1BR1B

Smooth muscle myosin motor domain-essential light chain complex with mgadp.alf4 bound at the active site
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
148
structure length
148
Chain Sequence
FSEEQTAEFKEAFQLFDRTGDGKILYSQCGDVMRALGQNPTNAEVMKVLGNPKSDEMNLKTLKFEQFLPMMQTIAKNKDQGCFEDYVEGLRVFDKEGNGTVMGAEIRHVLVTLGEKMTEEEVEQLVAGHEDSNGCINYEELVRMVLSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MYOSIN
publication title Crystal structure of a vertebrate smooth muscle myosin motor domain and its complex with the essential light chain: visualization of the pre-power stroke state.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Muscle protein
total genus 38
structure length 148
sequence length 148
chains with identical sequence D, F, H
ec nomenclature ec 3.6.1.32: Transferred entry: 5.6.1.8.
pdb deposition date 1998-08-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1br1B02
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1br1B01
1GGWA 2I18A 2LCPA 2H2KA 2LAPA 1BMOA 2KYFA 1B47A 1QX5B 3AAJA 1M63B 1K93D 4A4BA 2OS8C 1B8CA 1X02A 1BOCA 1C7WA 2CTNA 2KAXA 2BKHB 3GK4X 3EVRA 4AOMA 2F8PA 2LV7A 1CLLA 5J3XA 3FS7A 1NX0A 4CIDA 1YVHA 1BR4B 4MEWA 1YURA 3KPXA 4BY4A 2I2RE 1QJTA 2Y1NA 2M49B 1EG3A 1XFWO 4FTGA 1PULA 1H4BA 3TZ1A 2MAZA 2MLFC 2LANA 3AAKA 1E8AA 3D0YB 1G8IA 5KTYA 1LINA 1N65A 4YGAA 2BBNA 4C0KA 4NDBA 2BE4A 3KF9A 3JTDC 1DJHA 1Y6WA 3BOWB 2ZRTA 1CM1A 1LA3A 1MHOA 2ZRSA 1DGVA 2AUCA 2E30A 5CPVA 5AERA 2TN4A 2HPSA 1J7QA 1RTP1 4AQIA 1SR6C 1DGUA 2MHHA 1L2OB 4QJ4B 2NXQA 1W7JB 3KEVA 1S3PA 2JT8A 2KQYA 1CB1A 1IWQA 5KU1A 2FCDA 3LLEA 2FJUB 4C0JA 1K8UA 1XFYO 1MWNA 3CLNA 5GQQC 1OZOA 3BXKA 4FQOA 2ZNEA 2SCPA 2JPTA 2JRFA 3BUWB 1MUXA 2LMUA 4GPLB 1N2DA 3LK1A 4GGFC 1EG4A 4GFTA 2KNEA 1CLMA 1YUTA 1EJ3A 2A4JA 4OR9B 3VRPA 4JQ0D 5AFPA 4GBAA 3PN7C 1Y1XA 5DKNA 5ER4X 3K21A 5DKQA 2JT0A 1QS7A 3HX4A 4JPZB 1PSRA 1JWDA 4PE0A 1JC2A 2F2PA 2CBLA 2KI6D 1J7PA 1QX7A 2NCOA 1QXPA 2M97A 2O60A 2EC6C 1F4OA 1LA0A 4CFRA 1CDNA 3OHMB 1F71A 2VRGA 1V1FA 2KOTA 4CLNA 1FI5A 3DF0B 2WCEA 5CSNA 2LLSA 1J1DA 4DS7A 2Y4QA 3I5GB 1A75A 3EKJA 1BU3A 1S26D 2K2AA 4M2OA 3ZNIA 5G08A 3JVTB 3DVEA 4USLA 1UHIA 2L2EA 4HREE 3OP0A 4I5NB 3TS5B 1BG1A 1H8BA 1UHKA 2MJWB 1NCXA 1AUIB 3VRNA 5PALA 2M1UA 4ZCUA 3NSKA 1DJXA 4PE4A 2O5GA 1QATA 1L7ZA 4YGDB 1OQPA 1TNPA 1DMOA 1LXFC 1QLKA 1NX1A 4HSZA 3BUXB 1IH0A 4PALA 1XVJA 2JNFA 4QJ5B 2JZIA 5K89A 3RM1A 2ZKMX 1K9KA 4ETOA 1OSAA 3TDIA 1BF5A 2F3ZA 3SG4A 4M2QA 2BE6A 1M45A 1A29A 3O6BA 2KBMA 2KYCA 4MVFA 3ICBA 1K9PA 1QIWA 1PVBA 2D8NA 4U8DA 1UWOA 2OPOA 1A2XA 1B4CA 2QACA 3O78A 4XYNA 4XJKA 4N5XA 1SK6D 2CT9A 4I5JA 1CFDA 5HKWA 5I8NA 1TCFA 1YUUA 2CCMA 1NUBA 2JQ6A 1CNPA 1SL9A 3OB1B 3QRXA 5B8IB 1EXRA 2GGZA 1K2HA 3FWBA 1SRAA 3SG7A 1DJWA 3CR5X 1JSAA 4YGEB 2H61A 2COLB 1JF0A 1L2OC 3BUNB 4HRGA 1PVAA 3NSLA 1RROA 3PLFB 1CFFA 1M31A 2L4HA 2KQ6A 3BUOB 1QTXA 4ICBA 3SIAA 1CFPA 1DF0B 1U5IB 1XFZO 3SIBA 1HT9A 1FF1A 4MBEA 2GV5A 1B9AA 3DVKA 1IRJA 1FPWA 1AHRA 1ODBA 3I5FB 2OTGB 2KHNA 2BCAA 2PASA 1WRZA 2HQ8A 2LUCA 4WRIA 2BL0C 2WC8A 3D0YA 1SW8A 1FBVA 2LC5A 1QIVA 1SL8A 2JXCA 1W7IB 2K8MB 3PFVA 2HETA 2P6BB 2JWWA 2M29A 2NLNA 1DT7B 5JJGA 3PM8A 1OMRA 2LUXA 3BOWA 2K7CA 1CFCA 1J1EA 2L5XB 1XO5A 1KQMB 1B7TY 1YX8A 2BCBA 1DJGA 4MZKA 2EGDA 1F4QA 2QPTA 4OKHA 3TDZA 1WRKA 1Q80A 1IJ5A 1CDMA 2EHBA 2M7NA 1LKJA 1K96A 1WDCB 1R6PA 2HQWA 4DRWA 2MA2A 1ZOTB 1QVIY 2LLTA 3I5GC 1GGZA 1DJZA 1ZFSA 2F33A 4IL1A 2OS8B 2G2BA 3SG6A 1RFJA 5HLOA 1S6JA 2G9BA 1TNWA 1QX2A 2M8UA 4Q04A 3WHTB 2JT3A 3I5HB 1NCZA 2JTTA 1IQ3A 1UHNA 2KGBC 3M0WA 2LP2A 1RJVA 4MRYA 1XFVO 1K94A 1KSOA 2I7AA 5HKZA 2LNKA 1B7TZ 3OB2B 2WNDA 3MSEB 4YRUA 3GK2A 1GQMA 2LHLA 1CDPA 1UHJA 2FCEA 3EK7A 4OV2A 4GAOA 3AKAA 2BCXA 1QVIZ 4WQ3A 1YX7A 5FYXA 4BY5A 1PK0D 1AJ4A 5CSJA 3WXAA 1A03A 1F54A 1CM4A 1UUSA 4MRXA 1YVLA 2RGIA 5AEQA 1KK8C 4E68A 1YTZC 3EVVA 1EH2A 4P2YB 2K7OA 1SCVA 3OX5A 1DVIA 1RECA 3I5IB 3RLZA 1SL7A 3KO0A 1Y1AA 1RK9A 4YI9A 1J55A 3NXAA 1XK4C 2H61C 2M1KB 1CDLA 4YGCB 1ALVA 1MXLC 2K2FA 3DD4A 4CPVA 4UPGA 4PHMA 1K9UA 1S5GZ 4MN0A 1JFJA 1LVCD 1C7VA 1WRLA 2KDHA 1NX2A 3AKBA 3VRQA 2AAOA 1RWYA 4WQ2A 1KFXL 1KSMA 3PN7B 1NYAA 3ZWHA 4F0ZB 4N1GA 2SASA 2MRDA 1TRFA 1R2UA 4C0LA 2KBIA 1ALWA 2WCFA 1TOPA 1SKTA 1IGVA 3FWCA 4N1FA 4ORCB 1Y1UA 1CMFA 1J7RA 2LM5A 4PE1A 1JFKA 2EC6B 2OTGC 2Y1MA 3LK0A 1TN4A 3PATA 2LVVA 4R1EA 2CXJA 2B1UA 3A8RA 2K7BA 1A4PA 1QASA 2M0RA 4OVNF 4P5OE 4YBHB 1FW4A 5HKYA 2LVKA 3CR2A 2MLEC 3PALA 1V1GA 2DOQA 1G33A 2GGMA 2BKIB 4MLWA 4MSPA 1TTXA 3EK4A 5HLVA 1XK4A 5I2LA 1BODA 3EVUA 1NSHA 1KFXS 2K61A 4ZCVA 1N0YA 4TNCA 1SBJA 4PDZA 4HRHA 1WDCC 5CSIA 1BR1B 3KHEA 1F8HA 2V53A 1QV1A 1DF0A 1U5IA 2KFFA 4YGBB 5I2OA 2KI4B 1TIZA 5AANA 2WORA 1M39A 1WY9A 3BUMB 1AJ5A 2JOJA 1JBAA 1K95A 1S6CA 4MZJA 1AP4A 2JC2A 3I5HC 3LL8B 1KWOB 2KGRA 2CNPA 3IQOA 5BPJA 1HQVA 3O2PA 2Q91A 1SCMB 2PALA 5KSZA 1KFUS 3IF7A 1MF8B 2LMTA 2L51A 3BYAA 1CMGA 1OOJA 2PMYA 2L4IA 1IJ6A 1S6IA 1DTLA 1YR5A 1BJFA 4NQGA 1YRTB 4AQJA 3WNXB 3TUYB 3HCMA 4ORBB 1KK7Z 4PHKA 2JU0A 2F3YA 1J7OA 2LP3A 2K7DA 1CTRA 3BQ3A 1YRUB 2ZN8A 5HYDA 1OZSA 2KAYA 3EKHA 1NP8A 2FOTA 2JULA 1DJIA 1YUSA 1JUOA 2NCPA 1NX3A 1JF2A 3EK8A 3JVTC 4PHJA 3DVMA 1TNQA 3TS5C 1G4YR 2M9GA 1GJYA 3SG3A 3VGOA 2M7LA 1SY9A 2I94A 3I5IC 1CKKA 1SNLA 3GOFA 3H4SE 3NSOA 4JWQA 2LHIA 1ZUZA 5DKRA 1BLQA 1OMDA 2LE9B 4OCIA 1OMVA 1F55A 1NPQA 1C07A 1PRWA 1ZACA 1NCYA 1S5GY 1SPYA 3CS1A 5D69A 3SG2A 2LVJA 1UHHA 5TNCA 3TDUA 1M46A 2JNXA 5AXIA 1EL4A 3JTDB 1PALA 1SMGA 2BL0B 2KFHA 