3S0DA

Apis mellifera obp 14 in complex with the citrus odorant citralva (3,7-dimethylocta-2,6-dienenitrile)
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
119
structure length
119
Chain Sequence
MTIEELKTRLHTEQSVCKTETGIDQQKANDVIEGNIDVEDKKVQLYCECILKNFNILDKNNVFKPQGIKAVMELLIDENSVKQLVSDCSTISEENPHLKASKLVQCVSKYKTMKSVDFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords OBP14
publication title Crystal structure of Apis mellifera OBP14, a C-minus odorant-binding protein, and its complexes with odorant molecules.
pubmed doi rcsb
source organism Apis mellifera
molecule tags Transport protein
total genus 49
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2011-05-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.20 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 Pheromone/general odorant binding protein domain 3s0dA00
2QDIA 3D73A 2WCHA 3K1EA 1OOFA 3DXLA 3DYEA 1ORGA 2QEOA 3R1OA 3B6XA 2WC6A 4F7FA 1GM0A 3BFBA 3BFHA 3R1PA 3QMEA 3B7AA 3CZ0A 3D76A 4INXA 3L47A 3B86A 2GTEA 1LS8A 3B88A 3DZTA 2WC5A 4OZDA 3S0EA 3BJHA 3S0GA 5DICA 3R72A 1XFRA 3V2LA 2KPHA 3FE9A 2QEBA 1OOGA 3OGNA 3DY9A 3VB1A 2WCLA 3PJIA 3R1VA 3L4LA 1OOIX 3CZ1A 3D75A 3Q8IA 3CABA 3BFAA 3S0DA 4FQTA 4INWA 3CDNA 1T14A 2P71A 3NGVA 2WCKA 2JPOA 3N7HA 4JD9A 2QEHA 3B87A 3D74A 1OOHA 3CYZA 2ERBA 3FE6A 3FE8A 3RZSA 2PQLA 2WCJA 2FJYA 3NHIA 1C3YA 1P28A 3NHTA 3S0AA 2WCMA 3D78A 2H8VA 1TUJA 1OW4A 1TWOA 3D77A 3S0BA 2P70A 1QWVA 2QEVA 1DQEA 4PT1A 3L4AA 5EL2A 2L2CA 3S0FA 3CZ2A 1C3ZA
chains in the Genus database with same CATH superfamily
1Z4HA 1M63B 2JULA 2WCHA 1IQ5A 5HYDA 1IKUA 1CDMA 2L5XB 3EKHA 1KQVA 3CZTX 3BYAA 2A4JA 1QVIY 2HF5A 1BF5A 2PVBA 2WNDA 1SPYA 4JWQA 1SK6D 3VRQA 3LL8B 4GFTA 3UO9A 5FI6A 5D69A 3R1OA 1CDLA 1CM4A 2JT3A 4IJ7A 4F7FA 2KQYA 1CMFA 2E6WA 1S5GZ 3BOWB 5CPVA 1S6IA 1WDCB 2KAYA 1Y1UA 3DVKA 3R1PA 2F33A 2MRDA 2MAZA 2WCEA 3KO0A 1CDNA 1B7TY 2BBMA 4YRUA 2PSRA 3O4XA 4GGNA 3L47A 1N65A 1U5IA 2WC5A 4OZDA 1QLSA 2F3YA 1B1GA 5DKRA 1YRUB 3HCMA 1BG1A 3I5GC 1QIVA 2KBIA 3I5IB 4GBAA 5B8IB 3DVJA 5G08A 5DICA 2JNXA 1MF8B 2WOSA 1TNPA 1RTP1 1YURA 1K90D 4ICBA 4PHJA 2KI4B 2SCPA 2JPTA 3FE9A 1GGWA 1OOGA 4CFQA 1AJ4A 1FF1A 2KI6C 2R2IA 3GK2A 3D0YA 1G8IA 1ALVA 2M97A 3JTDB 1DTLA 3L4LA 2KYCA 5AXIA 2IS9A 1ZACA 1OOIX 5HKYA 2JZIA 3LLEA 3A8RA 3Q8IA 4PE7A 2BKHB 2QACA 3LK1A 3C1VA 1SW8A 4NQGA 1F71A 1F4OA 1LINA 3I5HB 3VRNA 1YVHA 2KFGA 3AKAA 3DVMA 4MEWA 3CTNA 4PCWA 2EC6C 2GGMA 3DF0B 4PE4A 2HPSA 1F8HA 2NLNA 5J3XA 