1BR1B

Smooth muscle myosin motor domain-essential light chain complex with mgadp.alf4 bound at the active site
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
148
structure length
148
Chain Sequence
FSEEQTAEFKEAFQLFDRTGDGKILYSQCGDVMRALGQNPTNAEVMKVLGNPKSDEMNLKTLKFEQFLPMMQTIAKNKDQGCFEDYVEGLRVFDKEGNGTVMGAEIRHVLVTLGEKMTEEEVEQLVAGHEDSNGCINYEELVRMVLSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MYOSIN
publication title Crystal structure of a vertebrate smooth muscle myosin motor domain and its complex with the essential light chain: visualization of the pre-power stroke state.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Muscle protein
total genus 38
structure length 148
sequence length 148
chains with identical sequence D, F, H
ec nomenclature ec 3.6.1.32: Transferred entry: 5.6.1.8.
pdb deposition date 1998-08-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1br1B02
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1br1B01
2JTTA 1TTXA 2M29A 1DGUA 1FI6A 2BBNA 1F4OA 1FPWA 5I2OA 1DJXA 1S6JA 4YI9A 3I5HC 1UP5A 4M2QA 5JOLA 2LUXA 1CLMA 1S5GY 4GUKA 4WQ2A 2KQ6A 2LC5A 1RECA 1DMOA 5KTYA 2HPSA 1KQMC 3O4YA 1SMGA 4JPZB 2HF5A 3AAKA 1MQ1A 2KFFA 1OMVA 2OS8B 2F2PA 4YGDB 4PDZA 1EG3A 3JTDB 3H4SE 4WQ3A 2R2IA 1XO5A 5KU1A 3M0WA 2LVVA 3JVTC 4MEWA 1QIWA 2L4IA 1YX7A 5HLVA 4I5LB 1WLMA 1QX7A 3DF0A 3DVEA 4PALA 5CPVA 1MR8A 1JC2A 4I5JA 3FWCA 4YBHB 2K7CA 3TDZA 3ZWHA 1S3PA 1YURA 3RM1A 2LV7A 4MLWA 2JC2A 2M97A 4HREE 1QVIY 3IF7A 2L50A 2MLEC 2KHNA 1CDNA 1MF8B 1M46A 2JNFA 1ALWA 3C1VA 1DJYA 3CTNA 2L2EA 1IQ5A 1QX2A 1J55A 2F3ZA 2LHLA 4I5KA 1YRTB 2KI6C 2AUCA 1AK8A 1UHKA 1U5IB 3KEVA 2SASA 2WORA 3I5FC 4F0ZB 1Y0VH 1A29A 2SCPA 2ZN9A 2RGIA 1NSHA 1YTZC 2BL0B 3VRNA 1KK7Z 3A4UB 2KNEA 3HX4A 3OB1B 4HRHA 3OB2B 1NPQA 4CPVA 2KGBC 1G4YR 2JZIA 4MBEA 1G33A 2KYCA 1KSMA 1AUIB 2NCOA 4M2OA 1TNQA 5CSIA 4IL1A 5F6TA 2PVBA 3FWBA 1S26D 1SYMA 1CKKA 1YVHA 1YX8A 4PHNA 4HSZA 4N5XA 3TDUA 1J7QA 2EC6B 1NCXA 2JRFA 3EK7A 3OHMB 4GFTA 1K9PA 2H61C 2JT8A 5G08A 1BLQA 1AHRA 1KFXS 1W7IB 1VRKA 4P5OE 2OPOA 2OS8C 2AMIA 1K96A 2HETA 2WOSA 4MRXA 3JTDC 1H8BA 2MA2A 3WHTB 1B8LA 4ZCUA 3D10A 4GAOA 1K2HA 1JF0A 3NXAA 4A4CA 5HKWA 4GNKB 1A4PA 1XA5A 1OMRA 1E8AA 3BOWB 2KQYA 1F55A 1TN4A 2WCBA 3JVTB 2P6BB 5ER5A 1XFVO 1WRKA 1L7ZA 1K95A 1RJVA 2LMVA 2PALA 1TNWA 1UUSA 2B1UA 2KI6D 2O60A 4PE7A 4C0LA 2ZKMX 2FCEA 1DVIA 4GGFA 1BU3A 1C07A 1CFFA 3CZTX 1LA0A 1R2UA 1ODBA 1CDMA 2PRUA 4MRYA 3KO0A 1ZFSA 1Y1UA 3ICBA 4CLNA 1NX2A 3DVKA 3KPXA 4OCIA 2GGMA 2CBLA 2LMTA 1TCOB 2ZN8A 1B7TY 2KI4C 2HQWA 2BL0C 2G9BA 1SRAA 2L0PA 4R1EA 3LK1A 1A2XA 1LKJA 1ZACA 4ORAB 1B8CA 1WY9A 5J3XA 2K7BA 4JWQA 5AFPA 4M2PA 1SK6D 1IWQA 4YGAA 2NLNA 1JFKA 1WLZA 5D69A 3EVVA 3VRRA 2K2FA 4Q04A 4OV2A 4U8DA 5HYDA 1IGVA 5HLOA 4CFQA 1QJTA 1XFXO 2K8MB 3K21A 3DVJA 2ZNEA 4XJKA 4DS7A 1NCZA 2LANA 1CMFA 1QTXA 4ORCB 2EC6C 1DF0A 2WCFA 2LP2A 3LLEA 1AJ5A 1F4QA 4C0KA 1J7OA 1L2OB 4AQIA 1A75A 1NCYA 3DF0B 2KBMA 1ZMZA 1BG1A 3KHEA 3PFVA 3SG6A 3GK1A 4GGFC 5DKNA 1MXEA 4PCWA 2LNKA 2I2RE 1IRJA 1CM1A 5IBWA 2MJWB 1JF2A 1QIVA 1KFUS 2M3WA 5DKRA 5B8IB 1QXPA 1B8RA 2JU0A 2AAOA 4N1GA 2Q91A 1PSBA 1IJ6A 3FS7A 1A03A 1XFZO 2KFHA 3TUYB 3GK4X 1YRUB 4PE4A 5I8NA 1LINA 1G8IA 1GJYA 1C7WA 2JPTA 1KCYA 3KF9A 1Q80A 1RROA 4MVFA 4YGCB 1F8HA 3BUWB 1S5GZ 1EH2A 2F2OA 2IS9A 3NSKA 3LK0A 1KWOB 2HQ8A 3WXAA 1QV1A 4BY4A 1JSAA 1DGVA 2FOTA 2ZFDA 2K0JA 1OE9B 1LXFC 5CSJA 1XK4A 1AP4A 4DIRA 1LVCD 1CFDA 3ZNIA 2KI4B 4MSPA 1JWDA 2CTNA 3EK8A 2D8NA 3SJSA 1SL7A 2ISDA 1NUBA 5I2QA 3LL8B 1IJ5A 2CCMA 1DTLA 4D1EA 1K9UA 1V1GA 3D0YA 1YR5A 3CS1A 4DCKA 1OSAA 1WDCB 2JXLA 3EVRA 2KOTA 1UHIA 4FTGA 1NIWA 1FBVA 4GGNA 4PE0A 1JFJA 2BKIB 2LVIA 1QATA 1DJGA 2CT9A 4AQJA 1L2OC 3CR4X 3TDIA 2Y4QA 2BE4A 1EJ3A 1IG5A 1BR4B 1K93D 1KSOA 4MZKA 2F3YA 1TIZA 4OVNF 1RWYA 4NDBA 5D7FA 1EXRA 3SG4A 3SIBA 2NXQA 2BCXA 5AXIA 1K9KA 1B9AA 1OMDA 2MRDA 4ZCVA 1TNXA 1GGZA 3TZ1A 3IQQA 2K61A 1RK9A 1SPYA 1Y1XA 1MXLC 2LLSA 2BBMA 1DJWA 2KAVA 3IQOA 1UHJA 2JTZA 4C0JA 3PATA 3PM8A 3TUYC 2KGRA 1M63B 4NQGA 3VROA 1Y1AA 1KFXL 3I5IB 1MHOA 1W7JB 3EKJA 4I5NB 1IH0A 2VRGA 1NWDA 4DRWA 1KWOC 5TNCA 2K7DA 1PK0D 3WHUB 2M8UA 1F54A 1ZOTB 3BQ3A 3HCMA 2M1UA 2QPTA 3AKAA 2LVKA 2JOJA 4XJKB 2I94A 1SR6B 1DF0B 2JT3A 5AEQA 2L5XB 2M1KB 1OZSA 1CB1A 2LVJA 3SG5A 1PVBA 1A75B 3O78A 2WCEA 2O5GA 5HKYA 1WDCC 1KK8B 2F33A 1CMGA 2LM5A 1XFWO 3SG7A 3QRXA 4UPGA 1CFPA 1CLBA 1CM4A 3BUOB 1UHNA 2M49B 5DKQA 3E3RA 4NDDA 4PHJA 1BJFA 2L4HA 1GGWA 3WNXB 1DJHA 1AJ4A 2WC8A 1PRWA 1EG4A 1UWOA 4JQ0D 1S6CA 4A4BA 5ER4X 2H2KA 3BUXB 2A4JA 1J7PA 1WRLA 1SCMB 5I2LA 4P2YB 4YGBB 1DJZA 5HKZA 3EK4A 1S1EA 1PSRA 3EKHA 4YI8A 4MZJA 1LA3A 1B7TZ 4NDCA 5AERA 4TNCA 2MAZA 2LMUA 1BR1B 2V53A 2ZRTA 4PHKA 1SNLA 1RFJA 2JQ6A 3GK2A 3I5IC 1SCVA 3CGAA 3BXKA 2MLFC 3FIAA 2NZ0A 3MSEB 4ETOA 1TCFA 1DT7B 1H4BA 1S6IA 2BE6A 1CNPA 1XYDA 1GQMA 2KFGA 1JBAA 3PN7B 1YUTA 2FCDA 4AOMA 4CIDA 3I5GB 1SBJA 2K2AA 2OTGB 1N65A 1SL8A 4XYNA 2KYFA 3OX6A 3CLNA 3TS5C 1F70A 2GV5A 1B1GA 1KK7Y 1KFUL 3PLFB 5BPJA 1SL9A 4YRUA 2JT0A 3D0YB 1SR6C 2Y1MA 1J1EA 1CTRA 3PSRA 4USLA 2JWWA 2M7NA 1CFCA 2DOQA 2H61A 1S36A 4DUQA 5FYXA 1M39A 3NSOA 3OP0A 1C7VA 1D1OA 1FI5A 2EHBA 1J1DA 4OR9B 1OOJA 4PE1A 1BOCA 1TOPA 1KK8C 2KSPA 1QX5B 1M45A 3BUNB 5PALA 1YUSA 2K7OA 3DD4A 3CR5X 2M7LA 4E68A 2ZNDA 1QS7A 4QJ4B 2I7AA 2BKHB 4L9MA 1ALVA 3EVUA 1K94A 4WRIA 3SG3A 1QASA 1K8UA 1QVIZ 2E30A 2JXCA 3LCPC 5KSZA 1WRZA 5CSNA 3SIAA 3NSIA 2LAPA 2TN4A 1SCMC 2M0RA 1BMOA 2JNXA 3VRPA 2LLUA 2EGDA 1J7RA 2BCAA 