1XA5A 1AK8A 4D1EA 2WCBA 2KFGA 3O4YA 1VRKA 1XFXO 1IG5A 1UP5A 1S1EA 1TCOB 3DF0A 3LCPC 4NDDA 1XFUO 2PRUA 2KSPA 3CGAA 3CTNA 1ZMZA 2HF5A 2JXLA 1K90D 1SR6B 3VROA 4L9MA 4DUQA 4GNKB 3CZTX 3E3RA 1QV0A 1WLZA 2Q4UA 3OX6A 3PSRA 2LLUA 2PSRA 4ORAB 1MR8A 2BBMA 2KI6C 3CR4X 2AMIA 1DJYA 1B8LA 5JOLA 1A75B 4NDCA 1KCYA 2L50A 2LMVA 4PCWA 3SG5A 1CLBA 1Y0VH 3FIAA 5CSFA 1F70A 4QJ3B 4CFQA 2MBXA 3SJSA 2JTZA 1WLMA 1SYMA 2K0JA 2M3WA 4GGFA 4YI8A 3GK1A 1KQVA 4A4CA 3CWGA 1D1OA 2F2OA 3DVJA 2ZNDA 5D7FA 3NSIA 1IKUA 1PSBA 1OE9B 4GGNA 2E6WA 2KI4C 3I5FC 3WHUB 5F6TA 4PE7A 5IBWA 1QLSA 3A4UB 1MXEA 1IQ5A 1BT6A 5I2QA 3F45A 1UURA 2Y5IA 1B8RA 4DCKA 2ZFDA 2ISDA 1KWOC 1B1GA 4M2PA 2PVBA 3D10A 2L98A 1MQ1A 1SCMC 2IS9A 2NZ0A 4I5LB 2KAVA 4DIRA 2R2IA 2LVIA 2ZN9A 1KQMC 2WOSA 1FI6A 1KFUL 2BECA 1TNXA 4XJKB 2L0PA 4PHNA 1AVSA 1XYDA 1KK8B 3VRRA 4GUKA 1S36A 5ER5A 3IQQA 3TUYC 1KK7Y 4MZLA 1NWDA 3C1VA 4I5KA 1NIWA
chains in the Genus database with same CATH superfamily
1GGWA 2I18A 2LCPA 2H2KA 2LAPA 1BMOA 2KYFA 1B47A 1QX5B 3AAJA 1M63B 3QMEA 1K93D 4A4BA 2OS8C 1B8CA 1X02A 2WCJA 1C7WA 2CTNA 2KAXA 1BOCA 2BKHB 3GK4X 1DEKA 3EVRA 4AOMA 2F8PA 2LV7A 3UO9A 1CLLA 5J3XA 3FS7A 1NX0A 4CIDA 1YVHA 1BR4B 4MEWA 1YURA 3D78A 3KPXA 3S0DA 4BY4A 2I2RE 1QJTA 2Y1NA 2M49B 5HL1A 1EG3A 1XFWO 4FTGA 1PULA 3B86A 1H4BA 3TZ1A 2MAZA 2MLFC 2LANA 3AAKA 1E8AA 3D0YB 1G8IA 3FE9A 5KTYA 1LINA 1N65A 4YGAA 3S0GA 2BBNA 3O4XA 4NDBA 4C0KA 2BE4A 3KF9A 1IIOA 3JTDC 1DJHA 1Y6WA 3BOWB 2ZRTA 1CM1A 1LA3A 1MHOA 2ZRSA 1DGVA 2AUCA 2E30A 5CPVA 5AERA 2TN4A 2HPSA 1J7QA 1RTP1 4AQIA 1SR6C 1DGUA 1TUJA 1L2OB 2L5YA 2MHHA 2NXQA 1W7JB 3KEVA 4QJ4B 1S3PA 2JT8A 2KQYA 3R72A 1CB1A 1IWQA 5HKYA 2FCDA 5KU1A 3LLEA 2FJUB 2WCHA 4C0JA 1ORGA 1K8UA 1XFYO 1MWNA 3CLNA 5GQQC 1OZOA 3BXKA 4FQOA 2ZNEA 2SCPA 2JPTA 2JRFA 3BUWB 1MUXA 2LMUA 4GPLB 1N2DA 3LK1A 4GGFC 5I94A 1EG4A 4GFTA 2KNEA 3IVTA 1CLMA 1YUTA 1OOIX 1EJ3A 2A4JA 4OR9B 3VRPA 4JQ0D 5AFPA 4GBAA 3PN7C 1Y1XA 5DKNA 5ER4X 3K21A 5DKQA 2JT0A 3L4LA 1QS7A 3HX4A 4JPZB 1PSRA 1JWDA 4PE0A 1JC2A 2F2PA 2CBLA 3BFAA 2KI6D 1J7PA 1QX7A 2NCOA 1QXPA 2M97A 2O60A 3NHTA 2EC6C 1F4OA 3D74A 1LA0A 4CFRA 1CDNA 3OHMB 3CDNA 2KLDA 2VRGA 1F71A 1V1FA 2KOTA 4CLNA 1FI5A 3DF0B 2WCEA 5CSNA 2LLSA 1J1DA 4DS7A 2Y4QA 3I5GB 1A75A 3EKJA 1BU3A 1S26D 2K2AA 4M2OA 3ZNIA 5G08A 3JVTB 3DVEA 4USLA 1UHIA 2L2EA 4HREE 3OP0A 4I5NB 3TS5B 1BG1A 1P28A 1UHKA 2MJWB 1NCXA 1AUIB 3VRNA 5PALA 1H8BA 2M1UA 1W9ZA 3NHIA 3EG5B 4ZCUA 3NSKA 1DJXA 4PE4A 2O5GA 1QATA 1L7ZA 4YGDB 1OQPA 1OOFA 1TNPA 4F7FA 1DMOA 1LXFC 1QLKA 1NX1A 4HSZA 3BUXB 3DY9A 1IH0A 4PALA 1XVJA 2JNFA 4QJ5B 2JZIA 5K89A 3RM1A 3D77A 3VB1A 2PYQA 2ZKMX 1K9KA 4ETOA 1OSAA 3TDIA 1BF5A 2F3ZA 3SG4A 2WCKA 4M2QA 2BE6A 1M45A 1A29A 3O6BA 3SS4A 2KBMA 2KYCA 4MVFA 3ICBA 5D3OA 1K9PA 1C3ZA 1QIWA 1PVBA 2D8NA 4U8DA 3PM2A 1OOGA 1DELA 1UWOA 2OPOA 1A2XA 1B4CA 2QACA 3O78A 4XYNA 4XJKA 4N5XA 1SK6D 2CT9A 4I5JA 1CFDA 5HKWA 3SS5A 1OW4A 3V2LA 5I8NA 1TCFA 1YUUA 2CCMA 1NUBA 2JQ6A 1CNPA 1SL9A 3OB1B 3QRXA 5B8IB 1EXRA 2GGZA 2QEHA 1K2HA 3FWBA 1SRAA 3SG7A 1DJWA 3CR5X 1JSAA 3NGVA 4YGEB 2H61A 1JF0A 1L2OC 2COLB 3BUNB 4HRGA 1PVAA 3NSLA 1RROA 3PLFB 1CFFA 1M31A 2L4HA 2KQ6A 1TWOA 1QTXA 3BUOB 4ICBA 3SIAA 1CFPA 1DF0B 1U5IB 1XFZO 3SIBA 1HT9A 2P70A 1FF1A 1Z4HA 4MBEA 2GV5A 1B9AA 3DVKA 1IRJA 1FPWA 4KYNA 1AHRA 1ODBA 2BAPA 4INWA 3D75A 3I5FB 3R1VA 2OTGB 2KHNA 2BCAA 2PASA 1WRZA 2HQ8A 2LUCA 3R1OA 4WRIA 2BL0C 2WC8A 3D0YA 1SW8A 1FBVA 2LC5A 1QIVA 1SL8A 2JXCA 1W7IB 2K8MB 3PFVA 2HETA 2P6BB 2JWWA 2M29A 2NLNA 1DT7B 1SSEB 5JJGA 3PM8A 1OMRA 2LUXA 3BOWA 2K7CA 1CFCA 1J1EA 2L5XB 1XO5A 1KQMB 1B7TY 1YX8A 2BCBA 1DJGA 4MZKA 2EGDA 1F4QA 2QPTA 2BNXA 4OKHA 1GM0A 3BFHA 3TDZA 1WRKA 1Q80A 3DXLA 1IJ5A 1CDMA 2EHBA 2M7NA 1LKJA 1K96A 1WDCB 1R6PA 2HQWA 4DRWA 3FE6A 2MA2A 1ZOTB 1QVIY 2LLTA 3I5GC 1GGZA 1DJZA 1ZFSA 2F33A 4IL1A 2OS8B 2G2BA 3SG6A 1RFJA 5HLOA 1S6JA 2G9BA 1TNWA 1XFRA 1QX2A 2M8UA 2WCLA 4Q04A 2JT3A 3I5HB 1NCZA 2JTTA 3WHTB 1IQ3A 1UHNA 2KGBC 3M0WA 2LP2A 1RJVA 2WC5A 4MRYA 1XFVO 1K94A 1KSOA 2I7AA 5HKZA 2LNKA 1B7TZ 3OB2B 2WNDA 3MSEB 3B88A 4YRUA 3GK2A 1GQMA 3CZ0A 2LHLA 2GTEA 1CDPA 1UHJA 2FCEA 3EK7A 4OV2A 2L2CA 4GAOA 3AKAA 3BJHA 3S0EA 2BCXA 1QVIZ 4WQ3A 1YX7A 5FYXA 4BY5A 1PK0D 1AJ4A 5CSJA 3WXAA 1A03A 1F54A 1CM4A 3S0AA 1UUSA 4MRXA 1YVLA 2RGIA 5AEQA 1KK8C 4E68A 1YTZC 3FE8A 3EVVA 2KPHA 1EH2A 3CZ2A 2K7OA 4P2YB 1SCVA 3OX5A 1DVIA 1RECA 3I5IB 3Q8IA 3RLZA 1SL7A 3B7AA 3KO0A 3D76A 1Y1AA 1RK9A 4YI9A 1LS8A 1J55A 3NXAA 1XK4C 2H61C 2M1KB 1CDLA 4YGCB 1ALVA 1MXLC 2K2FA 3DD4A 4CPVA 4UPGA 4PHMA 1K9UA 1S5GZ 4MN0A 1JFJA 3CZ1A 1LVCD 1C7VA 1WRLA 2KDHA 1NX2A 3AKBA 3VRQA 2AAOA 1RWYA 4WQ2A 1KFXL 1KSMA 3PN7B 1NYAA 3ZWHA 4F0ZB 4N1GA 2SASA 1TUZA 2MRDA 1TRFA 1R2UA 4C0LA 2KBIA 1ALWA 2WCFA 1TOPA 1SKTA 1IGVA 3FWCA 3K1EA 2QEOA 4N1FA 4ORCB 1Y1UA 2WC6A 1CMFA 1J7RA 2LM5A 4PE1A 1JFKA 2EC6B 2OTGC 2Y1MA 3LK0A 1TN4A 2JPOA 3PATA 3D73A 2LVVA 4R1EA 2CXJA 2B1UA 3A8RA 2K7BA 1A4PA 1QASA 2M0RA 3CABA 4OVNF 4P5OE 1FW4A 4YBHB 1T14A 2LVKA 3CR2A 1DC1A 3RZSA 2MLEC 3PALA 1V1GA 2DOQA 1G33A 2GGMA 2BKIB 4MLWA 4MSPA 1TTXA 3EK4A 5HLVA 1XK4A 5I2LA 3B87A 1BODA 5EL2A 3EVUA 1NSHA 1KFXS 2K61A 4ZCVA 1N0YA 3PJIA 4TNCA 1SBJA 4PDZA 4HRHA 1WDCC 5CSIA 1BR1B 3KHEA 1F8HA 2V53A 1QV1A 3DZTA 3N7HA 1DF0A 1U5IA 2FJYA 2KFFA 4YGBB 5I2OA 2KI4B 1TIZA 5AANA 2WORA 1M39A 1WY9A 3BUMB 1AJ5A 2JOJA 1JBAA 1K95A 4OZDA 1S6CA 4IJ7A 4MZJA 1AP4A 2JC2A 3I5HC 3LL8B 1KWOB 2KGRA 2CNPA 3IQOA 5BPJA 1HQVA 3O2PA 2Q91A 1SCMB 2PALA 5KSZA 1KFUS 3IF7A 1MF8B 2LMTA 2L51A 3B6XA 3BYAA 