3CZTX

Crystal structure of s100b in the calcium and zinc loaded state at ph 9
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
91
structure length
91
Chain Sequence
MSELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDNDGDGECDFQEFMAFVAMVTTACHEFFEH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein S100-B
publication title The crystal structures of human S100B in the zinc- and calcium-loaded state at three pH values reveal zinc ligand swapping.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal binding protein
total genus 32
structure length 91
sequence length 91
ec nomenclature
pdb deposition date 2008-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00036 EF-hand_1 EF hand
X PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3cztX00
3IQOA 1BJFA 2K2FA 2Y5IA 1XFVO 3CR5X 1KSOA 2KQYA 2EHBA 2WCEA 1CDMA 2K0JA 3A8RA 3JTDC 5FYXA 1DF0A 1TRFA 2JXCA 1V1GA 4YI8A 2KYCA 4GGFA 1B7TZ 2PRUA 1CMFA 1IQ3A 2HETA 1FPWA 2K7DA 1BMOA 4JWQA 4BY4A 1BOCA 1RECA 3SIBA 3BOWB 1DJIA 5HLVA 2OS8C 3KPXA 4MBEA 4I5NB 2G2BA 1PSRA 1WLZA 2F2OA 2BE6A 1KCYA 3VGOA 3SG2A 1DJWA 4CPVA 3I5FC 1WDCB 1Q80A 5HYDA 3TS5B 1NP8A 1SR6C 2I18A 3BUMB 1EG3A 5HKZA 2KI4C 1RTP1 2ZN9A 1DJYA 2CTNA 2LLUA 1EJ3A 2LLSA 2O5GA 2LMTA 3GK1A 2LVJA 2G9BA 3DF0B 5AFPA 5HKWA 1XFXO 1KSMA 1K2HA 3RM1A 4ICBA 2ZKMX 3PFVA 1BT6A 4BY5A 2LNKA 1RWYA 1IJ6A 2PSRA 1C07A 1XK4A 2GV5A 3OP0A 1QX2A 1B8RA 2JTTA 4USLA 2M97A 4NDCA 5JOLA 3ZNIA 1YX7A 2AMIA 4ORBB 4OVNF 1KK8B 4E68A 1JF0A 4YGCB 3WHUB 5D7FA 1ZFSA 1PULA 1DGVA 4YBHB 2EC6B 1AVSA 2OPOA 2KAYA 3CS1A 5AXIA 2H2KA 2ISDA 1NPQA 4PE7A 5CSFA 1BF5A 1MF8B 2JT0A 4MRYA 1IGVA 1CDPA 4HRHA 1SMGA 3DF0A 1CFDA 3O2PA 4WQ2A 5AEQA 2CCMA 2BBMA 1A29A 3VRNA 1XVJA 3DVKA 2IS9A 2JNXA 3EVUA 3TDIA 2MLEC 3GK4X 4N5XA 1UHNA 1AK8A 1QVIZ 3VRQA 1IRJA 3TUYB 4WRIA 4GBAA 3O6BA 1UHIA 2M8UA 3FS7A 2PVBA 2LP3A 1S26D 1KWOC 3TZ1A 2PASA 1L2OB 1WRZA 1R6PA 2JT3A 1J55A 1KK8C 1SW8A 2CBLA 1BG1A 1QLKA 4UPGA 1JC2A 1ZOTB 3I5GC 3A4UB 1NCZA 5ER4X 1N65A 3EK8A 4PHJA 1OMRA 1SRAA 2KAXA 2JNFA 1CMGA 2I2RE 2K61A 1SCMB 1K90D 4CIDA 1CM4A 3BXKA 5HKYA 3BUOB 1S6JA 2BCBA 2FOTA 1DF0B 1M45A 1MHOA 3F45A 5TNCA 1XO5A 2BE4A 1A75A 2L50A 2TN4A 1S5GZ 3SIAA 2LV7A 2JPTA 1DGUA 1J1DA 1EXRA 1IQ5A 1QJTA 2A4JA 2BKHB 1L7ZA 1TNWA 2K8MB 2F3ZA 2ZFDA 4DS7A 3OB2B 2ZNEA 3DD4A 1OZSA 2HQ8A 1K95A 1RJVA 4M2OA 4NQGA 1UHJA 3TUYC 1E8AA 1MUXA 1OZOA 3BUXB 4FQOA 4HSZA 4YGBB 1OQPA 2DOQA 1CDLA 3HCMA 2WCFA 