2JTTA 1T14A 3PLFB 1AHRA 3NGVA 4C0JA 2BL0C 2WCKA 1J7OA 2TN4A 4Q04A 4GUKA 1YUUA 2L5YA 2QEHA 3B87A 4M2PA 5CSJA 3OX6A 2L51A 1S5GY 2M29A 3O4YA 1CMGA 2ERBA 3PN7C 4P5OE 5HLOA 2LNKA 1DJHA 5KSZA 1KFUL 5I2OA 1SBJA 1KWOC 4GAOA 4ZCVA 5I8NA 2NZ0A 1MQ1A 1FPWA 1UHHA 2AMIA 3CWGA 2FJYA 5I2QA 3EK8A 3KF9A 3UNWA 2KHNA 1GGZA 2LLTA 1JFKA 1Q80A 2OS8B 5HKWA 3RLZA 1C3YA 1KK8B 2L50A 2D8NA 1RK9A 2H61A 1TCFA 2M9GA 1K9PA 2WCMA 1TUJA 1RFJA 3WHTB 1QX2A 3SG3A 3IQQA 3PJIA 2HQ8A 3D77A 5PALA 1LVCD 3S0BA 3CR2A 4I5NB 3PSRA 3BUOB 2ZKMX 1W7IB 1QATA 1RJVA 4R1EA 2BAPA 1BLQA 1F70A 1IRJA 4A4BA 1N0YA 1OMVA 1MWNA 2JXCA 2F3ZA 3CGAA 1UUSA 5EL2A 2K7OA 1NUBA 2LVVA 2M8UA 4XJKB 3BQ3A 5D3OA 3SIAA 1C3ZA 4GGFA 4L9MA 1CLLA 2KGRA 1UHKA 4DRWA 1OMDA 1SCMB 4GGFC 2I7AA 1HT9A 1TCOB 4YI9A 4YBHB 1IWQA 1B4CA 2CT9A 1XFUO 2L98A 1QX5B 5HL1A 3VRRA 4HREE 1OOJA 4BY5A 2GGZA 3DYEA 4PE1A 3O6BA 3O78A 4WQ3A 2PALA 1YX7A 4A4CA 1OE9B 2JC2A 2JT0A 1IH0A 1FBVA 1WLZA 2LP3A 3NXAA 2KI6D 3IF7A 3OB2B 3B6XA 1D1OA 2LVJA 2P6BB 3GOFA 3KHEA 4NDBA 1JBAA 2KNEA 1GM0A 2LC5A 3OX5A 1NX2A 1DVIA 2JQ6A 2KBMA 1IG5A 1LA3A 1S36A 2BBNA 1DGUA 3B7AA 5HKZA 1IIOA 1LA0A 1J7PA 1DJZA 1J7RA 3I5FC 3SG6A 4INXA 4DIRA 1PSBA 2LCPA 1KSOA 4KYNA 3B86A 1A2XA 4OV2A 3WXAA 3SS4A 5KU1A 4MRYA 3TS5B 1BU3A 2MLEC 3BJHA 3VGOA 1NCYA 4PHMA 5AANA 3R72A 3QRXA 4E68A 1UWOA 1TIZA 1M39A 2OPOA 4MBEA 4PALA 2KLEA 3V2LA 2KPHA 2I18A 2K7DA 3KEVA 1XA5A 1KSMA 5CSFA 2K0JA 2QEBA 4YGBB 2NXQA 1ZFSA 2KQ6A 3FS7A 1OMRA 1GQMA 1OZOA 2WCLA 2KFFA 1RROA 2HQWA 1QJTA 2BKIB 2L0PA 3JVTC 4MZKA 3D75A 1L2OB 1ALWA 3CABA 5K89A 1AP4A 5AERA 4ORBB 2BCXA 1KK7Z 2NCPA 3CDNA 2FOTA 2KDHA 1CFDA 5AFPA 1YUTA 3IVTA 1YVLA 1QASA 3OBVA 2OTGC 2JPOA 1DEKA 4JKTA 4NDDA 3GK1A 1DF0B 1SKTA 1EG3A 1OOHA 1S26D 3LCPC 4C0LA 4USLA 3CYZA 1OSAA 4NDCA 2JNFA 3SG7A 1SL9A 4YGEB 3SG2A 1F55A 3A4UB 3RZSA 1M45A 2KYFA 3GK4X 1RECA 4GPLB 1EL4A 1K93D 1KQMC 1QV1A 3D10A 1MXLC 3DF0A 1TN4A 3I5HC 1SR6C 3I5GB 1HQVA 3OB1B 4BY4A 3NHTA 1AK8A 3PALA 4JPZB 2ZNEA 1ZOTB 1PRWA 1WRZA 3EK4A 4CIDA 1QXPA 1DJGA 2L2EA 2P70A 2LV7A 4OVNF 1QWVA 1FI5A 2CBLA 4MVFA 1TUZA 4OR9B 2O60A 4DUQA 4CPVA 1CLBA 3EK7A 1XK4A 3ZWHA 4C0KA 3SS3A 1L7ZA 1XK4C 3D0YB 2L2CA 3S0FA 1K96A 1SCVA 3PM2A 2JOJA 4MRXA 1QV0A 1DJXA 1NX3A 3AAKA 3ICBA 2B1UA 2M1UA 2EC6B 2LUXA 3D73A 3K1EA 1OOFA 2MLFC 1C7VA 4HRHA 1DJIA 2LUCA 5JOLA 1K95A 4I5JA 1KCYA 1QS7A 1NCXA 2WCBA 1QLKA 5F6TA 2H61C 4WQ2A 3BUXB 1J55A 3TZ1A 2JXLA 3OHMB 2G9BA 2LM5A 3PN7B 3BFBA 2FJUB 1CDPA 4XJKA 1KWOB 1Y0VH 3FWCA 1BMOA 1SL8A 1JC2A 2JTZA 