1CMGA 1OOJA 2PMYA 2L4IA 1IJ6A 1S6IA 1DTLA 1YR5A 1BJFA 4NQGA 1YRTB 4AQJA 2ERBA 3WNXB 3TUYB 3HCMA 4ORBB 1KK7Z 1DQEA 4PHKA 2JU0A 2F3YA 1J7OA 2LP3A 2K7DA 1CTRA 2P71A 2QEVA 3BQ3A 1YRUB 2ZN8A 5HYDA 1OZSA 2KAYA 3EKHA 1NP8A 2FOTA 2JULA 1DJIA 1YUSA 1JUOA 2NCPA 2KLEA 1NX3A 3SS3A 1JF2A 3EK8A 3JVTC 4JD9A 3DVMA 4PHJA 1TNQA 3TS5C 1G4YR 2M9GA 1GJYA 3SG3A 3VGOA 2M7LA 1SY9A 2I94A 3I5IC 1CKKA 1SNLA 3GOFA 3H4SE 3NSOA 3R1PA 2LHIA 1QWVA 4JWQA 1ZUZA 5DKRA 1BLQA 3S0FA 3L47A 1OMDA 2LE9B 5FI2A 3OBVA 4OCIA 1OMVA 4PT1A 5FI6A 1F55A 1NPQA 1C07A 1PRWA 1ZACA 1NCYA 1S5GY 1SPYA 3CS1A 5D69A 3SG2A 2WCMA 2LVJA 1UHHA 5TNCA 3TDUA 1M46A 2JNXA 5AXIA 1EL4A 3JTDB 1PALA 1SMGA 2BL0B 2KFHA 1XA5A 1AK8A 4D1EA 2WCBA 2KFGA 3O4YA 1VRKA 1XFXO 1IG5A 1UP5A 1S1EA 1TCOB 3DF0A 3LCPC 3S0BA 2K60A 3L4AA 1XFUO 4NDDA 2PRUA 2KSPA 3CGAA 3CTNA 2QEBA 1ZMZA 2HF5A 2JXLA 1K90D 1SR6B 3VROA 2QDIA 4L9MA 4DUQA 4GNKB 3CZTX 4JKTA 3E3RA 5FI7A 1QV0A 1WLZA 2Q4UA 3OX6A 3PSRA 2LLUA 2PSRA 4ORAB 1MR8A 2BBMA 2KI6C 3CR4X 2AMIA 1DJYA 1B8LA 5JOLA 1A75B 3CYZA 4NDCA 1KCYA 2L50A 3OGNA 2LMVA 4PCWA 1Z2CB 3SG5A 1CLBA 1Y0VH 3FIAA 5CSFA 1F70A 4QJ3B 4CFQA 2MBXA 3SJSA 3BFBA 2JTZA 1WLMA 2H8VA 1C3YA 1SYMA 2K0JA 2M3WA 4GGFA 4YI8A 3GK1A 5DICA 1KQVA 4A4CA 3CWGA 1D1OA 2F2OA 3DVJA 2ZNDA 5D7FA 3NSIA 1IKUA 1PSBA 1OE9B 1OOHA 2E6WA 2KI4C 3I5FC 4GGNA 5F6TA 3WHUB 4PE7A 3UNWA 5IBWA 1QLSA 3A4UB 1MXEA 1IQ5A 1BT6A 5I2QA 3F45A 1UURA 2Y5IA 1B8RA 4DCKA 2ZFDA 2ISDA 1KWOC 1B1GA 4M2PA 2PQLA 2PVBA 3D10A 2L98A 1MQ1A 1SCMC 2IS9A 2NZ0A 3DYEA 2KAVA 4I5LB 4INXA 2YGUA 4DIRA 2R2IA 2LVIA 2ZN9A 1KQMC 2WOSA 1FI6A 1KFUL 2BECA 1TNXA 4XJKB 2L0PA 4PHNA 1AVSA 1XYDA 1KK8B 3VRRA 4GUKA 1S36A 5ER5A 3IQQA 4FQTA 3TUYC 1KK7Y 4MZLA 1NWDA 3C1VA 4I5KA 1NIWA
chains in the Genus database with same CATH topology
1GGWA 2I18A 2LCPA 2H2KA 2LAPA 1BMOA 2KYFA 1B47A 1QX5B 3AAJA 1M63B 1K93D 4A4BA 2OS8C 1B8CA 1X02A 1BOCA 1C7WA 2CTNA 2KAXA 2BKHB 3GK4X 3EVRA 4AOMA 2F8PA 2LV7A 1CLLA 5J3XA 3FS7A 1NX0A 4CIDA 1YVHA 1BR4B 4MEWA 1YURA 3KPXA 4BY4A 2I2RE 1QJTA 2Y1NA 2M49B 1EG3A 1XFWO 4FTGA 1PULA 1H4BA 3TZ1A 2MAZA 2MLFC 2LANA 3AAKA 1E8AA 3D0YB 1G8IA 5KTYA 1LINA 1N65A 4YGAA 2BBNA 4C0KA 4NDBA 2BE4A 3KF9A 3JTDC 1DJHA 1Y6WA 3BOWB 2ZRTA 1CM1A 1LA3A 1MHOA 2ZRSA 1DGVA 2AUCA 2E30A 5CPVA 5AERA 2TN4A 2HPSA 1J7QA 1RTP1 4AQIA 1SR6C 1DGUA 2MHHA 1L2OB 4QJ4B 2NXQA 1W7JB 3KEVA 1S3PA 2JT8A 2KQYA 1CB1A 1IWQA 5KU1A 2FCDA 3LLEA 2FJUB 4C0JA 1K8UA 1XFYO 1MWNA 3CLNA 5GQQC 1OZOA 3BXKA 4FQOA 2ZNEA 2SCPA 2JPTA 2JRFA 3BUWB 1MUXA 2LMUA 4GPLB 1N2DA 3LK1A 4GGFC 1EG4A 4GFTA 2KNEA 1CLMA 1YUTA 1EJ3A 2A4JA 4OR9B 3VRPA 4JQ0D 5AFPA 4GBAA 3PN7C 1Y1XA 5DKNA 5ER4X 3K21A 5DKQA 2JT0A 1QS7A 3HX4A 4JPZB 1PSRA 1JWDA 4PE0A 1JC2A 2F2PA 2CBLA 2KI6D 1J7PA 1QX7A 2NCOA 1QXPA 2M97A 2O60A 2EC6C 1F4OA 1LA0A 4CFRA 1CDNA 3OHMB 1F71A 2VRGA 1V1FA 2KOTA 4CLNA 1FI5A 3DF0B 2WCEA 5CSNA 2LLSA 1J1DA 4DS7A 2Y4QA 3I5GB 1A75A 3EKJA 1BU3A 1S26D 2K2AA 4M2OA 3ZNIA 5G08A 3JVTB 3DVEA 4USLA 1UHIA 2L2EA 4HREE 3OP0A 4I5NB 3TS5B 1BG1A 1H8BA 1UHKA 2MJWB 1NCXA 1AUIB 3VRNA 5PALA 2M1UA 4ZCUA 3NSKA 1DJXA 4PE4A 2O5GA 1QATA 1L7ZA 4YGDB 1OQPA 1TNPA 1DMOA 1LXFC 1QLKA 1NX1A 4HSZA 3BUXB 1IH0A 4PALA 1XVJA 2JNFA 4QJ5B 2JZIA 5K89A 3RM1A 2ZKMX 1K9KA 4ETOA 1OSAA 3TDIA 1BF5A 2F3ZA 3SG4A 4M2QA 2BE6A 1M45A 1A29A 3O6BA 2KBMA 2KYCA 4MVFA 3ICBA 1K9PA 1QIWA 1PVBA 2D8NA 4U8DA 1UWOA 2OPOA 1A2XA 1B4CA 2QACA 3O78A 4XYNA 4XJKA 4N5XA 1SK6D 2CT9A 4I5JA 1CFDA 5HKWA 5I8NA 1TCFA 1YUUA 2CCMA 1NUBA 2JQ6A 1CNPA 1SL9A 3OB1B 3QRXA 5B8IB 1EXRA 2GGZA 1K2HA 3FWBA 1SRAA 3SG7A 1DJWA 3CR5X 1JSAA 4YGEB 2H61A 2COLB 1JF0A 1L2OC 3BUNB 4HRGA 1PVAA 3NSLA 1RROA 3PLFB 1CFFA 1M31A 2L4HA 2KQ6A 3BUOB 1QTXA 4ICBA 3SIAA 1CFPA 1DF0B 1U5IB 1XFZO 3SIBA 1HT9A 1FF1A 4MBEA 2GV5A 1B9AA 3DVKA 1IRJA 1FPWA 1AHRA 1ODBA 3I5FB 2OTGB 2KHNA 2BCAA 2PASA 1WRZA 2HQ8A 2LUCA 4WRIA 2BL0C 2WC8A 3D0YA 1SW8A 1FBVA 2LC5A 1QIVA 1SL8A 2JXCA 1W7IB 2K8MB 3PFVA 2HETA 2P6BB 2JWWA 2M29A 2NLNA 1DT7B 5JJGA 3PM8A 1OMRA 2LUXA 3BOWA 2K7CA 1CFCA 1J1EA 2L5XB 1XO5A 1KQMB 1B7TY 1YX8A 2BCBA 1DJGA 4MZKA 2EGDA 1F4QA 2QPTA 4OKHA 3TDZA 1WRKA 1Q80A 1IJ5A 1CDMA 2EHBA 2M7NA 1LKJA 1K96A 1WDCB 1R6PA 2HQWA 4DRWA 2MA2A 1ZOTB 1QVIY 2LLTA 3I5GC 1GGZA 1DJZA 1ZFSA 2F33A 4IL1A 2OS8B 2G2BA 3SG6A 1RFJA 5HLOA 1S6JA 2G9BA 1TNWA 1QX2A 2M8UA 4Q04A 3WHTB 2JT3A 3I5HB 1NCZA 2JTTA 1IQ3A 1UHNA 2KGBC 3M0WA 2LP2A 1RJVA 4MRYA 1XFVO 1K94A 1KSOA 2I7AA 5HKZA 2LNKA 1B7TZ 3OB2B 2WNDA 3MSEB 4YRUA 3GK2A 1GQMA 2LHLA 1CDPA 1UHJA 2FCEA 3EK7A 4OV2A 4GAOA 3AKAA 2BCXA 1QVIZ 4WQ3A 1YX7A 5FYXA 4BY5A 1PK0D 1AJ4A 5CSJA 3WXAA 1A03A 1F54A 1CM4A 1UUSA 4MRXA 1YVLA 2RGIA 5AEQA 1KK8C 4E68A 1YTZC 3EVVA 1EH2A 4P2YB 2K7OA 1SCVA 3OX5A 1DVIA 1RECA 3I5IB 3RLZA 1SL7A 3KO0A 1Y1AA 1RK9A 4YI9A 1J55A 3NXAA 1XK4C 2H61C 2M1KB 1CDLA 4YGCB 1ALVA 1MXLC 2K2FA 3DD4A 4CPVA 4UPGA 4PHMA 1K9UA 1S5GZ 4MN0A 1JFJA 1LVCD 1C7VA 1WRLA 2KDHA 1NX2A 3AKBA 3VRQA 2AAOA 1RWYA 4WQ2A 1KFXL 1KSMA 3PN7B 1NYAA 3ZWHA 4F0ZB 4N1GA 2SASA 2MRDA 1TRFA 1R2UA 4C0LA 2KBIA 1ALWA 2WCFA 1TOPA 1SKTA 1IGVA 3FWCA 4N1FA 4ORCB 1Y1UA 1CMFA 1J7RA 2LM5A 4PE1A 1JFKA 2EC6B 2OTGC 2Y1MA 3LK0A 1TN4A 3PATA 2LVVA 4R1EA 2CXJA 2B1UA 3A8RA 2K7BA 1A4PA 1QASA 2M0RA 4OVNF 4P5OE 4YBHB 1FW4A 5HKYA 2LVKA 3CR2A 2MLEC 3PALA 1V1GA 2DOQA 1G33A 2GGMA 2BKIB 4MLWA 4MSPA 1TTXA 3EK4A 5HLVA 1XK4A 5I2LA 1BODA 3EVUA 1NSHA 1KFXS 2K61A 4ZCVA 1N0YA 4TNCA 1SBJA 4PDZA 4HRHA 1WDCC 5CSIA 1BR1B 3KHEA 1F8HA 2V53A 1QV1A 1DF0A 1U5IA 2KFFA 4YGBB 5I2OA 2KI4B 1TIZA 5AANA 2WORA 1M39A 