3CZTX

Crystal structure of s100b in the calcium and zinc loaded state at ph 9
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
91
structure length
91
Chain Sequence
MSELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDNDGDGECDFQEFMAFVAMVTTACHEFFEH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords Protein S100-B
publication title The crystal structures of human S100B in the zinc- and calcium-loaded state at three pH values reveal zinc ligand swapping.
pubmed doi rcsb
source organism Homo sapiens
total genus 32
structure length 91
sequence length 91
ec nomenclature
pdb deposition date 2008-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00036 EF-hand_1 EF hand
X PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3cztX00
1K90D 2LLSA 1LKJA 1J55A 3JVTB 2M97A 4DCKA 1XFYO 1IQ3A 4PE0A 4GFTA 1DJIA 1K93D 4HRHA 3SG6A 1GJYA 1JFKA 2WCFA 1BOCA 1IGVA 3PALA 2L4HA 2MBXA 4YGEB 4JPZB 1F71A 2JU0A 4QJ4B 1JFJA 4ETOA 4N5XA 1BR4B 1CM1A 1KFUS 3GK4X 2BCXA 1M63B 1UUSA 1JC2A 3VRQA 1IKUA 1AUIB 2L4IA 5HKYA 1J7QA 1B4CA 2LP3A 1SK6D 5DKRA 1KQMC 5PALA 2FOTA 1EJ3A 4AOMA 4HSZA 2JZIA 4A4CA 1BU3A 3SG4A 1K95A 1MXLC 1TOPA 2OS8B 3O2PA 3SG3A 3GK1A 4DRWA 1QVIY 1U5IB 1MQ1A 3KHEA 1C7VA 3I5IB 1PALA 1UHHA 1FPWA 1GGWA 2L0PA 1C07A 1ZMZA 3VGOA 1OOJA 1SCVA 1QXPA 1QX2A 5D69A 2WNDA 1SR6B 2KYCA 3PFVA 1QX7A 2BKIB 1IG5A 1WDCC 2CTNA 4QJ3B 3VRPA 4AQJA 2WCBA 2R2IA 2GV5A 3SIBA 1UWOA 4XJKA 1QS7A 3KO0A 1KCYA 1G4YR 2H61C 1BMOA 2JXCA 2H61A 1OMRA 2KAVA 1SRAA 1EXRA 2M8UA 3HX4A 1FW4A 1FBVA 3WHUB 1H8BA 2KAXA 3CZTX 1RJVA 2LP2A 2JWWA 3LK1A 4I5NB 4P5OE 2NCPA 1B1GA 3EK4A 5AXIA 1QATA 3JVTC 1DTLA 1KFUL 1YURA 5D7FA 1J7PA 1S5GY 1V1FA 1CLBA 2I7AA 3JTDB 1KQVA 3SG7A 2F2OA 1SKTA 3CWGA 1QV0A 1JF0A 3NSKA 2F3YA 1QIVA 4PHJA 1RWYA 4DUQA 1R2UA 4YI8A 1S6JA 1M39A 1S36A 1A29A 1K9KA 1YX8A 1KQMB 4PHKA 1CMGA 3EKJA 4A4BA 3CGAA 3SG2A 2F8PA 4CFRA 2CXJA 1Y1XA 2M49B 1OQPA 1J1EA 1NCZA 1PSRA 1F55A 1UHJA 1EH2A 2G2BA 5I2QA 1OMDA 4F0ZB 4M2OA 2KGBC 2LVJA 2OS8C 1KWOC 1TRFA 2D8NA 2WCEA 4U8DA 5HLOA 1MUXA 1CFPA 1JBAA 1TCFA 1C7WA 3I5IC 1U5IA 1UHNA 1PRWA 1M31A 2MA2A 1K94A 1NWDA 2MLFC 4ORCB 1WDCB 2BL0C 1MF8B 1J7OA 1DVIA 2K7OA 2EC6C 1NUBA 3SJSA 2JT0A 1TN4A 2HQ8A 2PALA 1SR6C 2JC2A 4OV2A 2FCDA 3KEVA 1L7ZA 1OMVA 3I5HB 1AJ4A 3AKBA 4GBAA 1K96A 5TNCA 3FIAA 1RFJA 2H2KA 2OPOA 4YGCB 1DJWA 3RM1A 1NP8A 4N1FA 3GK2A 3I5GC 3CTNA 1LA0A 1TNQA 1JF2A 5CSFA 3FWBA 3O6BA 2Y4QA 1B47A 2BE6A 4NDBA 5HKWA 1KSOA 4HREE 4M2QA 2KQYA 1XA5A 3BUNB 1N0YA 2LVIA 4JQ0D 2AUCA 1IJ5A 1Y1AA 1WRLA 3JTDC 5F6TA 1XFXO 5I2OA 2BBMA 2FCEA 2M3WA 5ER4X 1BG1A 3PM8A 2JTZA 2MAZA 2K7BA 2BBNA 1Y1UA 3NSLA 2L50A 1XFZO 4YGDB 1JWDA 1A4PA 1NX3A 1F4OA 3O78A 2ISDA 1BR1B 4GGNA 3DVJA 3NSOA 2AAOA 1CDNA 3BYAA 1A2XA 4MZLA 4GAOA 1CFDA 4MRXA 1DF0B 1WLZA 3TDIA 2JNXA 4ORBB 3LK0A 2BECA 1YUSA 4PDZA 1AK8A 5FYXA 3FWCA 2HF5A 3F45A 1KWOB 2M0RA 3BXKA 4PHMA 3ZWHA 2KFHA 1HT9A 2LHIA 1FF1A 3TUYC 3K21A 1KK7Z 1WRKA 2BL0B 2F2PA 1BT6A 2IS9A 1XFUO 2LNKA 3CLNA 4N1GA 5ER5A 1Y6WA 2EC6B 2MHHA 2M1KB 1NX1A 3BUMB 1ZUZA 1GQMA 5CSNA 1RROA 3MSEB 1N2DA 1CDLA 1XK4C 1D1OA 2P6BB 1SY9A 2LHLA 5KU1A 1SL8A 1YVHA 1A03A 1F54A 2DOQA 3EKHA 1F70A 1YVLA 2KI4B 2O5GA 3DVKA 3I5HC 1XFVO 2L2EA 1SPYA 3I5GB 5I2LA 4MN0A 1TNPA 2LE9B 2LC5A 1NCYA 5HLVA 2BCAA 1QV1A 5CSIA 1TNWA 1SMGA 1XVJA 2L51A 2JPTA 2L98A 2ZNDA 3M0WA 4FTGA 1DJZA 1TCOB 5IBWA 5KSZA 1KK8C 1AJ5A 3PATA 3KPXA 1PVAA 2MRDA 2V53A 3OX5A 1CKKA 1N65A 2LMUA 3AAKA 3SIAA 2CCMA 3PN7C 1SL9A 2LVVA 1JUOA 4ICBA 4DS7A 1XO5A 1AVSA 4OCIA 3BOWB 5AFPA 1ALVA 2NZ0A 1RTP1 1L2OB 2LCPA 3D10A 5G08A 1PVBA 1SCMC 3OB2B 1CFFA 1LVCD 1YUTA 1ODBA 3IF7A 1IQ5A 3DF0A 4P2YB 1NPQA 1TTXA 1PULA 4WQ3A 2ZRSA 4NDDA 4USLA 2JTTA 2JOJA 2JQ6A 1DF0A 2WORA 1MWNA 1NCXA 2PSRA 3I5FC 1DGUA 1E8AA 3OX6A 3TUYB 1S1EA 2KQ6A 2NCOA 1A75B 1LINA 1H4BA 1QIWA 1S6CA 2MJWB 1YR5A 4XYNA 2COLB 1EG3A 3NSIA 1BLQA 2JNFA 1B7TZ 2E30A 3TDZA 2KI6D 2Q91A 4I5KA 4PCWA 4YI9A 1CMFA 1QX5B 1CFCA 2K2FA 4HRGA 2CT9A 4ZCVA 1UP5A 1QLKA 2LUXA 1CTRA 1HQVA 1W7IB 4PE4A 1NYAA 4MBEA 1J1DA 1EL4A 2KBMA 4D1EA 1LXFC 1YX7A 2BE4A 1QTXA 2KI4C 3EVUA 1SW8A 3O4YA 1VRKA 1CLMA 1YRUB 2LANA 1DJGA 1ZOTB 3FS7A 4C0LA 1B9AA 2K7CA 2AMIA 1BODA 1MR8A 1KK8B 2KSPA 3LLEA 2JT8A 3OB1B 3EVVA 4BY5A 3PN7B 4UPGA 2MLEC 3PSRA 2KFFA 3BQ3A 1FI6A 2JULA 4I5JA 3D0YA 1V1GA 4YRUA 2K8MB 4MLWA 1B8RA 4TNCA 4MEWA 1YUUA 1CDMA 1TIZA 1NSHA 3CR4X 1Q80A 1CM4A 1S3PA 3A4UB 5CPVA 1SCMB 2I94A 1OE9B 2JT3A 3EK7A 3EVRA 1IWQA 2ZN8A 3IQOA 3VRNA 3DF0B 3BOWA 4GGFC 1Y0VH 1L2OC 1CNPA 2PVBA 4GGFA 2KDHA 3NXAA 3RLZA 4BY4A 1UHIA 1SBJA 2LVKA 1SNLA 1K2HA 1G8IA 4IL1A 1ALWA 2SCPA 2LAPA 3I5FB 1B8LA 1DT7B 4MZKA 4MSPA 4NDCA 5GQQC 1EG4A 3A8RA 1DMOA 3EK8A 1SL7A 2KGRA 2NLNA 1KK7Y 1M46A 2GGMA 4L9MA 2M7LA 1KSMA 1M45A 4QJ5B 1GGZA 1SYMA 2KBIA 3IQQA 1F8HA 1A75A 2M9GA 2BCBA 4PALA 4PE7A 2LLUA 4JWQA 4DIRA 4ZCUA 3WNXB 4GNKB 5J3XA 2I2RE 1KFXS 3TS5C 2JRFA 1XK4A 1F4QA 2LLTA 1B8CA 2FJUB 1NX2A 2KNEA 2QPTA 2M7NA 3QRXA 3TZ1A 2HETA 4CLNA 1JSAA 4C0KA 2RGIA 5JJGA 1XFWO 4MZJA 1TNXA 2WC8A 2G9BA 3DD4A 2Y1MA 2E6WA 3LCPC 1QVIZ 2K0JA 5BPJA 2F3ZA 2OTGC 4MRYA 2M29A 2O60A 2KAYA 1CB1A 1K9PA 4MVFA 2B1UA 3SG5A 3DVMA 2A4JA 2LM5A 1ZFSA 2JXLA 1DGVA 3BUOB 3D0YB 4OKHA 1BF5A 5DKQA 2PASA 3OP0A 2LMVA 2EHBA 4YGBB 2HQWA 3BUXB 1CLLA 3CR2A 1X02A 2K2AA 5AERA 5K89A 2HPSA 4Q04A 2SASA 4WQ2A 1FI5A 1XYDA 1UURA 2BKHB 2K61A 1CDPA 3AKAA 3BUWB 2KHNA 2PMYA 2KFGA 1OZOA 2PRUA 1R6PA 4R1EA 4OR9B 1NIWA 3VRRA 4GUKA 2Q4UA 5HYDA 1PSBA 4YGAA 1QASA 3CS1A 1IH0A 3WXAA 2NXQA 1S26D 2QACA 1QJTA 1YTZC 3LL8B 4YBHB 3ZNIA 3OHMB 1MHOA 3VROA 2LMTA 2ZKMX 4CPVA 1KFXL 1S5GZ 1PK0D 2KOTA 1RECA 2LV7A 2ZRTA 4E68A 2TN4A 2ZNEA 4OVNF 1WY9A 2VRGA 2LUCA 1DJXA 4I5LB 1B7TY 2CBLA 2I18A 1LA3A 3C1VA 1S6IA 1MXEA 4PE1A 3TS5B 2L5XB 3KF9A 1G33A 5KTYA 5AEQA 1YRTB 3GOFA 4GPLB 1DJHA 4AQIA 1AP4A 2M1UA 1K9UA 2OTGB 2Y1NA 4CIDA 1DJYA 1IRJA 1W7JB 4ORAB 1K8UA 3WHTB 1NX0A 5JOLA 2EGDA 2F33A 1QLSA 2K7DA 3TDUA 1IJ6A 2KYFA 4XJKB 2KI6C 1ZACA 1WLMA 4C0JA 5B8IB 1WRZA 3ICBA 5I8NA 1RK9A 5DKNA 2ZN9A 2CNPA 3E3RA 3PLFB 4WRIA 5CSJA 2ZFDA 1OZSA 4CFQA 3H4SE 3CR5X 5AANA 4PHNA 5HKZA 4M2PA 4NQGA 1AHRA 2WOSA 4FQOA 2Y5IA 1J7RA 1BJFA 3HCMA 3DVEA 1OSAA 1UHKA 3AAJA 2GGZA