1TNQA 1V1GA 2Y4QA 3CZ0A 3NSIA 1CNPA 2KAVA 1PK0D 3M0WA 4PHNA 4TNCA 1SYMA 2BE6A 2DOQA 2LMVA 3CR4X 2GTEA 2K7CA 5AEQA 1R2UA 5JJGA 1QTXA 3SG4A 1BR1B 1RWYA 3TDUA 2MBXA 1JUOA 3MSEB 5ER4X 1DGVA 3S0GA 1CM1A 2BCBA 2V53A 3AKBA 1X02A 3SS5A 1YR5A 3DD4A 2K2AA 2G2BA 5DKNA 1J1DA 1YTZC 4FTGA 1B9AA 1K9UA 2COLB 4DS7A 5I2LA 4JQ0D 1K9KA 3DY9A 1CFCA 2KAXA 4YI8A 2M7NA 2LANA 3E3RA 3VB1A 3R1VA 2BCAA 2ZN9A 1OZSA 4ETOA 3CZ1A 1FW4A 2ZFDA 1B7TZ 2CNPA 4ZCUA 3TUYB 1UHIA 2LHIA 2CTNA 2M49B 3BFAA 2F2OA 1A75B 1TNWA 2JT8A 2L4HA 4YGDB 3S0DA 4INWA 3O2PA 2BE4A 2K8MB 4GNKB 1G4YR 1XYDA 2LMTA 2M0RA 4OCIA 1WRLA 3N7HA 4FQOA 2ZNDA 1YUSA 1XFWO 4JD9A 1A4PA 3CLNA 1JWDA 2K60A 1UURA 1JF0A 3BOWA 1B8CA 1N2DA 1S6JA 2AUCA 1S1EA 3FE6A 1NPQA 3K21A 1WDCC 4P2YB 2L4IA 2PRUA 3SIBA 1BODA 3I5FB 1XVJA 1MR8A 2QPTA 1L2OC 1LXFC 2M7LA 2PMYA 1WLMA 3VRPA 1CKKA 1NIWA 3NHIA 2SASA 1IJ5A 3BUNB 2KSPA 1SNLA 2LAPA 1MXEA 2JWWA 1C07A 1NCZA 1S6CA 3D78A 5D7FA 3I5IC 1H8BA 1OW4A 1K8UA 1TWOA 1OQPA 1NX1A 2ZN8A 1TRFA 1DF0A 1CTRA 1SY9A 1AVSA 3FIAA 4M2QA 2NCOA 1AJ5A 1Y1XA 2K61A 1J7QA 2KI4C 1ODBA 2KGBC 1XFYO 1K2HA 1BT6A 1DJWA 2Y1MA 3SJSA 3OP0A 3JVTB 4PT1A 1M46A 3TDIA 2MJWB 3L4AA 1W9ZA 3KPXA 3JTDC 5FI7A 4YGAA 1MHOA 1CB1A 1PULA 5I94A 2F2PA 3WHUB 2K7BA 5GQQC 1NX0A 4MN0A 4HSZA 1KFXS 1XFXO 3EVUA 4MZLA 2QDIA 2PYQA 1UHNA 1U5IB 2LVKA 3DXLA 2ISDA 4OKHA 1GJYA 1DC1A 1CFPA 2OTGB 1EG4A 2E30A 1JFJA 1BR4B 4AQIA 1A29A 1ORGA 2F8PA 1PALA 1CLMA 2CXJA 2QEOA 1C7WA 1DELA 1R6PA 3ZNIA 5BPJA 1EJ3A 1JF2A 4N5XA 2WC6A 4N1GA 4DCKA 2CCMA 3BFHA 2M3WA 1WY9A 4D1EA 3QMEA 2LVIA 2FCEA 1DJYA 1M31A 1SMGA 3SG5A 5KTYA 5CSNA 3EG5B 3HX4A 3H4SE 1IQ3A 3D76A 1KQMB 1UP5A 1NWDA 1QIWA 4QJ5B 1SR6B 3B88A 1LS8A 3DZTA 4WRIA 1NSHA 1J1EA 1PVAA 2LP2A 1VRKA 2Y5IA 1KK7Y 3CS1A 3EKJA 4MSPA 1PSRA 3BXKA 2AAOA 2JU0A 2I2RE 2OS8C 3S0EA 5FYXA 1KK8C 3PM8A 2EHBA 3DVEA 3PFVA 2BL0B 1BOCA 4HRGA 1XFRA 1ZUZA 2MA2A 2ZRSA 1Z2CB 3BUWB 3IQOA 3VROA 1F54A 1B8RA 2H2KA 2EGDA 3OGNA 5ER5A 1LKJA 4AOMA 2RGIA 2BNXA 1K94A 2LE9B 1IGVA 1ZMZA 1NYAA 2LHLA 4UPGA 1Y1AA 4YGCB 4IL1A 2WC8A 1UHJA 1S3PA 1V1FA 1W7JB 3CR5X 1AUIB 1SL7A 3NSOA 1IJ6A 4CLNA 1SCMC 2WCFA 4FQTA 1TTXA 3RM1A 3LK0A 1CFFA 2P71A 4M2OA 4CFRA 1B47A 1QVIZ 2YGUA 2ZRTA 1FI6A 3AAJA 3NSLA 1YX8A 1Y6WA 2KLDA 3EVVA 4AQJA 2FCDA 3D74A 4MLWA 3PATA 2I94A 5IBWA 4U8DA 5FI2A 1BJFA 5HLVA 3TDZA 4F0ZB 3FE8A 4MZJA 4PHKA 2Q4UA 1XFZO 2O5GA 1G33A 1A03A 4QJ4B 2PQLA 1TOPA 1A75A 1WRKA 2WCJA 3WNXB 3TUYC 1DT7B 1SRAA 2GV5A 4I5KA 2LMUA 4PDZA 1F4QA 4N1FA 1P28A 3BUMB 1KFUS 3S0AA 1XFVO 2KFHA 2BECA 2Q91A 2H8VA 2JRFA 2LLUA 2HETA 2MHHA 3F45A 3TS5C 4QJ3B 5DKQA 4PE0A 1JSAA 1XO5A 2WORA 4I5LB 4ORAB 2KOTA 2VRGA 3FWBA 2QEVA 1DQEA 1PVBA 4XYNA 1EH2A 1B8LA 3EVRA 1E8AA 1KFXL 2K2FA 1NP8A 3NSKA 5TNCA 1H4BA 1YRTB 2LLSA 5CSIA 1SSEB 1EXRA 1MUXA 1TNXA 2M1KB 1DMOA 3CZ2A 4ORCB 2PASA 1QX7A 2Y1NA
