2PQLA

Crystal structure of anopheles gambiae d7r4-tryptamine complex
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
144
structure length
144
Chain Sequence
ETVQDCENKLPPSLKSRLCEIRRYEIIEGPEMDKHIHCVMRALDFVYEDGRGDYHKLYDPLNIIELDKRHDVNLEKCIGECVQVPTSERAHVFYKCLLKSTTGRTFKKVFDLMELKKAGKVPQHQRYTAEFVQIMKDYDKALNC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords D7r4 protein
publication title The Crystal Structure of D7r4, a Salivary Biogenic Amine-binding Protein from the Malaria Mosquito Anopheles gambiae.
pubmed doi rcsb
source organism Anopheles gambiae
molecule tags Transport protein
total genus 56
structure length 144
sequence length 144
ec nomenclature
pdb deposition date 2007-05-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.20 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 Pheromone/general odorant binding protein domain 2pqlA00
3S0GA 3BFBA 3R1OA 1C3YA 3R72A 2L2CA 3CYZA 2WCLA 2FJYA 4FQTA 3DXLA 4OZDA 1OOGA 3RZSA 2WC6A 3NHIA 1QWVA 2JPOA 3B87A 3S0FA 3L47A 2QEHA 1OW4A 1OOHA 4PT1A 3OGNA 2P70A 3K1EA 3R1VA 1TUJA 2WC5A 3PJIA 2WCKA 3CZ2A 3D73A 5EL2A 4F7FA 3N7HA 3V2LA 3VB1A 2QEVA 3NHTA 3BFHA 2QDIA 3D76A 3R1PA 3B6XA 3B86A 3DYEA 1GM0A 3B88A 1P28A 3D77A 3CZ1A 3NGVA 3QMEA 3BFAA 1ORGA 1XFRA 3D74A 4INWA 3DY9A 2QEBA 2WCJA 3BJHA 3L4LA 2WCHA 3B7AA 3S0BA 1C3ZA 2KPHA 5DICA 1T14A 3CZ0A 2QEOA 2GTEA 3S0EA 1TWOA 4JD9A 3CDNA 1OOFA 3D78A 3D75A 2H8VA 3CABA 2P71A 1OOIX 3Q8IA 4INXA 3L4AA 3S0DA 3FE8A 2WCMA 3FE6A 3FE9A 1DQEA 2PQLA 3DZTA 2ERBA 3S0AA 1LS8A
chains in the Genus database with same CATH superfamily
1IKUA 1M31A 1Y6WA 5FYXA 2O60A 1DF0A 2KFHA 1BF5A 1WDCB 2KYCA 2ZRTA 4PHJA 2KAXA 2K61A 4XYNA 1B7TZ 1JF0A 1WDCC 1TTXA 1QIWA 4N1FA 5HKZA 5BPJA 1QX2A 2JT8A 1K95A 5CPVA 5GQQC 2KBIA 4R1EA 2NXQA 1Y1AA 1FF1A 2L98A 1NUBA 2FOTA 2K2FA 1BJFA 4HREE 1F8HA 2G9BA 2L2EA 2ZRSA 2FJYA 1EG4A 4FQTA 3LK0A 1L7ZA 1WRLA 1V1FA 2K60A 1TCFA 1IQ5A 1SK6D 1FPWA 3RZSA 3VRQA 1K96A 2WOSA 1MXEA 1SL8A 2KQYA 5HL1A 3BXKA 1GJYA 3M0WA 1MHOA 1G4YR 1QWVA 3B87A 4PCWA 1KCYA 4MRXA 1DT7B 2HQWA 4N1GA 4D1EA 1IIOA 2M97A 3L47A 1KSOA 1WRKA 3CTNA 3DVEA 2LVKA 4BY4A 1YVLA 1OW4A 1CKKA 1DJHA 1Q80A 3E3RA 1B47A 4PT1A 1U5IA 1OZOA 2DOQA 4HRHA 1PVBA 4PE7A 2MJWB 2P70A 2BCXA 4WQ3A 1SKTA 2FCDA 2L50A 1TOPA 2LC5A 3AKBA 1JSAA 3ZWHA 2KLDA 2F3YA 4ZCVA 1PALA 3SG7A 5JJGA 4YRUA 4OVNF 1YRTB 3DVJA 1ZACA 1TNPA 1N0YA 5FI2A 1G8IA 1ZFSA 3PJIA 3SG2A 5AXIA 1A2XA 4OCIA 1K93D 3D73A 2O5GA 1QS7A 4MLWA 4AQJA 5PALA 3KF9A 