4MZJA 4HRGA 3OX6A 2F8PA 3DVEA 1WY9A 4A4BA 2D8NA 1CFPA 3LK0A 2I94A 1M31A 1SYMA 4I5KA 3PN7B 1DMOA 1K94A 1XFYO 2M1UA 1FI5A 4AOMA 4ETOA 3BUNB 4OR9B 1UHKA 1Y1UA 4GUKA 5GQQC 2BCXA 1GGZA 3I5IB 1SCMC 1S6CA 1M63B 1LKJA 1JFJA 1SCVA 1FW4A 1FF1A 2BL0B 1QIWA 4GGFC 2Y1MA 4ORCB 4QJ3B 2MHHA 3IF7A 1F4QA 2OTGC 3KHEA 2L4HA 1IH0A 1LVCD 3KO0A 1JFKA 5I2OA 1TNPA 1S36A 1KK7Z 1G8IA 2ZRTA 1SKTA 1AJ5A 3KF9A 5CPVA 4WQ3A 1HQVA 3JVTB 1YX8A 1BU3A 3AKBA 4M2QA 2KBIA 5HLOA 1S6IA 3SG4A 4Q04A 2AUCA 1RK9A 3WHTB 2KI6D 2LMVA 1B7TY 3FIAA 4GAOA 4CLNA 1LA0A 1AJ4A 1ZMZA 4OKHA 1NSHA 1Y0VH 2Q4UA 2ZN8A 4YGAA 3NXAA 1QX5B 2JTZA 3FWBA 4XYNA 1K9UA 2F2PA 2H61C 2I7AA 3PLFB 1BR1B 3EK7A 1B8CA 3OB1B 1ZACA 2KI6C 1J7PA 1N2DA 2BCAA 3NSOA 1SNLA 2Q91A 2L5XB 3TDZA 4CFQA 3LK1A 1QV1A 2JULA 1RROA 2M49B 1BLQA 1NCYA 3WXAA 2KFGA 1N0YA 1RFJA 3FWCA 3BUWB 5CSNA 1HT9A 4MLWA 5I2QA 2LUXA 2LMUA 1ALVA 3IQQA 4NDDA 1WDCC 3CR4X 3TS5C 3AAKA 5CSJA 5JJGA 2KYFA 2BKIB 1X02A 1KFXS 2JRFA 2SCPA 3JVTC 4GFTA 1K9PA 1OOJA 2QPTA 3EVVA 5KTYA 1JWDA 1QTXA 1OSAA 4ORAB 5B8IB 1A75B 1UWOA 3EK4A 1DVIA 2Y4QA 2MA2A 4GNKB 1QX7A 2AAOA 3RLZA 1S1EA 4QJ4B 2HQWA 3CWGA 2MAZA 1NX3A 2LC5A 1XA5A 2VRGA 3SG3A 2F33A 2KAVA 1NWDA 1B1GA 1PK0D 2WNDA 1F71A 2LM5A 2M3WA 2SASA 1TTXA 2WCBA 5DKQA 3D0YA 1B4CA 5KU1A 1JF2A 4JPZB 1KFXL 1H8BA 2KOTA 3ICBA 3M0WA 2B1UA 4PHKA 1B8LA 2EC6C 3I5HB 2K2AA 3CGAA 3NSLA 1TN4A 1AHRA 2L2EA 4MSPA 4OV2A 4TNCA 3PATA 1QVIY 1A2XA 1OMDA 1QATA 1F4OA 2M7NA 3LCPC 4YGDB 1SL8A 2COLB 4QJ5B 3PALA 1QS7A 2JZIA 2NXQA 1KFUS 1G33A 3VROA 1BODA 1C7VA 3E3RA 2JQ6A 2KDHA 2KBMA 2FCDA 3JTDB 5AERA 1CNPA 2LHLA 1NUBA 2LVKA 4U8DA 1SPYA 3VRRA 1ZUZA 2KHNA 2KGRA 4MZKA 4IL1A 1UHHA 1CFFA 4GGNA 1SL9A 1ALWA 4YGEB 1CFCA 1L2OC 3DVMA 1MXEA 3AAJA 1DJXA 4MVFA 1NX0A 2BECA 2M29A 1G4YR 5DKNA 2KQ6A 1DT7B 2OS8B 1IKUA 1KQMB 1TIZA 1MR8A 3PSRA 3QRXA 4C0LA 1S5GY 1KFUL 1UURA 1JSAA 3I5FB 3BYAA 3TDUA 1PSBA 2KGBC 5IBWA 1CDNA 1NYAA 2LUCA 3H4SE 2JC2A 1U5IA 1NX1A 2CXJA 3DVJA 2LE9B 2MJWB 3OHMB 2F3YA 2LLTA 2R2IA 2KI4B 5G08A 1SK6D 1UP5A 1XFZO 2WORA 2K7OA 1MQ1A 3LLEA 4GPLB 2O60A 1FI6A 4YI9A 1BR4B 1DTLA 2LVVA 4ZCUA 3OX5A 1J7RA 2ZRSA 1AP4A 1CB1A 3AKAA 1OMVA 2PMYA 4XJKA 1CM1A 1SL7A 1J1EA 1CTRA 2MLFC 1UUSA 1TOPA 1NCXA 1OE9B 2K7CA 4MRXA 3GK2A 1Y1XA 4JQ0D 1XFUO 4YRUA 1CLMA 2JT8A 3SG6A 1QV0A 2P6BB 1JBAA 1F70A 1S3PA 3KEVA 4MEWA 3CR2A 1QIVA 4PALA 1KQMC 4PE0A 3PN7C 4AQIA 4C0KA 2BBNA 1PALA 4A4CA 1NIWA 2L98A 3O78A 3D10A 2WOSA 1K93D 4PE4A 3SG7A 1Y6WA 