3CR2A 1OZOA 4ORBB 3A8RA 3SG2A 2PSRA 1RTP1 1M31A 3O2PA 2Y5IA 4PHMA 2KAXA 1U5IA 1BT6A 3GOFA 1TRFA 1AVSA 1X02A 4QJ3B 2CNPA 4MN0A 4GPLB 3OX5A 1B4CA 4CFRA 2BCBA 3AKBA 2BECA 3CWGA 1NX0A 1FW4A 1PALA 3I5HB 3NSLA 1JUOA 1HQVA 1XK4C 3O6BA 2L51A 3BUMB 1DJIA 3PN7C 3VRQA 3I5GC 2OTGC 1QLSA 5K89A 2KAYA 2WNDA 4HRGA 2I18A 1KQMB 2LCPA 2G2BA 5JJGA 4ICBA 1PVAA 3PALA 4N1FA 1YUUA 1ZUZA 3TS5B 4YGEB 3BYAA 2KDHA 3DVMA 1EL4A 1TNPA 1MUXA 2L98A 5AANA 2MBXA 4BY5A 1IQ3A 2KBIA 2NCPA 3AAJA 1BF5A 1R6PA 3RLZA 2M9GA 2Q4UA 2E6WA 1N2DA 1MWNA 2Y1NA 2MHHA 2F8PA 4MZLA 1NX3A 1YVLA 5CSFA 1NP8A 1QV0A 3VGOA 2PMYA 1NYAA 1UURA 2LHIA 1IKUA 1BODA 2GGZA 4FQOA 1HT9A 1SY9A 4QJ5B 2PASA 3BOWA 1NX1A 2LE9B 2LLTA 2COLB 2JULA 1UHHA 1CDLA 1XFYO 2FJUB 1N0YA 1KQVA 1QLKA 1B47A 2QACA 2LP3A 5GQQC 1F71A 1CDPA 3I5FB 3F45A 4OKHA 2CXJA 1CLLA 1V1FA 1K90D 1OQPA 1XFUO 1XVJA 2LUCA 1PULA 1FF1A 1Y6WA 2ZRSA 1SKTA 1SW8A 4GBAA
chains in the Genus database with same CATH superfamily
2JTTA 1TTXA 3B6XA 2M29A 1DGUA 1FI6A 2BBNA 1F4OA 5DICA 1FPWA 5I2OA 1DJXA 1S6JA 4YI9A 3I5HC 1UP5A 4M2QA 5JOLA 2LUXA 2KPHA 1CLMA 1S5GY 4GUKA 4WQ2A 3SS4A 2KQ6A 2LC5A 1RECA 1DMOA 5KTYA 2HPSA 1KQMC 3O4YA 1SMGA 4JPZB 2P70A 2HF5A 3IVTA 3AAKA 1MQ1A 2KFFA 1OMVA 2OS8B 2F2PA 2YGUA 4YGDB 3S0AA 5FI2A 4PDZA 1EG3A 3JTDB 3H4SE 4WQ3A 1OW4A 2R2IA 4IJ7A 1XO5A 5KU1A 3M0WA 2LVVA 3JVTC 4MEWA 1QIWA 2L4IA 1YX7A 5HLVA 2FJYA 1WLMA 1QX7A 3DF0A 3DVEA 4I5LB 4PALA 1MR8A 5CPVA 1JC2A 4I5JA 3FWCA 4YBHB 2K7CA 3TDZA 3D73A 1S3PA 1YURA 3BJHA 3RM1A 3ZWHA 2LV7A 4MLWA 2JC2A 2M97A 4HREE 1QWVA 1QVIY 3IF7A 2L50A 2MLEC 2KHNA 1CDNA 1MF8B 1M46A 3BFHA 2JNFA 2GTEA 1ALWA 3C1VA 1DJYA 3CTNA 2L2EA 1IQ5A 1QX2A 1J55A 2F3ZA 2LHLA 4I5KA 1YRTB 3D76A 5D3OA 2KI6C 2AUCA 1AK8A 1UHKA 1U5IB 3KEVA 2SASA 2WORA 3I5FC 4F0ZB 1Y0VH 1A29A 2SCPA 2ZN9A 2RGIA 1NSHA 1YTZC 2BL0B 3VRNA 1KK7Z 3A4UB 2KNEA 3HX4A 3OB1B 4HRHA 3OB2B 1NPQA 4CPVA 2KGBC 1G4YR 2JZIA 4JKTA 4MBEA 4OZDA 1G33A 2KYCA 1KSMA 1AUIB 2JPOA 2NCOA 4M2OA 5FI6A 1TNQA 3B86A 5CSIA 4IL1A 5F6TA 2PVBA 3FWBA 1S26D 1SYMA 1CKKA 2BNXA 1YVHA 1YX8A 4PHNA 4HSZA 4N5XA 3TDUA 1W9ZA 2EC6B 1NCXA 1J7QA 2JRFA 3EK7A 3OHMB 4GFTA 1K9PA 2H61C 2JT8A 5G08A 1BLQA 1AHRA 1KFXS 1W7IB 1LS8A 1VRKA 4P5OE 2OPOA 2OS8C 2AMIA 1K96A 2HETA 2WOSA 4MRXA 3JTDC 1H8BA 2MA2A 3WHTB 1B8LA 4ZCUA 3D10A 4GAOA 1K2HA 1JF0A 3NXAA 4A4CA 5HKWA 4GNKB 1A4PA 1XA5A 1OMRA 1E8AA 2WCLA 3BOWB 2KQYA 1F55A 4KYNA 1TN4A 2WCBA 3JVTB 2P6BB 5ER5A 1XFVO 1WRKA 1L7ZA 1K95A 2L5YA 1RJVA 2LMVA 1SSEB 2PALA 1TNWA 1UUSA 2B1UA 2KI6D 2O60A 4PE7A 4C0LA 2ZKMX 2FCEA 1DVIA 4GGFA 1BU3A 3S0BA 1C07A 1CFFA 1TWOA 3CZTX 1LA0A 3BFAA 1R2UA 1ODBA 1CDMA 2PRUA 4MRYA 3KO0A 1ZFSA 1Y1UA 3ICBA 4CLNA 1P28A 1NX2A 3DVKA 3KPXA 4OCIA 2GGMA 2CBLA 2LMTA 1TCOB 3R72A 1TUZA 2ZN8A 1B7TY 2KI4C 2HQWA 2BL0C 2G9BA 1SRAA 2L0PA 3FE6A 4PT1A 4R1EA 3LK1A 1A2XA 1LKJA 1ZACA 4ORAB 1B8CA 1WY9A 2PYQA 3FE9A 2K7BA 4JWQA 5J3XA 5AFPA 3CDNA 3D74A 4M2PA 1SK6D 1IWQA 4YGAA 2NLNA 1JFKA 1WLZA 5D69A 3EVVA 3VRRA 2K2FA 4Q04A 4OV2A 4U8DA 5HYDA 3FE8A 1IGVA 5HLOA 2QDIA 1QJTA 1XFXO 2K8MB 3K21A 3DVJA 2ZNEA 4XJKA 4CFQA 4DS7A 1NCZA 2LANA 1CMFA 1QTXA 4ORCB 2EC6C 1DF0A 3L4AA 2WCFA 2LP2A 1OOHA 3LLEA 1AJ5A 1F4QA 4C0KA 1J7OA 2WCHA 1L2OB 3RZSA 4AQIA 3O4XA 1A75A 1NCYA 3DF0B 2KBMA 1ZMZA 1BG1A 3KHEA 3PFVA 3SG6A 3GK1A 4GGFC 5DKNA 1MXEA 4PCWA 2LNKA 2I2RE 1IRJA 1C3YA 1CM1A 1T14A 2QEHA 2MJWB 5IBWA 1JF2A 1QIVA 1KFUS 3S0DA 2M3WA 5DKRA 5B8IB 1QXPA 1B8RA 2JU0A 2AAOA 4N1GA 2Q91A 1PSBA 1IJ6A 3FS7A 1A03A 1XFZO 2KFHA 2WC5A 3TUYB 3GK4X 1YRUB 2QEVA 3DYEA 1LINA 4PE4A 3SS5A 5I8NA 1G8IA 1GJYA 1C7WA 2JPTA 1KCYA 3KF9A 1Q80A 1RROA 3DY9A 4MVFA 4YGCB 1F8HA 3BUWB 1S5GZ 1EH2A 2F2OA 2IS9A 3NSKA 3LK0A 1KWOB 2HQ8A 3WXAA 1QV1A 4BY4A 2WC6A 1JSAA 1DGVA 2FOTA 2ZFDA 2K0JA 1OE9B 1LXFC 5CSJA 3B88A 1XK4A 1AP4A 4DIRA 1LVCD 3S0EA 1CFDA 1OOGA 3ZNIA 2WCJA 2KI4B 1ORGA 4MSPA 1JWDA 1DELA 2CTNA 3EK8A 2D8NA 3SJSA 1SL7A 2ISDA 1NUBA 5I2QA 3LL8B 1IJ5A 2CCMA 1DTLA 4D1EA 1K9UA 1V1GA 5FI7A 3D0YA 1YR5A 3CS1A 4DCKA 1OSAA 1WDCB 2JXLA 2K60A 2KOTA 3CYZA 1UHIA 3EVRA 3CZ2A 1NIWA 4FTGA 1FBVA 4GGNA 4PE0A 1JFJA 2BKIB 2LVIA 3R1OA 3L47A 1QATA 1DJGA 2CT9A 4AQJA 1L2OC 3CR4X 3TDIA 2Y4QA 2BE4A 1EJ3A 1IG5A 1BR4B 1K93D 1KSOA 4MZKA 3PM2A 2F3YA 1TIZA 4OVNF 1RWYA 4NDBA 5D7FA 1EXRA 3NHIA 3SG4A 3SIBA 2NXQA 2BCXA 5AXIA 1K9KA 1B9AA 1OMDA 2MRDA 4ZCVA 1TNXA 1GGZA 2BAPA 3TZ1A 3D78A 3IQQA 2K61A 1RK9A 1SPYA 1Y1XA 1MXLC 2LLSA 1TUJA 3R1PA 3UNWA 2BBMA 1DJWA 2KAVA 2KLEA 3IQOA 1UHJA 2JTZA 3D77A 4C0JA 3PATA 3PM8A 3TUYC 1OOFA 4FQTA 2KGRA 1M63B 4NQGA 3VROA 1Y1AA 1KFXL 3I5IB 3SS3A 1MHOA 1W7JB 3EKJA 4I5NB 4INWA 1IH0A 2QEBA 2VRGA 1NWDA 4DRWA 1KWOC 5TNCA 2K7DA 1PK0D 3WHUB 2M8UA 1F54A 1ZOTB 3BQ3A 3HCMA 2M1UA 2QPTA 3AKAA 2LVKA 2JOJA 4XJKB 2I94A 1SR6B 4JD9A 1DF0B 2JT3A 3BFBA 5AEQA 2L5XB 2M1KB 1OZSA 1CB1A 2LVJA 3SG5A 1PVBA 1A75B 3O78A 2WCEA 2O5GA 5HKYA 1WDCC 3L4LA 1KK8B 2F33A 1CMGA 2LM5A 1XFWO 3SG7A 3QRXA 4UPGA 1CFPA 1CLBA 1CM4A 3BUOB 1UHNA 2M49B 5DKQA 3E3RA 2ERBA 3EG5B 4NDDA 1BJFA 4PHJA 1DEKA 2L4HA 1GGWA 3WNXB 1DJHA 1AJ4A 2WC8A 1PRWA 1EG4A 1UWOA 3DXLA 4JQ0D 1S6CA 4A4BA 5ER4X 2H2KA 3BUXB 2A4JA 1J7PA 1WRLA 1IIOA 1SCMB 5I2LA 4P2YB 5EL2A 4YGBB 1DJZA 2WCMA 5HKZA 3EK4A 1S1EA 1PSRA 3EKHA 4YI8A 4MZJA 1LA3A 1B7TZ 4NDCA 3NGVA 5AERA 5I94A 4TNCA 2MAZA 2LMUA 1BR1B 2V53A 2ZRTA 4PHKA 1SNLA 3QMEA 1RFJA 2JQ6A 3GK2A 3I5IC 1SCVA 3CGAA 3BXKA 2MLFC 3FIAA 2NZ0A 3MSEB 4ETOA 1TCFA 1DT7B 1H4BA 1S6IA 2BE6A 1CNPA 1XYDA 1GQMA 2KFGA 1JBAA 3PN7B 1YUTA 2FCDA 3OBVA 4AOMA 4CIDA 3I5GB 