2KI6D 2ZNEA 2ZN9A 1NCYA 3FIAA 5DKRA 1CLMA 2QDIA 5F6TA 1KFXL 3D76A 2LLSA 3R1PA 5ER5A 1A4PA 3RM1A 1OQPA 3B6XA 3B86A 3D10A 5KSZA 1PVAA 4M2PA 5D7FA 1RWYA 3DYEA 4TNCA 1GM0A 3B88A 5CSNA 2BCAA 1AVSA 1S1EA 1ZOTB 4YGCB 1QXPA 3CLNA 4MN0A 1M63B 3GK1A 3D74A 4N5XA 4C0KA 3DY9A 5DKNA 2CXJA 4JWQA 2PVBA 2AAOA 4C0LA 1NX0A 4GNKB 4MRYA 1J1EA 1IWQA 1CFCA 1RROA 1BMOA 3S0BA 1C3ZA 2KPHA 1TNQA 1ODBA 3JTDB 3BUXB 3CZ0A 4ICBA 4PE0A 3LCPC 1C7WA 4IL1A 2H61A 3JTDC 3KO0A 4I5NB 1NPQA 3WXAA 3CDNA 1OOFA 2KGRA 3D78A 4A4CA 2MLFC 5I94A 2P71A 5D3OA 4QJ4B 2KYFA 3L4AA 1LXFC 1QIVA 1QVIY 2PALA 3FE8A 4YI8A 1DELA 1XFVO 1GGWA 3DZTA 1J1DA 2BE4A 3S0AA 4GGFA 2JC2A 1HT9A 2BAPA 3BUMB 4P2YB 2A4JA 2HPSA 3PALA 1H8BA 2HETA 1OZSA 1A75A 3A8RA 2M29A 3TS5B 1CM4A 3R1OA 1W7JB 1XO5A 3O4YA 2NZ0A 3TS5C 1K2HA 1DJYA 3CR5X 3R72A 3BUWB 1BR4B 4CFRA 4F0ZB 1JWDA 2EC6B 1Z2CB 2I7AA 4ORBB 2KBMA 1QJTA 3FWCA 2BE6A 3AKAA 1RJVA 2BECA 1QLSA 2EC6C 3I5FB 3OX5A 3OX6A 3PLFB 3SIAA 2NCPA 1CFDA 3I5FC 1OSAA 2FJUB 1UHIA 2L0PA 3NHIA 1UHJA 2WORA 1BOCA 1OOJA 3BYAA 2JPOA 4NDCA 4NQGA 4XJKB 1CDNA 1TUZA 1CLBA 1KFXS 1XK4C 4UPGA 1XVJA 3PM2A 1LA0A 2E30A 5K89A 1ZMZA 2KFFA 1VRKA 2BBNA 1YRUB 1JFJA 1JC2A 5AANA 1V1GA 1B7TY 1CDLA 3DD4A 3BOWB 1E8AA 1M46A 2JXCA 1B8LA 1BT6A 1UHKA 3K1EA 3OGNA 5HLVA 3VRPA 3GOFA 2K8MB 3CR2A 1YVHA 3I5HB 2BKHB 2KHNA 1YX8A 1MUXA 3VRNA 1EG3A 3CR4X 2NLNA 2PMYA 3I5HC 4NDBA 1RTP1 1PRWA 2WCKA 3CZ2A 3EK7A 1IRJA 5EL2A 1J7PA 1XFWO 1F4QA 1UUSA 2L5XB 1OMVA 1BODA 5KU1A 1NYAA 1QTXA 2KFGA 3VB1A 4HRGA 1YR5A 1L2OB 2JOJA 4M2QA 1MWNA 1S6CA 2ISDA 1EL4A 2LP3A 1S6IA 1NIWA 2JULA 1L2OC 2M3WA 1K90D 3TZ1A 1ALVA 3I5GB 2E6WA 2F3ZA 3CS1A 3NSKA 1P28A 5CSIA 5TNCA 4DS7A 4GGNA 2L4IA 3HCMA 1UHHA 3I5GC 3EVVA 1W9ZA 1ORGA 4JKTA 1QV1A 2LLTA 3VROA 4INWA 2D8NA 2JRFA 2QEBA 2MBXA 1CNPA 2JZIA 4I5JA 1M39A 5KTYA 4YI9A 1FI5A 1TCOB 1LINA 1B1GA 1DVIA 2LE9B 3SS4A 3CWGA 2WCHA 1DTLA 1DMOA 1IGVA 1A29A 3TDUA 1T14A 5CSJA 4E68A 5G08A 4USLA 2GTEA 3RLZA 1S5GZ 2ZNDA 2YGUA 1TWOA 2F33A 2GV5A 2Y1NA 5HKWA 1UP5A 4JD9A 3LL8B 5AERA 2VRGA 1S5GY 1K9PA 1CMGA 3LK1A 4PHMA 5FI6A 4CFQA 1GQMA 1YUSA 4Q04A 1JFKA 1MQ1A 2H2KA 2Y4QA 2L5YA 1PULA 3S0DA 4M2OA 2LVVA 3O2PA 1KFUL 3FE9A 1NCZA 4DRWA 2PQLA 1DJWA 2F8PA 2K2AA 1NX2A 2KAVA 2ERBA 2BCBA 2MRDA 2M1KB 2Q4UA 3QRXA 1J7RA 4KYNA 4XJKA 3OBVA 1DEKA 1IQ3A 1TNXA 4L9MA 1XA5A 3ZNIA 3BFBA 1N2DA 1CDPA 3DF0B 4YBHB 2B1UA 2MHHA 3BOWA 2KQ6A 3FWBA 1F4OA 1SCVA 1KQVA 2SASA 4PE4A 1RFJA 2M7LA 1NP8A 2JT3A 3CYZA 3KHEA 4AQIA 1BLQA 4I5LB 2CT9A 1C7VA 1H4BA 3VRRA 