chains in the Genus database with same CATH topology
2QDIA 3D73A 2WCHA 3K1EA 1OOFA 3DXLA 3DYEA 1ORGA 2QEOA 3R1OA 3B6XA 2WC6A 4F7FA 1GM0A 3BFBA 3BFHA 3R1PA 3QMEA 3B7AA 3CZ0A 3D76A 4INXA 3L47A 3B86A 2GTEA 1LS8A 3B88A 3DZTA 2WC5A 4OZDA 3S0EA 3BJHA 3S0GA 5DICA 3R72A 1XFRA 3V2LA 2KPHA 3FE9A 2QEBA 1OOGA 3OGNA 3DY9A 3VB1A 2WCLA 3PJIA 3R1VA 3L4LA 1OOIX 3CZ1A 3D75A 3Q8IA 3CABA 3BFAA 3S0DA 4FQTA 4INWA 3CDNA 1T14A 2P71A 3NGVA 2WCKA 2JPOA 3N7HA 4JD9A 2QEHA 3B87A 3D74A 1OOHA 3CYZA 2ERBA 3FE6A 3FE8A 3RZSA 2PQLA 2WCJA 2FJYA 3NHIA 1C3YA 1P28A 3NHTA 3S0AA 2WCMA 3D78A 2H8VA 1TUJA 1OW4A 1TWOA 3D77A 3S0BA 2P70A 1QWVA 2QEVA 1DQEA 4PT1A 3L4AA 5EL2A 2L2CA 3S0FA 3CZ2A 1C3ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QDI A;  3D73 A;  2WCH A;  3K1E A;  1OOF A;  3DXL A;  3DYE A;  1ORG A;  2QEO A;  3R1O A;  3B6X A;  2WC6 A;  4F7F A;  1GM0 A;  3BFB A;  3BFH A;  3R1P A;  3QME A;  3B7A A;  3CZ0 A;  3D76 A;  4INX A;  3L47 A;  3B86 A;  2GTE A;  1LS8 A;  3B88 A;  3DZT A;  2WC5 A;  4OZD A;  3S0E A;  3BJH A;  3S0G A;  5DIC A;  3R72 A;  1XFR A;  3V2L A;  2KPH A;  3FE9 A;  2QEB A;  1OOG A;  3OGN A;  3DY9 A;  3VB1 A;  2WCL A;  3PJI A;  3R1V A;  3L4L A;  1OOI X;  3CZ1 A;  3D75 A;  3Q8I A;  3CAB A;  3BFA A;  3S0D A;  4FQT A;  4INW A;  3CDN A;  1T14 A;  2P71 A;  3NGV A;  2WCK A;  2JPO A;  3N7H A;  4JD9 A;  2QEH A;  3B87 A;  3D74 A;  1OOH A;  3CYZ A;  2ERB A;  3FE6 A;  3FE8 A;  3RZS A;  2PQL A;  2WCJ A;  2FJY A;  3NHI A;  1C3Y A;  1P28 A;  3NHT A;  3S0A A;  2WCM A;  3D78 A;  2H8V A;  1TUJ A;  1OW4 A;  1TWO A;  3D77 A;  3S0B A;  2P70 A;  1QWV A;  2QEV A;  1DQE A;  4PT1 A;  3L4A A;  5EL2 A;  2L2C A;  3S0F A;  3CZ2 A;  1C3Z A; 
#chains in the Genus database with same CATH topology
 1Z4H A;  1M63 B;  2JUL A;  2WCH A;  1IQ5 A;  5HYD A;  1IKU A;  1CDM A;  2L5X B;  3EKH A;  1KQV A;  3CZT X;  3BYA A;  2A4J A;  1QVI Y;  2HF5 A;  1BF5 A;  2PVB A;  2WND A;  1SPY A;  4JWQ A;  1SK6 D;  3VRQ A;  3LL8 B;  4GFT A;  3UO9 A;  5FI6 A;  5D69 A;  3R1O A;  1CDL A;  1CM4 A;  2JT3 A;  4IJ7 A;  4F7F A;  2KQY A;  1CMF A;  2E6W A;  1S5G Z;  3BOW B;  5CPV A;  1S6I A;  1WDC B;  2KAY A;  1Y1U A;  