1WY9A 3BUMB 1AJ5A 2JOJA 1JBAA 1K95A 1S6CA 4MZJA 1AP4A 2JC2A 3I5HC 3LL8B 1KWOB 2KGRA 2CNPA 3IQOA 5BPJA 1HQVA 3O2PA 2Q91A 1SCMB 2PALA 5KSZA 1KFUS 3IF7A 1MF8B 2LMTA 2L51A 3BYAA 1CMGA 1OOJA 2PMYA 2L4IA 1IJ6A 1S6IA 1DTLA 1YR5A 1BJFA 4NQGA 1YRTB 4AQJA 3WNXB 3TUYB 3HCMA 4ORBB 1KK7Z 4PHKA 2JU0A 2F3YA 1J7OA 2LP3A 2K7DA 1CTRA 3BQ3A 1YRUB 2ZN8A 5HYDA 1OZSA 2KAYA 3EKHA 1NP8A 2FOTA 2JULA 1DJIA 1YUSA 1JUOA 2NCPA 1NX3A 1JF2A 3EK8A 3JVTC 4PHJA 3DVMA 1TNQA 3TS5C 1G4YR 2M9GA 1GJYA 3SG3A 3VGOA 2M7LA 1SY9A 2I94A 3I5IC 1CKKA 1SNLA 3GOFA 3H4SE 3NSOA 4JWQA 2LHIA 1ZUZA 5DKRA 1BLQA 1OMDA 2LE9B 4OCIA 1OMVA 1F55A 1NPQA 1C07A 1PRWA 1ZACA 1NCYA 1S5GY 1SPYA 3CS1A 5D69A 3SG2A 2LVJA 1UHHA 5TNCA 3TDUA 1M46A 2JNXA 5AXIA 1EL4A 3JTDB 1PALA 1SMGA 2BL0B 2KFHA 1XA5A 1AK8A 4D1EA 2WCBA 2KFGA 3O4YA 1VRKA 1XFXO 1IG5A 1UP5A 1S1EA 1TCOB 3DF0A 3LCPC 4NDDA 1XFUO 2PRUA 2KSPA 3CGAA 3CTNA 1ZMZA 2HF5A 2JXLA 1K90D 1SR6B 3VROA 4L9MA 4DUQA 4GNKB 3CZTX 3E3RA 1QV0A 1WLZA 2Q4UA 3OX6A 3PSRA 2LLUA 2PSRA 4ORAB 1MR8A 2BBMA 2KI6C 3CR4X 2AMIA 1DJYA 1B8LA 5JOLA 1A75B 4NDCA 1KCYA 2L50A 2LMVA 4PCWA 3SG5A 1CLBA 1Y0VH 3FIAA 5CSFA 1F70A 4QJ3B 4CFQA 2MBXA 3SJSA 2JTZA 1WLMA 1SYMA 2K0JA 2M3WA 4GGFA 4YI8A 3GK1A 1KQVA 4A4CA 3CWGA 1D1OA 2F2OA 3DVJA 2ZNDA 5D7FA 3NSIA 1IKUA 1PSBA 1OE9B 4GGNA 2E6WA 2KI4C 3I5FC 3WHUB 5F6TA 4PE7A 5IBWA 1QLSA 3A4UB 1MXEA 1IQ5A 1BT6A 5I2QA 3F45A 1UURA 2Y5IA 1B8RA 4DCKA 2ZFDA 2ISDA 1KWOC 1B1GA 4M2PA 2PVBA 3D10A 2L98A 1MQ1A 1SCMC 2IS9A 2NZ0A 4I5LB 2KAVA 4DIRA 2R2IA 2LVIA 2ZN9A 1KQMC 2WOSA 1FI6A 1KFUL 2BECA 1TNXA 4XJKB 2L0PA 4PHNA 1AVSA 1XYDA 1KK8B 3VRRA 4GUKA 1S36A 5ER5A 3IQQA 3TUYC 1KK7Y 4MZLA 1NWDA 3C1VA 4I5KA 1NIWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GGW A;  2I18 A;  2LCP A;  2H2K A;  2LAP A;  1BMO A;  2KYF A;  1B47 A;  1QX5 B;  3AAJ A;  1M63 B;  1K93 D;  4A4B A;  2OS8 C;  1B8C A;  1X02 A;  1BOC A;  1C7W A;  2CTN A;  2KAX A;  2BKH B;  3GK4 X;  3EVR A;  4AOM A;  2F8P A;  2LV7 A;  1CLL A;  5J3X A;  3FS7 A;  1NX0 A;  4CID A;  1YVH A;  1BR4 B;  4MEW A;  1YUR A;  3KPX A;  4BY4 A;  2I2R E;  1QJT A;  2Y1N A;  2M49 B;  1EG3 A;  1XFW O;  4FTG A;  1PUL A;  1H4B A;  3TZ1 A;  2MAZ A;  2MLF C;  2LAN A;  3AAK A;  1E8A A;  3D0Y B;  1G8I A;  5KTY A;  1LIN A;  1N65 A;  4YGA A;  2BBN A;  4C0K A;  4NDB A;  2BE4 A;  3KF9 A;  3JTD C;  1DJH A;  1Y6W A;  3BOW B;  2ZRT A;  1CM1 A;  1LA3 A;  1MHO A;  2ZRS A;  1DGV A;  2AUC A;  2E30 A;  5CPV A;  5AER A;  2TN4 A;  2HPS A;  1J7Q A;  1RTP 1;  4AQI A;  1SR6 C;  1DGU A;  2MHH A;  1L2O B;  4QJ4 B;  2NXQ A;  1W7J B;  3KEV A;  1S3P A;  2JT8 A;  2KQY A;  1CB1 A;  1IWQ A;  5KU1 A;  2FCD A;  3LLE A;  2FJU B;  4C0J A;  1K8U A;  1XFY O;  1MWN A;  3CLN A;  5GQQ C;  1OZO A;  3BXK A;  4FQO A;  2ZNE A;  2SCP A;  2JPT A;  2JRF A;  3BUW B;  1MUX A;  2LMU A;  4GPL B;  1N2D A;  3LK1 A;  4GGF C;  1EG4 A;  4GFT A;  2KNE A;  1CLM A;  1YUT A;  1EJ3 A;  2A4J A;  4OR9 B;  3VRP A;  4JQ0 D;  5AFP A;  4GBA A;  3PN7 C;  1Y1X A;  5DKN A;  5ER4 X;  3K21 A;  5DKQ A;  2JT0 A;  1QS7 A;  3HX4 A;  4JPZ B;  1PSR A;  1JWD A;  4PE0 A;  1JC2 A;  2F2P A;  2CBL A;  2KI6 D;  1J7P A;  1QX7 A;  2NCO A;  1QXP A;  2M97 A;  2O60 A;  2EC6 C;  1F4O A;  1LA0 A;  4CFR A;  1CDN A;  3OHM B;  1F71 A;  2VRG A;  1V1F A;  2KOT A;  4CLN A;  1FI5 A;  3DF0 B;  2WCE A;  5CSN A;  2LLS A;  1J1D A;  4DS7 A;  2Y4Q A;  3I5G B;  1A75 A;  3EKJ A;  1BU3 A;  1S26 D;  2K2A A;  4M2O A;  3ZNI A;  5G08 A;  3JVT B;  3DVE A;  4USL A;  1UHI A;  2L2E A;  4HRE E;  3OP0 A;  4I5N B;  3TS5 B;  1BG1 A;  1H8B A;  1UHK A;  2MJW B;  1NCX A;  1AUI B;  3VRN A;  5PAL A;  2M1U A;  4ZCU A;  3NSK A;  1DJX A;  4PE4 A;  2O5G A;  1QAT A;  1L7Z A;  4YGD B;  1OQP A;  1TNP A;  1DMO A;  1LXF C;  1QLK A;  1NX1 A;  4HSZ A;  3BUX B;  1IH0 A;  4PAL A;  1XVJ A;  2JNF A;  4QJ5 B;  2JZI A;  5K89 A;  3RM1 A;  2ZKM X;  1K9K A;  4ETO A;  1OSA A;  3TDI A;  1BF5 A;  2F3Z A;  3SG4 A;  4M2Q A;  2BE6 A;  1M45 A;  1A29 A;  3O6B A;  2KBM A;  2KYC A;  4MVF A;  3ICB A;  1K9P A;  1QIW A;  1PVB A;  2D8N A;  4U8D A;  1UWO A;  2OPO A;  1A2X A;  1B4C A;  2QAC A;  3O78 A;  4XYN A;  4XJK A;  4N5X A;  1SK6 D;  2CT9 A;  4I5J A;  1CFD A;  5HKW A;  5I8N A;  1TCF A;  1YUU A;  2CCM A;  1NUB A;  2JQ6 A;  1CNP A;  1SL9 A;  3OB1 B;  3QRX A;  5B8I B;  1EXR A;  2GGZ A;  1K2H A;  3FWB A;  1SRA A;  3SG7 A;  1DJW A;  3CR5 X;  1JSA A;  4YGE B;  2H61 A;  2COL B;  1JF0 A;  1L2O C;  3BUN B;  4HRG A;  1PVA A;  3NSL A;  1RRO A;  3PLF B;  1CFF A;  1M31 A;  2L4H A;  2KQ6 A;  3BUO B;  1QTX A;  4ICB A;  3SIA A;  1CFP A;  1DF0 B;  1U5I B;  1XFZ O;  3SIB A;  1HT9 A;  1FF1 A;  4MBE A;  2GV5 A;  1B9A A;  3DVK A;  1IRJ A;  1FPW A;  1AHR A;  1ODB A;  3I5F B;  2OTG B;  2KHN A;  2BCA A;  2PAS A;  1WRZ A;  2HQ8 A;  2LUC A;  4WRI A;  2BL0 C;  2WC8 A;  3D0Y A;  1SW8 A;  1FBV A;  2LC5 A;  1QIV A;  1SL8 A;  2JXC A;  1W7I B;  2K8M B;  3PFV A;  2HET A;  2P6B B;  2JWW A;  2M29 A;  2NLN A;  1DT7 B;  5JJG A;  3PM8 A;  1OMR A;  2LUX A;  3BOW A;  2K7C A;  1CFC A;  1J1E A;  2L5X B;  1XO5 A;  1KQM B;  1B7T Y;  1YX8 A;  2BCB A;  1DJG A;  4MZK A;  2EGD A;  1F4Q A;  2QPT A;  4OKH A;  3TDZ A;  1WRK A;  1Q80 A;  1IJ5 A;  1CDM A;  2EHB A;  2M7N A;  1LKJ A;  1K96 A;  1WDC B;  1R6P A;  2HQW A;  4DRW A;  2MA2 A;  1ZOT B;  1QVI Y;  2LLT A;  3I5G C;  1GGZ A;  1DJZ A;  1ZFS A;  2F33 A;  4IL1 A;  2OS8 B;  2G2B A;  3SG6 A;  1RFJ A;  5HLO A;  1S6J A;  2G9B A;  1TNW A;  1QX2 A;  2M8U A;  