4JPZB 3PM8A 4U8DA 2JPTA 1OOGA 5CSFA 5FI7A 2SCPA 4GFTA 4FTGA 1HQVA 1CB1A 1J55A 1B4CA 1PK0D 2LHIA 1BR1B 4I5KA 3K21A 5D69A 2LNKA 3EKHA 4ZCUA 3D0YB 1XYDA 2JWWA 1DJGA 1F54A 3IVTA 1XFYO 2HQ8A 4MZKA 2QEHA 5I2OA 1M45A 4PHNA 3KEVA 1NX1A 2KNEA 1SL9A 2EHBA 4GPLB 1U5IB 2EGDA 2WC8A 5AFPA 1WLMA 3UNWA 1KK7Z 2LVJA 3EK4A 5HKYA 2G2BA 2KAYA 5JOLA 5B8IB 4ETOA 3A4UB 4QJ3B 2I2RE 2I94A 3I5IB 1SRAA 2QACA 1SL7A 1SCMC 3IQQA 2LUCA 3PFVA 1NX3A 1SSEB 4NDDA 1KK8B 3DVKA 3I5IC 1NSHA 1S6JA 2LMVA 2Q91A 1NCXA 1TRFA 1KK8C 2LLUA 4OV2A 1JBAA 1CM1A 1QLKA 2QEVA 1Z4HA 3AAJA 1F70A 1FI6A 2KOTA 2BL0B 5ER4X 1AUIB 1MR8A 2L4HA 2LM5A 1KFUS 4MSPA 1AJ5A 2BL0C 2LMUA 5I2QA 3VGOA 1B9AA 3D77A 2TN4A 3CZ1A 1UURA 3NGVA 4CPVA 3QMEA 4GBAA 1X02A 4MEWA 1CMFA 1XFRA 2LVIA 1RK9A 2BNXA 2F2OA 3PN7B 3KPXA 2LCPA 1SYMA 1JF2A 2WCJA 3PSRA 1XFXO 1S26D 3BJHA 2MA2A 3L4LA 3PN7C 3WHTB 3SG4A 5AEQA 3DF0A 3WNXB 2LP2A 4YGBB 1DJZA 1BU3A 4IJ7A 4YGAA 1K9UA 2HF5A 1YUUA 1QV0A 1UWOA 2JTZA 2LHLA 1WLZA 5DICA 2K7DA 5J3XA 2QEOA 4A4BA 5IBWA 1ZUZA 4MZLA 3S0EA 1FW4A 3OHMB 4MBEA 3TDIA 1CFFA 3EKJA 3D75A 2H8VA 2Y1MA 1WRZA 2CNPA 3CABA 1OMRA 3MSEB 2JNXA 2KGBC 2H61C 3Q8IA 3GK2A 4INXA 2GGMA 3O6BA 1CLLA 2WCMA 1LA3A 3BUOB 2K7OA 1K8UA 1DQEA 1AJ4A 3GK4X 4DCKA 2IS9A 1Y1UA 2JU0A 3CZTX 1XFZO 2GGZA 1AHRA 3H4SE 2KI4B 3D0YA 3S0GA 2P6BB 2L51A 1J7QA 2ZKMX 1QASA 3WHUB 4GGFC 1MXLC 1A75B 1TIZA 2AUCA 1KSMA 2KI4C 2LV7A 1JUOA 4P5OE 4C0JA 1MF8B 4QJ5B 1DJXA 1OMDA 2OPOA 2JXLA 4MVFA 1AK8A 1C07A 4WRIA 1SNLA 2KSPA 1C3YA 2PSRA 2L2CA 4CIDA 3EVUA 3OP0A 4CLNA 2FCEA 2BKIB 2WCLA 1YUTA 4FQOA 1LVCD 2LUXA 5HLOA 2V53A 2WCBA 3DVMA 3SS5A 4BY5A 1QATA 4JQ0D 4YGEB 1WY9A 2F2PA 1K94A 1B8CA 1SPYA 1Y0VH 3DXLA 1OE9B 3LLEA 4OZDA 2JT0A 1XK4A 2WCEA 2WC6A 4HSZA 2K7CA 2MAZA 2QPTA 3SG6A 2Y5IA 3SIBA 3HX4A 1DJIA 4PHKA 3S0FA 4AOMA 3EG5B 3OB2B 2KLEA 1YURA 1SMGA 2KI6C 1DF0B 2LAPA 2PRUA 1D1OA 1DGUA 2MLEC 2M0RA 3EK8A 1OOHA 1W7IB 1R2UA 3UO9A 3C1VA 1BG1A 1SY9A 4OKHA 1IJ6A 1TN4A 5DKQA 1CDMA 3NXAA 2WNDA 3BUNB 3NSIA 3AAKA 2ZFDA 3PATA 3SS3A 3ICBA 3OB1B 5I8NA 1S3PA 1G33A 2CCMA 4GAOA 3R1VA 2KDHA 4ORCB 1EXRA 1J7OA 1KQMB 1TUJA 2CTNA 2WC5A 2I18A 3SG5A 3NSOA 1PSBA 1XFUO 3SG3A 2AMIA 1KQMC 1ALWA 2JTTA 2PYQA 4MZJA 2PASA 4DIRA 2M49B 4F7FA 3N7HA 3V2LA 2CBLA 1TNWA 3TUYB 2COLB 3NHTA 1SW8A 3IF7A 3BFHA 1RECA 2M7NA 3FS7A 3TUYC 4YGDB 3SJSA 5HYDA 1UHNA 1QVIZ 1EJ3A 1K9KA 1YTZC 2M9GA 2BBMA 1FBVA 1DC1A 1IJ5A 3JVTB 4ORAB 1PSRA 2WCFA 2R2IA 1Y1XA 3IQOA 3BFAA 1SCMB 2RGIA 3JVTC 1KK7Y 2LMTA 4OR9B 1NWDA 2M1UA 1SR6B 1CFPA 2K0JA 3CGAA 1A03A 1F71A 2M8UA 3B7AA 2NCOA 1SBJA 1CTRA 2OTGB 4PE1A 1SR6C 1QX7A 1F55A 1QX5B 2JNFA 3TDZA 1YX7A 2OTGC 3O78A 4WQ2A 5I2LA 1AP4A 2OS8B 1GGZA 1IG5A 1KWOB 2OS8C 1OOIX 1EH2A 1IH0A 1R6PA 1KWOC 2LANA 3NSLA 3F45A 4PALA 4GUKA 3O4XA 4PDZA 2K7BA 3FE6A 3BQ3A 2JQ6A 1B8RA 1S36A 1LKJA 2ZN8A 1N65A 1DGVA 4DUQA 1LS8A 3EVRA