3I5IC 3K21A 1YURA 2M0RA 4AQJA 1JUOA 1IJ5A 1KK7Y 2JOJA 1R2UA 2JU0A 2JWWA 1PVAA 2NCPA 1XK4C 2BL0C 2LHIA 4P5OE 3WNXB 1QASA 5PALA 3SJSA 3VRPA 1DJHA 1B47A 4CFRA 2GGZA 2H61A 1D1OA 1IG5A 2E30A 3D0YB 1F55A 2M1KB 1EH2A 2NZ0A 4I5JA 4PCWA 3NSIA 2RGIA 2PALA 2JXLA 2M7LA 1GJYA 1YUUA 1K96A 1TCFA 2Y1NA 2L0PA 4I5LB 1KWOB 1KQVA 2LCPA 3LL8B 3BQ3A 3EKJA 1PVBA 2HPSA 1YVHA 2LP2A 3BOWA 1YR5A 1YRUB 4OCIA 2NCOA 2LVIA 4MN0A 1V1FA 3CTNA 4PE1A 4L9MA 1F8HA 2L51A 5I2LA 2M9GA 1CLLA 1M46A 1YUTA 1FBVA 3HX4A 3I5GB 2FJUB 2CNPA 1M39A 3CZTX 1F54A 4DUQA 1W7IB 5F6TA 4D1EA 1XFWO 3MSEB 1IWQA 3ZWHA 1Y1AA 2ZNDA 4N1FA 3EVRA 2EGDA 1VRKA 1NX2A 5BPJA 3EKHA 1GGWA 2L4IA 3PM8A 5D69A 2MBXA 1LA3A 1TCOB 2KFHA 1WRKA 4ZCVA 2CT9A 1GQMA 2LAPA 2LANA 1C7WA 4PHMA 5KSZA 1AUIB 2KSPA 4M2PA 4F0ZB 5J3XA 1LINA 1A4PA 2GGMA 2FCEA 5I8NA 4R1EA 2KFFA 2QACA 1YUSA 4NDBA 4HREE 1DJGA 1CLBA 4MZLA 3GOFA 1MXLC 1YTZC 1U5IB 1SBJA 3CLNA 4N1GA 5ER5A 3O4YA 4DCKA 2WC8A 2KNEA 5K89A 1K8UA 5DKRA 4PHNA 1ODBA 1TNXA 1TNQA 2K7BA 1XYDA 1EL4A 3NSKA 1A03A 2NLNA 1YVLA 1SY9A 1MWNA 1W7JB 1QLSA 4XJKB 1PRWA 4DIRA 1J7OA 1K9KA 2V53A 2MRDA 1J7QA 1WRLA 1DJZA 4PDZA 1B9AA 1LXFC 2OTGB 3C1VA 2HF5A 5CSIA 3SG5A 1WLMA 3I5HC 1CKKA 1EG4A 1SR6B 5AANA 4DRWA 1YRTB 2E6WA 4FTGA 1H4BA 4C0JA 1QXPA 4P2YB
chains in the Genus database with same CATH superfamily
3IQOA 2KPHA 1BJFA 2K2FA 2Y5IA 1XFVO 3CR5X 1KSOA 2KQYA 2EHBA 2WCEA 1CDMA 2K0JA 1W9ZA 3A8RA 3JTDC 5FYXA 1DF0A 1TRFA 2JXCA 1V1GA 4YI8A 2KYCA 4GGFA 3S0EA 1B7TZ 2PRUA 1CMFA 1IQ3A 2HETA 1FPWA 2K7DA 1BMOA 4JWQA 4BY4A 1BOCA 1RECA 3SIBA 3BOWB 1DJIA 5HLVA 2OS8C 3KPXA 4MBEA 4I5NB 3CABA 2G2BA 1PSRA 1WLZA 2F2OA 2BE6A 2WCLA 3VGOA 1KCYA 3SG2A 1DJWA 4CPVA 3I5FC 1WDCB 1Q80A 2PYQA 3TS5B 5HYDA 1NP8A 1SR6C 2I18A 3BUMB 1EG3A 5HKZA 2KI4C 1RTP1 2ZN9A 1DJYA 2CTNA 2LLUA 1EJ3A 2LLSA 2O5GA 2LMTA 3GK1A 2LVJA 2G9BA 3DF0B 5AFPA 3CYZA 4JKTA 3D73A 1XFXO 5HKWA 1KSMA 4PT1A 1K2HA 3RM1A 4ICBA 2ZKMX 3PFVA 1BT6A 4BY5A 2LNKA 1RWYA 1IJ6A 2PSRA 1C07A 1XK4A 3QMEA 2GV5A 3OP0A 1QX2A 1B8RA 2JTTA 1C3ZA 4USLA 2M97A 4NDCA 5JOLA 3ZNIA 1YX7A 2AMIA 4ORBB 4OVNF 1KK8B 4E68A 1JF0A 4YGCB 3WHUB 5D7FA 1ZFSA 1PULA 1DGVA 4YBHB 2EC6B 1AVSA 2OPOA 2WCMA 2KAYA 3CS1A 5AXIA 2H2KA 2ISDA 3L4AA 1NPQA 3CZ0A 2PQLA 4PE7A 5CSFA 1BF5A 1MF8B 2JT0A 3D76A 1IGVA 2P70A 4MRYA 1CDPA 4HRHA 1SMGA 3DF0A 1CFDA 3O2PA 4WQ2A 5AEQA 2CCMA 1T14A 2BBMA 1A29A 3VRNA 1XVJA 3DVKA 3NHIA 2IS9A 2JNXA 3EVUA 3TDIA 2MLEC 1C3YA 3GK4X 4N5XA 3SS4A 1UHNA 1AK8A 