chains in the Genus database with same CATH superfamily
1K90D 2LLSA 1LKJA 1J55A 3JVTB 2M97A 4DCKA 3FE6A 1XFYO 1IQ3A 4PE0A 4GFTA 1DJIA 1K93D 4HRHA 3SG6A 1GJYA 1JFKA 2WCFA 1BOCA 1IGVA 3PALA 2BAPA 2L4HA 3IVTA 2MBXA 4YGEB 4JPZB 1F71A 3S0AA 2JU0A 4QJ4B 1JFJA 4ETOA 4F7FA 4N5XA 1BR4B 3DZTA 1CM1A 1KFUS 1OOIX 3GK4X 2BCXA 1M63B 1UUSA 3B6XA 1JC2A 3VRQA 1IKUA 1AUIB 2L4IA 2QEBA 5HKYA 1J7QA 1B4CA 2LP3A 1SK6D 5DKRA 1KQMC 5PALA 2FOTA 1EJ3A 3BFAA 4AOMA 2QEVA 4HSZA 2JZIA 4A4CA 1BU3A 3SG4A 1K95A 1MXLC 1TOPA 2OS8B 3O2PA 3SG3A 3GK1A 3NHIA 1LS8A 2JPOA 4DRWA 1QVIY 1U5IB 1MQ1A 3KHEA 3D78A 3I5IB 1C7VA 1PALA 1UHHA 1FPWA 1GGWA 2QEHA 2L0PA 3S0EA 1C07A 1ZMZA 3VGOA 1OOJA 1SCVA 3R1OA 1QXPA 1QX2A 5D69A 2WNDA 3R1VA 1SR6B 2KYCA 3PFVA 1QX7A 2BKIB 1IG5A 1WDCC 2CTNA 4QJ3B 3VRPA 4AQJA 2WCBA 2R2IA 2GV5A 3PM2A 3SIBA 1UWOA 4XJKA 1QS7A 3R1PA 4KYNA 3KO0A 3CZ2A 1KCYA 1G4YR 2H61C 3R72A 1BMOA 2JXCA 2H61A 1OMRA 2KAVA 1SRAA 1EXRA 2M8UA 3HX4A 1FW4A 1FBVA 3WHUB 1H8BA 2KAXA 3CZTX 1RJVA 2LP2A 2JWWA 3LK1A 4I5NB 4P5OE 1XFRA 2NCPA 1B1GA 3EK4A 5AXIA 1QATA 3JVTC 1DTLA 3OGNA 1KFUL 3L47A 1YURA 5D7FA 1J7PA 1S5GY 1V1FA 1CLBA 2I7AA 3JTDB 1KQVA 3SG7A 2F2OA 1SKTA 3CWGA 1QV0A 1JF0A 3NSKA 2F3YA 1W9ZA 1QIVA 1QWVA 3L4AA 3PJIA 1RWYA 4PHJA 1R2UA 4DUQA 4YI8A 1S6JA 2WC6A 1M39A 1S36A 1A29A 1K9KA 1YX8A 1KQMB 4PHKA 1CMGA 5D3OA 3EKJA 1DELA 4A4BA 3CGAA 3SG2A 2F8PA 4CFRA 2CXJA 1Y1XA 2M49B 1OQPA 3O4XA 1J1EA 1NCZA 1PSRA 1F55A 1UHJA 1EH2A 2G2BA 3VB1A 5I2QA 1OMDA 4F0ZB 4M2OA 2KGBC 2LVJA 2OS8C 1KWOC 3FE8A 1TRFA 2D8NA 2WCEA 4U8DA 5HLOA 1MUXA 3UO9A 1CFPA 1JBAA 1TCFA 1C7WA 1ORGA 3I5IC 1U5IA 1UHNA 1PRWA 1M31A 2MA2A 1K94A 1NWDA 5DICA 2MLFC 4ORCB 1WDCB 2BL0C 1MF8B 1J7OA 1DVIA 2K7OA 2EC6C 1NUBA 3SJSA 2JT0A 1TN4A 2HQ8A 2PALA 1SR6C 2JC2A 4OV2A 2FCDA 3KEVA 1L7ZA 1OMVA 3I5HB 1AJ4A 2L5YA 3AKBA 2P71A 1K96A 4GBAA 5TNCA 3FIAA 1RFJA 2H2KA 1TUZA 2OPOA 4YGCB 1DJWA 3RM1A 1T14A 1NP8A 4N1FA 3GK2A 3I5GC 3CTNA 1LA0A 1TNQA 1JF2A 1C3YA 2H8VA 5CSFA 3FWBA 3O6BA 2Y4QA 1B47A 2BE6A 4NDBA 5HKWA 1KSOA 3D75A 4HREE 4M2QA 2KQYA 1XA5A 3BUNB 1N0YA 2LVIA 4JQ0D 2WC5A 2AUCA 1IJ5A 3BFBA 1Y1AA 1WRLA 3JTDC 5F6TA 1XFXO 5I2OA 2BBMA 2FCEA 2M3WA 5ER4X 5I94A 1BG1A 3PM8A 2JTZA 2MAZA 2K7BA 2BBNA 1Y1UA 3NSLA 2L50A 1XFZO 4YGDB 1JWDA 1A4PA 1NX3A 1F4OA 3O78A 2ISDA 1BR1B 4GGNA 3DVJA 3NSOA 2AAOA 1CDNA 3B7AA 3BYAA 1A2XA 4MZLA 4GAOA 1CFDA 4MRXA 1DF0B 1WLZA 3TDIA 2JNXA 4ORBB 3LK0A 2BECA 3B87A 1YUSA 4PDZA 1AK8A 5FYXA 3FWCA 2K60A 2HF5A 3F45A 1KWOB 2M0RA 3BXKA 4PHMA 3ZWHA 1C3ZA 2KFHA 1HT9A 3S0GA 2LHIA 1FF1A 3TUYC 1SSEB 3NGVA 3K21A 1KK7Z 1WRKA 2BL0B 2F2PA 1BT6A 2IS9A 1XFUO 2LNKA 3CLNA 4N1GA 5ER5A 1Y6WA 2EC6B 2MHHA 2M1KB 1NX1A 3BUMB 1ZUZA 5EL2A 1GQMA 5CSNA 1RROA 4IJ7A 3MSEB 1N2DA 1CDLA 1XK4C 2GTEA 1D1OA 2P6BB 1SY9A 2LHLA 5KU1A 1SL8A 1YVHA 1A03A 1F54A 2DOQA 3EKHA 1F70A 1YVLA 2KI4B 2O5GA 3DVKA 3I5HC 3N7HA 1XFVO 2L2EA 1SPYA 3I5GB 1DQEA 5I2LA 4MN0A 1TNPA 2LE9B 2LC5A 1NCYA 5HLVA 2BCAA 1QV1A 5CSIA 1TNWA 1SMGA 1XVJA 2L51A 2JPTA 2L98A 2ZNDA 3M0WA 4FTGA 1DJZA 1TCOB 5IBWA 5KSZA 1KK8C 1AJ5A 3PATA 3KPXA 1PVAA 2MRDA 2V53A 3OX5A 1CKKA 1N65A 2LMUA 3AAKA 3CABA 3SIAA 1GM0A 2CCMA 3PN7C 1SL9A 2LVVA 1JUOA 4ICBA 4DS7A 1XO5A 1AVSA 4OCIA 3BOWB 5AFPA 1ALVA 1OOFA 1RTP1 2NZ0A 2BNXA 3UNWA 1L2OB 2LCPA 3D10A 5G08A 1PVBA 1SCMC 3OB2B 3OBVA 1CFFA 1LVCD 2YGUA 1YUTA 2PYQA 1ODBA 3EG5B 1IQ5A 3DF0A 3IF7A 4P2YB 1NPQA 1TTXA 1PULA 3DY9A 2ZRSA 4WQ3A 3V2LA 4NDDA 4USLA 2JTTA 2JOJA 2JQ6A 1DF0A 2WORA 1MWNA 1NCXA 2PSRA 3I5FC 1DGUA 1Z4HA 1E8AA 3OX6A 3TUYB 1S1EA 2KQ6A 2NCOA 1A75B 1LINA 1H4BA 1QIWA 3NHTA 1S6CA 2MJWB 3B86A 1YR5A 4XYNA 2COLB 1EG3A 3NSIA 1BLQA 2JNFA 2KLEA 1B7TZ 2E30A 3TDZA 2KI6D 2Q91A 4I5KA 4PCWA 4YI9A 1CMFA 1QX5B 1CFCA 2K2FA 2WCLA 4HRGA 2CT9A 4ZCVA 1UP5A 1QLKA 2LUXA 1CTRA 1HQVA 1W7IB 4PE4A 1NYAA 4MBEA 1J1DA 1EL4A 2KBMA 4D1EA 1LXFC 1YX7A 2BE4A 1QTXA 2L2CA 2KI4C 3CDNA 3EVUA 1SW8A 3O4YA 1VRKA 1CLMA 1YRUB 2LANA 1DJGA 1ZOTB 1OOHA 3FS7A 4C0LA 1B9AA 2K7CA 2AMIA 3DYEA 1BODA 1MR8A 1KK8B 2KSPA 3LLEA 2JT8A 3OB1B 3EVVA 4BY5A 3PN7B 4UPGA 2MLEC 3PSRA 2KFFA 3BQ3A 1FI6A 2JULA 4I5JA 3D0YA 1V1GA 4YRUA 2K8MB 4MLWA 1IIOA 1B8RA 3D73A 4MEWA 4TNCA 1YUUA 1CDMA 1TIZA 1NSHA 3CR4X 3FE9A 1Q80A 1CM4A 1S3PA 3A4UB 5CPVA 1SCMB 2I94A 1OE9B 2JT3A 3EK7A 3D76A 1IWQA 1P28A 2ZN8A 3EVRA 3IQOA 4INWA 3VRNA 3DF0B 3BOWA 4GGFC 1Y0VH 1L2OC 1CNPA 2PVBA 4GGFA 2KDHA 3NXAA 3RLZA 4BY4A 1UHIA 1SBJA 5HL1A 2LVKA 1SNLA 1K2HA 1G8IA 4IL1A 1ALWA 2SCPA 2LAPA 3D74A 1B8LA 3I5FB 1DT7B 4MZKA 4MSPA 4NDCA 5GQQC 1EG4A 3A8RA 1DMOA 3EK8A 1SL7A 2KGRA 2NLNA 1KK7Y 1M46A 2GGMA 4L9MA 2QEOA 2M7LA 1KSMA 1M45A 4QJ5B 1GGZA 2WCHA 1SYMA 2KBIA 3B88A 3IQQA 3BFHA 3SS5A 1F8HA 1A75A 2M9GA 2BCBA 4PALA 4PE7A 2LLUA 4JWQA 4DIRA 4ZCUA 3WNXB 4GNKB 5J3XA 2I2RE 1KFXS 