chains in the Genus database with same CATH topology
3S0GA 3BFBA 3R1OA 1C3YA 3R72A 2L2CA 3CYZA 2WCLA 2FJYA 4FQTA 3DXLA 4OZDA 1OOGA 3RZSA 2WC6A 3NHIA 1QWVA 2JPOA 3B87A 3S0FA 3L47A 2QEHA 1OW4A 1OOHA 4PT1A 3OGNA 2P70A 3K1EA 3R1VA 1TUJA 2WC5A 3PJIA 2WCKA 3CZ2A 3D73A 5EL2A 4F7FA 3N7HA 3V2LA 3VB1A 2QEVA 3NHTA 3BFHA 2QDIA 3D76A 3R1PA 3B6XA 3B86A 3DYEA 1GM0A 3B88A 1P28A 3D77A 3CZ1A 3NGVA 3QMEA 3BFAA 1ORGA 1XFRA 3D74A 4INWA 3DY9A 2QEBA 2WCJA 3BJHA 3L4LA 2WCHA 3B7AA 3S0BA 1C3ZA 2KPHA 5DICA 1T14A 3CZ0A 2QEOA 2GTEA 3S0EA 1TWOA 4JD9A 3CDNA 1OOFA 3D78A 3D75A 2H8VA 3CABA 2P71A 1OOIX 3Q8IA 4INXA 3L4AA 3S0DA 3FE8A 2WCMA 3FE6A 3FE9A 1DQEA 2PQLA 3DZTA 2ERBA 3S0AA 1LS8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3S0G A;  3BFB A;  3R1O A;  1C3Y A;  3R72 A;  2L2C A;  3CYZ A;  2WCL A;  2FJY A;  4FQT A;  3DXL A;  4OZD A;  1OOG A;  3RZS A;  2WC6 A;  3NHI A;  1QWV A;  2JPO A;  3B87 A;  3S0F A;  3L47 A;  2QEH A;  1OW4 A;  1OOH A;  4PT1 A;  3OGN A;  2P70 A;  3K1E A;  3R1V A;  1TUJ A;  2WC5 A;  3PJI A;  2WCK A;  3CZ2 A;  3D73 A;  5EL2 A;  4F7F A;  3N7H A;  3V2L A;  3VB1 A;  2QEV A;  3NHT A;  3BFH A;  2QDI A;  3D76 A;  3R1P A;  3B6X A;  3B86 A;  3DYE A;  1GM0 A;  3B88 A;  1P28 A;  3D77 A;  3CZ1 A;  3NGV A;  3QME A;  3BFA A;  1ORG A;  1XFR A;  3D74 A;  4INW A;  3DY9 A;  2QEB A;  2WCJ A;  3BJH A;  3L4L A;  2WCH A;  3B7A A;  3S0B A;  1C3Z A;  2KPH A;  5DIC A;  1T14 A;  3CZ0 A;  2QEO A;  2GTE A;  3S0E A;  1TWO A;  4JD9 A;  3CDN A;  1OOF A;  3D78 A;  3D75 A;  2H8V A;  3CAB A;  2P71 A;  1OOI X;  3Q8I A;  4INX A;  3L4A A;  3S0D A;  3FE8 A;  2WCM A;  3FE6 A;  3FE9 A;  1DQE A;  2PQL A;  3DZT A;  2ERB A;  3S0A A;  1LS8 A; 
#chains in the Genus database with same CATH topology
 1IKU A;  1M31 A;  1Y6W A;  5FYX A;  2O60 A;  1DF0 A;  2KFH A;  1BF5 A;  1WDC B;  2KYC A;  2ZRT A;  4PHJ A;  2KAX A;  2K61 A;  4XYN A;  1B7T Z;  1JF0 A;  1WDC C;  1TTX A;  1QIW A;  4N1F A;  5HKZ A;  5BPJ A;  1QX2 A;  2JT8 A;  1K95 A;  5CPV A;  5GQQ C;  2KBI A;  4R1E A;  2NXQ A;  1Y1A A;  1FF1 A;  2L98 A;  1NUB A;  2FOT A;  2K2F A;  1BJF A;  4HRE E;  1F8H A;  2G9B A;  2L2E A;  2ZRS A;  