3DVK A;  3R1P A;  2F33 A;  2MRD A;  2MAZ A;  2WCE A;  3KO0 A;  1CDN A;  1B7T Y;  2BBM A;  4YRU A;  2PSR A;  3O4X A;  4GGN A;  3L47 A;  1N65 A;  1U5I A;  2WC5 A;  4OZD A;  1QLS A;  2F3Y A;  1B1G A;  5DKR A;  1YRU B;  3HCM A;  1BG1 A;  3I5G C;  1QIV A;  2KBI A;  3I5I B;  4GBA A;  5B8I B;  3DVJ A;  5G08 A;  5DIC A;  2JNX A;  1MF8 B;  2WOS A;  1TNP A;  1RTP 1;  1YUR A;  1K90 D;  4ICB A;  4PHJ A;  2KI4 B;  2SCP A;  2JPT A;  3FE9 A;  1GGW A;  1OOG A;  4CFQ A;  1AJ4 A;  1FF1 A;  2KI6 C;  2R2I A;  3GK2 A;  3D0Y A;  1G8I A;  1ALV A;  2M97 A;  3JTD B;  1DTL A;  3L4L A;  2KYC A;  5AXI A;  2IS9 A;  1ZAC A;  1OOI X;  5HKY A;  2JZI A;  3LLE A;  3A8R A;  3Q8I A;  4PE7 A;  2BKH B;  2QAC A;  3LK1 A;  3C1V A;  1SW8 A;  4NQG A;  1F71 A;  1F4O A;  1LIN A;  3I5H B;  3VRN A;  1YVH A;  2KFG A;  3AKA A;  3DVM A;  4MEW A;  3CTN A;  4PCW A;  2EC6 C;  2GGM A;  3DF0 B;  4PE4 A;  2HPS A;  1F8H A;  2NLN A;  5J3X A;  2JTT A;  1T14 A;  3PLF B;  1AHR A;  3NGV A;  4C0J A;  2BL0 C;  2WCK A;  1J7O A;  2TN4 A;  4Q04 A;  4GUK A;  1YUU A;  2L5Y A;  2QEH A;  3B87 A;  4M2P A;  5CSJ A;  3OX6 A;  2L51 A;  1S5G Y;  2M29 A;  3O4Y A;  1CMG A;  2ERB A;  3PN7 C;  4P5O E;  5HLO A;  2LNK A;  1DJH A;  5KSZ A;  1KFU L;  5I2O A;  1SBJ A;  1KWO C;  4GAO A;  4ZCV A;  5I8N A;  2NZ0 A;  1MQ1 A;  1FPW A;  1UHH A;  2AMI A;  3CWG A;  2FJY A;  5I2Q A;  3EK8 A;  3KF9 A;  3UNW A;  2KHN A;  1GGZ A;  2LLT A;  1JFK A;  1Q80 A;  2OS8 B;  5HKW A;  3RLZ A;  1C3Y A;  1KK8 B;  2L50 A;  2D8N A;  1RK9 A;  2H61 A;  1TCF A;  2M9G A;  1K9P A;  2WCM A;  1TUJ A;  1RFJ A;  3WHT B;  1QX2 A;  3SG3 A;  3IQQ A;  3PJI A;  2HQ8 A;  3D77 A;  5PAL A;  1LVC D;  3S0B A;  3CR2 A;  4I5N B;  3PSR A;  3BUO B;  2ZKM X;  1W7I B;  1QAT A;  1RJV A;  4R1E A;  2BAP A;  1BLQ A;  1F70 A;  1IRJ A;  4A4B A;  1N0Y A;  1OMV A;  1MWN A;  2JXC A;  2F3Z A;  3CGA A;  1UUS A;  5EL2 A;  2K7O A;  1NUB A;  2LVV A;  2M8U A;  4XJK B;  3BQ3 A;  5D3O A;  3SIA A;  1C3Z A;  4GGF A;  4L9M A;  1CLL A;  2KGR A;  1UHK A;  4DRW A;  1OMD A;  1SCM B;  4GGF C;  2I7A A;  1HT9 A;  1TCO B;  4YI9 A;  4YBH B;  1IWQ A;  1B4C A;  2CT9 A;  1XFU O;  2L98 A;  1QX5 B;  5HL1 A;  3VRR A;  4HRE E;  1OOJ A;  4BY5 A;  2GGZ A;  3DYE A;  4PE1 A;  3O6B A;  3O78 A;  4WQ3 A;  2PAL A;  1YX7 A;  4A4C A;  1OE9 B;  2JC2 A;  2JT0 A;  1IH0 A;  1FBV A;  1WLZ A;  2LP3 A;  3NXA A;  2KI6 D;  3IF7 A;  3OB2 B;  3B6X A;  1D1O A;  2LVJ A;  2P6B B;  3GOF A;  3KHE A;  4NDB A;  1JBA A;  2KNE