1SBJA 2K2AA 2OTGB 3CABA 1N65A 1SL8A 4XYNA 1XFRA 2KYFA 4F7FA 3OX6A 3CLNA 3TS5C 1Z4HA 1F70A 3R1VA 2GV5A 1B1GA 3B87A 1KK7Y 1KFUL 3PLFB 5BPJA 1SL9A 2KLDA 2JT0A 3D0YB 4YRUA 1SR6C 2Y1MA 1J1EA 1CTRA 3PSRA 4USLA 2JWWA 2M7NA 3CZ0A 1CFCA 2DOQA 3S0FA 2H61A 1S36A 4DUQA 5FYXA 1M39A 3NSOA 3OP0A 4INXA 1C7VA 1D1OA 1FI5A 2EHBA 1J1DA 4OR9B 1OOJA 1Z2CB 4PE1A 1TOPA 1KK8C 1BOCA 2KSPA 1QX5B 1M45A 3BUNB 5PALA 1YUSA 2K7OA 3DD4A 3CR5X 2M7LA 4E68A 2ZNDA 1QS7A 4QJ4B 2I7AA 2BKHB 4L9MA 1ALVA 3EVUA 1K94A 4WRIA 3SG3A 1QASA 3VB1A 1K8UA 1QVIZ 2E30A 2JXCA 3LCPC 5HL1A 1WRZA 5KSZA 5CSNA 2H8VA 3SIAA 3NSIA 2LAPA 2TN4A 1SCMC 2M0RA 1BMOA 1C3ZA 2JNXA 3VRPA 2LLUA 2EGDA 1J7RA 2BCAA 3CR2A 1OZOA 4ORBB 3A8RA 3SG2A 2PSRA 1RTP1 2L2CA 1M31A 3O2PA 2Y5IA 4PHMA 2KAXA 1U5IA 1BT6A 3GOFA 1TRFA 1AVSA 1X02A 4QJ3B 2CNPA 4MN0A 4GPLB 3OX5A 1B4CA 4CFRA 2BCBA 3AKBA 2BECA 3CWGA 1NX0A 1FW4A 1PALA 3I5HB 3NSLA 1JUOA 1HQVA 1XK4C 3O6BA 2L51A 3BUMB 1DJIA 3PN7C 2WCKA 3VRQA 3I5GC 2OTGC 1QLSA 3V2LA 5K89A 2KAYA 2WNDA 3CZ1A 4HRGA 2I18A 1KQMB 2LCPA 2G2BA 5JJGA 4ICBA 1DC1A 1PVAA 3PALA 4N1FA 1YUUA 1ZUZA 1GM0A 3TS5B 4YGEB 3BYAA 2KDHA 3DVMA 3Q8IA 1EL4A 1TNPA 1MUXA 2L98A 5AANA 2MBXA 4BY5A 1IQ3A 1OOIX 2KBIA 3UO9A 2NCPA 3AAJA 1BF5A 1R6PA 3RLZA 2M9GA 2Q4UA 3NHTA 2E6WA 3K1EA 1N2DA 3OGNA 1MWNA 2Y1NA 2MHHA 3PJIA 2F8PA 4MZLA 1NX3A 1YVLA 5CSFA 1NP8A 1QV0A 3VGOA 2PMYA 1NYAA 1UURA 2LHIA 1IKUA 1BODA 2GGZA 4FQOA 1HT9A 3S0GA 1SY9A 4QJ5B 3B7AA 2PASA 3BOWA 2PQLA 1NX1A 2LE9B 2LLTA 2COLB 2JULA 1UHHA 1CDLA 1XFYO 2FJUB 3N7HA 1N0YA 1KQVA 2QEOA 1QLKA 1B47A 2QACA 2LP3A 5GQQC 2P71A 1F71A 1CDPA 3I5FB 3F45A 4OKHA 2CXJA 1CLLA 1V1FA 1K90D 1OQPA 3D75A 1XFUO 1XVJA 2LUCA 1PULA 1FF1A 1DQEA 1Y6WA 2ZRSA 1SKTA 1SW8A 4GBAA 3DZTA
chains in the Genus database with same CATH topology
2JTTA 1TTXA 2M29A 1DGUA 1FI6A 2BBNA 1F4OA 1FPWA 5I2OA 1DJXA 1S6JA 4YI9A 3I5HC 1UP5A 4M2QA 5JOLA 2LUXA 1CLMA 1S5GY 4GUKA 4WQ2A 2KQ6A 2LC5A 1RECA 1DMOA 5KTYA 2HPSA 1KQMC 3O4YA 1SMGA 4JPZB 2HF5A 3AAKA 1MQ1A 2KFFA 1OMVA 2OS8B 2F2PA 4YGDB 4PDZA 1EG3A 3JTDB 3H4SE 4WQ3A 2R2IA 1XO5A 5KU1A 3M0WA 2LVVA 3JVTC 4MEWA 1QIWA 2L4IA 1YX7A 5HLVA 4I5LB 1WLMA 1QX7A 3DF0A 3DVEA 4PALA 5CPVA 1MR8A 1JC2A 4I5JA 3FWCA 4YBHB 2K7CA 3TDZA 3ZWHA 1S3PA 1YURA 3RM1A 2LV7A 4MLWA 2JC2A 2M97A 4HREE 1QVIY 3IF7A 2L50A 2MLEC 2KHNA 1CDNA 1MF8B 1M46A 2JNFA 1ALWA 3C1VA 1DJYA 3CTNA 2L2EA 1IQ5A 1QX2A 1J55A 2F3ZA 2LHLA 4I5KA 1YRTB 2KI6C 2AUCA 1AK8A 1UHKA 1U5IB 3KEVA 2SASA 2WORA 3I5FC 4F0ZB 1Y0VH 1A29A 2SCPA 2ZN9A 2RGIA 1NSHA 1YTZC 2BL0B 3VRNA 1KK7Z 3A4UB 2KNEA 3HX4A 3OB1B 4HRHA 3OB2B 1NPQA 4CPVA 2KGBC 1G4YR 2JZIA 4MBEA 1G33A 2KYCA 1KSMA 1AUIB 2NCOA 4M2OA 1TNQA 5CSIA 4IL1A 5F6TA 2PVBA 3FWBA 1S26D 1SYMA 1CKKA 1YVHA 1YX8A 4PHNA 4HSZA 4N5XA 3TDUA 1J7QA 2EC6B 1NCXA 2JRFA 3EK7A 3OHMB 4GFTA 1K9PA 2H61C 2JT8A 5G08A 1BLQA 1AHRA 1KFXS 1W7IB 1VRKA 4P5OE 2OPOA 2OS8C 2AMIA 1K96A 2HETA 2WOSA 4MRXA 3JTDC 1H8BA 2MA2A 3WHTB 1B8LA 4ZCUA 3D10A 4GAOA 1K2HA 1JF0A 3NXAA 4A4CA 5HKWA 4GNKB 1A4PA 1XA5A 1OMRA 1E8AA 3BOWB 2KQYA 1F55A 1TN4A 2WCBA 3JVTB 2P6BB 5ER5A 1XFVO 1WRKA 1L7ZA 1K95A 1RJVA 2LMVA 2PALA 1TNWA 1UUSA 2B1UA 2KI6D 2O60A 4PE7A 4C0LA 2ZKMX 2FCEA 1DVIA 4GGFA 1BU3A 1C07A 1CFFA 3CZTX 1LA0A 1R2UA 1ODBA 1CDMA 2PRUA 4MRYA 3KO0A 1ZFSA 1Y1UA 3ICBA 4CLNA 1NX2A 3DVKA 3KPXA 4OCIA 2GGMA 2CBLA 2LMTA 1TCOB 2ZN8A 1B7TY 2KI4C 2HQWA 2BL0C 2G9BA 1SRAA 2L0PA 4R1EA 3LK1A 1A2XA 1LKJA 1ZACA 4ORAB 1B8CA 1WY9A 5J3XA 2K7BA 4JWQA 5AFPA 4M2PA 1SK6D 1IWQA 4YGAA 2NLNA 1JFKA 1WLZA 5D69A 3EVVA 3VRRA 2K2FA 4Q04A 4OV2A 4U8DA 5HYDA 1IGVA 5HLOA 4CFQA 1QJTA 1XFXO 2K8MB 3K21A 3DVJA 2ZNEA 4XJKA 4DS7A 1NCZA 2LANA 1CMFA 1QTXA 4ORCB 2EC6C 1DF0A 2WCFA 2LP2A 3LLEA 1AJ5A 1F4QA 4C0KA 1J7OA 1L2OB 4AQIA 1A75A 1NCYA 3DF0B 2KBMA 1ZMZA 1BG1A 3KHEA 3PFVA 3SG6A 3GK1A 4GGFC 5DKNA 1MXEA 4PCWA 2LNKA 2I2RE 1IRJA 1CM1A 5IBWA 2MJWB 1JF2A 1QIVA 1KFUS 2M3WA 5DKRA 5B8IB 1QXPA 1B8RA 2JU0A 2AAOA 4N1GA 2Q91A 1PSBA 1IJ6A 3FS7A 1A03A 1XFZO 2KFHA 3TUYB 3GK4X 1YRUB 4PE4A 5I8NA 1LINA 1G8IA 1GJYA 1C7WA 2JPTA 1KCYA 3KF9A 1Q80A 1RROA 4MVFA 4YGCB 1F8HA 3BUWB 1S5GZ 1EH2A 2F2OA 2IS9A 3NSKA 3LK0A 1KWOB 2HQ8A 3WXAA 1QV1A 4BY4A 1JSAA 1DGVA 2FOTA 2ZFDA 2K0JA 1OE9B 1LXFC 5CSJA 1XK4A 1AP4A 4DIRA 1LVCD 1CFDA 3ZNIA 2KI4B 4MSPA 1JWDA 2CTNA 3EK8A 2D8NA 3SJSA 1SL7A 2ISDA 1NUBA 5I2QA 3LL8B 1IJ5A 2CCMA 1DTLA 4D1EA 1K9UA 1V1GA 3D0YA 1YR5A 3CS1A 4DCKA 1OSAA 1WDCB 2JXLA 3EVRA 2KOTA 1UHIA 4FTGA 1NIWA 1FBVA 4GGNA 4PE0A 1JFJA 2BKIB 2LVIA 1QATA 1DJGA 2CT9A 4AQJA 1L2OC 3CR4X 3TDIA 2Y4QA 2BE4A 1EJ3A 1IG5A 1BR4B 1K93D 1KSOA 4MZKA 2F3YA 1TIZA 4OVNF 1RWYA 4NDBA 5D7FA 1EXRA 3SG4A 3SIBA 2NXQA 2BCXA 5AXIA 1K9KA 1B9AA 1OMDA 2MRDA 4ZCVA 1TNXA 1GGZA 3TZ1A 3IQQA 2K61A 1RK9A 1SPYA 1Y1XA 1MXLC 2LLSA 2BBMA 1DJWA 2KAVA 3IQOA 1UHJA 2JTZA 4C0JA 3PATA 3PM8A 3TUYC 2KGRA 1M63B 4NQGA 3VROA 1Y1AA 1KFXL 3I5IB 1MHOA 1W7JB 3EKJA 4I5NB 1IH0A 2VRGA 1NWDA 4DRWA 1KWOC 5TNCA 2K7DA 1PK0D 3WHUB 2M8UA 1F54A 1ZOTB 3BQ3A 3HCMA 2M1UA 2QPTA 3AKAA 2LVKA 2JOJA 4XJKB 2I94A 1SR6B 1DF0B 2JT3A 5AEQA 2L5XB 2M1KB 1OZSA 1CB1A 2LVJA 3SG5A 1PVBA 1A75B 3O78A 2WCEA 2O5GA 5HKYA 1WDCC 1KK8B 2F33A 1CMGA 2LM5A 1XFWO 3SG7A 3QRXA 4UPGA 1CFPA 1CLBA 1CM4A 3BUOB 1UHNA 2M49B 5DKQA 3E3RA 4NDDA 4PHJA 1BJFA 2L4HA 1GGWA 3WNXB 1DJHA 1AJ4A 2WC8A 1PRWA 1EG4A 1UWOA 4JQ0D 1S6CA 4A4BA 5ER4X 2H2KA 3BUXB 2A4JA 1J7PA 1WRLA 1SCMB 5I2LA 4P2YB 4YGBB 1DJZA 5HKZA 3EK4A 1S1EA 1PSRA 3EKHA 4YI8A 4MZJA 1LA3A 1B7TZ 4NDCA 5AERA 4TNCA 2MAZA 2LMUA 1BR1B 2V53A 2ZRTA 4PHKA 