3TS5C 2JRFA 1XK4A 1F4QA 2LLTA 3QMEA 1B8CA 2FJUB 1NX2A 2KNEA 2QPTA 1TWOA 2M7NA 3QRXA 3TZ1A 2HETA 4CLNA 1JSAA 4FQTA 4C0KA 2RGIA 3SS3A 5JJGA 1XFWO 2WCMA 2FJYA 1TNXA 4MZJA 1Z2CB 2WC8A 2G9BA 3DD4A 2Y1MA 2E6WA 3LCPC 1QVIZ 2K0JA 3BJHA 5BPJA 2F3ZA 2OTGC 4MRYA 1OOGA 2M29A 2O60A 2KAYA 1CB1A 1K9PA 4MVFA 2B1UA 3SG5A 3DVMA 4JD9A 2A4JA 2LM5A 1ZFSA 2JXLA 1DGVA 3BUOB 3D0YB 4OKHA 4OZDA 1BF5A 5DKQA 2PASA 2PQLA 3OP0A 2LMVA 2EHBA 4YGBB 2HQWA 3BUXB 1CLLA 3CR2A 4PT1A 1X02A 2K2AA 5AERA 5FI2A 5K89A 2HPSA 4Q04A 2SASA 3S0FA 3CZ0A 4WQ2A 1XYDA 1UURA 2BKHB 2K61A 1FI5A 2KPHA 1CDPA 3AKAA 3BUWB 2KHNA 5FI6A 2PMYA 2KFGA 1OZOA 2KLDA 2PRUA 1R6PA 4R1EA 4OR9B 1NIWA 3VRRA 4GUKA 2Q4UA 3SS4A 1PSBA 4YGAA 3S0BA 1QASA 5HYDA 3CS1A 1IH0A 3WXAA 2NXQA 1S26D 2QACA 1QJTA 1YTZC 2ERBA 3LL8B 4YBHB 3ZNIA 3OHMB 1MHOA 3VROA 2LMTA 2ZKMX 4CPVA 1KFXL 1S5GZ 1PK0D 2KOTA 1RECA 2LV7A 2ZRTA 3Q8IA 4E68A 2TN4A 2ZNEA 4OVNF 1WY9A 2VRGA 2LUCA 1DC1A 1DJXA 4I5LB 1B7TY 2WCKA 2CBLA 2I18A 1LA3A 3C1VA 1S6IA 1MXEA 4PE1A 3TS5B 2L5XB 3KF9A 1G33A 5KTYA 5AEQA 1YRTB 3GOFA 2P70A 4GPLB 4INXA 3RZSA 3S0DA 1DJHA 4AQIA 1AP4A 4JKTA 2M1UA 1K9UA 2QDIA 3CYZA 3CZ1A 1OW4A 2OTGB 2Y1NA 3L4LA 1DJYA 1IRJA 1W7JB 4ORAB 4CIDA 1DEKA 1K8UA 3WHTB 1TUJA 1NX0A 5JOLA 2EGDA 2F33A 1QLSA 2K7DA 3TDUA 1IJ6A 2KYFA 4XJKB 2KI6C 1ZACA 1WLMA 4C0JA 5B8IB 1WRZA 3ICBA 5I8NA 1RK9A 5DKNA 2ZN9A 2CNPA 3E3RA 3PLFB 4WRIA 2WCJA 3K1EA 2ZFDA 1OZSA 5CSJA 4CFQA 3H4SE 3CR5X 5AANA 4PHNA 5HKZA 4M2PA 4NQGA 1AHRA 2WOSA 4FQOA 2Y5IA 1J7RA 1BJFA 3HCMA 3DXLA 5FI7A 3DVEA 1OSAA 1UHKA 3D77A 3AAJA 2GGZA
chains in the Genus database with same CATH topology
1K90D 2LLSA 1LKJA 1J55A 3JVTB 2M97A 4DCKA 1XFYO 1IQ3A 4PE0A 4GFTA 1DJIA 1K93D 4HRHA 3SG6A 1GJYA 1JFKA 2WCFA 1BOCA 1IGVA 3PALA 2L4HA 2MBXA 4YGEB 4JPZB 1F71A 2JU0A 4QJ4B 1JFJA 4ETOA 4N5XA 1BR4B 1CM1A 1KFUS 3GK4X 2BCXA 1M63B 1UUSA 1JC2A 3VRQA 1IKUA 1AUIB 2L4IA 5HKYA 1J7QA 1B4CA 2LP3A 1SK6D 5DKRA 1KQMC 5PALA 2FOTA 1EJ3A 4AOMA 4HSZA 2JZIA 4A4CA 1BU3A 3SG4A 1K95A 1MXLC 1TOPA 2OS8B 3O2PA 3SG3A 3GK1A 4DRWA 1QVIY 1U5IB 1MQ1A 3KHEA 1C7VA 3I5IB 1PALA 1UHHA 1FPWA 1GGWA 2L0PA 1C07A 1ZMZA 3VGOA 1OOJA 1SCVA 1QXPA 1QX2A 5D69A 2WNDA 1SR6B 2KYCA 3PFVA 1QX7A 2BKIB 1IG5A 1WDCC 2CTNA 4QJ3B 3VRPA 4AQJA 2WCBA 2R2IA 2GV5A 3SIBA 1UWOA 4XJKA 1QS7A 3KO0A 1KCYA 1G4YR 2H61C 1BMOA 2JXCA 2H61A 1OMRA 2KAVA 1SRAA 1EXRA 2M8UA 3HX4A 1FW4A 1FBVA 3WHUB 1H8BA 2KAXA 3CZTX 1RJVA 2LP2A 2JWWA 3LK1A 4I5NB 4P5OE 2NCPA 1B1GA 3EK4A 5AXIA 1QATA 3JVTC 1DTLA 1KFUL 1YURA 5D7FA 1J7PA 1S5GY 1V1FA 1CLBA 2I7AA 3JTDB 1KQVA 3SG7A 2F2OA 1SKTA 3CWGA 1QV0A 1JF0A 3NSKA 2F3YA 1QIVA 4PHJA 1RWYA 4DUQA 1R2UA 4YI8A 1S6JA 1M39A 1S36A 1A29A 1K9KA 1YX8A 1KQMB 4PHKA 1CMGA 3EKJA 4A4BA 3CGAA 3SG2A 2F8PA 4CFRA 2CXJA 1Y1XA 2M49B 1OQPA 1J1EA 1NCZA 1PSRA 1F55A 1UHJA 1EH2A 2G2BA 5I2QA 1OMDA 4F0ZB 4M2OA 2KGBC 2LVJA 2OS8C 1KWOC 1TRFA 2D8NA 2WCEA 4U8DA 5HLOA 1MUXA 1CFPA 1JBAA 1TCFA 1C7WA 3I5IC 1U5IA 1UHNA 1PRWA 1M31A 2MA2A 1K94A 1NWDA 2MLFC 4ORCB 1WDCB 2BL0C 1MF8B 1J7OA 1DVIA 2K7OA 2EC6C 1NUBA 3SJSA 2JT0A 1TN4A 2HQ8A 2PALA 1SR6C 2JC2A 4OV2A 2FCDA 3KEVA 1L7ZA 1OMVA 3I5HB 1AJ4A 3AKBA 4GBAA 1K96A 5TNCA 3FIAA 1RFJA 2H2KA 2OPOA 4YGCB 1DJWA 3RM1A 1NP8A 4N1FA 3GK2A 3I5GC 3CTNA 1LA0A 1TNQA 1JF2A 5CSFA 3FWBA 3O6BA 2Y4QA 1B47A 2BE6A 4NDBA 5HKWA 1KSOA 4HREE 4M2QA 2KQYA 1XA5A 3BUNB 1N0YA 2LVIA 4JQ0D 2AUCA 1IJ5A 1Y1AA 1WRLA 3JTDC 5F6TA 1XFXO 5I2OA 2BBMA 2FCEA 2M3WA 5ER4X 1BG1A 3PM8A 2JTZA 2MAZA 2K7BA 2BBNA 1Y1UA 3NSLA 2L50A 1XFZO 4YGDB 1JWDA 1A4PA 1NX3A 1F4OA 3O78A 2ISDA 1BR1B 4GGNA 3DVJA 3NSOA 2AAOA 1CDNA 3BYAA 1A2XA 4MZLA 4GAOA 1CFDA 4MRXA 1DF0B 1WLZA 3TDIA 2JNXA 4ORBB 3LK0A 2BECA 1YUSA 4PDZA 1AK8A 5FYXA 3FWCA 2HF5A 3F45A 1KWOB 2M0RA 3BXKA 4PHMA 3ZWHA 2KFHA 1HT9A 2LHIA 1FF1A 3TUYC 3K21A 1KK7Z 1WRKA 2BL0B 2F2PA 1BT6A 2IS9A 1XFUO 2LNKA 3CLNA 4N1GA 5ER5A 1Y6WA 2EC6B 2MHHA 2M1KB 1NX1A 3BUMB 1ZUZA 1GQMA 5CSNA 1RROA 3MSEB 1N2DA 1CDLA 1XK4C 1D1OA 2P6BB 1SY9A 2LHLA 5KU1A 1SL8A 1YVHA 1A03A 1F54A 2DOQA 3EKHA 1F70A 1YVLA 2KI4B 2O5GA 3DVKA 3I5HC 1XFVO 2L2EA 1SPYA 3I5GB 5I2LA 4MN0A 1TNPA 2LE9B 2LC5A 1NCYA 5HLVA 2BCAA 1QV1A 5CSIA 1TNWA 1SMGA 1XVJA 2L51A 2JPTA 2L98A 2ZNDA 3M0WA 4FTGA 1DJZA 1TCOB 5IBWA 5KSZA 1KK8C 1AJ5A 3PATA 3KPXA 1PVAA 2MRDA 2V53A 3OX5A 1CKKA 1N65A 2LMUA 3AAKA 3SIAA 2CCMA 3PN7C 1SL9A 2LVVA 1JUOA 4ICBA 4DS7A 1XO5A 1AVSA 4OCIA 3BOWB 5AFPA 1ALVA 2NZ0A 1RTP1 1L2OB 2LCPA 3D10A 5G08A 1PVBA 1SCMC 3OB2B 1CFFA 1LVCD 1YUTA 1ODBA 3IF7A 1IQ5A 3DF0A 4P2YB 1NPQA 1TTXA 1PULA 4WQ3A 2ZRSA 4NDDA 4USLA 2JTTA 2JOJA 2JQ6A 1DF0A 2WORA 1MWNA 1NCXA 2PSRA 3I5FC 1DGUA 1E8AA 3OX6A 3TUYB 1S1EA 2KQ6A 2NCOA 1A75B 1LINA 1H4BA 1QIWA 1S6CA 2MJWB 1YR5A 4XYNA 2COLB 1EG3A 3NSIA 1BLQA 2JNFA 1B7TZ 2E30A 3TDZA 2KI6D 2Q91A 4I5KA 4PCWA 4YI9A 1CMFA 1QX5B 1CFCA 2K2FA 4HRGA 2CT9A 4ZCVA 1UP5A 1QLKA 2LUXA 1CTRA 1HQVA 1W7IB 4PE4A 1NYAA 4MBEA 1J1DA 1EL4A 2KBMA 4D1EA 1LXFC 1YX7A 2BE4A 1QTXA 2KI4C 3EVUA 1SW8A 3O4YA 1VRKA 1CLMA 1YRUB 2LANA 1DJGA 1ZOTB 3FS7A 4C0LA 1B9AA 2K7CA 2AMIA 1BODA 1MR8A 1KK8B 2KSPA 3LLEA 2JT8A 3OB1B 3EVVA 4BY5A 3PN7B 4UPGA 2MLEC 3PSRA 2KFFA 3BQ3A 1FI6A 2JULA 4I5JA 3D0YA 1V1GA 4YRUA 2K8MB 4MLWA 1B8RA 4TNCA 4MEWA 1YUUA 1CDMA 1TIZA 1NSHA 3CR4X 1Q80A 1CM4A 1S3PA 3A4UB 5CPVA 1SCMB 2I94A 1OE9B 2JT3A 3EK7A 3EVRA 1IWQA 2ZN8A 3IQOA 3VRNA 3DF0B 3BOWA 4GGFC 1Y0VH 1L2OC 1CNPA 2PVBA 4GGFA 2KDHA 3NXAA 3RLZA 4BY4A 1UHIA 1SBJA 2LVKA 1SNLA 1K2HA 1G8IA 4IL1A 1ALWA 2SCPA 2LAPA 3I5FB 1B8LA 1DT7B 