2FJY A;  1EG4 A;  4FQT A;  3LK0 A;  1L7Z A;  1WRL A;  1V1F A;  2K60 A;  1TCF A;  1IQ5 A;  1SK6 D;  1FPW A;  3RZS A;  3VRQ A;  1K96 A;  2WOS A;  1MXE A;  1SL8 A;  2KQY A;  5HL1 A;  3BXK A;  1GJY A;  3M0W A;  1MHO A;  1G4Y R;  1QWV A;  3B87 A;  4PCW A;  1KCY A;  4MRX A;  1DT7 B;  2HQW A;  4N1G A;  4D1E A;  1IIO A;  2M97 A;  3L47 A;  1KSO A;  1WRK A;  3CTN A;  3DVE A;  2LVK A;  4BY4 A;  1YVL A;  1OW4 A;  1CKK A;  1DJH A;  1Q80 A;  3E3R A;  1B47 A;  4PT1 A;  1U5I A;  1OZO A;  2DOQ A;  4HRH A;  1PVB A;  4PE7 A;  2MJW B;  2P70 A;  2BCX A;  4WQ3 A;  1SKT A;  2FCD A;  2L50 A;  1TOP A;  2LC5 A;  3AKB A;  1JSA A;  3ZWH A;  2KLD A;  2F3Y A;  4ZCV A;  1PAL A;  3SG7 A;  5JJG A;  4YRU A;  4OVN F;  1YRT B;  3DVJ A;  1ZAC A;  1TNP A;  1N0Y A;  5FI2 A;  1G8I A;  1ZFS A;  3PJI A;  3SG2 A;  5AXI A;  1A2X A;  4OCI A;  1K93 D;  3D73 A;  2O5G A;  1QS7 A;  4MLW A;  4AQJ A;  5PAL A;  3KF9 A;  2KI6 D;  2ZNE A;  2ZN9 A;  1NCY A;  3FIA A;  5DKR A;  1CLM A;  2QDI A;  5F6T A;  1KFX L;  3D76 A;  2LLS A;  3R1P A;  5ER5 A;  1A4P A;  3RM1 A;  1OQP A;  3B6X A;  3B86 A;  3D10 A;  5KSZ A;  1PVA A;  4M2P A;  5D7F A;  1RWY A;  3DYE A;  4TNC A;  1GM0 A;  3B88 A;  5CSN A;  2BCA A;  1AVS A;  1S1E A;  1ZOT B;  4YGC B;  1QXP A;  3CLN A;  4MN0 A;  1M63 B;  3GK1 A;  3D74 A;  4N5X A;  4C0K A;  3DY9 A;  5DKN A;  2CXJ A;  4JWQ A;  2PVB A;  2AAO A;  4C0L A;  1NX0 A;  4GNK B;  4MRY A;  1J1E A;  1IWQ A;  1CFC A;  1RRO A;  1BMO A;  3S0B A;  1C3Z A;  2KPH A;  1TNQ A;  1ODB A;  3JTD B;  3BUX B;  3CZ0 A;  4ICB A;  4PE0 A;  3LCP C;  1C7W A;  4IL1 A;  2H61 A;  3JTD C;  3KO0 A;  4I5N B;  1NPQ A;  3WXA A;  3CDN A;  1OOF A;  2KGR A;  3D78 A;  4A4C A;  2MLF C;  5I94 A;  2P71 A;  5D3O A;  4QJ4 B;  2KYF A;  3L4A A;  1LXF C;  1QIV A;  1QVI Y;  2PAL A;  3FE8 A;  4YI8 A;  1DEL A;  1XFV O;  1GGW A;  3DZT A;  1J1D A;  2BE4 A;  3S0A A;  4GGF A;  2JC2 A;  1HT9 A;  2BAP A;  3BUM B;  4P2Y B;  2A4J A;  2HPS A;  3PAL A;  1H8B A;  2HET A;  1OZS A;  1A75 A;  3A8R A;  2M29 A;  3TS5 B;  1CM4 A;  3R1O A;  1W7J B;  1XO5 A;  3O4Y A;  2NZ0 A;  3TS5 C;  1K2H A;  1DJY A;  3CR5 X;  3R72 A;  3BUW B;  1BR4 B;  4CFR A;  4F0Z B;  1JWD A;  2EC6 B;  1Z2C B;  2I7A A;  4ORB B;  2KBM A;  1QJT A;  3FWC A;  2BE6 A;  3AKA A;  1RJV A;  2BEC A;  1QLS A;  2EC6 C;  3I5F B;  3OX5 A;  3OX6 A;  3PLF B;  3SIA A;  2NCP A;  1CFD A;  3I5F C;  1OSA A;  2FJU B;  1UHI A;  2L0P A;  3NHI A;  1UHJ A;  2WOR A;  1BOC A;  1OOJ A;  3BYA A;  2JPO A;  