1SNLA 1RFJA 2JQ6A 3GK2A 3I5IC 1SCVA 3CGAA 3BXKA 2MLFC 3FIAA 2NZ0A 3MSEB 4ETOA 1TCFA 1DT7B 1H4BA 1S6IA 2BE6A 1CNPA 1XYDA 1GQMA 2KFGA 1JBAA 3PN7B 1YUTA 2FCDA 4AOMA 4CIDA 3I5GB 1SBJA 2K2AA 2OTGB 1N65A 1SL8A 4XYNA 2KYFA 3OX6A 3CLNA 3TS5C 1F70A 2GV5A 1B1GA 1KK7Y 1KFUL 3PLFB 5BPJA 1SL9A 4YRUA 2JT0A 3D0YB 1SR6C 2Y1MA 1J1EA 1CTRA 3PSRA 4USLA 2JWWA 2M7NA 1CFCA 2DOQA 2H61A 1S36A 4DUQA 5FYXA 1M39A 3NSOA 3OP0A 1C7VA 1D1OA 1FI5A 2EHBA 1J1DA 4OR9B 1OOJA 4PE1A 1BOCA 1TOPA 1KK8C 2KSPA 1QX5B 1M45A 3BUNB 5PALA 1YUSA 2K7OA 3DD4A 3CR5X 2M7LA 4E68A 2ZNDA 1QS7A 4QJ4B 2I7AA 2BKHB 4L9MA 1ALVA 3EVUA 1K94A 4WRIA 3SG3A 1QASA 1K8UA 1QVIZ 2E30A 2JXCA 3LCPC 5KSZA 1WRZA 5CSNA 3SIAA 3NSIA 2LAPA 2TN4A 1SCMC 2M0RA 1BMOA 2JNXA 3VRPA 2LLUA 2EGDA 1J7RA 2BCAA 3CR2A 1OZOA 4ORBB 3A8RA 3SG2A 2PSRA 1RTP1 1M31A 3O2PA 2Y5IA 4PHMA 2KAXA 1U5IA 1BT6A 3GOFA 1TRFA 1AVSA 1X02A 4QJ3B 2CNPA 4MN0A 4GPLB 3OX5A 1B4CA 4CFRA 2BCBA 3AKBA 2BECA 3CWGA 1NX0A 1FW4A 1PALA 3I5HB 3NSLA 1JUOA 1HQVA 1XK4C 3O6BA 2L51A 3BUMB 1DJIA 3PN7C 3VRQA 3I5GC 2OTGC 1QLSA 5K89A 2KAYA 2WNDA 4HRGA 2I18A 1KQMB 2LCPA 2G2BA 5JJGA 4ICBA 1PVAA 3PALA 4N1FA 1YUUA 1ZUZA 3TS5B 4YGEB 3BYAA 2KDHA 3DVMA 1EL4A 1TNPA 1MUXA 2L98A 5AANA 2MBXA 4BY5A 1IQ3A 2KBIA 2NCPA 3AAJA 1BF5A 1R6PA 3RLZA 2M9GA 2Q4UA 2E6WA 1N2DA 1MWNA 2Y1NA 2MHHA 2F8PA 4MZLA 1NX3A 1YVLA 5CSFA 1NP8A 1QV0A 3VGOA 2PMYA 1NYAA 1UURA 2LHIA 1IKUA 1BODA 2GGZA 4FQOA 1HT9A 1SY9A 4QJ5B 2PASA 3BOWA 1NX1A 2LE9B 2LLTA 2COLB 2JULA 1UHHA 1CDLA 1XFYO 2FJUB 1N0YA 1KQVA 1QLKA 1B47A 2QACA 2LP3A 5GQQC 1F71A 1CDPA 3I5FB 3F45A 4OKHA 2CXJA 1CLLA 1V1FA 1K90D 1OQPA 1XFUO 1XVJA 2LUCA 1PULA 1FF1A 1Y6WA 2ZRSA 1SKTA 1SW8A 4GBAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JTT A;  1TTX A;  2M29 A;  1DGU A;  1FI6 A;  2BBN A;  1F4O A;  1FPW A;  5I2O A;  1DJX A;  1S6J A;  4YI9 A;  3I5H C;  1UP5 A;  4M2Q A;  5JOL A;  2LUX A;  1CLM A;  1S5G Y;  4GUK A;  4WQ2 A;  2KQ6 A;  2LC5 A;  1REC A;  1DMO A;  5KTY A;  2HPS A;  1KQM C;  3O4Y A;  1SMG A;  4JPZ B;  2HF5 A;  3AAK A;  1MQ1 A;  2KFF A;  1OMV A;  2OS8 B;  2F2P A;  4YGD B;  4PDZ A;  1EG3 A;  3JTD B;  3H4S E;  4WQ3 A;  2R2I A;  1XO5 A;  5KU1 A;  3M0W A;  2LVV A;  3JVT C;  4MEW A;  1QIW A;  2L4I A;  1YX7 A;  5HLV A;  4I5L B;  1WLM A;  1QX7 A;  3DF0 A;  3DVE A;  4PAL A;  5CPV A;  1MR8 A;  1JC2 A;  4I5J A;  3FWC A;  4YBH B;  2K7C A;  3TDZ A;  3ZWH A;  1S3P A;  1YUR A;  3RM1 A;  2LV7 A;  4MLW A;  2JC2 A;  2M97 A;  4HRE E;  1QVI Y;  3IF7 A;  2L50 A;  2MLE C;  2KHN A;  1CDN A;  1MF8 B;  1M46 A;  2JNF A;  1ALW A;  3C1V A;  1DJY A;  3CTN A;  2L2E A;  1IQ5 A;  1QX2 A;  1J55 A;  2F3Z A;  2LHL A;  4I5K A;  1YRT B;  2KI6 C;  2AUC A;  1AK8 A;  1UHK A;  1U5I B;  3KEV A;  2SAS A;  2WOR A;  3I5F C;  4F0Z B;  1Y0V H;  1A29 A;  2SCP A;  2ZN9 A;  2RGI A;  1NSH A;  1YTZ C;  2BL0 B;  3VRN A;  1KK7 Z;  3A4U B;  2KNE A;  3HX4 A;  3OB1 B;  4HRH A;  3OB2 B;  1NPQ A;  4CPV A;  2KGB C;  1G4Y R;  2JZI A;  4MBE A;  1G33 A;  2KYC A;  1KSM A;  1AUI B;  2NCO A;  4M2O A;  1TNQ A;  5CSI A;  4IL1 A;  5F6T A;  2PVB A;  3FWB A;  1S26 D;  1SYM A;  1CKK A;  1YVH A;  1YX8 A;  4PHN A;  4HSZ A;  4N5X A;  3TDU A;  1J7Q A;  2EC6 B;  1NCX A;  2JRF A;  3EK7 A;  3OHM B;  4GFT A;  1K9P A;  2H61 C;  2JT8 A;  5G08 A;  1BLQ A;  1AHR A;  1KFX S;  1W7I B;  1VRK A;  4P5O E;  2OPO A;  2OS8 C;  2AMI A;  1K96 A;  2HET A;  2WOS A;  4MRX A;  3JTD C;  1H8B A;  2MA2 A;  3WHT B;  1B8L A;  4ZCU A;  3D10 A;  4GAO A;  1K2H A;  1JF0 A;  3NXA A;  4A4C A;  5HKW A;  4GNK B;  1A4P A;  1XA5 A;  1OMR A;  1E8A A;  3BOW B;  2KQY A;  1F55 A;  1TN4 A;  2WCB A;  3JVT B;  2P6B B;  5ER5 A;  1XFV O;  1WRK A;  1L7Z A;  1K95 A;  1RJV A;  2LMV A;  2PAL A;  1TNW A;  1UUS A;  2B1U A;  2KI6 D;  2O60 A;  4PE7 A;  4C0L A;  2ZKM X;  2FCE A;  1DVI A;  4GGF A;  1BU3 A;  1C07 A;  1CFF A;  3CZT X;  1LA0 A;  1R2U A;  1ODB A;  1CDM A;  2PRU A;  4MRY A;  3KO0 A;  1ZFS A;  1Y1U A;  3ICB A;  4CLN A;  1NX2 A;  3DVK A;  3KPX A;  4OCI A;  2GGM A;  2CBL A;  2LMT A;  1TCO B;  2ZN8 A;  1B7T Y;  2KI4 C;  2HQW A;  2BL0 C;  2G9B A;  1SRA A;  2L0P A;  4R1E A;  3LK1 A;  1A2X A;  1LKJ A;  1ZAC A;  4ORA B;  1B8C A;  1WY9 A;  5J3X A;  2K7B A;  4JWQ A;  5AFP A;  4M2P A;  1SK6 D;  1IWQ A;  4YGA A;  2NLN A;  1JFK A;  1WLZ A;  5D69 A;  3EVV A;  3VRR A;  2K2F A;  4Q04 A;  4OV2 A;  4U8D A;  5HYD A;  1IGV A;  5HLO A;  4CFQ A;  1QJT A;  1XFX O;  2K8M B;  3K21 A;  3DVJ A;  2ZNE A;  4XJK A;  4DS7 A;  1NCZ A;  2LAN A;  1CMF A;  1QTX A;  4ORC B;  2EC6 C;  1DF0 A;  2WCF A;  2LP2 A;  3LLE A;  1AJ5 A;  1F4Q A;  4C0K A;  1J7O A;  1L2O B;  4AQI A;  1A75 A;  1NCY A;  3DF0 B;  2KBM A;  1ZMZ A;  1BG1 A;  3KHE A;  3PFV A;  3SG6 A;  3GK1 A;  4GGF C;  5DKN A;  1MXE A;  4PCW A;  2LNK A;  2I2R E;  1IRJ A;  1CM1 A;  5IBW A;  2MJW B;  1JF2 A;  1QIV A;  1KFU S;  2M3W A;  5DKR A;  5B8I B;  1QXP A;  1B8R A;  2JU0 A;  2AAO A;  4N1G A;  2Q91 A;  1PSB A;  1IJ6 A;  3FS7 A;  1A03 A;  1XFZ O;  2KFH A;  3TUY B;  3GK4 X;  1YRU B;  4PE4 A;  5I8N A;  1LIN A;  1G8I A;  1GJY A;  1C7W A;  2JPT A;  1KCY A;  3KF9 A;  1Q80 A;  1RRO A;  4MVF A;  4YGC B;  1F8H A;  3BUW B;  1S5G Z;  1EH2 A;  2F2O A;  2IS9 A;  3NSK A;  3LK0 A;  1KWO B;  2HQ8 A;  3WXA A;  1QV1 A;  4BY4 A;  1JSA A;  1DGV A;  2FOT A;  2ZFD A;  2K0J A;  1OE9 B;  1LXF C;  5CSJ A;  1XK4 A;  1AP4 A;  4DIR A;  1LVC D;  1CFD A;  3ZNI A;  2KI4 B;  4MSP A;  1JWD A;  2CTN A;  3EK8 A;  2D8N A;  3SJS A;  1SL7 A;  