8P A;  2EHB A;  2WC8 A;  4USL A;  2WCE A;  1J1E A;  4FQO A;  1M63 B;  3CR5 X;  1V1F A;  1K8U A;  1TNW A;  1UHN A;  2LP3 A;  2SCP A;  3BQ3 A;  3CS1 A;  4GBA A;  1LXF C;  1MWN A;  1YTZ C;  2M3W A;  1FPW A;  2CXJ A;  2LHI A;  2K61 A;  4FTG A;  1DVI A;  1QTX A;  1R6P A;  5F6T A;  2HQ8 A;  3CR2 A;  4MVF A;  1QAT A;  1GJY A;  1VRK A;  4GGF A;  2KAV A;  1B9A A;  2F3Z A;  1YUT A;  2K8M B;  4PE4 A;  4CID A;  5HYD A;  2OS8 B;  4I5J A;  2KGB C;  1DT7 B;  4Q04 A;  1F54 A;  4XJK A;  1Y1U A;  5CSF A;  2KI4 B;  1A75 A;  2BCX A;  1WRK A;  3NSK A;  4NQG A;  4YI8 A;  1IJ6 A;  1JF2 A;  3WNX B;  1NCZ A;  3TDI A;  4CFQ A;  1IGV A;  1NX1 A;  2F2P A;  4GGF C;  3HCM A;  1NX2 A;  4GAO A;  5TNC A;  5CSI A;  1EH2 A;  2FCD A;  2Y4Q A;  2H2K A;  2PRU A;  2D8N A;  1BR1 B;  2ZKM X;  3JTD C;  4HRE E;  1UHI A;  1A29 A;  3PLF B;  3NXA A;  3I5F B;  3RM1 A;  1DJZ A;  3WHU B;  4NDD A;  3AKA A;  2CTN A;  1GGW A;  3WXA A;  1L7Z A;  1B47 A;  2ZRS A;  2MBX A;  5DKQ A;  2LAP A;  1QV1 A;  2NLN A;  1K93 D;  1B1G A;  1J1D A;  1PAL A;  4L9M A;  1S3P A;  4XYN A;  4UPG A;  2KQ6 A;  2KGR A;  1SL9 A;  3BUM B;  4ORC B;  1QIV A;  2M9G A;  1BU3 A;  4GGN A;  2EC6 B;  1M45 A;  4GUK A;  5AER A;  3DD4 A;  1NP8 A;  1XFU O;  2JT0 A;  3PN7 C;  1NCY A;  4AQJ A;  1IWQ A;  1DGV A;  3NSO A;  1A4P A;  1K2H A;  1LKJ A;  3LK0 A;  3LK1 A;  1OOJ A;  3H4S E;  1YVL A;  1XO5 A;  3MSE B;  3SG4 A;  3I5I C;  1RJV A;  1CFP A;  4ETO A;  4DS7 A;  1G33 A;  1RFJ A;  4BY5 A;  2EGD A;  1SYM A;  1QIW A;  1S6I A;  1SL7 A;  2FJU B;  2PSR A;  1MUX A;  4C0J A;  2NZ0 A;  1OMR A;  2ZFD A;  4NDB A;  3DF0 A;  1JUO A;  3F45 A;  3I5H B;  3JVT C;  1SR6 B;  1YX8 A;  3FWB A;  1ZOT B;  2GV5 A;  2L2E A;  2CT9 A;  1OE9 B;  2DOQ A;  2ZNE A;  4PDZ A;  1IH0 A;  3NSI A;  1OZS A;  1J7Q A;  3A8R A;  2LMV A;  2QPT A;  2AUC A;  1CMF A;  2BL0 B;  2KYC A;  2ZN9 A;  1M39 A;  3D0Y B;  1G4Y R;  2JPT A;  1IKU A;  1UP5 A;  1WDC B;  1IRJ A;  1N0Y A;  5AXI A;  1CDP A;  1Q80 A;  4NDC A;  3ICB A;  1PK0 D;  4MZJ A;  5D7F A;  3OHM B;  3EK7 A;  3FIA A;  2LMT A;  4PAL A;  1NX0 A;  2RGI A;  1CDN A;  1QV0 A;  2WOS A;  1AJ5 A;  1B7T Y;  1SMG A;  2JXC A;  1DJI A;  3TZ1 A;  1CFD A;  1L2O B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...