1QVIZ 3VRQA 1IRJA 3TUYB 4WRIA 4GBAA 3O6BA 1UHIA 2M8UA 3FS7A 4F7FA 2PVBA 2LP3A 1S26D 1KWOC 3TZ1A 1OOFA 2PASA 3PM2A 1L2OB 1WRZA 3OBVA 1Z4HA 1R6PA 2JT3A 1J55A 1KK8C 1SW8A 2CBLA 1BG1A 1QLKA 4UPGA 1JC2A 1ZOTB 3I5GC 3A4UB 1NCZA 5ER4X 1N65A 3EK8A 4PHJA 1OMRA 1SRAA 2KAXA 4OZDA 2JNFA 1CMGA 3DY9A 2I2RE 3FE6A 2K61A 1SCMB 1K90D 4CIDA 3S0AA 1CM4A 3BXKA 5HKYA 1OOGA 3BUOB 1S6JA 2BCBA 2FOTA 1DF0B 1M45A 1MHOA 3F45A 5TNCA 1XO5A 2BE4A 1A75A 2L50A 2TN4A 1S5GZ 3SIAA 2LV7A 2JPTA 1DGUA 1J1DA 1EXRA 1IQ5A 1QJTA 2A4JA 2BKHB 3OGNA 1GM0A 1L7ZA 1TNWA 2K8MB 2F3ZA 2ZFDA 4DS7A 3OB2B 2ZNEA 3DD4A 1OZSA 2HQ8A 1K95A 1RJVA 4M2OA 4NQGA 1UHJA 3TUYC 1E8AA 1MUXA 1OZOA 3BUXB 4FQOA 4HSZA 4YGBB 1OQPA 2DOQA 1CDLA 3HCMA 2WCFA 4MZJA 4HRGA 3OX6A 2WCJA 2F8PA 3DVEA 1WY9A 4INXA 4A4BA 2D8NA 1CFPA 3LK0A 2I94A 1M31A 1SYMA 4I5KA 3PN7B 1DMOA 1K94A 1XFYO 2M1UA 1FI5A 4AOMA 4ETOA 3BUNB 4OR9B 1UHKA 1Y1UA 4GUKA 5GQQC 2BCXA 3EG5B 1GGZA 3I5IB 1SCMC 1S6CA 1M63B 1LKJA 1JFJA 1P28A 1SCVA 1FW4A 3BJHA 1FF1A 2BL0B 1QIWA 4GGFC 3D74A 2Y1MA 4ORCB 4QJ3B 1OW4A 2MHHA 3IF7A 1F4QA 2OTGC 2WCKA 3KHEA 2L4HA 1IH0A 1LVCD 3KO0A 3UO9A 1JFKA 5I2OA 1TNPA 1S36A 2BAPA 1KK7Z 1G8IA 2ZRTA 1SKTA 3FE8A 1AJ5A 3KF9A 3BFHA 5CPVA 4WQ3A 1HQVA 3JVTB 1YX8A 1BU3A 3AKBA 4M2QA 2KBIA 5HLOA 1S6IA 3SG4A 4Q04A 2AUCA 1RK9A 3WHTB 2KI6D 2LMVA 1B7TY 3FIAA 4GAOA 4CLNA 1LA0A 3FE9A 1AJ4A 1ZMZA 4OKHA 1NSHA 1Y0VH 2Q4UA 2ZN8A 3L47A 4YGAA 3NXAA 1QX5B 2JTZA 3FWBA 4XYNA 2GTEA 3NHTA 1K9UA 2F2PA 2H61C 2I7AA 3PLFB 1BR1B 3S0GA 3EK7A 1B8CA 2ERBA 3OB1B 1ZACA 2KI6C 1J7PA 1N2DA 2BCAA 2QEBA 1SNLA 2Q91A 2L5XB 3B86A 3NSOA 3TDZA 3LK1A 1QV1A 4CFQA 2JULA 1RROA 2M49B 1BLQA 2QDIA 1NCYA 3WXAA 2KFGA 1N0YA 1RFJA 2H8VA 3FWCA 3BUWB 5CSNA 1HT9A 4MLWA 5I2QA 2LUXA 3BFBA 2LMUA 1ALVA 3IQQA 4NDDA 1WDCC 1LS8A 3B88A 3CR4X 3TS5C 3AAKA 5CSJA 5JJGA 2WC6A 2KYFA 2BKIB 1X02A 1KFXS 2JRFA 2SCPA 3JVTC 4GFTA 1K9PA 1OOJA 2QPTA 3EVVA 5KTYA 1JWDA 2WCHA 1QTXA 1OSAA 2JPOA 4ORAB 1A75B 5B8IB 3N7HA 1UWOA 3EK4A 1DVIA 3R1OA 2Y4QA 2MA2A 4GNKB 1QX7A 2AAOA 3RLZA 1S1EA 4QJ4B 2HQWA 3CWGA 2MAZA 1NX3A 2LC5A 1XA5A 4FQTA 2VRGA 3SG3A 2F33A 5I94A 2KAVA 1NWDA 1B1GA 1PK0D 2WNDA 1F71A 2LM5A 2M3WA 2SASA 1TTXA 2WCBA 5DKQA 3D0YA 1DC1A 1B4CA 5KU1A 1JF2A 4JPZB 1KFXL 1H8BA 2KOTA 3ICBA 3K1EA 3M0WA 2B1UA 4PHKA 1B8LA 2EC6C 3I5HB 2K2AA 3R1PA 3CGAA 3NSLA 1TN4A 1AHRA 2L2EA 4MSPA 4OV2A 4TNCA 3PATA 3CDNA 1QVIY 1A2XA 1OMDA 1QATA 1F4OA 2M7NA 3LCPC 4YGDB 3UNWA 1SL8A 3DXLA 3S0BA 2COLB 