4NDC A;  4NQG A;  4XJK B;  1CDN A;  1TUZ A;  1CLB A;  1KFX S;  1XK4 C;  4UPG A;  1XVJ A;  3PM2 A;  1LA0 A;  2E30 A;  5K89 A;  1ZMZ A;  2KFF A;  1VRK A;  2BBN A;  1YRU B;  1JFJ A;  1JC2 A;  5AAN A;  1V1G A;  1B7T Y;  1CDL A;  3DD4 A;  3BOW B;  1E8A A;  1M46 A;  2JXC A;  1B8L A;  1BT6 A;  1UHK A;  3K1E A;  3OGN A;  5HLV A;  3VRP A;  3GOF A;  2K8M B;  3CR2 A;  1YVH A;  3I5H B;  2BKH B;  2KHN A;  1YX8 A;  1MUX A;  3VRN A;  1EG3 A;  3CR4 X;  2NLN A;  2PMY A;  3I5H C;  4NDB A;  1RTP 1;  1PRW A;  2WCK A;  3CZ2 A;  3EK7 A;  1IRJ A;  5EL2 A;  1J7P A;  1XFW O;  1F4Q A;  1UUS A;  2L5X B;  1OMV A;  1BOD A;  5KU1 A;  1NYA A;  1QTX A;  2KFG A;  3VB1 A;  4HRG A;  1YR5 A;  1L2O B;  2JOJ A;  4M2Q A;  1MWN A;  1S6C A;  2ISD A;  1EL4 A;  2LP3 A;  1S6I A;  1NIW A;  2JUL A;  1L2O C;  2M3W A;  1K90 D;  3TZ1 A;  1ALV A;  3I5G B;  2E6W A;  2F3Z A;  3CS1 A;  3NSK A;  1P28 A;  5CSI A;  5TNC A;  4DS7 A;  4GGN A;  2L4I A;  3HCM A;  1UHH A;  3I5G C;  3EVV A;  1W9Z A;  1ORG A;  4JKT A;  1QV1 A;  2LLT A;  3VRO A;  4INW A;  2D8N A;  2JRF A;  2QEB A;  2MBX A;  1CNP A;  2JZI A;  4I5J A;  1M39 A;  5KTY A;  4YI9 A;  1FI5 A;  1TCO B;  1LIN A;  1B1G A;  1DVI A;  2LE9 B;  3SS4 A;  3CWG A;  2WCH A;  1DTL A;  1DMO A;  1IGV A;  1A29 A;  3TDU A;  1T14 A;  5CSJ A;  4E68 A;  5G08 A;  4USL A;  2GTE A;  3RLZ A;  1S5G Z;  2ZND A;  2YGU A;  1TWO A;  2F33 A;  2GV5 A;  2Y1N A;  5HKW A;  1UP5 A;  4JD9 A;  3LL8 B;  5AER A;  2VRG A;  1S5G Y;  1K9P A;  1CMG A;  3LK1 A;  4PHM A;  5FI6 A;  4CFQ A;  1GQM A;  1YUS A;  4Q04 A;  1JFK A;  1MQ1 A;  2H2K A;  2Y4Q A;  2L5Y A;  1PUL A;  3S0D A;  4M2O A;  2LVV A;  3O2P A;  1KFU L;  3FE9 A;  1NCZ A;  4DRW A;  2PQL A;  1DJW A;  2F8P A;  2K2A A;  1NX2 A;  2KAV A;  2ERB A;  2BCB A;  2MRD A;  2M1K B;  2Q4U A;  3QRX A;  1J7R A;  4KYN A;  4XJK A;  3OBV A;  1DEK A;  1IQ3 A;  1TNX A;  4L9M A;  1XA5 A;  3ZNI A;  3BFB A;  1N2D A;  1CDP A;  3DF0 B;  4YBH B;  2B1U A;  2MHH A;  3BOW A;  2KQ6 A;  3FWB A;  1F4O A;  1SCV A;  1KQV A;  2SAS A;  4PE4 A;  1RFJ A;  2M7L A;  1NP8 A;  2JT3 A;  3CYZ A;  3KHE A;  4AQI A;  1BLQ A;  4I5L B;  2CT9 A;  1C7V A;  1H4B A;  3VRR A;  4JPZ B;  3PM8 A;  4U8D A;  2JPT A;  1OOG A;  5CSF A;  5FI7 A;  2SCP A;  4GFT A;  4FTG A;  1HQV A;  1CB1 A;  1J55 A;  1B4C A;  1PK0 D;  2LHI A;  1BR1 B;  4I5K A;  3K21 A;  5D69 A;  2LNK A;  3EKH A;  4ZCU A;  3D0Y B;  1XYD A;  2JWW A;  1DJG A;  1F54 A;  3IVT A;  1XFY O;  2HQ8 A;  4MZK A;  2QEH A;  5I2O A;  