4Q04 A;  3WHT B;  2JT3 A;  3I5H B;  1NCZ A;  2JTT A;  1IQ3 A;  1UHN A;  2KGB C;  3M0W A;  2LP2 A;  1RJV A;  4MRY A;  1XFV O;  1K94 A;  1KSO A;  2I7A A;  5HKZ A;  2LNK A;  1B7T Z;  3OB2 B;  2WND A;  3MSE B;  4YRU A;  3GK2 A;  1GQM A;  2LHL A;  1CDP A;  1UHJ A;  2FCE A;  3EK7 A;  4OV2 A;  4GAO A;  3AKA A;  2BCX A;  1QVI Z;  4WQ3 A;  1YX7 A;  5FYX A;  4BY5 A;  1PK0 D;  1AJ4 A;  5CSJ A;  3WXA A;  1A03 A;  1F54 A;  1CM4 A;  1UUS A;  4MRX A;  1YVL A;  2RGI A;  5AEQ A;  1KK8 C;  4E68 A;  1YTZ C;  3EVV A;  1EH2 A;  4P2Y B;  2K7O A;  1SCV A;  3OX5 A;  1DVI A;  1REC A;  3I5I B;  3RLZ A;  1SL7 A;  3KO0 A;  1Y1A A;  1RK9 A;  4YI9 A;  1J55 A;  3NXA A;  1XK4 C;  2H61 C;  2M1K B;  1CDL A;  4YGC B;  1ALV A;  1MXL C;  2K2F A;  3DD4 A;  4CPV A;  4UPG A;  4PHM A;  1K9U A;  1S5G Z;  4MN0 A;  1JFJ A;  1LVC D;  1C7V A;  1WRL A;  2KDH A;  1NX2 A;  3AKB A;  3VRQ A;  2AAO A;  1RWY A;  4WQ2 A;  1KFX L;  1KSM A;  3PN7 B;  1NYA A;  3ZWH A;  4F0Z B;  4N1G A;  2SAS A;  2MRD A;  1TRF A;  1R2U A;  4C0L A;  2KBI A;  1ALW A;  2WCF A;  1TOP A;  1SKT A;  1IGV A;  3FWC A;  4N1F A;  4ORC B;  1Y1U A;  1CMF A;  1J7R A;  2LM5 A;  4PE1 A;  1JFK A;  2EC6 B;  2OTG C;  2Y1M A;  3LK0 A;  1TN4 A;  3PAT A;  2LVV A;  4R1E A;  2CXJ A;  2B1U A;  3A8R A;  2K7B A;  1A4P A;  1QAS A;  2M0R A;  4OVN F;  4P5O E;  4YBH B;  1FW4 A;  5HKY A;  2LVK A;  3CR2 A;  2MLE C;  3PAL A;  1V1G A;  2DOQ A;  1G33 A;  2GGM A;  2BKI B;  4MLW A;  4MSP A;  1TTX A;  3EK4 A;  5HLV A;  1XK4 A;  5I2L A;  1BOD A;  3EVU A;  1NSH A;  1KFX S;  2K61 A;  4ZCV A;  1N0Y A;  4TNC A;  1SBJ A;  4PDZ A;  4HRH A;  1WDC C;  5CSI A;  1BR1 B;  3KHE A;  1F8H A;  2V53 A;  1QV1 A;  1DF0 A;  1U5I A;  2KFF A;  4YGB B;  5I2O A;  2KI4 B;  1TIZ A;  5AAN A;  2WOR A;  1M39 A;  1WY9 A;  3BUM B;  1AJ5 A;  2JOJ A;  1JBA A;  1K95 A;  1S6C A;  4MZJ A;  1AP4 A;  2JC2 A;  3I5H C;  3LL8 B;  1KWO B;  2KGR A;  2CNP A;  3IQO A;  5BPJ A;  1HQV A;  3O2P A;  2Q91 A;  1SCM B;  2PAL A;  5KSZ A;  1KFU S;  3IF7 A;  1MF8 B;  2LMT A;  2L51 A;  3BYA A;  1CMG A;  1OOJ A;  2PMY A;  2L4I A;  1IJ6 A;  1S6I A;  1DTL A;  1YR5 A;  1BJF A;  4NQG A;  1YRT B;  4AQJ A;  3WNX B;  3TUY B;  3HCM A;  4ORB B;  1KK7 Z;  4PHK A;  2JU0 A;  2F3Y A;  1J7O A;  2LP3 A;  2K7D A;  1CTR A;  3BQ3 A;  1YRU B;  2ZN8 A;  5HYD A;  1OZS A;  2KAY A;  3EKH A;  1NP8 A;  2FOT A;  2JUL A;  1DJI A;  1YUS A;  1JUO A;  2NCP A;  1NX3 A;  1JF2 A;  3EK8 A;  3JVT C;  4PHJ A;  3DVM A;  1TNQ A;  3TS5 C;  1G4Y R;  2M9G A;  1GJY A;  3SG3 A;  3VGO A;  2M7L A;  1SY9 A;  2I94 A;  3I5I C;  1CKK A;  1SNL A;  3GOF A;  3H4S E;  3NSO A;  4JWQ A;  2LHI A;  1ZUZ A;  5DKR A;  1BLQ A;  1OMD A;  2LE9 B;  4OCI A;  1OMV A;  1F55 A;  1NPQ A;  1C07 A;  1PRW A;  1ZAC A;  1NCY A;  1S5G Y;  1SPY A;  3CS1 A;  5D69 A;  3SG2 A;  2LVJ A;  1UHH A;  5TNC A;  3TDU A;  1M46 A;  2JNX A;  5AXI A;  1EL4 A;  3JTD B;  1PAL A;  1SMG A;  2BL0 B;  2KFH A;  1XA5 A;  1AK8 A;  4D1E A;  2WCB A;  2KFG A;  3O4Y A;  1VRK A;  1XFX O;  1IG5 A;  1UP5 A;  1S1E A;  1TCO B;  3DF0 A;  3LCP C;  4NDD A;  1XFU O;  2PRU A;  2KSP A;  3CGA A;  3CTN A;  1ZMZ A;  2HF5 A;  2JXL A;  1K90 D;  1SR6 B;  3VRO A;  4L9M A;  4DUQ A;  4GNK B;  3CZT X;  3E3R A;  1QV0 A;  1WLZ A;  2Q4U A;  3OX6 A;  3PSR A;  2LLU A;  2PSR A;  4ORA B;  1MR8 A;  2BBM A;  2KI6 C;  3CR4 X;  2AMI A;  1DJY A;  1B8L A;  5JOL A;  1A75 B;  4NDC A;  1KCY A;  2L50 A;  2LMV A;  4PCW A;  3SG5 A;  1CLB A;  1Y0V H;  3FIA A;  5CSF A;  1F70 A;  4QJ3 B;  4CFQ A;  2MBX A;  3SJS A;  2JTZ A;  1WLM A;  1SYM A;  2K0J A;  2M3W A;  4GGF A;  4YI8 A;  3GK1 A;  1KQV A;  4A4C A;  3CWG A;  1D1O A;  2F2O A;  3DVJ A;  2ZND A;  5D7F A;  3NSI A;  1IKU A;  1PSB A;  1OE9 B;  4GGN A;  2E6W A;  2KI4 C;  3I5F C;  3WHU B;  5F6T A;  4PE7 A;  5IBW A;  1QLS A;  3A4U B;  1MXE A;  1IQ5 A;  1BT6 A;  5I2Q A;  3F45 A;  1UUR A;  2Y5I A;  1B8R A;  4DCK A;  2ZFD A;  2ISD A;  1KWO C;  1B1G A;  4M2P A;  2PVB A;  3D10 A;  2L98 A;  1MQ1 A;  1SCM C;  2IS9 A;  2NZ0 A;  4I5L B;  2KAV A;  4DIR A;  2R2I A;  2LVI A;  2ZN9 A;  1KQM C;  2WOS A;  1FI6 A;  1KFU L;  2BEC A;  1TNX A;  4XJK B;  2L0P A;  4PHN A;  1AVS A;  1XYD A;  1KK8 B;  3VRR A;  4GUK A;  1S36 A;  5ER5 A;  3IQQ A;  3TUY C;  1KK7 Y;  4MZL A;  1NWD A;  3C1V A;  4I5K A;  1NIW A; 
#chains in the Genus database with same CATH topology
 1GGW A;  2I18 A;  2LCP A;  2H2K A;  2LAP A;  1BMO A;  2KYF A;  1B47 A;  1QX5 B;  3AAJ A;  1M63 B;  3QME A;  1K93 D;  4A4B A;  2OS8 C;  1B8C A;  1X02 A;  2WCJ A;  1C7W A;  2CTN A;  2KAX A;  1BOC A;  2BKH B;  3GK4 X;  1DEK A;  3EVR A;  4AOM A;  2F8P A;  2LV7 A;  3UO9 A;  1CLL A;  5J3X A;  3FS7 A;  1NX0 A;  4CID A;  1YVH A;  1BR4 B;  4MEW A;  1YUR A;  3D78 A;  3KPX A;  3S0D A;  4BY4 A;  2I2R E;  1QJT A;  2Y1N A;  2M49 B;  5HL1 A;  1EG3 A;  1XFW O;  4FTG A;  1PUL A;  3B86 A;  1H4B A;  3TZ1 A;  2MAZ A;  2MLF C;  2LAN A;  3AAK A;  1E8A A;  3D0Y B;  1G8I A;  3FE9 A;  5KTY A;  1LIN A;  1N65 A;  4YGA A;  3S0G A;  2BBN A;  3O4X A;  4NDB A;  4C0K A;  2BE4 A;  3KF9 A;  1IIO A;  3JTD C;  1DJH A;  1Y6W A;  3BOW B;  2ZRT A;  1CM1 A;  1LA3 A;  1MHO A;  2ZRS A;  1DGV A;  2AUC A;  2E30 A;  5CPV A;  5AER A;  2TN4 A;  2HPS A;  1J7Q A;  1RTP 1;  4AQI A;  1SR6 C;  1DGU A;  1TUJ A;  1L2O B;  2L5Y A;  2MHH A;  2NXQ A;  1W7J B;  3KEV A;  4QJ4 B;  1S3P A;  2JT8 A;  2KQY A;  3R72 A;  1CB1 A;  1IWQ A;  5HKY A;  2FCD A;  5KU1 A;  3LLE A;  2FJU B;  2WCH A;  