4QJ5B 3PALA 1QS7A 2JZIA 2NXQA 1KFUS 1G33A 3VROA 5HL1A 1BODA 1C7VA 3E3RA 2JQ6A 2KDHA 2KBMA 2FCDA 3IVTA 3JTDB 4INWA 2LHLA 1NUBA 2BNXA 2LVKA 5AERA 4U8DA 1SPYA 3VRRA 1ZUZA 2KHNA 1Z2CB 2KGRA 4MZKA 4IL1A 1UHHA 1CFFA 4GGNA 1SL9A 1ALWA 4YGEB 1CFCA 1L2OC 3DVMA 5FI2A 1MXEA 2YGUA 1XFRA 3BFAA 3AAJA 1DJXA 4MVFA 1NX0A 2BECA 2M29A 1G4YR 1OOHA 2KQ6A 5DKNA 2L5YA 2P71A 2OS8B 1DT7B 1IKUA 1KQMB 1TIZA 1MR8A 3PSRA 3QRXA 4C0LA 2QEHA 1S5GY 1KFUL 1UURA 3L4LA 1JSAA 3I5FB 3BYAA 3SS5A 1PSBA 4JD9A 2KGBC 5D3OA 3TDUA 5IBWA 1NYAA 2LUCA 3H4SE 2JC2A 1CDNA 1U5IA 1NX1A 3VB1A 2CXJA 3DVJA 2LE9B 2MJWB 3OHMB 2F3YA 2LLTA 2R2IA 2KI4B 5G08A 1SK6D 1UP5A 1XFZO 4KYNA 2KLDA 2WORA 2K7OA 1MQ1A 2K60A 3LLEA 4GPLB 2O60A 1FI6A 2FJYA 1IIOA 4YI9A 3Q8IA 1BR4B 1DTLA 2LVVA 4ZCUA 3OX5A 1J7RA 2ZRSA 3S0FA 3B7AA 3AKAA 1OMVA 1AP4A 1CB1A 2PMYA 4XJKA 1CM1A 1SL7A 3O4XA 1J1EA 1CTRA 2L2CA 2MLFC 3D75A 1UUSA 1TOPA 1NCXA 1OE9B 1TWOA 2K7CA 4MRXA 3GK2A 1Y1XA 4JQ0D 1XFUO 4YRUA 1CLMA 2JT8A 3SG6A 1QV0A 1QWVA 2P6BB 1JBAA 1F70A 1S3PA 3KEVA 4MEWA 3CR2A 1QIVA 4PALA 1KQMC 4PE0A 3PN7C 4AQIA 4C0KA 2BBNA 1PALA 4A4CA 3D77A 1CNPA 1NIWA 2L98A 3O78A 3D10A 2WOSA 1K93D 4PE4A 3SG7A 1Y6WA 3I5IC 3K21A 1YURA 2M0RA 4AQJA 1JUOA 1IJ5A 1KK7Y 2JOJA 1R2UA 2JU0A 2JWWA 1PVAA 2NCPA 1XK4C 2BL0C 2LHIA 4P5OE 3WNXB 1QASA 5PALA 1DEKA 3SJSA 3VRPA 1DJHA 1B47A 3R72A 4CFRA 2GGZA 2H61A 1D1OA 1IG5A 2E30A 3D0YB 5EL2A 2KLEA 1F55A 2M1KB 1EH2A 2NZ0A 4I5JA 4PCWA 3NSIA 2RGIA 2PALA 2JXLA 2M7LA 1GJYA 1SSEB 1YUUA 1K96A 1TCFA 2Y1NA 2L0PA 4I5LB 1KWOB 1KQVA 2LCPA 3LL8B 3DZTA 3BQ3A 3EKJA 1PVBA 2HPSA 1YVHA 2LP2A 3BOWA 1YR5A 1YRUB 4OCIA 2NCOA 2LVIA 4MN0A 1V1FA 3CTNA 3PJIA 4IJ7A 4L9MA 4PE1A 1F8HA 2L51A 5I2LA 2M9GA 1CLLA 1M46A 1YUTA 1FBVA 3HX4A 3I5GB 2FJUB 2CNPA 1M39A 3CZTX 1F54A 5FI7A 4DUQA 1W7IB 5F6TA 4D1EA 1XFWO 3MSEB 1IWQA 3ZWHA 1DQEA 1Y1AA 2ZNDA 3CZ2A 4N1FA 3EVRA 2EGDA 1ORGA 1VRKA 1NX2A 5BPJA 3EKHA 1GGWA 2L4IA 2WC5A 3PM8A 5D69A 2MBXA 1LA3A 1TCOB 2KFHA 3DYEA 1WRKA 4ZCVA 2CT9A 1GQMA 2LAPA 2LANA 3NGVA 1C7WA 3CZ1A 4PHMA 3V2LA 5KSZA 1AUIB 2KSPA 4M2PA 4F0ZB 5J3XA 1LINA 1A4PA 2GGMA 2FCEA 5DICA 5I8NA 4R1EA 2KFFA 2QACA 1YUSA 4NDBA 1TUZA 1DJGA 4HREE 1CLBA 4MZLA 3GOFA 1MXLC 3D78A 1YTZC 1U5IB 1SBJA 3CLNA 4N1GA 5ER5A 3O4YA 4DCKA 2WC8A 2KNEA 1TUJA 5K89A 1K8UA 5DKRA 4PHNA 1ODBA 1TNXA 1TNQA 3R1VA 1OOIX 2K7BA 1XYDA 1EL4A 2QEOA 3B6XA 3NSKA 3RZSA 1A03A 2NLNA 1YVLA 1SY9A 1MWNA 1W7JB 1QLSA 4XJKB 1PRWA 1DELA 4DIRA 1K9KA 2V53A 2MRDA 1J7OA 1J7QA 1WRLA 3SS3A 1DJZA 4PDZA 1B9AA 3B87A 1LXFC 2OTGB 5FI6A 3C1VA 2HF5A 2QEVA 5CSIA 3S0DA 3SG5A 1WLMA 3I5HC 1CKKA 1EG4A 1SR6B 5AANA 4DRWA 1YRTB 2E6WA 4FTGA 1H4BA 4C0JA 1QXPA 4P2YB