1M45 A;  4PHN A;  3KEV A;  1NX1 A;  2KNE A;  1SL9 A;  2EHB A;  4GPL B;  1U5I B;  2EGD A;  2WC8 A;  5AFP A;  1WLM A;  3UNW A;  1KK7 Z;  2LVJ A;  3EK4 A;  5HKY A;  2G2B A;  2KAY A;  5JOL A;  5B8I B;  4ETO A;  3A4U B;  4QJ3 B;  2I2R E;  2I94 A;  3I5I B;  1SRA A;  2QAC A;  1SL7 A;  1SCM C;  3IQQ A;  2LUC A;  3PFV A;  1NX3 A;  1SSE B;  4NDD A;  1KK8 B;  3DVK A;  3I5I C;  1NSH A;  1S6J A;  2LMV A;  2Q91 A;  1NCX A;  1TRF A;  1KK8 C;  2LLU A;  4OV2 A;  1JBA A;  1CM1 A;  1QLK A;  2QEV A;  1Z4H A;  3AAJ A;  1F70 A;  1FI6 A;  2KOT A;  2BL0 B;  5ER4 X;  1AUI B;  1MR8 A;  2L4H A;  2LM5 A;  1KFU S;  4MSP A;  1AJ5 A;  2BL0 C;  2LMU A;  5I2Q A;  3VGO A;  1B9A A;  3D77 A;  2TN4 A;  3CZ1 A;  1UUR A;  3NGV A;  4CPV A;  3QME A;  4GBA A;  1X02 A;  4MEW A;  1CMF A;  1XFR A;  2LVI A;  1RK9 A;  2BNX A;  2F2O A;  3PN7 B;  3KPX A;  2LCP A;  1SYM A;  1JF2 A;  2WCJ A;  3PSR A;  1XFX O;  1S26 D;  3BJH A;  2MA2 A;  3L4L A;  3PN7 C;  3WHT B;  3SG4 A;  5AEQ A;  3DF0 A;  3WNX B;  2LP2 A;  4YGB B;  1DJZ A;  1BU3 A;  4IJ7 A;  4YGA A;  1K9U A;  2HF5 A;  1YUU A;  1QV0 A;  1UWO A;  2JTZ A;  2LHL A;  1WLZ A;  5DIC A;  2K7D A;  5J3X A;  2QEO A;  4A4B A;  5IBW A;  1ZUZ A;  4MZL A;  3S0E A;  1FW4 A;  3OHM B;  4MBE A;  3TDI A;  1CFF A;  3EKJ A;  3D75 A;  2H8V A;  2Y1M A;  1WRZ A;  2CNP A;  3CAB A;  1OMR A;  3MSE B;  2JNX A;  2KGB C;  2H61 C;  3Q8I A;  3GK2 A;  4INX A;  2GGM A;  3O6B A;  1CLL A;  2WCM A;  1LA3 A;  3BUO B;  2K7O A;  1K8U A;  1DQE A;  1AJ4 A;  3GK4 X;  4DCK A;  2IS9 A;  1Y1U A;  2JU0 A;  3CZT X;  1XFZ O;  2GGZ A;  1AHR A;  3H4S E;  2KI4 B;  3D0Y A;  3S0G A;  2P6B B;  2L51 A;  1J7Q A;  2ZKM X;  1QAS A;  3WHU B;  4GGF C;  1MXL C;  1A75 B;  1TIZ A;  2AUC A;  1KSM A;  2KI4 C;  2LV7 A;  1JUO A;  4P5O E;  4C0J A;  1MF8 B;  4QJ5 B;  1DJX A;  1OMD A;  2OPO A;  2JXL A;  4MVF A;  1AK8 A;  1C07 A;  4WRI A;  1SNL A;  2KSP A;  1C3Y A;  2PSR A;  2L2C A;  4CID A;  3EVU A;  3OP0 A;  4CLN A;  2FCE A;  2BKI B;  2WCL A;  1YUT A;  4FQO A;  1LVC D;  2LUX A;  5HLO A;  2V53 A;  2WCB A;  3DVM A;  3SS5 A;  4BY5 A;  1QAT A;  4JQ0 D;  4YGE B;  1WY9 A;  2F2P A;  1K94 A;  1B8C A;  1SPY A;  1Y0V H;  3DXL A;  1OE9 B;  3LLE A;  4OZD A;  2JT0 A;  1XK4 A;  2WCE A;  2WC6 A;  4HSZ A;  2K7C A;  2MAZ A;  2QPT A;  3SG6 A;  2Y5I A;  3SIB A;  3HX4 A;  1DJI A;  4PHK A;  3S0F A;  4AOM A;  3EG5 B;  3OB2 B;  2KLE A;  1YUR A;  1SMG A;  2KI6 C;  1DF0 B;  2LAP A;  2PRU A;  1D1O A;  1DGU A;  2MLE C;  2M0R A;  