4C0J A;  1ORG A;  1K8U A;  1XFY O;  1MWN A;  3CLN A;  5GQQ C;  1OZO A;  3BXK A;  4FQO A;  2ZNE A;  2SCP A;  2JPT A;  2JRF A;  3BUW B;  1MUX A;  2LMU A;  4GPL B;  1N2D A;  3LK1 A;  4GGF C;  5I94 A;  1EG4 A;  4GFT A;  2KNE A;  3IVT A;  1CLM A;  1YUT A;  1OOI X;  1EJ3 A;  2A4J A;  4OR9 B;  3VRP A;  4JQ0 D;  5AFP A;  4GBA A;  3PN7 C;  1Y1X A;  5DKN A;  5ER4 X;  3K21 A;  5DKQ A;  2JT0 A;  3L4L A;  1QS7 A;  3HX4 A;  4JPZ B;  1PSR A;  1JWD A;  4PE0 A;  1JC2 A;  2F2P A;  2CBL A;  3BFA A;  2KI6 D;  1J7P A;  1QX7 A;  2NCO A;  1QXP A;  2M97 A;  2O60 A;  3NHT A;  2EC6 C;  1F4O A;  3D74 A;  1LA0 A;  4CFR A;  1CDN A;  3OHM B;  3CDN A;  2KLD A;  2VRG A;  1F71 A;  1V1F A;  2KOT A;  4CLN A;  1FI5 A;  3DF0 B;  2WCE A;  5CSN A;  2LLS A;  1J1D A;  4DS7 A;  2Y4Q A;  3I5G B;  1A75 A;  3EKJ A;  1BU3 A;  1S26 D;  2K2A A;  4M2O A;  3ZNI A;  5G08 A;  3JVT B;  3DVE A;  4USL A;  1UHI A;  2L2E A;  4HRE E;  3OP0 A;  4I5N B;  3TS5 B;  1BG1 A;  1P28 A;  1UHK A;  2MJW B;  1NCX A;  1AUI B;  3VRN A;  5PAL A;  1H8B A;  2M1U A;  1W9Z A;  3NHI A;  3EG5 B;  4ZCU A;  3NSK A;  1DJX A;  4PE4 A;  2O5G A;  1QAT A;  1L7Z A;  4YGD B;  1OQP A;  1OOF A;  1TNP A;  4F7F A;  1DMO A;  1LXF C;  1QLK A;  1NX1 A;  4HSZ A;  3BUX B;  3DY9 A;  1IH0 A;  4PAL A;  1XVJ A;  2JNF A;  4QJ5 B;  2JZI A;  5K89 A;  3RM1 A;  3D77 A;  3VB1 A;  2PYQ A;  2ZKM X;  1K9K A;  4ETO A;  1OSA A;  3TDI A;  1BF5 A;  2F3Z A;  3SG4 A;  2WCK A;  4M2Q A;  2BE6 A;  1M45 A;  1A29 A;  3O6B A;  3SS4 A;  2KBM A;  2KYC A;  4MVF A;  3ICB A;  5D3O A;  1K9P A;  1C3Z A;  1QIW A;  1PVB A;  2D8N A;  4U8D A;  3PM2 A;  1OOG A;  1DEL A;  1UWO A;  2OPO A;  1A2X A;  1B4C A;  2QAC A;  3O78 A;  4XYN A;  4XJK A;  4N5X A;  1SK6 D;  2CT9 A;  4I5J A;  1CFD A;  5HKW A;  3SS5 A;  1OW4 A;  3V2L A;  5I8N A;  1TCF A;  1YUU A;  2CCM A;  1NUB A;  2JQ6 A;  1CNP A;  1SL9 A;  3OB1 B;  3QRX A;  5B8I B;  1EXR A;  2GGZ A;  2QEH A;  1K2H A;  3FWB A;  1SRA A;  3SG7 A;  1DJW A;  3CR5 X;  1JSA A;  3NGV A;  4YGE B;  2H61 A;  1JF0 A;  1L2O C;  2COL B;  3BUN B;  4HRG A;  1PVA A;  3NSL A;  1RRO A;  3PLF B;  1CFF A;  1M31 A;  2L4H A;  2KQ6 A;  1TWO A;  1QTX A;  3BUO B;  4ICB A;  3SIA A;  1CFP A;  1DF0 B;  1U5I B;  1XFZ O;  3SIB A;  1HT9 A;  2P70 A;  1FF1 A;  1Z4H A;  4MBE A;  2GV5 A;  1B9A A;  3DVK A;  1IRJ A;  1FPW A;  4KYN A;  1AHR A;  1ODB A;  2BAP A;  4INW A;  3D75 A;  3I5F B;  3R1V A;  2OTG B;  2KHN A;  2BCA A;  2PAS A;  1WRZ A;  2HQ8 A;  2LUC A;  3R1O A;  4WRI A;  2BL0 C;  2WC8 A;  3D0Y A;  1SW8 A;  1FBV A;  2LC5 A;  1QIV A;  1SL8 A;  2JXC A;  1W7I B;  2K8M B;  3PFV A;  2HET A;  2P6B B;  2JWW A;  2M29 A;  2NLN A;  1DT7 B;  1SSE B;  5JJG A;  3PM8 A;  1OMR A;  2LUX A;  3BOW A;  2K7C A;  1CFC A;  1J1E A;  2L5X B;  1XO5 A;  1KQM B;  1B7T Y;  1YX8 A;  2BCB A;  1DJG A;  4MZK A;  2EGD A;  1F4Q A;  2QPT A;  2BNX A;  4OKH A;  1GM0 A;  3BFH A;  3TDZ A;  1WRK A;  1Q80 A;  3DXL A;  1IJ5 A;  1CDM A;  2EHB A;  2M7N A;  1LKJ A;  1K96 A;  1WDC B;  1R6P A;  2HQW A;  4DRW A;  3FE6 A;  2MA2 A;  1ZOT B;  1QVI Y;  2LLT A;  3I5G C;  1GGZ A;  1DJZ A;  1ZFS A;  2F33 A;  4IL1 A;  2OS8 B;  2G2B A;  3SG6 A;  1RFJ A;  5HLO A;  1S6J A;  2G9B A;  1TNW A;  1XFR A;  1QX2 A;  2M8U A;  2WCL A;  4Q04 A;  2JT3 A;  3I5H B;  1NCZ A;  2JTT A;  3WHT B;  1IQ3 A;  1UHN A;  2KGB C;  3M0W A;  2LP2 A;  1RJV A;  2WC5 A;  4MRY A;  1XFV O;  1K94 A;  1KSO A;  2I7A A;  5HKZ A;  2LNK A;  1B7T Z;  3OB2 B;  2WND A;  3MSE B;  3B88 A;  4YRU A;  3GK2 A;  1GQM A;  3CZ0 A;  2LHL A;  2GTE A;  1CDP A;  1UHJ A;  2FCE A;  3EK7 A;  4OV2 A;  2L2C A;  4GAO A;  3AKA A;  3BJH A;  3S0E A;  2BCX A;  1QVI Z;  4WQ3 A;  1YX7 A;  5FYX A;  4BY5 A;  1PK0 D;  1AJ4 A;  5CSJ A;  3WXA A;  1A03 A;  1F54 A;  1CM4 A;  3S0A A;  1UUS A;  4MRX A;  1YVL A;  2RGI A;  5AEQ A;  1KK8 C;  4E68 A;  1YTZ C;  3FE8 A;  3EVV A;  2KPH A;  1EH2 A;  3CZ2 A;  2K7O A;  4P2Y B;  1SCV A;  3OX5 A;  1DVI A;  1REC A;  3I5I B;  3Q8I A;  3RLZ A;  1SL7 A;  3B7A A;  3KO0 A;  3D76 A;  1Y1A A;  1RK9 A;  4YI9 A;  1LS8 A;  1J55 A;  3NXA A;  1XK4 C;  2H61 C;  2M1K B;  1CDL A;  4YGC B;  1ALV A;  1MXL C;  2K2F A;  3DD4 A;  4CPV A;  4UPG A;  4PHM A;  1K9U A;  1S5G Z;  4MN0 A;  1JFJ A;  3CZ1 A;  1LVC D;  1C7V A;  1WRL A;  2KDH A;  1NX2 A;  3AKB A;  3VRQ A;  2AAO A;  1RWY A;  4WQ2 A;  1KFX L;  1KSM A;  3PN7 B;  1NYA A;  3ZWH A;  4F0Z B;  4N1G A;  2SAS A;  1TUZ A;  2MRD A;  1TRF A;  1R2U A;  4C0L A;  2KBI A;  1ALW A;  2WCF A;  1TOP A;  1SKT A;  1IGV A;  3FWC A;  3K1E A;  2QEO A;  4N1F A;  4ORC B;  1Y1U A;  2WC6 A;  1CMF A;  1J7R A;  2LM5 A;  4PE1 A;  1JFK A;  2EC6 B;  2OTG C;  2Y1M A;  3LK0 A;  1TN4 A;  2JPO A;  3PAT A;  3D73 A;  2LVV A;  4R1E A;  2CXJ A;  2B1U A;  3A8R A;  2K7B A;  1A4P A;  1QAS A;  2M0R A;  3CAB A;  4OVN F;  4P5O E;  1FW4 A;  4YBH B;  1T14 A;  2LVK A;  3CR2 A;  1DC1 A;  3RZS A;  2MLE C;  3PAL A;  1V1G A;  2DOQ A;  1G33 A;  2GGM A;  2BKI B;  4MLW A;  4MSP A;  1TTX A;  3EK4 A;  5HLV A;  1XK4 A;  5I2L A;  3B87 A;  1BOD A;  5EL2 A;  3EVU A;  1NSH A;  1KFX S;  2K61 A;  4ZCV A;  1N0Y A;  3PJI A;  4TNC A;  1SBJ A;  4PDZ A;  4HRH A;  1WDC C;  5CSI A;  1BR1 B;  3KHE A;  1F8H A;  2V53 A;  1QV1 A;  3DZT A;  3N7H A;  1DF0 A;  1U5I A;  2FJY A;  2KFF A;  4YGB B;  5I2O A;  2KI4 B;  1TIZ A;  5AAN A;  2WOR A;  1M39 A;  1WY9 A;  3BUM B;  1AJ5 A;  2JOJ A;  1JBA A;  1K95 A;  4OZD A;  1S6C A;  4IJ7 A;  4MZJ A;  1AP4 A;  2JC2 A;  3I5H C;  