2ISD A;  1NUB A;  5I2Q A;  3LL8 B;  1IJ5 A;  2CCM A;  1DTL A;  4D1E A;  1K9U A;  1V1G A;  3D0Y A;  1YR5 A;  3CS1 A;  4DCK A;  1OSA A;  1WDC B;  2JXL A;  3EVR A;  2KOT A;  1UHI A;  4FTG A;  1NIW A;  1FBV A;  4GGN A;  4PE0 A;  1JFJ A;  2BKI B;  2LVI A;  1QAT A;  1DJG A;  2CT9 A;  4AQJ A;  1L2O C;  3CR4 X;  3TDI A;  2Y4Q A;  2BE4 A;  1EJ3 A;  1IG5 A;  1BR4 B;  1K93 D;  1KSO A;  4MZK A;  2F3Y A;  1TIZ A;  4OVN F;  1RWY A;  4NDB A;  5D7F A;  1EXR A;  3SG4 A;  3SIB A;  2NXQ A;  2BCX A;  5AXI A;  1K9K A;  1B9A A;  1OMD A;  2MRD A;  4ZCV A;  1TNX A;  1GGZ A;  3TZ1 A;  3IQQ A;  2K61 A;  1RK9 A;  1SPY A;  1Y1X A;  1MXL C;  2LLS A;  2BBM A;  1DJW A;  2KAV A;  3IQO A;  1UHJ A;  2JTZ A;  4C0J A;  3PAT A;  3PM8 A;  3TUY C;  2KGR A;  1M63 B;  4NQG A;  3VRO A;  1Y1A A;  1KFX L;  3I5I B;  1MHO A;  1W7J B;  3EKJ A;  4I5N B;  1IH0 A;  2VRG A;  1NWD A;  4DRW A;  1KWO C;  5TNC A;  2K7D A;  1PK0 D;  3WHU B;  2M8U A;  1F54 A;  1ZOT B;  3BQ3 A;  3HCM A;  2M1U A;  2QPT A;  3AKA A;  2LVK A;  2JOJ A;  4XJK B;  2I94 A;  1SR6 B;  1DF0 B;  2JT3 A;  5AEQ A;  2L5X B;  2M1K B;  1OZS A;  1CB1 A;  2LVJ A;  3SG5 A;  1PVB A;  1A75 B;  3O78 A;  2WCE A;  2O5G A;  5HKY A;  1WDC C;  1KK8 B;  2F33 A;  1CMG A;  2LM5 A;  1XFW O;  3SG7 A;  3QRX A;  4UPG A;  1CFP A;  1CLB A;  1CM4 A;  3BUO B;  1UHN A;  2M49 B;  5DKQ A;  3E3R A;  4NDD A;  4PHJ A;  1BJF A;  2L4H A;  1GGW A;  3WNX B;  1DJH A;  1AJ4 A;  2WC8 A;  1PRW A;  1EG4 A;  1UWO A;  4JQ0 D;  1S6C A;  4A4B A;  5ER4 X;  2H2K A;  3BUX B;  2A4J A;  1J7P A;  1WRL A;  1SCM B;  5I2L A;  4P2Y B;  4YGB B;  1DJZ A;  5HKZ A;  3EK4 A;  1S1E A;  1PSR A;  3EKH A;  4YI8 A;  4MZJ A;  1LA3 A;  1B7T Z;  4NDC A;  5AER A;  4TNC A;  2MAZ A;  2LMU A;  1BR1 B;  2V53 A;  2ZRT A;  4PHK A;  1SNL A;  1RFJ A;  2JQ6 A;  3GK2 A;  3I5I C;  1SCV A;  3CGA A;  3BXK A;  2MLF C;  3FIA A;  2NZ0 A;  3MSE B;  4ETO A;  1TCF A;  1DT7 B;  1H4B A;  1S6I A;  2BE6 A;  1CNP A;  1XYD A;  1GQM A;  2KFG A;  1JBA A;  3PN7 B;  1YUT A;  2FCD A;  4AOM A;  4CID A;  3I5G B;  1SBJ A;  2K2A A;  2OTG B;  1N65 A;  1SL8 A;  4XYN A;  2KYF A;  3OX6 A;  3CLN A;  3TS5 C;  1F70 A;  2GV5 A;  1B1G A;  1KK7 Y;  1KFU L;  3PLF B;  5BPJ A;  1SL9 A;  4YRU A;  2JT0 A;  3D0Y B;  1SR6 C;  2Y1M A;  1J1E A;  1CTR A;  3PSR A;  4USL A;  2JWW A;  2M7N A;  1CFC A;  2DOQ A;  2H61 A;  1S36 A;  4DUQ A;  5FYX A;  1M39 A;  3NSO A;  3OP0 A;  1C7V A;  1D1O A;  1FI5 A;  2EHB A;  1J1D A;  4OR9 B;  1OOJ A;  4PE1 A;  1BOC A;  1TOP A;  1KK8 C;  2KSP A;  1QX5 B;  1M45 A;  3BUN B;  5PAL A;  1YUS A;  2K7O A;  3DD4 A;  3CR5 X;  2M7L A;  4E68 A;  2ZND A;  1QS7 A;  4QJ4 B;  2I7A A;  2BKH B;  4L9M A;  1ALV A;  3EVU A;  1K94 A;  4WRI A;  3SG3 A;  1QAS A;  1K8U A;  1QVI Z;  2E30 A;  2JXC A;  3LCP C;  5KSZ A;  1WRZ A;  5CSN A;  3SIA A;  3NSI A;  2LAP A;  2TN4 A;  1SCM C;  2M0R A;  1BMO A;  2JNX A;  3VRP A;  2LLU A;  2EGD A;  1J7R A;  2BCA A;  3CR2 A;  1OZO A;  4ORB B;  3A8R A;  3SG2 A;  2PSR A;  1RTP 1;  1M31 A;  3O2P A;  2Y5I A;  4PHM A;  2KAX A;  1U5I A;  1BT6 A;  3GOF A;  1TRF A;  1AVS A;  1X02 A;  4QJ3 B;  2CNP A;  4MN0 A;  4GPL B;  3OX5 A;  1B4C A;  4CFR A;  2BCB A;  3AKB A;  2BEC A;  3CWG A;  1NX0 A;  1FW4 A;  1PAL A;  3I5H B;  3NSL A;  1JUO A;  1HQV A;  1XK4 C;  3O6B A;  2L51 A;  3BUM B;  1DJI A;  3PN7 C;  3VRQ A;  3I5G C;  2OTG C;  1QLS A;  5K89 A;  2KAY A;  2WND A;  4HRG A;  2I18 A;  1KQM B;  2LCP A;  2G2B A;  5JJG A;  4ICB A;  1PVA A;  3PAL A;  4N1F A;  1YUU A;  1ZUZ A;  3TS5 B;  4YGE B;  3BYA A;  2KDH A;  3DVM A;  1EL4 A;  1TNP A;  1MUX A;  2L98 A;  5AAN A;  2MBX A;  4BY5 A;  1IQ3 A;  2KBI A;  2NCP A;  3AAJ A;  1BF5 A;  1R6P A;  3RLZ A;  2M9G A;  2Q4U A;  2E6W A;  1N2D A;  1MWN A;  2Y1N A;  2MHH A;  2F8P A;  4MZL A;  1NX3 A;  1YVL A;  5CSF A;  1NP8 A;  1QV0 A;  3VGO A;  2PMY A;  1NYA A;  1UUR A;  2LHI A;  1IKU A;  1BOD A;  2GGZ A;  4FQO A;  1HT9 A;  1SY9 A;  4QJ5 B;  2PAS A;  3BOW A;  1NX1 A;  2LE9 B;  2LLT A;  2COL B;  2JUL A;  1UHH A;  1CDL A;  1XFY O;  2FJU B;  1N0Y A;  1KQV A;  1QLK A;  1B47 A;  2QAC A;  2LP3 A;  5GQQ C;  1F71 A;  1CDP A;  3I5F B;  3F45 A;  4OKH A;  2CXJ A;  1CLL A;  1V1F A;  1K90 D;  1OQP A;  1XFU O;  1XVJ A;  2LUC A;  1PUL A;  1FF1 A;  1Y6W A;  2ZRS A;  1SKT A;  1SW8 A;  4GBA A; 
#chains in the Genus database with same CATH topology
 2JTT A;  1TTX A;  3B6X A;  2M29 A;  1DGU A;  1FI6 A;  2BBN A;  1F4O A;  5DIC A;  1FPW A;  5I2O A;  1DJX A;  1S6J A;  4YI9 A;  3I5H C;  1UP5 A;  4M2Q A;  5JOL A;  2LUX A;  2KPH A;  1CLM A;  1S5G Y;  4GUK A;  4WQ2 A;  3SS4 A;  2KQ6 A;  2LC5 A;  1REC A;  1DMO A;  5KTY A;  2HPS A;  1KQM C;  3O4Y A;  1SMG A;  4JPZ B;  2P70 A;  2HF5 A;  3IVT A;  3AAK A;  1MQ1 A;  2KFF A;  1OMV A;  2OS8 B;  2F2P A;  2YGU A;  4YGD B;  3S0A A;  5FI2 A;  4PDZ A;  1EG3 A;  3JTD B;  3H4S E;  4WQ3 A;  1OW4 A;  2R2I A;  4IJ7 A;  1XO5 A;  5KU1 A;  3M0W A;  2LVV A;  3JVT C;  4MEW A;  1QIW A;  2L4I A;  1YX7 A;  5HLV A;  2FJY A;  1WLM A;  1QX7 A;  3DF0 A;  3DVE A;  4I5L B;  4PAL A;  1MR8 A;  5CPV A;  1JC2 A;  4I5J A;  3FWC A;  4YBH B;  2K7C A;  3TDZ A;  3D73 A;  1S3P A;  1YUR A;  3BJH A;  3RM1 A;  3ZWH A;  2LV7 A;  4MLW A;  2JC2 A;  2M97 A;  4HRE E;  1QWV A;  1QVI Y;  3IF7 A;  2L50 A;  2MLE C;  2KHN A;  1CDN A;  1MF8 B;  1M46 A;  3BFH A;  2JNF A;  2GTE A;  1ALW A;  3C1V A;  1DJY A;  3CTN A;  2L2E A;  1IQ5 A;  1QX2 A;  1J55 A;  2F3Z A;  2LHL A;  4I5K A;  1YRT B;  