4MZKA 4MSPA 4NDCA 5GQQC 1EG4A 3A8RA 1DMOA 3EK8A 1SL7A 2KGRA 2NLNA 1KK7Y 1M46A 2GGMA 4L9MA 2M7LA 1KSMA 1M45A 4QJ5B 1GGZA 1SYMA 2KBIA 3IQQA 1F8HA 1A75A 2M9GA 2BCBA 4PALA 4PE7A 2LLUA 4JWQA 4DIRA 4ZCUA 3WNXB 4GNKB 5J3XA 2I2RE 1KFXS 3TS5C 2JRFA 1XK4A 1F4QA 2LLTA 1B8CA 2FJUB 1NX2A 2KNEA 2QPTA 2M7NA 3QRXA 3TZ1A 2HETA 4CLNA 1JSAA 4C0KA 2RGIA 5JJGA 1XFWO 4MZJA 1TNXA 2WC8A 2G9BA 3DD4A 2Y1MA 2E6WA 3LCPC 1QVIZ 2K0JA 5BPJA 2F3ZA 2OTGC 4MRYA 2M29A 2O60A 2KAYA 1CB1A 1K9PA 4MVFA 2B1UA 3SG5A 3DVMA 2A4JA 2LM5A 1ZFSA 2JXLA 1DGVA 3BUOB 3D0YB 4OKHA 1BF5A 5DKQA 2PASA 3OP0A 2LMVA 2EHBA 4YGBB 2HQWA 3BUXB 1CLLA 3CR2A 1X02A 2K2AA 5AERA 5K89A 2HPSA 4Q04A 2SASA 4WQ2A 1FI5A 1XYDA 1UURA 2BKHB 2K61A 1CDPA 3AKAA 3BUWB 2KHNA 2PMYA 2KFGA 1OZOA 2PRUA 1R6PA 4R1EA 4OR9B 1NIWA 3VRRA 4GUKA 2Q4UA 5HYDA 1PSBA 4YGAA 1QASA 3CS1A 1IH0A 3WXAA 2NXQA 1S26D 2QACA 1QJTA 1YTZC 3LL8B 4YBHB 3ZNIA 3OHMB 1MHOA 3VROA 2LMTA 2ZKMX 4CPVA 1KFXL 1S5GZ 1PK0D 2KOTA 1RECA 2LV7A 2ZRTA 4E68A 2TN4A 2ZNEA 4OVNF 1WY9A 2VRGA 2LUCA 1DJXA 4I5LB 1B7TY 2CBLA 2I18A 1LA3A 3C1VA 1S6IA 1MXEA 4PE1A 3TS5B 2L5XB 3KF9A 1G33A 5KTYA 5AEQA 1YRTB 3GOFA 4GPLB 1DJHA 4AQIA 1AP4A 2M1UA 1K9UA 2OTGB 2Y1NA 4CIDA 1DJYA 1IRJA 1W7JB 4ORAB 1K8UA 3WHTB 1NX0A 5JOLA 2EGDA 2F33A 1QLSA 2K7DA 3TDUA 1IJ6A 2KYFA 4XJKB 2KI6C 1ZACA 1WLMA 4C0JA 5B8IB 1WRZA 3ICBA 5I8NA 1RK9A 5DKNA 2ZN9A 2CNPA 3E3RA 3PLFB 4WRIA 5CSJA 2ZFDA 1OZSA 4CFQA 3H4SE 3CR5X 5AANA 4PHNA 5HKZA 4M2PA 4NQGA 1AHRA 2WOSA 4FQOA 2Y5IA 1J7RA 1BJFA 3HCMA 3DVEA 1OSAA 1UHKA 3AAJA 2GGZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K90 D;  2LLS A;  1LKJ A;  1J55 A;  3JVT B;  2M97 A;  4DCK A;  1XFY O;  1IQ3 A;  4PE0 A;  4GFT A;  1DJI A;  1K93 D;  4HRH A;  3SG6 A;  1GJY A;  1JFK A;  2WCF A;  1BOC A;  1IGV A;  3PAL A;  2L4H A;  2MBX A;  4YGE B;  4JPZ B;  1F71 A;  2JU0 A;  4QJ4 B;  1JFJ A;  4ETO A;  4N5X A;  1BR4 B;  1CM1 A;  1KFU S;  3GK4 X;  2BCX A;  1M63 B;  1UUS A;  1JC2 A;  3VRQ A;  1IKU A;  1AUI B;  2L4I A;  5HKY A;  1J7Q A;  1B4C A;  2LP3 A;  1SK6 D;  5DKR A;  1KQM C;  5PAL A;  2FOT A;  1EJ3 A;  4AOM A;  4HSZ A;  2JZI A;  4A4C A;  1BU3 A;  3SG4 A;  1K95 A;  1MXL C;  1TOP A;  2OS8 B;  3O2P A;  3SG3 A;  3GK1 A;  4DRW A;  1QVI Y;  1U5I B;  1MQ1 A;  3KHE A;  1C7V A;  3I5I B;  1PAL A;  1UHH A;  1FPW A;  1GGW A;  2L0P A;  1C07 A;  1ZMZ A;  3VGO A;  1OOJ A;  1SCV A;  1QXP A;  1QX2 A;  5D69 A;  2WND A;  1SR6 B;  2KYC A;  3PFV A;  1QX7 A;  2BKI B;  1IG5 A;  1WDC C;  2CTN A;  4QJ3 B;  3VRP A;  4AQJ A;  2WCB A;  2R2I A;  2GV5 A;  3SIB A;  1UWO A;  4XJK A;  1QS7 A;  3KO0 A;  1KCY A;  1G4Y R;  2H61 C;  1BMO A;  2JXC A;  2H61 A;  1OMR A;  2KAV A;  1SRA A;  1EXR A;  2M8U A;  3HX4 A;  1FW4 A;  1FBV A;  3WHU B;  1H8B A;  2KAX A;  3CZT X;  1RJV A;  2LP2 A;  2JWW A;  3LK1 A;  4I5N B;  4P5O E;  2NCP A;  1B1G A;  3EK4 A;  5AXI A;  1QAT A;  3JVT C;  1DTL A;  1KFU L;  1YUR A;  5D7F A;  1J7P A;  1S5G Y;  1V1F A;  1CLB A;  2I7A A;  3JTD B;  1KQV A;  3SG7 A;  2F2O A;  1SKT A;  3CWG A;  1QV0 A;  1JF0 A;  3NSK A;  2F3Y A;  1QIV A;  4PHJ A;  1RWY A;  4DUQ A;  1R2U A;  4YI8 A;  1S6J A;  1M39 A;  1S36 A;  1A29 A;  1K9K A;  1YX8 A;  1KQM B;  4PHK A;  1CMG A;  3EKJ A;  4A4B A;  3CGA A;  3SG2 A;  2F8P A;  4CFR A;  2CXJ A;  1Y1X A;  2M49 B;  1OQP A;  1J1E A;  1NCZ A;  1PSR A;  1F55 A;  1UHJ A;  1EH2 A;  2G2B A;  5I2Q A;  1OMD A;  4F0Z B;  4M2O A;  2KGB C;  2LVJ A;  2OS8 C;  1KWO C;  1TRF A;  2D8N A;  2WCE A;  4U8D A;  5HLO A;  1MUX A;  1CFP A;  1JBA A;  1TCF A;  1C7W A;  3I5I C;  1U5I A;  1UHN A;  1PRW A;  1M31 A;  2MA2 A;  1K94 A;  1NWD A;  2MLF C;  4ORC B;  1WDC B;  2BL0 C;  1MF8 B;  1J7O A;  1DVI A;  2K7O A;  2EC6 C;  1NUB A;  3SJS A;  2JT0 A;  1TN4 A;  2HQ8 A;  2PAL A;  1SR6 C;  2JC2 A;  4OV2 A;  2FCD A;  3KEV A;  1L7Z A;  1OMV A;  3I5H B;  1AJ4 A;  3AKB A;  4GBA A;  1K96 A;  5TNC A;  3FIA A;  1RFJ A;  2H2K A;  2OPO A;  4YGC B;  1DJW A;  3RM1 A;  1NP8 A;  4N1F A;  3GK2 A;  3I5G C;  3CTN A;  1LA0 A;  1TNQ A;  1JF2 A;  5CSF A;  3FWB A;  3O6B A;  2Y4Q A;  1B47 A;  2BE6 A;  4NDB A;  5HKW A;  1KSO A;  4HRE E;  4M2Q A;  2KQY A;  1XA5 A;  3BUN B;  1N0Y A;  2LVI A;  4JQ0 D;  2AUC A;  1IJ5 A;  1Y1A A;  1WRL A;  3JTD C;  5F6T A;  1XFX O;  5I2O A;  2BBM A;  2FCE A;  2M3W A;  5ER4 X;  1BG1 A;  3PM8 A;  2JTZ A;  2MAZ A;  2K7B A;  2BBN A;  1Y1U A;  3NSL A;  2L50 A;  1XFZ O;  4YGD B;  1JWD A;  1A4P A;  1NX3 A;  1F4O A;  3O78 A;  2ISD A;  1BR1 B;  4GGN A;  3DVJ A;  3NSO A;  2AAO A;  1CDN A;  3BYA A;  1A2X A;  4MZL A;  4GAO A;  1CFD A;  4MRX A;  1DF0 B;  1WLZ A;  3TDI A;  2JNX A;  4ORB B;  3LK0 A;  2BEC A;  1YUS A;  4PDZ A;  1AK8 A;  5FYX A;  3FWC A;  2HF5 A;  3F45 A;  1KWO B;  2M0R A;  3BXK A;  4PHM A;  3ZWH A;  2KFH A;  1HT9 A;  2LHI A;  1FF1 A;  3TUY C;  3K21 A;  1KK7 Z;  1WRK A;  2BL0 B;  2F2P A;  1BT6 A;  2IS9 A;  1XFU O;  2LNK A;  3CLN A;  4N1G A;  5ER5 A;  1Y6W A;  2EC6 B;  2MHH A;  2M1K B;  1NX1 A;  3BUM B;  1ZUZ A;  1GQM A;  5CSN A;  1RRO A;  3MSE B;  1N2D A;  1CDL A;  1XK4 C;  1D1O A;  2P6B B;  1SY9 A;  2LHL A;  5KU1 A;  1SL8 A;  1YVH A;  1A03 A;  1F54 A;  2DOQ A;  3EKH A;  1F70 A;  1YVL A;  2KI4 B;  2O5G A;  3DVK A;  3I5H C;  1XFV O;  2L2E A;  1SPY A;  3I5G B;  5I2L A;  4MN0 A;  1TNP A;  2LE9 B;  2LC5 A;  1NCY A;  5HLV A;  2BCA A;  1QV1 A;  5CSI A;  1TNW A;  1SMG A;  1XVJ A;  2L51 A;  2JPT A;  2L98 A;  2ZND A;  3M0W A;  4FTG A;  1DJZ A;  1TCO