3LL8 B;  1KWO B;  2KGR A;  2CNP A;  3IQO A;  5BPJ A;  1HQV A;  3O2P A;  2Q91 A;  1SCM B;  2PAL A;  5KSZ A;  1KFU S;  3IF7 A;  1MF8 B;  2LMT A;  2L51 A;  3B6X A;  3BYA A;  1CMG A;  1OOJ A;  2PMY A;  2L4I A;  1IJ6 A;  1S6I A;  1DTL A;  1YR5 A;  1BJF A;  4NQG A;  1YRT B;  4AQJ A;  2ERB A;  3WNX B;  3TUY B;  3HCM A;  4ORB B;  1KK7 Z;  1DQE A;  4PHK A;  2JU0 A;  2F3Y A;  1J7O A;  2LP3 A;  2K7D A;  1CTR A;  2P71 A;  2QEV A;  3BQ3 A;  1YRU B;  2ZN8 A;  5HYD A;  1OZS A;  2KAY A;  3EKH A;  1NP8 A;  2FOT A;  2JUL A;  1DJI A;  1YUS A;  1JUO A;  2NCP A;  2KLE A;  1NX3 A;  3SS3 A;  1JF2 A;  3EK8 A;  3JVT C;  4JD9 A;  3DVM A;  4PHJ A;  1TNQ A;  3TS5 C;  1G4Y R;  2M9G A;  1GJY A;  3SG3 A;  3VGO A;  2M7L A;  1SY9 A;  2I94 A;  3I5I C;  1CKK A;  1SNL A;  3GOF A;  3H4S E;  3NSO A;  3R1P A;  2LHI A;  1QWV A;  4JWQ A;  1ZUZ A;  5DKR A;  1BLQ A;  3S0F A;  3L47 A;  1OMD A;  2LE9 B;  5FI2 A;  3OBV A;  4OCI A;  1OMV A;  4PT1 A;  5FI6 A;  1F55 A;  1NPQ A;  1C07 A;  1PRW A;  1ZAC A;  1NCY A;  1S5G Y;  1SPY A;  3CS1 A;  5D69 A;  3SG2 A;  2WCM A;  2LVJ A;  1UHH A;  5TNC A;  3TDU A;  1M46 A;  2JNX A;  5AXI A;  1EL4 A;  3JTD B;  1PAL A;  1SMG A;  2BL0 B;  2KFH A;  1XA5 A;  1AK8 A;  4D1E A;  2WCB A;  2KFG A;  3O4Y A;  1VRK A;  1XFX O;  1IG5 A;  1UP5 A;  1S1E A;  1TCO B;  3DF0 A;  3LCP C;  3S0B A;  2K60 A;  3L4A A;  1XFU O;  4NDD A;  2PRU A;  2KSP A;  3CGA A;  3CTN A;  2QEB A;  1ZMZ A;  2HF5 A;  2JXL A;  1K90 D;  1SR6 B;  3VRO A;  2QDI A;  4L9M A;  4DUQ A;  4GNK B;  3CZT X;  4JKT A;  3E3R A;  5FI7 A;  1QV0 A;  1WLZ A;  2Q4U A;  3OX6 A;  3PSR A;  2LLU A;  2PSR A;  4ORA B;  1MR8 A;  2BBM A;  2KI6 C;  3CR4 X;  2AMI A;  1DJY A;  1B8L A;  5JOL A;  1A75 B;  3CYZ A;  4NDC A;  1KCY A;  2L50 A;  3OGN A;  2LMV A;  4PCW A;  1Z2C B;  3SG5 A;  1CLB A;  1Y0V H;  3FIA A;  5CSF A;  1F70 A;  4QJ3 B;  4CFQ A;  2MBX A;  3SJS A;  3BFB A;  2JTZ A;  1WLM A;  2H8V A;  1C3Y A;  1SYM A;  2K0J A;  2M3W A;  4GGF A;  4YI8 A;  3GK1 A;  5DIC A;  1KQV A;  4A4C A;  3CWG A;  1D1O A;  2F2O A;  3DVJ A;  2ZND A;  5D7F A;  3NSI A;  1IKU A;  1PSB A;  1OE9 B;  1OOH A;  2E6W A;  2KI4 C;  3I5F C;  4GGN A;  5F6T A;  3WHU B;  4PE7 A;  3UNW A;  5IBW A;  1QLS A;  3A4U B;  1MXE A;  1IQ5 A;  1BT6 A;  5I2Q A;  3F45 A;  1UUR A;  2Y5I A;  1B8R A;  4DCK A;  2ZFD A;  2ISD A;  1KWO C;  1B1G A;  4M2P A;  2PQL A;  2PVB A;  3D10 A;  2L98 A;  1MQ1 A;  1SCM C;  2IS9 A;  2NZ0 A;  3DYE A;  2KAV A;  4I5L B;  4INX A;  2YGU A;  4DIR A;  2R2I A;  2LVI A;  2ZN9 A;  1KQM C;  2WOS A;  1FI6 A;  1KFU L;  2BEC A;  1TNX A;  4XJK B;  2L0P A;  4PHN A;  1AVS A;  1XYD A;  1KK8 B;  3VRR A;  4GUK A;  1S36 A;  5ER5 A;  3IQQ A;  4FQT A;  3TUY C;  1KK7 Y;  4MZL A;  1NWD A;  3C1V A;  4I5K A;  1NIW A; 
#chains in the Genus database with same CATH homology
 1GGW A;  2I18 A;  2LCP A;  2H2K A;  2LAP A;  1BMO A;  2KYF A;  1B47 A;  1QX5 B;  3AAJ A;  1M63 B;  1K93 D;  4A4B A;  2OS8 C;  1B8C A;  1X02 A;  1BOC A;  1C7W A;  2CTN A;  2KAX A;  2BKH B;  3GK4 X;  3EVR A;  4AOM A;  2F8P A;  2LV7 A;  1CLL A;  5J3X A;  3FS7 A;  1NX0 A;  4CID A;  1YVH A;  1BR4 B;  4MEW A;  1YUR A;  3KPX A;  4BY4 A;  2I2R E;  1QJT A;  2Y1N A;  2M49 B;  1EG3 A;  1XFW O;  4FTG A;  1PUL A;  1H4B A;  3TZ1 A;  2MAZ A;  2MLF C;  2LAN A;  3AAK A;  1E8A A;  3D0Y B;  1G8I A;  5KTY A;  1LIN A;  1N65 A;  4YGA A;  2BBN A;  4C0K A;  4NDB A;  2BE4 A;  3KF9 A;  3JTD C;  1DJH A;  1Y6W A;  3BOW B;  2ZRT A;  1CM1 A;  1LA3 A;  1MHO A;  2ZRS A;  1DGV A;  2AUC A;  2E30 A;  5CPV A;  5AER A;  2TN4 A;  2HPS A;  1J7Q A;  1RTP 1;  4AQI A;  1SR6 C;  1DGU A;  2MHH A;  1L2O B;  4QJ4 B;  2NXQ A;  1W7J B;  3KEV A;  1S3P A;  2JT8 A;  2KQY A;  1CB1 A;  1IWQ A;  5KU1 A;  2FCD A;  3LLE A;  2FJU B;  4C0J A;  1K8U A;  1XFY O;  1MWN A;  3CLN A;  5GQQ C;  1OZO A;  3BXK A;  4FQO A;  2ZNE A;  2SCP A;  2JPT A;  2JRF A;  3BUW B;  1MUX A;  2LMU A;  4GPL B;  1N2D A;  3LK1 A;  4GGF C;  1EG4 A;  4GFT A;  2KNE A;  1CLM A;  1YUT A;  1EJ3 A;  2A4J A;  4OR9 B;  3VRP A;  4JQ0 D;  5AFP A;  4GBA A;  3PN7 C;  1Y1X A;  5DKN A;  5ER4 X;  3K21 A;  5DKQ A;  2JT0 A;  1QS7 A;  3HX4 A;  4JPZ B;  1PSR A;  1JWD A;  4PE0 A;  1JC2 A;  2F2P A;  2CBL A;  2KI6 D;  1J7P A;  1QX7 A;  2NCO A;  1QXP A;  2M97 A;  2O60 A;  2EC6 C;  1F4O A;  1LA0 A;  4CFR A;  1CDN A;  3OHM B;  1F71 A;  2VRG A;  1V1F A;  2KOT A;  4CLN A;  1FI5 A;  3DF0 B;  2WCE A;  5CSN A;  2LLS A;  1J1D A;  4DS7 A;  2Y4Q A;  3I5G B;  1A75 A;  3EKJ A;  1BU3 A;  1S26 D;  2K2A A;  4M2O A;  3ZNI A;  5G08 A;  3JVT B;  3DVE A;  4USL A;  1UHI A;  2L2E A;  4HRE E;  3OP0 A;  4I5N B;  3TS5 B;  1BG1 A;  1H8B A;  1UHK A;  2MJW B;  1NCX A;  1AUI B;  3VRN A;  5PAL A;  2M1U A;  4ZCU A;  3NSK A;  1DJX A;  4PE4 A;  2O5G A;  1QAT A;  1L7Z A;  4YGD B;  1OQP A;  1TNP A;  1DMO A;  1LXF C;  1QLK A;  1NX1 A;  4HSZ A;  3BUX B;  1IH0 A;  4PAL A;  1XVJ A;  2JNF A;  4QJ5 B;  2JZI A;  5K89 A;  3RM1 A;  2ZKM X;  1K9K A;  4ETO A;  1OSA A;  3TDI A;  1BF5 A;  2F3Z A;  3SG4 A;  4M2Q A;  2BE6 A;  1M45 A;  1A29 A;  3O6B A;  2KBM A;  2KYC A;  4MVF A;  3ICB A;  1K9P A;  1QIW A;  1PVB A;  2D8N A;  4U8D A;  1UWO A;  2OPO A;  1A2X A;  1B4C A;  2QAC A;  3O78 A;  4XYN A;  4XJK A;  4N5X A;  1SK6 D;  2CT9 A;  4I5J A;  1CFD A;  5HKW A;  5I8N A;  1TCF A;  1YUU A;  2CCM A;  1NUB A;  2JQ6 A;  1CNP A;  1SL9 A;  3OB1 B;  3QRX A;  5B8I B;  1EXR A;  2GGZ A;  1K2H A;  3FWB A;  1SRA A;  3SG7 A;  1DJW