chains in the Genus database with same CATH topology
3IQOA 1BJFA 2K2FA 2Y5IA 1XFVO 3CR5X 1KSOA 2KQYA 2EHBA 2WCEA 1CDMA 2K0JA 3A8RA 3JTDC 5FYXA 1DF0A 1TRFA 2JXCA 1V1GA 4YI8A 2KYCA 4GGFA 1B7TZ 2PRUA 1CMFA 1IQ3A 2HETA 1FPWA 2K7DA 1BMOA 4JWQA 4BY4A 1BOCA 1RECA 3SIBA 3BOWB 1DJIA 5HLVA 2OS8C 3KPXA 4MBEA 4I5NB 2G2BA 1PSRA 1WLZA 2F2OA 2BE6A 1KCYA 3VGOA 3SG2A 1DJWA 4CPVA 3I5FC 1WDCB 1Q80A 5HYDA 3TS5B 1NP8A 1SR6C 2I18A 3BUMB 1EG3A 5HKZA 2KI4C 1RTP1 2ZN9A 1DJYA 2CTNA 2LLUA 1EJ3A 2LLSA 2O5GA 2LMTA 3GK1A 2LVJA 2G9BA 3DF0B 5AFPA 5HKWA 1XFXO 1KSMA 1K2HA 3RM1A 4ICBA 2ZKMX 3PFVA 1BT6A 4BY5A 2LNKA 1RWYA 1IJ6A 2PSRA 1C07A 1XK4A 2GV5A 3OP0A 1QX2A 1B8RA 2JTTA 4USLA 2M97A 4NDCA 5JOLA 3ZNIA 1YX7A 2AMIA 4ORBB 4OVNF 1KK8B 4E68A 1JF0A 4YGCB 3WHUB 5D7FA 1ZFSA 1PULA 1DGVA 4YBHB 2EC6B 1AVSA 2OPOA 2KAYA 3CS1A 5AXIA 2H2KA 2ISDA 1NPQA 4PE7A 5CSFA 1BF5A 1MF8B 2JT0A 4MRYA 1IGVA 1CDPA 4HRHA 1SMGA 3DF0A 1CFDA 3O2PA 4WQ2A 5AEQA 2CCMA 2BBMA 1A29A 3VRNA 1XVJA 3DVKA 2IS9A 2JNXA 3EVUA 3TDIA 2MLEC 3GK4X 4N5XA 1UHNA 1AK8A 1QVIZ 3VRQA 1IRJA 3TUYB 4WRIA 4GBAA 3O6BA 1UHIA 2M8UA 3FS7A 2PVBA 2LP3A 1S26D 1KWOC 3TZ1A 2PASA 1L2OB 1WRZA 1R6PA 2JT3A 1J55A 1KK8C 1SW8A 2CBLA 1BG1A 1QLKA 4UPGA 1JC2A 1ZOTB 3I5GC 3A4UB 1NCZA 5ER4X 1N65A 3EK8A 4PHJA 1OMRA 1SRAA 2KAXA 2JNFA 1CMGA 2I2RE 2K61A 1SCMB 1K90D 4CIDA 1CM4A 3BXKA 5HKYA 3BUOB 1S6JA 2BCBA 2FOTA 1DF0B 1M45A 1MHOA 3F45A 5TNCA 1XO5A 2BE4A 1A75A 2L50A 2TN4A 1S5GZ 3SIAA 2LV7A 2JPTA 1DGUA 1J1DA 1EXRA 1IQ5A 1QJTA 2A4JA 2BKHB 1L7ZA 1TNWA 2K8MB 2F3ZA 2ZFDA 4DS7A 3OB2B 2ZNEA 3DD4A 1OZSA 2HQ8A 1K95A 1RJVA 4M2OA 4NQGA 1UHJA 3TUYC 1E8AA 1MUXA 1OZOA 3BUXB 4FQOA 4HSZA 4YGBB 1OQPA 2DOQA 1CDLA 3HCMA 2WCFA 4MZJA 4HRGA 3OX6A 2F8PA 3DVEA 1WY9A 4A4BA 2D8NA 1CFPA 3LK0A 2I94A 1M31A 1SYMA 4I5KA 3PN7B 1DMOA 1K94A 1XFYO 2M1UA 1FI5A 4AOMA 4ETOA 3BUNB 4OR9B 1UHKA 1Y1UA 4GUKA 5GQQC 2BCXA 1GGZA 3I5IB 1SCMC 1S6CA 1M63B 1LKJA 1JFJA 1SCVA 1FW4A 1FF1A 2BL0B 1QIWA 4GGFC 2Y1MA 4ORCB 4QJ3B 2MHHA 3IF7A 1F4QA 2OTGC 3KHEA 2L4HA 1IH0A 1LVCD 3KO0A 1JFKA 5I2OA 1TNPA 1S36A 1KK7Z 1G8IA 2ZRTA 1SKTA 1AJ5A 3KF9A 5CPVA 4WQ3A 1HQVA 3JVTB 1YX8A 1BU3A 3AKBA 4M2QA 2KBIA 5HLOA 1S6IA 3SG4A 4Q04A 2AUCA 1RK9A 3WHTB 2KI6D 2LMVA 1B7TY 3FIAA 4GAOA 4CLNA 1LA0A 1AJ4A 1ZMZA 