A;  1GM0 A;  2LC5 A;  3OX5 A;  1NX2 A;  1DVI A;  2JQ6 A;  2KBM A;  1IG5 A;  1LA3 A;  1S36 A;  2BBN A;  1DGU A;  3B7A A;  5HKZ A;  1IIO A;  1LA0 A;  1J7P A;  1DJZ A;  1J7R A;  3I5F C;  3SG6 A;  4INX A;  4DIR A;  1PSB A;  2LCP A;  1KSO A;  4KYN A;  3B86 A;  1A2X A;  4OV2 A;  3WXA A;  3SS4 A;  5KU1 A;  4MRY A;  3TS5 B;  1BU3 A;  2MLE C;  3BJH A;  3VGO A;  1NCY A;  4PHM A;  5AAN A;  3R72 A;  3QRX A;  4E68 A;  1UWO A;  1TIZ A;  1M39 A;  2OPO A;  4MBE A;  4PAL A;  2KLE A;  3V2L A;  2KPH A;  2I18 A;  2K7D A;  3KEV A;  1XA5 A;  1KSM A;  5CSF A;  2K0J A;  2QEB A;  4YGB B;  2NXQ A;  1ZFS A;  2KQ6 A;  3FS7 A;  1OMR A;  1GQM A;  1OZO A;  2WCL A;  2KFF A;  1RRO A;  2HQW A;  1QJT A;  2BKI B;  2L0P A;  3JVT C;  4MZK A;  3D75 A;  1L2O B;  1ALW A;  3CAB A;  5K89 A;  1AP4 A;  5AER A;  4ORB B;  2BCX A;  1KK7 Z;  2NCP A;  3CDN A;  2FOT A;  2KDH A;  1CFD A;  5AFP A;  1YUT A;  3IVT A;  1YVL A;  1QAS A;  3OBV A;  2OTG C;  2JPO A;  1DEK A;  4JKT A;  4NDD A;  3GK1 A;  1DF0 B;  1SKT A;  1EG3 A;  1OOH A;  1S26 D;  3LCP C;  4C0L A;  4USL A;  3CYZ A;  1OSA A;  4NDC A;  2JNF A;  3SG7 A;  1SL9 A;  4YGE B;  3SG2 A;  1F55 A;  3A4U B;  3RZS A;  1M45 A;  2KYF A;  3GK4 X;  1REC A;  4GPL B;  1EL4 A;  1K93 D;  1KQM C;  1QV1 A;  3D10 A;  1MXL C;  3DF0 A;  1TN4 A;  3I5H C;  1SR6 C;  3I5G B;  1HQV A;  3OB1 B;  4BY4 A;  3NHT A;  1AK8 A;  3PAL A;  4JPZ B;  2ZNE A;  1ZOT B;  1PRW A;  1WRZ A;  3EK4 A;  4CID A;  1QXP A;  1DJG A;  2L2E A;  2P70 A;  2LV7 A;  4OVN F;  1QWV A;  1FI5 A;  2CBL A;  4MVF A;  1TUZ A;  4OR9 B;  2O60 A;  4DUQ A;  4CPV A;  1CLB A;  3EK7 A;  1XK4 A;  3ZWH A;  4C0K A;  3SS3 A;  1L7Z A;  1XK4 C;  3D0Y B;  2L2C A;  3S0F A;  1K96 A;  1SCV A;  3PM2 A;  2JOJ A;  4MRX A;  1QV0 A;  1DJX A;  1NX3 A;  3AAK A;  3ICB A;  2B1U A;  2M1U A;  2EC6 B;  2LUX A;  3D73 A;  3K1E A;  1OOF A;  2MLF C;  1C7V A;  4HRH A;  1DJI A;  2LUC A;  5JOL A;  1K95 A;  4I5J A;  1KCY A;  1QS7 A;  1NCX A;  2WCB A;  1QLK A;  5F6T A;  2H61 C;  4WQ2 A;  3BUX B;  1J55 A;  3TZ1 A;  2JXL A;  3OHM B;  2G9B A;  2LM5 A;  3PN7 B;  3BFB A;  2FJU B;  1CDP A;  4XJK A;  1KWO B;  1Y0V H;  3FWC A;  1BMO A;  1SL8 A;  1JC2 A;  2JTZ A;  1TNQ A;  1V1G A;  2Y4Q A;  3CZ0 A;  3NSI A;  1CNP A;  2KAV A;  1PK0 D;  3M0W A;  4PHN A;  4TNC A;  1SYM A;  2BE6 A;  2DOQ A;  2LMV A;  3CR4 X;  2GTE A;  2K7C A;  5AEQ A;  1R2U A;  5JJG A;  1QTX A;  3SG4 A;  1BR1 B;  1RWY A;  3TDU A;  2MBX A;  1JUO A;  3MSE B;  5ER4 X;  1DGV A;  3S0G