A;  3CR5 X;  1JSA A;  4YGE B;  2H61 A;  2COL B;  1JF0 A;  1L2O C;  3BUN B;  4HRG A;  1PVA A;  3NSL A;  1RRO A;  3PLF B;  1CFF A;  1M31 A;  2L4H A;  2KQ6 A;  3BUO B;  1QTX A;  4ICB A;  3SIA A;  1CFP A;  1DF0 B;  1U5I B;  1XFZ O;  3SIB A;  1HT9 A;  1FF1 A;  4MBE A;  2GV5 A;  1B9A A;  3DVK A;  1IRJ A;  1FPW A;  1AHR A;  1ODB A;  3I5F B;  2OTG B;  2KHN A;  2BCA A;  2PAS A;  1WRZ A;  2HQ8 A;  2LUC A;  4WRI A;  2BL0 C;  2WC8 A;  3D0Y A;  1SW8 A;  1FBV A;  2LC5 A;  1QIV A;  1SL8 A;  2JXC A;  1W7I B;  2K8M B;  3PFV A;  2HET A;  2P6B B;  2JWW A;  2M29 A;  2NLN A;  1DT7 B;  5JJG A;  3PM8 A;  1OMR A;  2LUX A;  3BOW A;  2K7C A;  1CFC A;  1J1E A;  2L5X B;  1XO5 A;  1KQM B;  1B7T Y;  1YX8 A;  2BCB A;  1DJG A;  4MZK A;  2EGD A;  1F4Q A;  2QPT A;  4OKH A;  3TDZ A;  1WRK A;  1Q80 A;  1IJ5 A;  1CDM A;  2EHB A;  2M7N A;  1LKJ A;  1K96 A;  1WDC B;  1R6P A;  2HQW A;  4DRW A;  2MA2 A;  1ZOT B;  1QVI Y;  2LLT A;  3I5G C;  1GGZ A;  1DJZ A;  1ZFS A;  2F33 A;  4IL1 A;  2OS8 B;  2G2B A;  3SG6 A;  1RFJ A;  5HLO A;  1S6J A;  2G9B A;  1TNW A;  1QX2 A;  2M8U A;  4Q04 A;  3WHT B;  2JT3 A;  3I5H B;  1NCZ A;  2JTT A;  1IQ3 A;  1UHN A;  2KGB C;  3M0W A;  2LP2 A;  1RJV A;  4MRY A;  1XFV O;  1K94 A;  1KSO A;  2I7A A;  5HKZ A;  2LNK A;  1B7T Z;  3OB2 B;  2WND A;  3MSE B;  4YRU A;  3GK2 A;  1GQM A;  2LHL A;  1CDP A;  1UHJ A;  2FCE A;  3EK7 A;  4OV2 A;  4GAO A;  3AKA A;  2BCX A;  1QVI Z;  4WQ3 A;  1YX7 A;  5FYX A;  4BY5 A;  1PK0 D;  1AJ4 A;  5CSJ A;  3WXA A;  1A03 A;  1F54 A;  1CM4 A;  1UUS A;  4MRX A;  1YVL A;  2RGI A;  5AEQ A;  1KK8 C;  4E68 A;  1YTZ C;  3EVV A;  1EH2 A;  4P2Y B;  2K7O A;  1SCV A;  3OX5 A;  1DVI A;  1REC A;  3I5I B;  3RLZ A;  1SL7 A;  3KO0 A;  1Y1A A;  1RK9 A;  4YI9 A;  1J55 A;  3NXA A;  1XK4 C;  2H61 C;  2M1K B;  1CDL A;  4YGC B;  1ALV A;  1MXL C;  2K2F A;  3DD4 A;  4CPV A;  4UPG A;  4PHM A;  1K9U A;  1S5G Z;  4MN0 A;  1JFJ A;  1LVC D;  1C7V A;  1WRL A;  2KDH A;  1NX2 A;  3AKB A;  3VRQ A;  2AAO A;  1RWY A;  4WQ2 A;  1KFX L;  1KSM A;  3PN7 B;  1NYA A;  3ZWH A;  4F0Z B;  4N1G A;  2SAS A;  2MRD A;  1TRF A;  1R2U A;  4C0L A;  2KBI A;  1ALW A;  2WCF A;  1TOP A;  1SKT A;  1IGV A;  3FWC A;  4N1F A;  4ORC B;  1Y1U A;  1CMF A;  1J7R A;  2LM5 A;  4PE1 A;  1JFK A;  2EC6 B;  2OTG C;  2Y1M A;  3LK0 A;  1TN4 A;  3PAT A;  2LVV A;  4R1E A;  2CXJ A;  2B1U A;  3A8R A;  2K7B A;  1A4P A;  1QAS A;  2M0R A;  4OVN F;  4P5O E;  4YBH B;  1FW4 A;  5HKY A;  2LVK A;  3CR2 A;  2MLE C;  3PAL A;  1V1G A;  2DOQ A;  1G33 A;  2GGM A;  2BKI B;  4MLW A;  4MSP A;  1TTX A;  3EK4 A;  5HLV A;  1XK4 A;  5I2L A;  1BOD A;  3EVU A;  1NSH A;  1KFX S;  2K61 A;  4ZCV A;  1N0Y A;  4TNC A;  1SBJ A;  4PDZ A;  4HRH A;  1WDC C;  5CSI A;  1BR1 B;  3KHE A;  1F8H A;  2V53 A;  1QV1 A;  1DF0 A;  1U5I A;  2KFF A;  4YGB B;  5I2O A;  2KI4 B;  1TIZ A;  5AAN A;  2WOR A;  1M39 A;  1WY9 A;  3BUM B;  1AJ5 A;  2JOJ A;  1JBA A;  1K95 A;  1S6C A;  4MZJ A;  1AP4 A;  2JC2 A;  3I5H C;  3LL8 B;  1KWO B;  2KGR A;  2CNP A;  3IQO A;  5BPJ A;  1HQV A;  3O2P A;  2Q91 A;  1SCM B;  2PAL A;  5KSZ A;  1KFU S;  3IF7 A;  1MF8 B;  2LMT A;  2L51 A;  3BYA A;  1CMG A;  1OOJ A;  2PMY A;  2L4I A;  1IJ6 A;  1S6I A;  1DTL A;  1YR5 A;  1BJF A;  4NQG A;  1YRT B;  4AQJ A;  3WNX B;  3TUY B;  3HCM A;  4ORB B;  1KK7 Z;  4PHK A;  2JU0 A;  2F3Y A;  1J7O A;  2LP3 A;  2K7D A;  1CTR A;  3BQ3 A;  1YRU B;  2ZN8 A;  5HYD A;  1OZS A;  2KAY A;  3EKH A;  1NP8 A;  2FOT A;  2JUL A;  1DJI A;  1YUS A;  1JUO A;  2NCP A;  1NX3 A;  1JF2 A;  3EK8 A;  3JVT C;  4PHJ A;  3DVM A;  1TNQ A;  3TS5 C;  1G4Y R;  2M9G A;  1GJY A;  3SG3 A;  3VGO A;  2M7L A;  1SY9 A;  2I94 A;  3I5I C;  1CKK A;  1SNL A;  3GOF A;  3H4S E;  3NSO A;  4JWQ A;  2LHI A;  1ZUZ A;  5DKR A;  1BLQ A;  1OMD A;  2LE9 B;  4OCI A;  1OMV A;  1F55 A;  1NPQ A;  1C07 A;  1PRW A;  1ZAC A;  1NCY A;  1S5G Y;  1SPY A;  3CS1 A;  5D69 A;  3SG2 A;  2LVJ A;  1UHH A;  5TNC A;  3TDU A;  1M46 A;  2JNX A;  5AXI A;  1EL4 A;  3JTD B;  1PAL A;  1SMG A;  2BL0 B;  2KFH A;  1XA5 A;  1AK8 A;  4D1E A;  2WCB A;  2KFG A;  3O4Y A;  1VRK A;  1XFX O;  1IG5 A;  1UP5 A;  1S1E A;  1TCO B;  3DF0 A;  3LCP C;  4NDD A;  1XFU O;  2PRU A;  2KSP A;  3CGA A;  3CTN A;  1ZMZ A;  2HF5 A;  2JXL A;  1K90 D;  1SR6 B;  3VRO A;  4L9M A;  4DUQ A;  4GNK B;  3CZT X;  3E3R A;  1QV0 A;  1WLZ A;  2Q4U A;  3OX6 A;  3PSR A;  2LLU A;  2PSR A;  4ORA B;  1MR8 A;  2BBM A;  2KI6 C;  3CR4 X;  2AMI A;  1DJY A;  1B8L A;  5JOL A;  1A75 B;  4NDC A;  1KCY A;  2L50 A;  2LMV A;  4PCW A;  3SG5 A;  1CLB A;  1Y0V H;  3FIA A;  5CSF A;  1F70 A;  4QJ3 B;  4CFQ A;  2MBX A;  3SJS A;  2JTZ A;  1WLM A;  1SYM A;  2K0J A;  2M3W A;  4GGF A;  4YI8 A;  3GK1 A;  1KQV A;  4A4C A;  3CWG A;  1D1O A;  2F2O A;  3DVJ A;  2ZND A;  5D7F A;  3NSI A;  1IKU A;  1PSB A;  1OE9 B;  4GGN A;  2E6W A;  2KI4 C;  3I5F C;  3WHU B;  5F6T A;  4PE7 A;  5IBW A;  1QLS A;  3A4U B;  1MXE A;  1IQ5 A;  1BT6 A;  5I2Q A;  3F45 A;  1UUR A;  2Y5I A;  1B8R A;  4DCK A;  2ZFD A;  2ISD A;  1KWO C;  1B1G A;  4M2P A;  2PVB A;  3D10 A;  2L98 A;  1MQ1 A;  1SCM C;  2IS9 A;  2NZ0 A;  4I5L B;  2KAV A;  4DIR A;  2R2I A;  2LVI A;  2ZN9 A;  1KQM C;  2WOS A;  1FI6 A;  1KFU L;  2BEC A;  1TNX A;  4XJK B;  2L0P A;  4PHN A;  1AVS A;  1XYD A;  1KK8 B;  3VRR A;  4GUK A;  1S36 A;  5ER5 A;  3IQQ A;  3TUY C;  1KK7 Y;  4MZL A;  1NWD A;  3C1V A;  4I5K A;  1NIW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...