B;  5IBW A;  5KSZ A;  1KK8 C;  1AJ5 A;  3PAT A;  3KPX A;  1PVA A;  2MRD A;  2V53 A;  3OX5 A;  1CKK A;  1N65 A;  2LMU A;  3AAK A;  3SIA A;  2CCM A;  3PN7 C;  1SL9 A;  2LVV A;  1JUO A;  4ICB A;  4DS7 A;  1XO5 A;  1AVS A;  4OCI A;  3BOW B;  5AFP A;  1ALV A;  2NZ0 A;  1RTP 1;  1L2O B;  2LCP A;  3D10 A;  5G08 A;  1PVB A;  1SCM C;  3OB2 B;  1CFF A;  1LVC D;  1YUT A;  1ODB A;  3IF7 A;  1IQ5 A;  3DF0 A;  4P2Y B;  1NPQ A;  1TTX A;  1PUL A;  4WQ3 A;  2ZRS A;  4NDD A;  4USL A;  2JTT A;  2JOJ A;  2JQ6 A;  1DF0 A;  2WOR A;  1MWN A;  1NCX A;  2PSR A;  3I5F C;  1DGU A;  1E8A A;  3OX6 A;  3TUY B;  1S1E A;  2KQ6 A;  2NCO A;  1A75 B;  1LIN A;  1H4B A;  1QIW A;  1S6C A;  2MJW B;  1YR5 A;  4XYN A;  2COL B;  1EG3 A;  3NSI A;  1BLQ A;  2JNF A;  1B7T Z;  2E30 A;  3TDZ A;  2KI6 D;  2Q91 A;  4I5K A;  4PCW A;  4YI9 A;  1CMF A;  1QX5 B;  1CFC A;  2K2F A;  4HRG A;  2CT9 A;  4ZCV A;  1UP5 A;  1QLK A;  2LUX A;  1CTR A;  1HQV A;  1W7I B;  4PE4 A;  1NYA A;  4MBE A;  1J1D A;  1EL4 A;  2KBM A;  4D1E A;  1LXF C;  1YX7 A;  2BE4 A;  1QTX A;  2KI4 C;  3EVU A;  1SW8 A;  3O4Y A;  1VRK A;  1CLM A;  1YRU B;  2LAN A;  1DJG A;  1ZOT B;  3FS7 A;  4C0L A;  1B9A A;  2K7C A;  2AMI A;  1BOD A;  1MR8 A;  1KK8 B;  2KSP A;  3LLE A;  2JT8 A;  3OB1 B;  3EVV A;  4BY5 A;  3PN7 B;  4UPG A;  2MLE C;  3PSR A;  2KFF A;  3BQ3 A;  1FI6 A;  2JUL A;  4I5J A;  3D0Y A;  1V1G A;  4YRU A;  2K8M B;  4MLW A;  1B8R A;  4TNC A;  4MEW A;  1YUU A;  1CDM A;  1TIZ A;  1NSH A;  3CR4 X;  1Q80 A;  1CM4 A;  1S3P A;  3A4U B;  5CPV A;  1SCM B;  2I94 A;  1OE9 B;  2JT3 A;  3EK7 A;  3EVR A;  1IWQ A;  2ZN8 A;  3IQO A;  3VRN A;  3DF0 B;  3BOW A;  4GGF C;  1Y0V H;  1L2O C;  1CNP A;  2PVB A;  4GGF A;  2KDH A;  3NXA A;  3RLZ A;  4BY4 A;  1UHI A;  1SBJ A;  2LVK A;  1SNL A;  1K2H A;  1G8I A;  4IL1 A;  1ALW A;  2SCP A;  2LAP A;  3I5F B;  1B8L A;  1DT7 B;  4MZK A;  4MSP A;  4NDC A;  5GQQ C;  1EG4 A;  3A8R A;  1DMO A;  3EK8 A;  1SL7 A;  2KGR A;  2NLN A;  1KK7 Y;  1M46 A;  2GGM A;  4L9M A;  2M7L A;  1KSM A;  1M45 A;  4QJ5 B;  1GGZ A;  1SYM A;  2KBI A;  3IQQ A;  1F8H A;  1A75 A;  2M9G A;  2BCB A;  4PAL A;  4PE7 A;  2LLU A;  4JWQ A;  4DIR A;  4ZCU A;  3WNX B;  4GNK B;  5J3X A;  2I2R E;  1KFX S;  3TS5 C;  2JRF A;  1XK4 A;  1F4Q A;  2LLT A;  1B8C A;  2FJU B;  1NX2 A;  2KNE A;  2QPT A;  2M7N A;  3QRX A;  3TZ1 A;  2HET A;  4CLN A;  1JSA A;  4C0K A;  2RGI A;  5JJG A;  1XFW O;  4MZJ A;  1TNX A;  2WC8 A;  2G9B A;  3DD4 A;  2Y1M A;  2E6W A;  3LCP C;  1QVI Z;  2K0J A;  5BPJ A;  2F3Z A;  2OTG C;  4MRY A;  2M29 A;  2O60 A;  2KAY A;  1CB1 A;  1K9P A;  4MVF A;  2B1U A;  3SG5 A;  3DVM A;  2A4J A;  2LM5 A;  1ZFS A;  2JXL A;  1DGV A;  3BUO B;  3D0Y B;  4OKH A;  1BF5 A;  5DKQ A;  2PAS A;  3OP0 A;  2LMV A;  2EHB A;  4YGB B;  2HQW A;  3BUX B;  1CLL A;  3CR2 A;  1X02 A;  2K2A A;  5AER A;  5K89 A;  2HPS A;  4Q04 A;  2SAS A;  4WQ2 A;  1FI5 A;  1XYD A;  1UUR A;  2BKH B;  2K61 A;  1CDP A;  3AKA A;  3BUW B;  2KHN A;  2PMY A;  2KFG A;  1OZO A;  2PRU A;  1R6P A;  4R1E A;  4OR9 B;  1NIW A;  3VRR A;  4GUK A;  2Q4U A;  5HYD A;  1PSB A;  4YGA A;  1QAS A;  3CS1 A;  1IH0 A;  3WXA A;  2NXQ A;  1S26 D;  2QAC A;  1QJT A;  1YTZ C;  3LL8 B;  4YBH B;  3ZNI A;  3OHM B;  1MHO A;  3VRO A;  2LMT A;  2ZKM X;  4CPV A;  1KFX L;  1S5G Z;  1PK0 D;  2KOT A;  1REC A;  2LV7 A;  2ZRT A;  4E68 A;  2TN4 A;  2ZNE A;  4OVN F;  1WY9 A;  2VRG A;  2LUC A;  1DJX A;  4I5L B;  1B7T Y;  2CBL A;  2I18 A;  1LA3 A;  3C1V A;  1S6I A;  1MXE A;  4PE1 A;  3TS5 B;  2L5X B;  3KF9 A;  1G33 A;  5KTY A;  5AEQ A;  1YRT B;  3GOF A;  4GPL B;  1DJH A;  4AQI A;  1AP4 A;  2M1U A;  1K9U A;  2OTG B;  2Y1N A;  4CID A;  1DJY A;  1IRJ A;  1W7J B;  4ORA B;  1K8U A;  3WHT B;  1NX0 A;  5JOL A;  2EGD A;  2F33 A;  1QLS A;  2K7D A;  3TDU A;  1IJ6 A;  2KYF A;  4XJK B;  2KI6 C;  1ZAC A;  1WLM A;  4C0J A;  5B8I B;  1WRZ A;  3ICB A;  5I8N A;  1RK9 A;  5DKN A;  2ZN9 A;  2CNP A;  3E3R A;  3PLF B;  4WRI A;  5CSJ A;  2ZFD A;  1OZS A;  4CFQ A;  3H4S E;  3CR5 X;  5AAN A;  4PHN A;  5HKZ A;  4M2P A;  4NQG A;  1AHR A;  2WOS A;  4FQO A;  2Y5I A;  1J7R A;  1BJF A;  3HCM A;  3DVE A;  1OSA A;  1UHK A;  3AAJ A;  2GGZ A; 
#chains in the Genus database with same CATH topology
 1K90 D;  2LLS A;  1LKJ A;  1J55 A;  3JVT B;  2M97 A;  4DCK A;  3FE6 A;  1XFY O;  1IQ3 A;  4PE0 A;  4GFT A;  1DJI A;  1K93 D;  4HRH A;  3SG6 A;  1GJY A;  1JFK A;  2WCF A;  1BOC A;  1IGV A;  3PAL A;  2BAP A;  2L4H A;  3IVT A;  2MBX A;  4YGE B;  4JPZ B;  1F71 A;  3S0A A;  2JU0 A;  4QJ4 B;  1JFJ A;  4ETO A;  4F7F A;  4N5X A;  1BR4 B;  3DZT A;  1CM1 A;  1KFU S;  1OOI X;  3GK4 X;  2BCX A;  1M63 B;  1UUS A;  3B6X A;  1JC2 A;  3VRQ A;  1IKU A;  1AUI B;  2L4I A;  2QEB A;  5HKY A;  1J7Q A;  1B4C A;  2LP3 A;  1SK6 D;  5DKR A;  1KQM C;  5PAL A;  2FOT A;  1EJ3 A;  3BFA A;  4AOM A;  2QEV A;  4HSZ A;  2JZI A;  4A4C A;  1BU3 A;  3SG4 A;  1K95 A;  1MXL C;  1TOP A;  2OS8 B;  3O2P A;  3SG3 A;  3GK1 A;  3NHI A;  1LS8 A;  2JPO A;  4DRW A;  1QVI Y;  1U5I B;  1MQ1 A;  3KHE A;  3D78 A;  3I5I B;  1C7V A;  1PAL A;  1UHH A;  1FPW A;  1GGW A;  2QEH A;  2L0P A;  3S0E A;  1C07 A;  1ZMZ A;  3VGO A;  1OOJ A;  1SCV A;  3R1O A;  1QXP A;  1QX2 A;  5D69 A;  2WND A;  3R1V A;  1SR6 B;  2KYC A;  3PFV A;  1QX7 A;  2BKI B;  1IG5 A;  1WDC C;  2CTN A;  4QJ3 B;  3VRP A;  4AQJ A;  2WCB A;  2R2I A;  2GV5 A;  3PM2 A;  3SIB A;  1UWO A;  4XJK A;  1QS7 