A;  1CM1 A;  2BCB A;  2V53 A;  3AKB A;  1X02 A;  3SS5 A;  1YR5 A;  3DD4 A;  2K2A A;  2G2B A;  5DKN A;  1J1D A;  1YTZ C;  4FTG A;  1B9A A;  1K9U A;  2COL B;  4DS7 A;  5I2L A;  4JQ0 D;  1K9K A;  3DY9 A;  1CFC A;  2KAX A;  4YI8 A;  2M7N A;  2LAN A;  3E3R A;  3VB1 A;  3R1V A;  2BCA A;  2ZN9 A;  1OZS A;  4ETO A;  3CZ1 A;  1FW4 A;  2ZFD A;  1B7T Z;  2CNP A;  4ZCU A;  3TUY B;  1UHI A;  2LHI A;  2CTN A;  2M49 B;  3BFA A;  2F2O A;  1A75 B;  1TNW A;  2JT8 A;  2L4H A;  4YGD B;  3S0D A;  4INW A;  3O2P A;  2BE4 A;  2K8M B;  4GNK B;  1G4Y R;  1XYD A;  2LMT A;  2M0R A;  4OCI A;  1WRL A;  3N7H A;  4FQO A;  2ZND A;  1YUS A;  1XFW O;  4JD9 A;  1A4P A;  3CLN A;  1JWD A;  2K60 A;  1UUR A;  1JF0 A;  3BOW A;  1B8C A;  1N2D A;  1S6J A;  2AUC A;  1S1E A;  3FE6 A;  1NPQ A;  3K21 A;  1WDC C;  4P2Y B;  2L4I A;  2PRU A;  3SIB A;  1BOD A;  3I5F B;  1XVJ A;  1MR8 A;  2QPT A;  1L2O C;  1LXF C;  2M7L A;  2PMY A;  1WLM A;  3VRP A;  1CKK A;  1NIW A;  3NHI A;  2SAS A;  1IJ5 A;  3BUN B;  2KSP A;  1SNL A;  2LAP A;  1MXE A;  2JWW A;  1C07 A;  1NCZ A;  1S6C A;  3D78 A;  5D7F A;  3I5I C;  1H8B A;  1OW4 A;  1K8U A;  1TWO A;  1OQP A;  1NX1 A;  2ZN8 A;  1TRF A;  1DF0 A;  1CTR A;  1SY9 A;  1AVS A;  3FIA A;  4M2Q A;  2NCO A;  1AJ5 A;  1Y1X A;  2K61 A;  1J7Q A;  2KI4 C;  1ODB A;  2KGB C;  1XFY O;  1K2H A;  1BT6 A;  1DJW A;  2Y1M A;  3SJS A;  3OP0 A;  3JVT B;  4PT1 A;  1M46 A;  3TDI A;  2MJW B;  3L4A A;  1W9Z A;  3KPX A;  3JTD C;  5FI7 A;  4YGA A;  1MHO A;  1CB1 A;  1PUL A;  5I94 A;  2F2P A;  3WHU B;  2K7B A;  5GQQ C;  1NX0 A;  4MN0 A;  4HSZ A;  1KFX S;  1XFX O;  3EVU A;  4MZL A;  2QDI A;  2PYQ A;  1UHN A;  1U5I B;  2LVK A;  3DXL A;  2ISD A;  4OKH A;  1GJY A;  1DC1 A;  1CFP A;  2OTG B;  1EG4 A;  2E30 A;  1JFJ A;  1BR4 B;  4AQI A;  1A29 A;  1ORG A;  2F8P A;  1PAL A;  1CLM A;  2CXJ A;  2QEO A;  1C7W A;  1DEL A;  1R6P A;  3ZNI A;  5BPJ A;  1EJ3 A;  1JF2 A;  4N5X A;  2WC6 A;  4N1G A;  4DCK A;  2CCM A;  3BFH A;  2M3W A;  1WY9 A;  4D1E A;  3QME A;  2LVI A;  2FCE A;  1DJY A;  1M31 A;  1SMG A;  3SG5 A;  5KTY A;  5CSN A;  3EG5 B;  3HX4 A;  3H4S E;  1IQ3 A;  3D76 A;  1KQM B;  1UP5 A;  1NWD A;  1QIW A;  4QJ5 B;  1SR6 B;  3B88 A;  1LS8 A;  3DZT A;  4WRI A;  1NSH A;  1J1E A;  1PVA A;  2LP2 A;  1VRK A;  2Y5I A;  1KK7 Y;  3CS1 A;  3EKJ A;  4MSP A;  1PSR A;  3BXK A;  2AAO A;  2JU0 A;  2I2R E;  2OS8 C;  3S0E A;  5FYX A;  1KK8 C;  3PM8 A;  2EHB A;  3DVE A;  3PFV A;  2BL0 B;  1BOC A;  4HRG A;  1XFR A;  1ZUZ A;  2MA2 A;  2ZRS A;  1Z2C B;  3BUW B;  3IQO A;  3VRO A;  1F54 A;  1B8R A;  2H2K A;  2EGD A;  3OGN A;  5ER5 A;  1LKJ A;  4AOM A;  2RGI A;  2BNX A;  1K94 A;  2LE9 B;  1IGV A;  1ZMZ A;  1NYA A;  2LHL A;  4UPG A;  1Y1A A;  4YGC B;  4IL1 A;  2WC8 A;  1UHJ A;  1S3P A;  1V1F A;  1W7J B;  3CR5 X;  1AUI B;  1SL7 A;  3NSO A;  1IJ6 A;  4CLN A;  1SCM C;  2WCF A;  4FQT A;  1TTX A;  3RM1 A;  3LK0 A;  1CFF A;  2P71 A;  4M2O A;  4CFR A;  1B47 A;  1QVI Z;  2YGU A;  2ZRT A;  1FI6 A;  3AAJ A;  3NSL A;  1YX8 A;  1Y6W A;  2KLD A;  3EVV A;  4AQJ A;  2FCD A;  3D74 A;  4MLW A;  3PAT A;  2I94 A;  5IBW A;  4U8D A;  5FI2 A;  1BJF A;  5HLV A;  3TDZ A;  4F0Z B;  3FE8 A;  4MZJ A;  4PHK A;  2Q4U A;  1XFZ O;  2O5G A;  1G33 A;  1A03 A;  4QJ4 B;  2PQL A;  1TOP A;  1A75 A;  1WRK A;  2WCJ A;  3WNX B;  3TUY C;  1DT7 B;  1SRA A;  2GV5 A;  4I5K A;  2LMU A;  4PDZ A;  1F4Q A;  4N1F A;  1P28 A;  3BUM B;  1KFU S;  3S0A A;  1XFV O;  2KFH A;  2BEC A;  2Q91 A;  2H8V A;  2JRF A;  2LLU A;  2HET A;  2MHH A;  3F45 A;  3TS5 C;  4QJ3 B;  5DKQ A;  4PE0 A;  1JSA A;  1XO5 A;  2WOR A;  4I5L B;  4ORA B;  2KOT A;  2VRG A;  3FWB A;  2QEV A;  1DQE A;  1PVB A;  4XYN A;  1EH2 A;  1B8L A;  3EVR A;  1E8A A;  1KFX L;  2K2F A;  1NP8 A;  3NSK A;  5TNC A;  1H4B A;  1YRT B;  2LLS A;  5CSI A;  1SSE B;  1EXR A;  1MUX A;  1TNX A;  2M1K B;  1DMO A;  3CZ2 A;  4ORC B;  2PAS A;  1QX7 A;  2Y1N A; 
#chains in the Genus database with same CATH homology
 2QDI A;  3D73 A;  2WCH A;  3K1E A;  1OOF A;  3DXL A;  3DYE A;  1ORG A;  2QEO A;  3R1O A;  3B6X A;  2WC6 A;  4F7F A;  1GM0 A;  3BFB A;  3BFH A;  3R1P A;  3QME A;  3B7A A;  3CZ0 A;  3D76 A;  4INX A;  3L47 A;  3B86 A;  2GTE A;  1LS8 A;  3B88 A;  3DZT A;  2WC5 A;  4OZD A;  3S0E A;  3BJH A;  3S0G A;  5DIC A;  3R72 A;  1XFR A;  3V2L A;  2KPH A;  3FE9 A;  2QEB A;  1OOG A;  3OGN A;  3DY9 A;  3VB1 A;  2WCL A;  3PJI A;  3R1V A;  3L4L A;  1OOI X;  3CZ1 A;  3D75 A;  3Q8I A;  3CAB A;  3BFA A;  3S0D A;  4FQT A;  4INW A;  3CDN A;  1T14 A;  2P71 A;  3NGV A;  2WCK A;  2JPO A;  3N7H A;  4JD9 A;  2QEH A;  3B87 A;  3D74 A;  1OOH A;  3CYZ A;  2ERB A;  3FE6 A;  3FE8 A;  3RZS A;  2PQL A;  2WCJ A;  2FJY A;  3NHI A;  1C3Y A;  1P28 A;  3NHT A;  3S0A A;  2WCM A;  3D78 A;  2H8V A;  1TUJ A;  1OW4 A;  1TWO A;  3D77 A;  3S0B A;  2P70 A;  1QWV A;  2QEV A;  1DQE A;  4PT1 A;  3L4A A;  5EL2 A;  2L2C A;  3S0F A;  3CZ2 A;  1C3Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...