3D76 A;  5D3O A;  2KI6 C;  2AUC A;  1AK8 A;  1UHK A;  1U5I B;  3KEV A;  2SAS A;  2WOR A;  3I5F C;  4F0Z B;  1Y0V H;  1A29 A;  2SCP A;  2ZN9 A;  2RGI A;  1NSH A;  1YTZ C;  2BL0 B;  3VRN A;  1KK7 Z;  3A4U B;  2KNE A;  3HX4 A;  3OB1 B;  4HRH A;  3OB2 B;  1NPQ A;  4CPV A;  2KGB C;  1G4Y R;  2JZI A;  4JKT A;  4MBE A;  4OZD A;  1G33 A;  2KYC A;  1KSM A;  1AUI B;  2JPO A;  2NCO A;  4M2O A;  5FI6 A;  1TNQ A;  3B86 A;  5CSI A;  4IL1 A;  5F6T A;  2PVB A;  3FWB A;  1S26 D;  1SYM A;  1CKK A;  2BNX A;  1YVH A;  1YX8 A;  4PHN A;  4HSZ A;  4N5X A;  3TDU A;  1W9Z A;  2EC6 B;  1NCX A;  1J7Q A;  2JRF A;  3EK7 A;  3OHM B;  4GFT A;  1K9P A;  2H61 C;  2JT8 A;  5G08 A;  1BLQ A;  1AHR A;  1KFX S;  1W7I B;  1LS8 A;  1VRK A;  4P5O E;  2OPO A;  2OS8 C;  2AMI A;  1K96 A;  2HET A;  2WOS A;  4MRX A;  3JTD C;  1H8B A;  2MA2 A;  3WHT B;  1B8L A;  4ZCU A;  3D10 A;  4GAO A;  1K2H A;  1JF0 A;  3NXA A;  4A4C A;  5HKW A;  4GNK B;  1A4P A;  1XA5 A;  1OMR A;  1E8A A;  2WCL A;  3BOW B;  2KQY A;  1F55 A;  4KYN A;  1TN4 A;  2WCB A;  3JVT B;  2P6B B;  5ER5 A;  1XFV O;  1WRK A;  1L7Z A;  1K95 A;  2L5Y A;  1RJV A;  2LMV A;  1SSE B;  2PAL A;  1TNW A;  1UUS A;  2B1U A;  2KI6 D;  2O60 A;  4PE7 A;  4C0L A;  2ZKM X;  2FCE A;  1DVI A;  4GGF A;  1BU3 A;  3S0B A;  1C07 A;  1CFF A;  1TWO A;  3CZT X;  1LA0 A;  3BFA A;  1R2U A;  1ODB A;  1CDM A;  2PRU A;  4MRY A;  3KO0 A;  1ZFS A;  1Y1U A;  3ICB A;  4CLN A;  1P28 A;  1NX2 A;  3DVK A;  3KPX A;  4OCI A;  2GGM A;  2CBL A;  2LMT A;  1TCO B;  3R72 A;  1TUZ A;  2ZN8 A;  1B7T Y;  2KI4 C;  2HQW A;  2BL0 C;  2G9B A;  1SRA A;  2L0P A;  3FE6 A;  4PT1 A;  4R1E A;  3LK1 A;  1A2X A;  1LKJ A;  1ZAC A;  4ORA B;  1B8C A;  1WY9 A;  2PYQ A;  3FE9 A;  2K7B A;  4JWQ A;  5J3X A;  5AFP A;  3CDN A;  3D74 A;  4M2P A;  1SK6 D;  1IWQ A;  4YGA A;  2NLN A;  1JFK A;  1WLZ A;  5D69 A;  3EVV A;  3VRR A;  2K2F A;  4Q04 A;  4OV2 A;  4U8D A;  5HYD A;  3FE8 A;  1IGV A;  5HLO A;  2QDI A;  1QJT A;  1XFX O;  2K8M B;  3K21 A;  3DVJ A;  2ZNE A;  4XJK A;  4CFQ A;  4DS7 A;  1NCZ A;  2LAN A;  1CMF A;  1QTX A;  4ORC B;  2EC6 C;  1DF0 A;  3L4A A;  2WCF A;  2LP2 A;  1OOH A;  3LLE A;  1AJ5 A;  1F4Q A;  4C0K A;  1J7O A;  2WCH A;  1L2O B;  3RZS A;  4AQI A;  3O4X A;  1A75 A;  1NCY A;  3DF0 B;  2KBM A;  1ZMZ A;  1BG1 A;  3KHE A;  3PFV A;  3SG6 A;  3GK1 A;  4GGF C;  5DKN A;  1MXE A;  4PCW A;  2LNK A;  2I2R E;  1IRJ A;  1C3Y A;  1CM1 A;  1T14 A;  2QEH A;  2MJW B;  5IBW A;  1JF2 A;  1QIV A;  1KFU S;  3S0D A;  2M3W A;  5DKR A;  5B8I B;  1QXP A;  1B8R A;  2JU0 A;  2AAO A;  4N1G A;  2Q91 A;  1PSB A;  1IJ6 A;  3FS7 A;  1A03 A;  1XFZ O;  2KFH A;  2WC5 A;  3TUY B;  3GK4 X;  1YRU B;  2QEV A;  3DYE A;  1LIN A;  4PE4 A;  3SS5 A;  5I8N A;  1G8I A;  1GJY A;  1C7W A;  2JPT A;  1KCY A;  3KF9 A;  1Q80 A;  1RRO A;  3DY9 A;  4MVF A;  4YGC B;  1F8H A;  3BUW B;  1S5G Z;  1EH2 A;  2F2O A;  2IS9 A;  3NSK A;  3LK0 A;  1KWO B;  2HQ8 A;  3WXA A;  1QV1 A;  4BY4 A;  2WC6 A;  1JSA A;  1DGV A;  2FOT A;  2ZFD A;  2K0J A;  1OE9 B;  1LXF C;  5CSJ A;  3B88 A;  1XK4 A;  1AP4 A;  4DIR A;  1LVC D;  3S0E A;  1CFD A;  1OOG A;  3ZNI A;  2WCJ A;  2KI4 B;  1ORG A;  4MSP A;  1JWD A;  1DEL A;  2CTN A;  3EK8 A;  2D8N A;  3SJS A;  1SL7 A;  2ISD A;  1NUB A;  5I2Q A;  3LL8 B;  1IJ5 A;  2CCM A;  1DTL A;  4D1E A;  1K9U A;  1V1G A;  5FI7 A;  3D0Y A;  1YR5 A;  3CS1 A;  4DCK A;  1OSA A;  1WDC B;  2JXL A;  2K60 A;  2KOT A;  3CYZ A;  1UHI A;  3EVR A;  3CZ2 A;  1NIW A;  4FTG A;  1FBV A;  4GGN A;  4PE0 A;  1JFJ A;  2BKI B;  2LVI A;  3R1O A;  3L47 A;  1QAT A;  1DJG A;  2CT9 A;  4AQJ A;  1L2O C;  3CR4 X;  3TDI A;  2Y4Q A;  2BE4 A;  1EJ3 A;  1IG5 A;  1BR4 B;  1K93 D;  1KSO A;  4MZK A;  3PM2 A;  2F3Y A;  1TIZ A;  4OVN F;  1RWY A;  4NDB A;  5D7F A;  1EXR A;  3NHI A;  3SG4 A;  3SIB A;  2NXQ A;  2BCX A;  5AXI A;  1K9K A;  1B9A A;  1OMD A;  2MRD A;  4ZCV A;  1TNX A;  1GGZ A;  2BAP A;  3TZ1 A;  3D78 A;  3IQQ A;  2K61 A;  1RK9 A;  1SPY A;  1Y1X A;  1MXL C;  2LLS A;  1TUJ A;  3R1P A;  3UNW A;  2BBM A;  1DJW A;  2KAV A;  2KLE A;  3IQO A;  1UHJ A;  2JTZ A;  3D77 A;  4C0J A;  3PAT A;  3PM8 A;  3TUY C;  1OOF A;  4FQT A;  2KGR A;  1M63 B;  4NQG A;  3VRO A;  1Y1A A;  1KFX L;  3I5I B;  3SS3 A;  1MHO A;  1W7J B;  3EKJ A;  4I5N B;  4INW A;  1IH0 A;  2QEB A;  2VRG A;  1NWD A;  4DRW A;  1KWO C;  5TNC A;  2K7D A;  1PK0 D;  3WHU B;  2M8U A;  1F54 A;  1ZOT B;  3BQ3 A;  3HCM A;  2M1U A;  2QPT A;  3AKA A;  2LVK A;  2JOJ A;  4XJK B;  2I94 A;  1SR6 B;  4JD9 A;  1DF0 B;  2JT3 A;  3BFB A;  5AEQ A;  2L5X B;  2M1K B;  1OZS A;  1CB1 A;  2LVJ A;  3SG5 A;  1PVB A;  1A75 B;  3O78 A;  2WCE A;  2O5G A;  5HKY A;  1WDC C;  3L4L A;  1KK8 B;  2F33 A;  1CMG A;  2LM5 A;  1XFW O;  3SG7 A;  3QRX A;  4UPG A;  1CFP A;  1CLB A;  1CM4 A;  3BUO B;  1UHN A;  2M49 B;  5DKQ A;  3E3R A;  2ERB A;  3EG5 B;  4NDD A;  1BJF A;  4PHJ A;  1DEK A;  2L4H A;  1GGW A;  3WNX B;  1DJH A;  1AJ4 A;  2WC8 A;  1PRW A;  1EG4 A;  1UWO A;  3DXL A;  4JQ0 D;  1S6C A;  4A4B A;  5ER4 X;  2H2K A;  3BUX B;  2A4J A;  1J7P A;  1WRL A;  1IIO A;  1SCM B;  5I2L A;  4P2Y B;  5EL2 A;  4YGB B;  1DJZ A;  2WCM A;  5HKZ A;  3EK4 A;  1S1E A;  1PSR A;  3EKH A;  4YI8 A;  4MZJ A;  1LA3 A;  1B7T Z;  4NDC A;  3NGV A;  5AER A;  5I94 A;  4TNC A;  2MAZ A;  2LMU A;  1BR1 B;  2V53 A;  2ZRT A;  4PHK A;  1SNL A;  3QME A;  1RFJ A;  2JQ6 A;  3GK2 A;  3I5I C;  1SCV A;  3CGA A;  3BXK A;  2MLF C;  3FIA A;  2NZ0 A;  