A;  3R1P A;  4KYN A;  3KO0 A;  3CZ2 A;  1KCY A;  1G4Y R;  2H61 C;  3R72 A;  1BMO A;  2JXC A;  2H61 A;  1OMR A;  2KAV A;  1SRA A;  1EXR A;  2M8U A;  3HX4 A;  1FW4 A;  1FBV A;  3WHU B;  1H8B A;  2KAX A;  3CZT X;  1RJV A;  2LP2 A;  2JWW A;  3LK1 A;  4I5N B;  4P5O E;  1XFR A;  2NCP A;  1B1G A;  3EK4 A;  5AXI A;  1QAT A;  3JVT C;  1DTL A;  3OGN A;  1KFU L;  3L47 A;  1YUR A;  5D7F A;  1J7P A;  1S5G Y;  1V1F A;  1CLB A;  2I7A A;  3JTD B;  1KQV A;  3SG7 A;  2F2O A;  1SKT A;  3CWG A;  1QV0 A;  1JF0 A;  3NSK A;  2F3Y A;  1W9Z A;  1QIV A;  1QWV A;  3L4A A;  3PJI A;  1RWY A;  4PHJ A;  1R2U A;  4DUQ A;  4YI8 A;  1S6J A;  2WC6 A;  1M39 A;  1S36 A;  1A29 A;  1K9K A;  1YX8 A;  1KQM B;  4PHK A;  1CMG A;  5D3O A;  3EKJ A;  1DEL A;  4A4B A;  3CGA A;  3SG2 A;  2F8P A;  4CFR A;  2CXJ A;  1Y1X A;  2M49 B;  1OQP A;  3O4X A;  1J1E A;  1NCZ A;  1PSR A;  1F55 A;  1UHJ A;  1EH2 A;  2G2B A;  3VB1 A;  5I2Q A;  1OMD A;  4F0Z B;  4M2O A;  2KGB C;  2LVJ A;  2OS8 C;  1KWO C;  3FE8 A;  1TRF A;  2D8N A;  2WCE A;  4U8D A;  5HLO A;  1MUX A;  3UO9 A;  1CFP A;  1JBA A;  1TCF A;  1C7W A;  1ORG A;  3I5I C;  1U5I A;  1UHN A;  1PRW A;  1M31 A;  2MA2 A;  1K94 A;  1NWD A;  5DIC A;  2MLF C;  4ORC B;  1WDC B;  2BL0 C;  1MF8 B;  1J7O A;  1DVI A;  2K7O A;  2EC6 C;  1NUB A;  3SJS A;  2JT0 A;  1TN4 A;  2HQ8 A;  2PAL A;  1SR6 C;  2JC2 A;  4OV2 A;  2FCD A;  3KEV A;  1L7Z A;  1OMV A;  3I5H B;  1AJ4 A;  2L5Y A;  3AKB A;  2P71 A;  1K96 A;  4GBA A;  5TNC A;  3FIA A;  1RFJ A;  2H2K A;  1TUZ A;  2OPO A;  4YGC B;  1DJW A;  3RM1 A;  1T14 A;  1NP8 A;  4N1F A;  3GK2 A;  3I5G C;  3CTN A;  1LA0 A;  1TNQ A;  1JF2 A;  1C3Y A;  2H8V A;  5CSF A;  3FWB A;  3O6B A;  2Y4Q A;  1B47 A;  2BE6 A;  4NDB A;  5HKW A;  1KSO A;  3D75 A;  4HRE E;  4M2Q A;  2KQY A;  1XA5 A;  3BUN B;  1N0Y A;  2LVI A;  4JQ0 D;  2WC5 A;  2AUC A;  1IJ5 A;  3BFB A;  1Y1A A;  1WRL A;  3JTD C;  5F6T A;  1XFX O;  5I2O A;  2BBM A;  2FCE A;  2M3W A;  5ER4 X;  5I94 A;  1BG1 A;  3PM8 A;  2JTZ A;  2MAZ A;  2K7B A;  2BBN A;  1Y1U A;  3NSL A;  2L50 A;  1XFZ O;  4YGD B;  1JWD A;  1A4P A;  1NX3 A;  1F4O A;  3O78 A;  2ISD A;  1BR1 B;  4GGN A;  3DVJ A;  3NSO A;  2AAO A;  1CDN A;  3B7A A;  3BYA A;  1A2X A;  4MZL A;  4GAO A;  1CFD A;  4MRX A;  1DF0 B;  1WLZ A;  3TDI A;  2JNX A;  4ORB B;  3LK0 A;  2BEC A;  3B87 A;  1YUS A;  4PDZ A;  1AK8 A;  5FYX A;  3FWC A;  2K60 A;  2HF5 A;  3F45 A;  1KWO B;  2M0R A;  3BXK A;  4PHM A;  3ZWH A;  1C3Z A;  2KFH A;  1HT9 A;  3S0G A;  2LHI A;  1FF1 A;  3TUY C;  1SSE B;  3NGV A;  3K21 A;  1KK7 Z;  1WRK A;  2BL0 B;  2F2P A;  1BT6 A;  2IS9 A;  1XFU O;  2LNK A;  3CLN A;  4N1G A;  5ER5 A;  1Y6W A;  2EC6 B;  2MHH A;  2M1K B;  1NX1 A;  3BUM B;  1ZUZ A;  5EL2 A;  1GQM A;  5CSN A;  1RRO A;  4IJ7 A;  3MSE B;  1N2D A;  1CDL A;  1XK4 C;  2GTE A;  1D1O A;  2P6B B;  1SY9 A;  2LHL A;  5KU1 A;  1SL8 A;  1YVH A;  1A03 A;  1F54 A;  2DOQ A;  3EKH A;  1F70 A;  1YVL A;  2KI4 B;  2O5G A;  3DVK A;  3I5H C;  3N7H A;  1XFV O;  2L2E A;  1SPY A;  3I5G B;  1DQE A;  5I2L A;  4MN0 A;  1TNP A;  2LE9 B;  2LC5 A;  1NCY A;  5HLV A;  2BCA A;  1QV1 A;  5CSI A;  1TNW A;  1SMG A;  1XVJ A;  2L51 A;  2JPT A;  2L98 A;  2ZND A;  3M0W A;  4FTG A;  1DJZ A;  1TCO B;  5IBW A;  5KSZ A;  1KK8 C;  1AJ5 A;  3PAT A;  3KPX A;  1PVA A;  2MRD A;  2V53 A;  3OX5 A;  1CKK A;  1N65 A;  2LMU A;  3AAK A;  3CAB A;  3SIA A;  1GM0 A;  2CCM A;  3PN7 C;  1SL9 A;  2LVV A;  1JUO A;  4ICB A;  4DS7 A;  1XO5 A;  1AVS A;  4OCI A;  3BOW B;  5AFP A;  1ALV A;  1OOF A;  1RTP 1;  2NZ0 A;  2BNX A;  3UNW A;  1L2O B;  2LCP A;  3D10 A;  5G08 A;  1PVB A;  1SCM C;  3OB2 B;  3OBV A;  1CFF A;  1LVC D;  2YGU A;  1YUT A;  2PYQ A;  1ODB A;  3EG5 B;  1IQ5 A;  3DF0 A;  3IF7 A;  4P2Y B;  1NPQ A;  1TTX A;  1PUL A;  3DY9 A;  2ZRS A;  4WQ3 A;  3V2L A;  4NDD A;  4USL A;  2JTT A;  2JOJ A;  2JQ6 A;  1DF0 A;  2WOR A;  1MWN A;  1NCX A;  2PSR A;  3I5F C;  1DGU A;  1Z4H A;  1E8A A;  3OX6 A;  3TUY B;  1S1E A;  2KQ6 A;  2NCO A;  1A75 B;  1LIN A;  1H4B A;  1QIW A;  3NHT A;  1S6C A;  2MJW B;  3B86 A;  1YR5 A;  4XYN A;  2COL B;  1EG3 A;  3NSI A;  1BLQ A;  2JNF A;  2KLE A;  1B7T Z;  2E30 A;  3TDZ A;  2KI6 D;  2Q91 A;  4I5K A;  4PCW A;  4YI9 A;  1CMF A;  1QX5 B;  1CFC A;  2K2F A;  2WCL A;  4HRG A;  2CT9 A;  4ZCV A;  1UP5 A;  1QLK A;  2LUX A;  1CTR A;  1HQV A;  1W7I B;  4PE4 A;  1NYA A;  4MBE A;  1J1D A;  1EL4 A;  2KBM A;  4D1E A;  1LXF C;  1YX7 A;  2BE4 A;  1QTX A;  2L2C A;  2KI4 C;  3CDN A;  3EVU A;  1SW8 A;  3O4Y A;  1VRK A;  1CLM A;  1YRU B;  2LAN A;  1DJG A;  1ZOT B;  1OOH A;  3FS7 A;  4C0L A;  1B9A A;  2K7C A;  2AMI A;  3DYE A;  1BOD A;  1MR8 A;  1KK8 B;  2KSP A;  3LLE A;  2JT8 A;  3OB1 B;  3EVV A;  4BY5 A;  3PN7 B;  4UPG A;  2MLE C;  3PSR A;  2KFF A;  3BQ3 A;  1FI6 A;  2JUL A;  4I5J A;  3D0Y A;  1V1G A;  4YRU A;  2K8M B;  4MLW A;  1IIO A;  1B8R A;  3D73 A;  4MEW A;  4TNC A;  1YUU A;  1CDM A;  1TIZ A;  1NSH A;  3CR4 X;  3FE9 A;  1Q80 A;  1CM4 A;  1S3P A;  3A4U B;  5CPV A;  1SCM B;  2I94 A;  1OE9 B;  2JT3 A;  3EK7 A;  3D76 A;  1IWQ A;  1P28 A;  2ZN8 A;  3EVR A;  3IQO A;  4INW A;  3VRN A;  3DF0 B;  3BOW A;  4GGF C;  1Y0V H;  1L2O C;  1CNP A;  2PVB A;  4GGF A;  2KDH A;  3NXA A;  3RLZ A;  4BY4 A;  1UHI A;  1SBJ A;  5HL1 A;  2LVK A;  1SNL A;  1K2H A;  1G8I A;  4IL1 A;  1ALW A;  2SCP A;  2LAP A;  3D74 A;  1B8L A;  3I5F B;  1DT7 B;  4MZK A;  4MSP A;  4NDC A;  5GQQ C;  1EG4 A;  3A8R A;  1DMO A;  3EK8 A;  1SL7 A;  2KGR A;  2NLN A;  1KK7 Y;  1M46 A;  2GGM A;  4L9M A;  2QEO A;  2M7L A;  1KSM A;  1M45 A;  4QJ5 B;  1GGZ A;  2WCH A;  1SYM A;  2KBI A;  3B88 A;  3IQQ A;  3BFH A;  3SS5 A;  1F8H A;  1A75 A;  2M9G A;  2BCB A;  4PAL A;  4PE7 A;  2LLU A;  4JWQ A;  4DIR A;  4ZCU A;  3WNX B;  4GNK B;  5J3X A;  2I2R E;  1KFX S;  3TS5 C;  2JRF A;  1XK4 A;  1F4Q A;  2LLT A;  3QME A;  1B8C A;  2FJU B;  1NX2 A;  2KNE A;  2QPT A;  1TWO A;  2M7N A;  3QRX A;  3TZ1 A;  2HET A;  4CLN A;  1JSA A;  4FQT A;  4C0K A;  2RGI A;  3SS3 A;  5JJG A;  1XFW O;  2WCM A;  2FJY A;  1TNX A;  4MZJ A;  1Z2C B;  2WC8 A;  2G9B A;  3DD4 A;  2Y1M A;  2E6W A;  3LCP C;  1QVI Z;  2K0J A;  3BJH A;  5BPJ A;  2F3Z A;  2OTG C;  4MRY A;  1OOG A;  2M29 A;  2O60 A;  2KAY A;  1CB1 A;  1K9P A;  4MVF A;  2B1U A;  3SG5 A;  3DVM A;  4JD9 A;  2A4J A;  2LM5 A;  1ZFS A;  2JXL A;  1DGV A;  3BUO B;  3D0Y B;  4OKH A;  4OZD A;  1BF5 A;  5DKQ A;  2PAS A;  2PQL A;  3OP0 A;  2LMV A;  2EHB A;  4YGB B;  2HQW A;  3BUX B;  1CLL A;  3CR2 A;  4PT1 A;  1X02 A;  2K2A A;  5AER A;  5FI2 A;  5K89 A;  2HPS A;  4Q04 A;  2SAS A;  3S0F A;  3CZ0 A;  4WQ2 A;  1XYD A;  1UUR A;  2BKH B;  2K61 A;  1FI5 A;  2KPH A;  1CDP A;  3AKA A;  3BUW B;  2KHN A;  5FI6 A;  2PMY A;  2KFG A;  1OZO A;  2KLD A;  2PRU A;  1R6P A;  4R1E A;  4OR9 B;  1NIW A;  3VRR A;  4GUK A;  2Q4U A;  3SS4 A;  1PSB A;  4YGA A;  3S0B A;  1QAS A;  5HYD A;  3CS1 A;  1IH0 A;  3WXA A;  2NXQ A;  1S26 D;  2QAC A;  1QJT A;  1YTZ C;  2ERB A;  3LL8 B;  4YBH B;  3ZNI A;  3OHM B;  1MHO A;  3VRO A;  2LMT A;  2ZKM X;  4CPV A;  1KFX L;  1S5G Z;  1PK0 D;  2KOT A;  1REC A;  2LV7 A;  2ZRT A;  3Q8I A;  4E68 A;  2TN4 A;  2ZNE A;  4OVN F;  1WY9 A;  2VRG A;  2LUC A;  1DC1 A;  1DJX A;  4I5L B;  1B7T Y;  2WCK A;  2CBL A;  2I18 A;  1LA3 A;  3C1V A;  1S6I A;  1MXE A;  4PE1 A;  3TS5 B;  2L5X B;  3KF9 A;  1G33 A;  5KTY A;  5AEQ A;  1YRT B;  3GOF A;  2P70 A;  4GPL B;  4INX A;  3RZS A;  3S0D A;  1DJH A;  4AQI A;  1AP4 A;  4JKT A;  2M1U A;  1K9U A;  2QDI A;  3CYZ A;  3CZ1 A;  1OW4 A;  2OTG B;  2Y1N A;  3L4L A;  1DJY A;  1IRJ A;  1W7J B;  4ORA B;  4CID A;  1DEK A;  1K8U A;  3WHT B;  1TUJ A;  1NX0 A;  5JOL A;  2EGD A;  2F33 A;  1QLS A;  2K7D A;  3TDU A;  1IJ6 A;  2KYF A;  4XJK B;  2KI6 C;  1ZAC A;  1WLM A;  4C0J A;  5B8I B;  1WRZ A;  3ICB A;  5I8N A;  1RK9 A;  5DKN A;  2ZN9 A;  2CNP A;  3E3R A;  3PLF B;  4WRI A;  2WCJ A;  3K1E A;  2ZFD A;  1OZS A;  5CSJ A;  4CFQ A;  3H4S E;  3CR5 X;  5AAN A;  4PHN A;  5HKZ A;  4M2P A;  4NQG A;  1AHR A;  2WOS A;  4FQO A;  2Y5I A;  1J7R A;  1BJF A;  3HCM A;  3DXL A;  5FI7 A;  3DVE A;  1OSA A;  1UHK A;  3D77 A;  3AAJ A;  2GGZ A; 
#chains in the Genus database with same CATH homology
 1K90 D;  2LLS A;  1LKJ A;  1J55 A;  3JVT B;  2M97 A;  4DCK A;  1XFY O;  1IQ3 A;  4PE0 A;  4GFT A;  1DJI A;  1K93 D;  4HRH A;  3SG6 A;  1GJY A;  1JFK A;  2WCF A;  1BOC A;  1IGV A;  3PAL A;  2L4H A;  2MBX A;  4YGE B;  4JPZ B;  1F71 A;  2JU0 A;  4QJ4 B;  1JFJ A;  4ETO A;  4N5X A;  1BR4 B;  1CM1 A;  1KFU S;  3GK4 X;  2BCX A;  1M63 B;  1UUS A;  1JC2 A;  3VRQ A;  1IKU A;  1AUI B;  2L4I A;  5HKY A;  1J7Q A;  1B4C A;  2LP3 A;  1SK6 D;  5DKR A;  1KQM C;  5PAL A;  2FOT A;  1EJ3 A;  4AOM A;  4HSZ A;  2JZI A;  4A4C A;  1BU3 A;  3SG4 A;  1K95 A;  1MXL C;  1TOP A;  2OS8 B;  3O2P A;  3SG3 A;  3GK1 A;  4DRW A;  1QVI Y;  1U5I B;  1MQ1 A;  3KHE A;  1C7V A;  3I5I B;  1PAL A;  1UHH A;  1FPW A;  1GGW A;  2L0P A;  1C07 A;  1ZMZ A;  3VGO A;  1OOJ A;  1SCV A;  1QXP A;  1QX2 A;  5D69 A;  2WND A;  1SR6 B;  2KYC A;  3PFV A;  1QX7 A;  2BKI B;  1IG5 A;  1WDC C;  2CTN A;  4QJ3 B;  3VRP A;  4AQJ A;  2WCB A;  2R2I A;  2GV5 A;  3SIB A;  1UWO A;  4XJK A;  1QS7 A;  3KO0 A;  1KCY A;  1G4Y R;  2H61 C;  1BMO A;  2JXC A;  2H61 A;  1OMR A;  2KAV A;  1SRA A;  1EXR A;  2M8U A;  3HX4 A;  1FW4 A;  1FBV A;  3WHU B;  1H8B A;  2KAX A;  3CZT X;  1RJV A;  2LP2 A;  2JWW A;  3LK1 A;  4I5N B;  4P5O E;  2NCP A;  1B1G A;  3EK4 A;  5AXI A;  1QAT A;  3JVT C;  1DTL A;  1KFU L;  1YUR A;  5D7F A;  1J7P A;  1S5G Y;  1V1F A;  1CLB A;  2I7A A;  3JTD B;  1KQV A;  3SG7 A;  2F2O A;  1SKT A;  3CWG A;  1QV0 A;  1JF0 A;  3NSK A;  2F3Y A;  1QIV A;  4PHJ A;  1RWY A;  4DUQ A;  1R2U A;  4YI8 A;  1S6J A;  1M39 A;  1S36 A;  1A29 A;  1K9K A;  1YX8 A;  1KQM B;  4PHK A;  1CMG A;  3EKJ A;  4A4B A;  3CGA A;  3SG2 A;  2F8P A;  4CFR A;  2CXJ A;  1Y1X A;  2M49 B;  1OQP A;  1J1E A;  1NCZ A;  1PSR A;  1F55 A;  1UHJ A;  1EH2 A;  2G2B A;  5I2Q A;  1OMD A;  4F0Z B;  4M2O A;  2KGB C;  2LVJ A;  2OS8 C;  1KWO C;  1TRF A;  2D8N A;  2WCE A;  4U8D A;  5HLO A;  1MUX A;  1CFP A;  1JBA A;  1TCF A;  1C7W A;  3I5I C;  1U5I A;  1UHN A;  1PRW A;  1M31 A;  2MA2 A;  1K94 A;  1NWD A;  2MLF C;  4ORC B;  1WDC B;  2BL0 C;  1MF8 B;  1J7O A;  1DVI A;  2K7O A;  2EC6 C;  1NUB A;  3SJS A;  2JT0 A;  1TN4 A;  2HQ8 A;  2PAL A;  1SR6 C;  2JC2 A;  4OV2 A;  2FCD A;  3KEV A;  1L7Z A;  1OMV A;  3I5H B;  1AJ4 A;  3AKB A;  4GBA A;  1K96 A;  5TNC A;  3FIA A;  1RFJ A;  2H2K A;  2OPO A;  4YGC B;  1DJW A;  3RM1 A;  1NP8 A;  4N1F A;  3GK2 A;  3I5G C;  3CTN A;  1LA0 A;  1TNQ A;  1JF2 A;  5CSF A;  3FWB A;  3O6B A;  2Y4Q A;  1B47 A;  2BE6 A;  4NDB A;  5HKW A;  1KSO A;  4HRE E;  4M2Q A;  2KQY A;  1XA5 A;  3BUN B;  1N0Y A;  2LVI A;  4JQ0 D;  2AUC A;  1IJ5 A;  1Y1A A;  1WRL A;  3JTD C;  5F6T A;  1XFX O;  5I2O