3EK8 A;  1OOH A;  1W7I B;  1R2U A;  3UO9 A;  3C1V A;  1BG1 A;  1SY9 A;  4OKH A;  1IJ6 A;  1TN4 A;  5DKQ A;  1CDM A;  3NXA A;  2WND A;  3BUN B;  3NSI A;  3AAK A;  2ZFD A;  3PAT A;  3SS3 A;  3ICB A;  3OB1 B;  5I8N A;  1S3P A;  1G33 A;  2CCM A;  4GAO A;  3R1V A;  2KDH A;  4ORC B;  1EXR A;  1J7O A;  1KQM B;  1TUJ A;  2CTN A;  2WC5 A;  2I18 A;  3SG5 A;  3NSO A;  1PSB A;  1XFU O;  3SG3 A;  2AMI A;  1KQM C;  1ALW A;  2JTT A;  2PYQ A;  4MZJ A;  2PAS A;  4DIR A;  2M49 B;  4F7F A;  3N7H A;  3V2L A;  2CBL A;  1TNW A;  3TUY B;  2COL B;  3NHT A;  1SW8 A;  3IF7 A;  3BFH A;  1REC A;  2M7N A;  3FS7 A;  3TUY C;  4YGD B;  3SJS A;  5HYD A;  1UHN A;  1QVI Z;  1EJ3 A;  1K9K A;  1YTZ C;  2M9G A;  2BBM A;  1FBV A;  1DC1 A;  1IJ5 A;  3JVT B;  4ORA B;  1PSR A;  2WCF A;  2R2I A;  1Y1X A;  3IQO A;  3BFA A;  1SCM B;  2RGI A;  3JVT C;  1KK7 Y;  2LMT A;  4OR9 B;  1NWD A;  2M1U A;  1SR6 B;  1CFP A;  2K0J A;  3CGA A;  1A03 A;  1F71 A;  2M8U A;  3B7A A;  2NCO A;  1SBJ A;  1CTR A;  2OTG B;  4PE1 A;  1SR6 C;  1QX7 A;  1F55 A;  1QX5 B;  2JNF A;  3TDZ A;  1YX7 A;  2OTG C;  3O78 A;  4WQ2 A;  5I2L A;  1AP4 A;  2OS8 B;  1GGZ A;  1IG5 A;  1KWO B;  2OS8 C;  1OOI X;  1EH2 A;  1IH0 A;  1R6P A;  1KWO C;  2LAN A;  3NSL A;  3F45 A;  4PAL A;  4GUK A;  3O4X A;  4PDZ A;  2K7B A;  3FE6 A;  3BQ3 A;  2JQ6 A;  1B8R A;  1S36 A;  1LKJ A;  2ZN8 A;  1N65 A;  1DGV A;  4DUQ A;  1LS8 A;  3EVR A; 
#chains in the Genus database with same CATH homology
 3S0G A;  3BFB A;  3R1O A;  1C3Y A;  3R72 A;  2L2C A;  3CYZ A;  2WCL A;  2FJY A;  4FQT A;  3DXL A;  4OZD A;  1OOG A;  3RZS A;  2WC6 A;  3NHI A;  1QWV A;  2JPO A;  3B87 A;  3S0F A;  3L47 A;  2QEH A;  1OW4 A;  1OOH A;  4PT1 A;  3OGN A;  2P70 A;  3K1E A;  3R1V A;  1TUJ A;  2WC5 A;  3PJI A;  2WCK A;  3CZ2 A;  3D73 A;  5EL2 A;  4F7F A;  3N7H A;  3V2L A;  3VB1 A;  2QEV A;  3NHT A;  3BFH A;  2QDI A;  3D76 A;  3R1P A;  3B6X A;  3B86 A;  3DYE A;  1GM0 A;  3B88 A;  1P28 A;  3D77 A;  3CZ1 A;  3NGV A;  3QME A;  3BFA A;  1ORG A;  1XFR A;  3D74 A;  4INW A;  3DY9 A;  2QEB A;  2WCJ A;  3BJH A;  3L4L A;  2WCH A;  3B7A A;  3S0B A;  1C3Z A;  2KPH A;  5DIC A;  1T14 A;  3CZ0 A;  2QEO A;  2GTE A;  3S0E A;  1TWO A;  4JD9 A;  3CDN A;  1OOF A;  3D78 A;  3D75 A;  2H8V A;  3CAB A;  2P71 A;  1OOI X;  3Q8I A;  4INX A;  3L4A A;  3S0D A;  3FE8 A;  2WCM A;  3FE6 A;  3FE9 A;  1DQE A;  2PQL A;  3DZT A;  2ERB A;  3S0A A;  1LS8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...