3MSE B;  4ETO A;  1TCF A;  1DT7 B;  1H4B A;  1S6I A;  2BE6 A;  1CNP A;  1XYD A;  1GQM A;  2KFG A;  1JBA A;  3PN7 B;  1YUT A;  2FCD A;  3OBV A;  4AOM A;  4CID A;  3I5G B;  1SBJ A;  2K2A A;  2OTG B;  3CAB A;  1N65 A;  1SL8 A;  4XYN A;  1XFR A;  2KYF A;  4F7F A;  3OX6 A;  3CLN A;  3TS5 C;  1Z4H A;  1F70 A;  3R1V A;  2GV5 A;  1B1G A;  3B87 A;  1KK7 Y;  1KFU L;  3PLF B;  5BPJ A;  1SL9 A;  2KLD A;  2JT0 A;  3D0Y B;  4YRU A;  1SR6 C;  2Y1M A;  1J1E A;  1CTR A;  3PSR A;  4USL A;  2JWW A;  2M7N A;  3CZ0 A;  1CFC A;  2DOQ A;  3S0F A;  2H61 A;  1S36 A;  4DUQ A;  5FYX A;  1M39 A;  3NSO A;  3OP0 A;  4INX A;  1C7V A;  1D1O A;  1FI5 A;  2EHB A;  1J1D A;  4OR9 B;  1OOJ A;  1Z2C B;  4PE1 A;  1TOP A;  1KK8 C;  1BOC A;  2KSP A;  1QX5 B;  1M45 A;  3BUN B;  5PAL A;  1YUS A;  2K7O A;  3DD4 A;  3CR5 X;  2M7L A;  4E68 A;  2ZND A;  1QS7 A;  4QJ4 B;  2I7A A;  2BKH B;  4L9M A;  1ALV A;  3EVU A;  1K94 A;  4WRI A;  3SG3 A;  1QAS A;  3VB1 A;  1K8U A;  1QVI Z;  2E30 A;  2JXC A;  3LCP C;  5HL1 A;  1WRZ A;  5KSZ A;  5CSN A;  2H8V A;  3SIA A;  3NSI A;  2LAP A;  2TN4 A;  1SCM C;  2M0R A;  1BMO A;  1C3Z A;  2JNX A;  3VRP A;  2LLU A;  2EGD A;  1J7R A;  2BCA A;  3CR2 A;  1OZO A;  4ORB B;  3A8R A;  3SG2 A;  2PSR A;  1RTP 1;  2L2C A;  1M31 A;  3O2P A;  2Y5I A;  4PHM A;  2KAX A;  1U5I A;  1BT6 A;  3GOF A;  1TRF A;  1AVS A;  1X02 A;  4QJ3 B;  2CNP A;  4MN0 A;  4GPL B;  3OX5 A;  1B4C A;  4CFR A;  2BCB A;  3AKB A;  2BEC A;  3CWG A;  1NX0 A;  1FW4 A;  1PAL A;  3I5H B;  3NSL A;  1JUO A;  1HQV A;  1XK4 C;  3O6B A;  2L51 A;  3BUM B;  1DJI A;  3PN7 C;  2WCK A;  3VRQ A;  3I5G C;  2OTG C;  1QLS A;  3V2L A;  5K89 A;  2KAY A;  2WND A;  3CZ1 A;  4HRG A;  2I18 A;  1KQM B;  2LCP A;  2G2B A;  5JJG A;  4ICB A;  1DC1 A;  1PVA A;  3PAL A;  4N1F A;  1YUU A;  1ZUZ A;  1GM0 A;  3TS5 B;  4YGE B;  3BYA A;  2KDH A;  3DVM A;  3Q8I A;  1EL4 A;  1TNP A;  1MUX A;  2L98 A;  5AAN A;  2MBX A;  4BY5 A;  1IQ3 A;  1OOI X;  2KBI A;  3UO9 A;  2NCP A;  3AAJ A;  1BF5 A;  1R6P A;  3RLZ A;  2M9G A;  2Q4U A;  3NHT A;  2E6W A;  3K1E A;  1N2D A;  3OGN A;  1MWN A;  2Y1N A;  2MHH A;  3PJI A;  2F8P A;  4MZL A;  1NX3 A;  1YVL A;  5CSF A;  1NP8 A;  1QV0 A;  3VGO A;  2PMY A;  1NYA A;  1UUR A;  2LHI A;  1IKU A;  1BOD A;  2GGZ A;  4FQO A;  1HT9 A;  3S0G A;  1SY9 A;  4QJ5 B;  3B7A A;  2PAS A;  3BOW A;  2PQL A;  1NX1 A;  2LE9 B;  2LLT A;  2COL B;  2JUL A;  1UHH A;  1CDL A;  1XFY O;  2FJU B;  3N7H A;  1N0Y A;  1KQV A;  2QEO A;  1QLK A;  1B47 A;  2QAC A;  2LP3 A;  5GQQ C;  2P71 A;  1F71 A;  1CDP A;  3I5F B;  3F45 A;  4OKH A;  2CXJ A;  1CLL A;  1V1F A;  1K90 D;  1OQP A;  3D75 A;  1XFU O;  1XVJ A;  2LUC A;  1PUL A;  1FF1 A;  1DQE A;  1Y6W A;  2ZRS A;  1SKT A;  1SW8 A;  4GBA A;  3DZT A; 
#chains in the Genus database with same CATH homology
 2JTT A;  1TTX A;  2M29 A;  1DGU A;  1FI6 A;  2BBN A;  1F4O A;  1FPW A;  5I2O A;  1DJX A;  1S6J A;  4YI9 A;  3I5H C;  1UP5 A;  4M2Q A;  5JOL A;  2LUX A;  1CLM A;  1S5G Y;  4GUK A;  4WQ2 A;  2KQ6 A;  2LC5 A;  1REC A;  1DMO A;  5KTY A;  2HPS A;  1KQM C;  3O4Y A;  1SMG A;  4JPZ B;  2HF5 A;  3AAK A;  1MQ1 A;  2KFF A;  1OMV A;  2OS8 B;  2F2P A;  4YGD B;  4PDZ A;  1EG3 A;  3JTD B;  3H4S E;  4WQ3 A;  2R2I A;  1XO5 A;  5KU1 A;  3M0W A;  2LVV A;  3JVT C;  4MEW A;  1QIW A;  2L4I A;  1YX7 A;  5HLV A;  4I5L B;  1WLM A;  1QX7 A;  3DF0 A;  3DVE A;  4PAL A;  5CPV A;  1MR8 A;  1JC2 A;  4I5J A;  3FWC A;  4YBH B;  2K7C A;  3TDZ A;  3ZWH A;  1S3P A;  1YUR A;  3RM1 A;  2LV7 A;  4MLW A;  2JC2 A;  2M97 A;  4HRE E;  1QVI Y;  3IF7 A;  2L50 A;  2MLE C;  2KHN A;  1CDN A;  1MF8 B;  1M46 A;  2JNF A;  1ALW A;  3C1V A;  1DJY A;  3CTN A;  2L2E A;  1IQ5 A;  1QX2 A;  1J55 A;  2F3Z A;  2LHL A;  4I5K A;  1YRT B;  2KI6 C;  2AUC A;  1AK8 A;  1UHK A;  1U5I B;  3KEV A;  2SAS A;  2WOR A;  3I5F C;  4F0Z B;  1Y0V H;  1A29 A;  2SCP A;  2ZN9 A;  2RGI A;  1NSH A;  1YTZ C;  2BL0 B;  3VRN A;  1KK7 Z;  3A4U B;  2KNE A;  3HX4 A;  3OB1 B;  4HRH A;  3OB2 B;  1NPQ A;  4CPV A;  2KGB C;  1G4Y R;  2JZI A;  4MBE A;  1G33 A;  2KYC A;  1KSM A;  1AUI B;  2NCO A;  4M2O A;  1TNQ A;  5CSI A;  4IL1 A;  5F6T A;  2PVB A;  3FWB A;  1S26 D;  1SYM A;  1CKK A;  1YVH A;  1YX8 A;  4PHN A;  4HSZ A;  4N5X A;  3TDU A;  1J7Q A;  2EC6 B;  1NCX A;  2JRF A;  3EK7 A;  3OHM B;  4GFT A;  1K9P A;  2H61 C;  2JT8 A;  5G08 A;  1BLQ A;  1AHR A;  1KFX S;  1W7I B;  1VRK A;  4P5O E;  2OPO A;  2OS8 C;  2AMI A;  1K96 A;  2HET A;  2WOS A;  4MRX A;  3JTD C;  1H8B A;  2MA2 A;  3WHT B;  1B8L A;  4ZCU A;  3D10 A;  4GAO A;  1K2H A;  1JF0 A;  3NXA A;  4A4C A;  5HKW A;  4GNK B;  1A4P A;  1XA5 A;  1OMR A;  1E8A A;  3BOW B;  2KQY A;  1F55 A;  1TN4 A;  2WCB A;  3JVT B;  2P6B B;  5ER5 A;  1XFV O;  1WRK A;  1L7Z A;  1K95 A;  1RJV A;  2LMV A;  2PAL A;  1TNW A;  1UUS A;  2B1U A;  2KI6 D;  2O60 A;  4PE7 A;  4C0L A;  2ZKM X;  2FCE A;  1DVI A;  4GGF A;  1BU3 A;  1C07 A;  1CFF A;  3CZT X;  1LA0 A;  1R2U A;  1ODB A;  1CDM A;  2PRU A;  4MRY A;  3KO0 A;  1ZFS A;  1Y1U A;  3ICB A;  4CLN A;  1NX2 A;  3DVK A;  3KPX A;  4OCI A;  2GGM A;  2CBL A;  2LMT A;  1TCO B;  2ZN8 A;  1B7T Y;  2KI4 C;  2HQW A;  2BL0 C;  2G9B A;  1SRA A;  2L0P A;  4R1E A;  3LK1 A;  1A2X A;  1LKJ A;  1ZAC A;  4ORA B;  1B8C A;  1WY9 A;  5J3X A;  2K7B A;  4JWQ A;  5AFP A;  4M2P A;  1SK6 D;  1IWQ A;  4YGA A;  2NLN A;  1JFK A;  1WLZ A;  5D69 A;  3EVV A;  3VRR A;  2K2F A;  4Q04 A;  4OV2 A;  4U8D A;  5HYD