A;  2BBM A;  2FCE A;  2M3W A;  5ER4 X;  1BG1 A;  3PM8 A;  2JTZ A;  2MAZ A;  2K7B A;  2BBN A;  1Y1U A;  3NSL A;  2L50 A;  1XFZ O;  4YGD B;  1JWD A;  1A4P A;  1NX3 A;  1F4O A;  3O78 A;  2ISD A;  1BR1 B;  4GGN A;  3DVJ A;  3NSO A;  2AAO A;  1CDN A;  3BYA A;  1A2X A;  4MZL A;  4GAO A;  1CFD A;  4MRX A;  1DF0 B;  1WLZ A;  3TDI A;  2JNX A;  4ORB B;  3LK0 A;  2BEC A;  1YUS A;  4PDZ A;  1AK8 A;  5FYX A;  3FWC A;  2HF5 A;  3F45 A;  1KWO B;  2M0R A;  3BXK A;  4PHM A;  3ZWH A;  2KFH A;  1HT9 A;  2LHI A;  1FF1 A;  3TUY C;  3K21 A;  1KK7 Z;  1WRK A;  2BL0 B;  2F2P A;  1BT6 A;  2IS9 A;  1XFU O;  2LNK A;  3CLN A;  4N1G A;  5ER5 A;  1Y6W A;  2EC6 B;  2MHH A;  2M1K B;  1NX1 A;  3BUM B;  1ZUZ A;  1GQM A;  5CSN A;  1RRO A;  3MSE B;  1N2D A;  1CDL A;  1XK4 C;  1D1O A;  2P6B B;  1SY9 A;  2LHL A;  5KU1 A;  1SL8 A;  1YVH A;  1A03 A;  1F54 A;  2DOQ A;  3EKH A;  1F70 A;  1YVL A;  2KI4 B;  2O5G A;  3DVK A;  3I5H C;  1XFV O;  2L2E A;  1SPY A;  3I5G B;  5I2L A;  4MN0 A;  1TNP A;  2LE9 B;  2LC5 A;  1NCY A;  5HLV A;  2BCA A;  1QV1 A;  5CSI A;  1TNW A;  1SMG A;  1XVJ A;  2L51 A;  2JPT A;  2L98 A;  2ZND A;  3M0W A;  4FTG A;  1DJZ A;  1TCO B;  5IBW A;  5KSZ A;  1KK8 C;  1AJ5 A;  3PAT A;  3KPX A;  1PVA A;  2MRD A;  2V53 A;  3OX5 A;  1CKK A;  1N65 A;  2LMU A;  3AAK A;  3SIA A;  2CCM A;  3PN7 C;  1SL9 A;  2LVV A;  1JUO A;  4ICB A;  4DS7 A;  1XO5 A;  1AVS A;  4OCI A;  3BOW B;  5AFP A;  1ALV A;  2NZ0 A;  1RTP 1;  1L2O B;  2LCP A;  3D10 A;  5G08 A;  1PVB A;  1SCM C;  3OB2 B;  1CFF A;  1LVC D;  1YUT A;  1ODB A;  3IF7 A;  1IQ5 A;  3DF0 A;  4P2Y B;  1NPQ A;  1TTX A;  1PUL A;  4WQ3 A;  2ZRS A;  4NDD A;  4USL A;  2JTT A;  2JOJ A;  2JQ6 A;  1DF0 A;  2WOR A;  1MWN A;  1NCX A;  2PSR A;  3I5F C;  1DGU A;  1E8A A;  3OX6 A;  3TUY B;  1S1E A;  2KQ6 A;  2NCO A;  1A75 B;  1LIN A;  1H4B A;  1QIW A;  1S6C A;  2MJW B;  1YR5 A;  4XYN A;  2COL B;  1EG3 A;  3NSI A;  1BLQ A;  2JNF A;  1B7T Z;  2E30 A;  3TDZ A;  2KI6 D;  2Q91 A;  4I5K A;  4PCW A;  4YI9 A;  1CMF A;  1QX5 B;  1CFC A;  2K2F A;  4HRG A;  2CT9 A;  4ZCV A;  1UP5 A;  1QLK A;  2LUX A;  1CTR A;  1HQV A;  1W7I B;  4PE4 A;  1NYA A;  4MBE A;  1J1D A;  1EL4 A;  2KBM A;  4D1E A;  1LXF C;  1YX7 A;  2BE4 A;  1QTX A;  2KI4 C;  3EVU A;  1SW8 A;  3O4Y A;  1VRK A;  1CLM A;  1YRU B;  2LAN A;  1DJG A;  1ZOT B;  3FS7 A;  4C0L A;  1B9A A;  2K7C A;  2AMI A;  1BOD A;  1MR8 A;  1KK8 B;  2KSP A;  3LLE A;  2JT8 A;  3OB1 B;  3EVV A;  4BY5 A;  3PN7 B;  4UPG A;  2MLE C;  3PSR A;  2KFF A;  3BQ3 A;  1FI6 A;  2JUL A;  4I5J A;  3D0Y A;  1V1G A;  4YRU A;  2K8M B;  4MLW A;  1B8R A;  4TNC A;  4MEW A;  1YUU A;  1CDM A;  1TIZ A;  1NSH A;  3CR4 X;  1Q80 A;  1CM4 A;  1S3P A;  3A4U B;  5CPV A;  1SCM B;  2I94 A;  1OE9 B;  2JT3 A;  3EK7 A;  3EVR A;  1IWQ A;  2ZN8 A;  3IQO A;  3VRN A;  3DF0 B;  3BOW A;  4GGF C;  1Y0V H;  1L2O C;  1CNP A;  2PVB A;  4GGF A;  2KDH A;  3NXA A;  3RLZ A;  4BY4 A;  1UHI A;  1SBJ A;  2LVK A;  1SNL A;  1K2H A;  1G8I A;  4IL1 A;  1ALW A;  2SCP A;  2LAP A;  3I5F B;  1B8L A;  1DT7 B;  4MZK A;  4MSP A;  4NDC A;  5GQQ C;  1EG4 A;  3A8R A;  1DMO A;  3EK8 A;  1SL7 A;  2KGR A;  2NLN A;  1KK7 Y;  1M46 A;  2GGM A;  4L9M A;  2M7L A;  1KSM A;  1M45 A;  4QJ5 B;  1GGZ A;  1SYM A;  2KBI A;  3IQQ A;  1F8H A;  1A75 A;  2M9G A;  2BCB A;  4PAL A;  4PE7 A;  2LLU A;  4JWQ A;  4DIR A;  4ZCU A;  3WNX B;  4GNK B;  5J3X A;  2I2R E;  1KFX S;  3TS5 C;  2JRF A;  1XK4 A;  1F4Q A;  2LLT A;  1B8C A;  2FJU B;  1NX2 A;  2KNE A;  2QPT A;  2M7N A;  3QRX A;  3TZ1 A;  2HET A;  4CLN A;  1JSA A;  4C0K A;  2RGI A;  5JJG A;  1XFW O;  4MZJ A;  1TNX A;  2WC8 A;  2G9B A;  3DD4 A;  2Y1M A;  2E6W A;  3LCP C;  1QVI Z;  2K0J A;  5BPJ A;  2F3Z A;  2OTG C;  4MRY A;  2M29 A;  2O60 A;  2KAY A;  1CB1 A;  1K9P A;  4MVF A;  2B1U A;  3SG5 A;  3DVM A;  2A4J A;  2LM5 A;  1ZFS A;  2JXL A;  1DGV A;  3BUO B;  3D0Y B;  4OKH A;  1BF5 A;  5DKQ A;  2PAS A;  3OP0 A;  2LMV A;  2EHB A;  4YGB B;  2HQW A;  3BUX B;  1CLL A;  3CR2 A;  1X02 A;  2K2A A;  5AER A;  5K89 A;  2HPS A;  4Q04 A;  2SAS A;  4WQ2 A;  1FI5 A;  1XYD A;  1UUR A;  2BKH B;  2K61 A;  1CDP A;  3AKA A;  3BUW B;  2KHN A;  2PMY A;  2KFG A;  1OZO A;  2PRU A;  1R6P A;  4R1E A;  4OR9 B;  1NIW A;  3VRR A;  4GUK A;  2Q4U A;  5HYD A;  1PSB A;  4YGA A;  1QAS A;  3CS1 A;  1IH0 A;  3WXA A;  2NXQ A;  1S26 D;  2QAC A;  1QJT A;  1YTZ C;  3LL8 B;  4YBH B;  3ZNI A;  3OHM B;  1MHO A;  3VRO A;  2LMT A;  2ZKM X;  4CPV A;  1KFX L;  1S5G Z;  1PK0 D;  2KOT A;  1REC A;  2LV7 A;  2ZRT A;  4E68 A;  2TN4 A;  2ZNE A;  4OVN F;  1WY9 A;  2VRG A;  2LUC A;  1DJX A;  4I5L B;  1B7T Y;  2CBL A;  2I18 A;  1LA3 A;  3C1V A;  1S6I A;  1MXE A;  4PE1 A;  3TS5 B;  2L5X B;  3KF9 A;  1G33 A;  5KTY A;  5AEQ A;  1YRT B;  3GOF A;  4GPL B;  1DJH A;  4AQI A;  1AP4 A;  2M1U A;  1K9U A;  2OTG B;  2Y1N A;  4CID A;  1DJY A;  1IRJ A;  1W7J B;  4ORA B;  1K8U A;  3WHT B;  1NX0 A;  5JOL A;  2EGD A;  2F33 A;  1QLS A;  2K7D A;  3TDU A;  1IJ6 A;  2KYF A;  4XJK B;  2KI6 C;  1ZAC A;  1WLM A;  4C0J A;  5B8I B;  1WRZ A;  3ICB A;  5I8N A;  1RK9 A;  5DKN A;  2ZN9 A;  2CNP A;  3E3R A;  3PLF B;  4WRI A;  5CSJ A;  2ZFD A;  1OZS A;  4CFQ A;  3H4S E;  3CR5 X;  5AAN A;  4PHN A;  5HKZ A;  4M2P A;  4NQG A;  1AHR A;  2WOS A;  4FQO A;  2Y5I A;  1J7R A;  1BJF A;  3HCM A;  3DVE A;  1OSA A;  1UHK A;  3AAJ A;  2GGZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...