4OKHA 1NSHA 1Y0VH 2Q4UA 2ZN8A 4YGAA 3NXAA 1QX5B 2JTZA 3FWBA 4XYNA 1K9UA 2F2PA 2H61C 2I7AA 3PLFB 1BR1B 3EK7A 1B8CA 3OB1B 1ZACA 2KI6C 1J7PA 1N2DA 2BCAA 3NSOA 1SNLA 2Q91A 2L5XB 3TDZA 4CFQA 3LK1A 1QV1A 2JULA 1RROA 2M49B 1BLQA 1NCYA 3WXAA 2KFGA 1N0YA 1RFJA 3FWCA 3BUWB 5CSNA 1HT9A 4MLWA 5I2QA 2LUXA 2LMUA 1ALVA 3IQQA 4NDDA 1WDCC 3CR4X 3TS5C 3AAKA 5CSJA 5JJGA 2KYFA 2BKIB 1X02A 1KFXS 2JRFA 2SCPA 3JVTC 4GFTA 1K9PA 1OOJA 2QPTA 3EVVA 5KTYA 1JWDA 1QTXA 1OSAA 4ORAB 5B8IB 1A75B 1UWOA 3EK4A 1DVIA 2Y4QA 2MA2A 4GNKB 1QX7A 2AAOA 3RLZA 1S1EA 4QJ4B 2HQWA 3CWGA 2MAZA 1NX3A 2LC5A 1XA5A 2VRGA 3SG3A 2F33A 2KAVA 1NWDA 1B1GA 1PK0D 2WNDA 1F71A 2LM5A 2M3WA 2SASA 1TTXA 2WCBA 5DKQA 3D0YA 1B4CA 5KU1A 1JF2A 4JPZB 1KFXL 1H8BA 2KOTA 3ICBA 3M0WA 2B1UA 4PHKA 1B8LA 2EC6C 3I5HB 2K2AA 3CGAA 3NSLA 1TN4A 1AHRA 2L2EA 4MSPA 4OV2A 4TNCA 3PATA 1QVIY 1A2XA 1OMDA 1QATA 1F4OA 2M7NA 3LCPC 4YGDB 1SL8A 2COLB 4QJ5B 3PALA 1QS7A 2JZIA 2NXQA 1KFUS 1G33A 3VROA 1BODA 1C7VA 3E3RA 2JQ6A 2KDHA 2KBMA 2FCDA 3JTDB 5AERA 1CNPA 2LHLA 1NUBA 2LVKA 4U8DA 1SPYA 3VRRA 1ZUZA 2KHNA 2KGRA 4MZKA 4IL1A 1UHHA 1CFFA 4GGNA 1SL9A 1ALWA 4YGEB 1CFCA 1L2OC 3DVMA 1MXEA 3AAJA 1DJXA 4MVFA 1NX0A 2BECA 2M29A 1G4YR 5DKNA 2KQ6A 1DT7B 2OS8B 1IKUA 1KQMB 1TIZA 1MR8A 3PSRA 3QRXA 4C0LA 1S5GY 1KFUL 1UURA 1JSAA 3I5FB 3BYAA 3TDUA 1PSBA 2KGBC 5IBWA 1CDNA 1NYAA 2LUCA 3H4SE 2JC2A 1U5IA 1NX1A 2CXJA 3DVJA 2LE9B 2MJWB 3OHMB 2F3YA 2LLTA 2R2IA 2KI4B 5G08A 1SK6D 1UP5A 1XFZO 2WORA 2K7OA 1MQ1A 3LLEA 4GPLB 2O60A 1FI6A 4YI9A 1BR4B 1DTLA 2LVVA 4ZCUA 3OX5A 1J7RA 2ZRSA 1AP4A 1CB1A 3AKAA 1OMVA 2PMYA 4XJKA 1CM1A 1SL7A 1J1EA 1CTRA 2MLFC 1UUSA 1TOPA 1NCXA 1OE9B 2K7CA 4MRXA 3GK2A 1Y1XA 4JQ0D 1XFUO 4YRUA 1CLMA 2JT8A 3SG6A 1QV0A 2P6BB 1JBAA 1F70A 1S3PA 3KEVA 4MEWA 3CR2A 1QIVA 4PALA 1KQMC 4PE0A 3PN7C 4AQIA 4C0KA 2BBNA 1PALA 4A4CA 1NIWA 2L98A 3O78A 3D10A 2WOSA 1K93D 4PE4A 3SG7A 1Y6WA 3I5IC 3K21A 1YURA 2M0RA 4AQJA 1JUOA 1IJ5A 1KK7Y 2JOJA 1R2UA 2JU0A 2JWWA 1PVAA 2NCPA 1XK4C 2BL0C 2LHIA 4P5OE 3WNXB 1QASA 5PALA 3SJSA 3VRPA 1DJHA 1B47A 4CFRA 2GGZA 2H61A 1D1OA 1IG5A 2E30A 3D0YB 1F55A 2M1KB 1EH2A 2NZ0A 4I5JA 4PCWA 3NSIA 2RGIA 2PALA 2JXLA 2M7LA 1GJYA 1YUUA 1K96A 1TCFA 2Y1NA 2L0PA 4I5LB 1KWOB 1KQVA 2LCPA 3LL8B 3BQ3A 3EKJA 1PVBA 2HPSA 1YVHA 2LP2A 3BOWA 1YR5A 1YRUB 4OCIA 2NCOA 2LVIA 4MN0A 1V1FA 3CTNA 4PE1A 4L9MA 1F8HA 2L51A 5I2LA 2M9GA 1CLLA 1M46A 1YUTA 1FBVA 3HX4A 3I5GB 2FJUB 2CNPA 1M39A 3CZTX 1F54A 4DUQA 1W7IB 5F6TA 4D1EA 