A;  1IGV A;  5HLO A;  4CFQ A;  1QJT A;  1XFX O;  2K8M B;  3K21 A;  3DVJ A;  2ZNE A;  4XJK A;  4DS7 A;  1NCZ A;  2LAN A;  1CMF A;  1QTX A;  4ORC B;  2EC6 C;  1DF0 A;  2WCF A;  2LP2 A;  3LLE A;  1AJ5 A;  1F4Q A;  4C0K A;  1J7O A;  1L2O B;  4AQI A;  1A75 A;  1NCY A;  3DF0 B;  2KBM A;  1ZMZ A;  1BG1 A;  3KHE A;  3PFV A;  3SG6 A;  3GK1 A;  4GGF C;  5DKN A;  1MXE A;  4PCW A;  2LNK A;  2I2R E;  1IRJ A;  1CM1 A;  5IBW A;  2MJW B;  1JF2 A;  1QIV A;  1KFU S;  2M3W A;  5DKR A;  5B8I B;  1QXP A;  1B8R A;  2JU0 A;  2AAO A;  4N1G A;  2Q91 A;  1PSB A;  1IJ6 A;  3FS7 A;  1A03 A;  1XFZ O;  2KFH A;  3TUY B;  3GK4 X;  1YRU B;  4PE4 A;  5I8N A;  1LIN A;  1G8I A;  1GJY A;  1C7W A;  2JPT A;  1KCY A;  3KF9 A;  1Q80 A;  1RRO A;  4MVF A;  4YGC B;  1F8H A;  3BUW B;  1S5G Z;  1EH2 A;  2F2O A;  2IS9 A;  3NSK A;  3LK0 A;  1KWO B;  2HQ8 A;  3WXA A;  1QV1 A;  4BY4 A;  1JSA A;  1DGV A;  2FOT A;  2ZFD A;  2K0J A;  1OE9 B;  1LXF C;  5CSJ A;  1XK4 A;  1AP4 A;  4DIR A;  1LVC D;  1CFD A;  3ZNI A;  2KI4 B;  4MSP A;  1JWD A;  2CTN A;  3EK8 A;  2D8N A;  3SJS A;  1SL7 A;  2ISD A;  1NUB A;  5I2Q A;  3LL8 B;  1IJ5 A;  2CCM A;  1DTL A;  4D1E A;  1K9U A;  1V1G A;  3D0Y A;  1YR5 A;  3CS1 A;  4DCK A;  1OSA A;  1WDC B;  2JXL A;  3EVR A;  2KOT A;  1UHI A;  4FTG A;  1NIW A;  1FBV A;  4GGN A;  4PE0 A;  1JFJ A;  2BKI B;  2LVI A;  1QAT A;  1DJG A;  2CT9 A;  4AQJ A;  1L2O C;  3CR4 X;  3TDI A;  2Y4Q A;  2BE4 A;  1EJ3 A;  1IG5 A;  1BR4 B;  1K93 D;  1KSO A;  4MZK A;  2F3Y A;  1TIZ A;  4OVN F;  1RWY A;  4NDB A;  5D7F A;  1EXR A;  3SG4 A;  3SIB A;  2NXQ A;  2BCX A;  5AXI A;  1K9K A;  1B9A A;  1OMD A;  2MRD A;  4ZCV A;  1TNX A;  1GGZ A;  3TZ1 A;  3IQQ A;  2K61 A;  1RK9 A;  1SPY A;  1Y1X A;  1MXL C;  2LLS A;  2BBM A;  1DJW A;  2KAV A;  3IQO A;  1UHJ A;  2JTZ A;  4C0J A;  3PAT A;  3PM8 A;  3TUY C;  2KGR A;  1M63 B;  4NQG A;  3VRO A;  1Y1A A;  1KFX L;  3I5I B;  1MHO A;  1W7J B;  3EKJ A;  4I5N B;  1IH0 A;  2VRG A;  1NWD A;  4DRW A;  1KWO C;  5TNC A;  2K7D A;  1PK0 D;  3WHU B;  2M8U A;  1F54 A;  1ZOT B;  3BQ3 A;  3HCM A;  2M1U A;  2QPT A;  3AKA A;  2LVK A;  2JOJ A;  4XJK B;  2I94 A;  1SR6 B;  1DF0 B;  2JT3 A;  5AEQ A;  2L5X B;  2M1K B;  1OZS A;  1CB1 A;  2LVJ A;  3SG5 A;  1PVB A;  1A75 B;  3O78 A;  2WCE A;  2O5G A;  5HKY A;  1WDC C;  1KK8 B;  2F33 A;  1CMG A;  2LM5 A;  1XFW O;  3SG7 A;  3QRX A;  4UPG A;  1CFP A;  1CLB A;  1CM4 A;  3BUO B;  1UHN A;  2M49 B;  5DKQ A;  3E3R A;  4NDD A;  4PHJ A;  1BJF A;  2L4H A;  1GGW A;  3WNX B;  1DJH A;  1AJ4 A;  2WC8 A;  1PRW A;  1EG4 A;  1UWO A;  4JQ0 D;  1S6C A;  4A4B A;  5ER4 X;  2H2K A;  3BUX B;  2A4J A;  1J7P A;  1WRL A;  1SCM B;  5I2L A;  4P2Y B;  4YGB B;  1DJZ A;  5HKZ A;  3EK4 A;  1S1E A;  1PSR A;  3EKH A;  4YI8 A;  4MZJ A;  1LA3 A;  1B7T Z;  4NDC A;  5AER A;  4TNC A;  2MAZ A;  2LMU A;  1BR1 B;  2V53 A;  2ZRT A;  4PHK A;  1SNL A;  1RFJ A;  2JQ6 A;  3GK2 A;  3I5I C;  1SCV A;  3CGA A;  3BXK A;  2MLF C;  3FIA A;  2NZ0 A;  3MSE B;  4ETO A;  1TCF A;  1DT7 B;  1H4B A;  1S6I A;  2BE6 A;  1CNP A;  1XYD A;  1GQM A;  2KFG A;  1JBA A;  3PN7 B;  1YUT A;  2FCD A;  4AOM A;  4CID A;  3I5G B;  1SBJ A;  2K2A A;  2OTG B;  1N65 A;  1SL8 A;  4XYN A;  2KYF A;  3OX6 A;  3CLN A;  3TS5 C;  1F70 A;  2GV5 A;  1B1G A;  1KK7 Y;  1KFU L;  3PLF B;  5BPJ A;  1SL9 A;  4YRU A;  2JT0 A;  3D0Y B;  1SR6 C;  2Y1M A;  1J1E A;  1CTR A;  3PSR A;  4USL A;  2JWW A;  2M7N A;  1CFC A;  2DOQ A;  2H61 A;  1S36 A;  4DUQ A;  5FYX A;  1M39 A;  3NSO A;  3OP0 A;  1C7V A;  1D1O A;  1FI5 A;  2EHB A;  1J1D A;  4OR9 B;  1OOJ A;  4PE1 A;  1BOC A;  1TOP A;  1KK8 C;  2KSP A;  1QX5 B;  1M45 A;  3BUN B;  5PAL A;  1YUS A;  2K7O A;  3DD4 A;  3CR5 X;  2M7L A;  4E68 A;  2ZND A;  1QS7 A;  4QJ4 B;  2I7A A;  2BKH B;  4L9M A;  1ALV A;  3EVU A;  1K94 A;  4WRI A;  3SG3 A;  1QAS A;  1K8U A;  1QVI Z;  2E30 A;  2JXC A;  3LCP C;  5KSZ A;  1WRZ A;  5CSN A;  3SIA A;  3NSI A;  2LAP A;  2TN4 A;  1SCM C;  2M0R A;  1BMO A;  2JNX A;  3VRP A;  2LLU A;  2EGD A;  1J7R A;  2BCA A;  3CR2 A;  1OZO A;  4ORB B;  3A8R A;  3SG2 A;  2PSR A;  1RTP 1;  1M31 A;  3O2P A;  2Y5I A;  4PHM A;  2KAX A;  1U5I A;  1BT6 A;  3GOF A;  1TRF A;  1AVS A;  1X02 A;  4QJ3 B;  2CNP A;  4MN0 A;  4GPL B;  3OX5 A;  1B4C A;  4CFR A;  2BCB A;  3AKB A;  2BEC A;  3CWG A;  1NX0 A;  1FW4 A;  1PAL A;  3I5H B;  3NSL A;  1JUO A;  1HQV A;  1XK4 C;  3O6B A;  2L51 A;  3BUM B;  1DJI A;  3PN7 C;  3VRQ A;  3I5G C;  2OTG C;  1QLS A;  5K89 A;  2KAY A;  2WND A;  4HRG A;  2I18 A;  1KQM B;  2LCP A;  2G2B A;  5JJG A;  4ICB A;  1PVA A;  3PAL A;  4N1F A;  1YUU A;  1ZUZ A;  3TS5 B;  4YGE B;  3BYA A;  2KDH A;  3DVM A;  1EL4 A;  1TNP A;  1MUX A;  2L98 A;  5AAN A;  2MBX A;  4BY5 A;  1IQ3 A;  2KBI A;  2NCP A;  3AAJ A;  1BF5 A;  1R6P A;  3RLZ A;  2M9G A;  2Q4U A;  2E6W A;  1N2D A;  1MWN A;  2Y1N A;  2MHH A;  2F8P A;  4MZL A;  1NX3 A;  1YVL A;  5CSF A;  1NP8 A;  1QV0 A;  3VGO A;  2PMY A;  1NYA A;  1UUR A;  2LHI A;  1IKU A;  1BOD A;  2GGZ A;  4FQO A;  1HT9 A;  1SY9 A;  4QJ5 B;  2PAS A;  3BOW A;  1NX1 A;  2LE9 B;  2LLT A;  2COL B;  2JUL A;  1UHH A;  1CDL A;  1XFY O;  2FJU B;  1N0Y A;  1KQV A;  1QLK A;  1B47 A;  2QAC A;  2LP3 A;  5GQQ C;  1F71 A;  1CDP A;  3I5F B;  3F45 A;  4OKH A;  2CXJ A;  1CLL A;  1V1F A;  1K90 D;  1OQP A;  1XFU O;  1XVJ A;  2LUC A;  1PUL A;  1FF1 A;  1Y6W A;  2ZRS A;  1SKT A;  1SW8 A;  4GBA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...