1XFWO 3MSEB 1IWQA 3ZWHA 1Y1AA 2ZNDA 4N1FA 3EVRA 2EGDA 1VRKA 1NX2A 5BPJA 3EKHA 1GGWA 2L4IA 3PM8A 5D69A 2MBXA 1LA3A 1TCOB 2KFHA 1WRKA 4ZCVA 2CT9A 1GQMA 2LAPA 2LANA 1C7WA 4PHMA 5KSZA 1AUIB 2KSPA 4M2PA 4F0ZB 5J3XA 1LINA 1A4PA 2GGMA 2FCEA 5I8NA 4R1EA 2KFFA 2QACA 1YUSA 4NDBA 4HREE 1DJGA 1CLBA 4MZLA 3GOFA 1MXLC 1YTZC 1U5IB 1SBJA 3CLNA 4N1GA 5ER5A 3O4YA 4DCKA 2WC8A 2KNEA 5K89A 1K8UA 5DKRA 4PHNA 1ODBA 1TNXA 1TNQA 2K7BA 1XYDA 1EL4A 3NSKA 1A03A 2NLNA 1YVLA 1SY9A 1MWNA 1W7JB 1QLSA 4XJKB 1PRWA 4DIRA 1J7OA 1K9KA 2V53A 2MRDA 1J7QA 1WRLA 1DJZA 4PDZA 1B9AA 1LXFC 2OTGB 3C1VA 2HF5A 5CSIA 3SG5A 1WLMA 3I5HC 1CKKA 1EG4A 1SR6B 5AANA 4DRWA 1YRTB 2E6WA 4FTGA 1H4BA 4C0JA 1QXPA 4P2YB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IQO A;  1BJF A;  2K2F A;  2Y5I A;  1XFV O;  3CR5 X;  1KSO A;  2KQY A;  2EHB A;  2WCE A;  1CDM A;  2K0J A;  3A8R A;  3JTD C;  5FYX A;  1DF0 A;  1TRF A;  2JXC A;  1V1G A;  4YI8 A;  2KYC A;  4GGF A;  1B7T Z;  2PRU A;  1CMF A;  1IQ3 A;  2HET A;  1FPW A;  2K7D A;  1BMO A;  4JWQ A;  4BY4 A;  1BOC A;  1REC A;  3SIB A;  3BOW B;  1DJI A;  5HLV A;  2OS8 C;  3KPX A;  4MBE A;  4I5N B;  2G2B A;  1PSR A;  1WLZ A;  2F2O A;  2BE6 A;  1KCY A;  3VGO A;  3SG2 A;  1DJW A;  4CPV A;  3I5F C;  1WDC B;  1Q80 A;  5HYD A;  3TS5 B;  1NP8 A;  1SR6 C;  2I18 A;  3BUM B;  1EG3 A;  5HKZ A;  2KI4 C;  1RTP 1;  2ZN9 A;  1DJY A;  2CTN A;  2LLU A;  1EJ3 A;  2LLS A;  2O5G A;  2LMT A;  3GK1 A;  2LVJ A;  2G9B A;  3DF0 B;  5AFP A;  5HKW A;  1XFX O;  1KSM A;  1K2H A;  3RM1 A;  4ICB A;  2ZKM X;  3PFV A;  1BT6 A;  4BY5 A;  2LNK A;  1RWY A;  1IJ6 A;  2PSR A;  1C07 A;  1XK4 A;  2GV5 A;  3OP0 A;  1QX2 A;  1B8R A;  2JTT A;  4USL A;  2M97 A;  4NDC A;  5JOL A;  3ZNI A;  1YX7 A;  2AMI A;  4ORB B;  4OVN F;  1KK8 B;  4E68 A;  1JF0 A;  4YGC B;  3WHU B;  5D7F A;  1ZFS A;  1PUL A;  1DGV A;  4YBH B;  2EC6 B;  1AVS A;  2OPO A;  2KAY A;  3CS1 A;  5AXI A;  2H2K A;  2ISD A;  1NPQ A;  4PE7 A;  5CSF A;  1BF5 A;  1MF8 B;  2JT0 A;  4MRY A;  1IGV A;  1CDP A;  4HRH A;  1SMG A;  3DF0 A;  1CFD A;  3O2P A;  4WQ2 A;  5AEQ A;  2CCM A;  2BBM A;  1A29 A;  3VRN A;  1XVJ A;  3DVK A;  2IS9 A;  2JNX A;  3EVU A;  3TDI A;  2MLE C;  3GK4 X;  4N5X A;  1UHN A;  1AK8 A;  1QVI Z;  3VRQ A;  1IRJ A;  3TUY B;  4WRI A;  4GBA A;  3O6B A;  1UHI A;  2M8U A;  3FS7 A;  2PVB A;  2LP3 A;  1S26 D;  1KWO C;  3TZ1 A;  2PAS A;  1L2O B;  1WRZ A;  1R6P A;  2JT3 A;  1J55 A;  1KK8 C;  1SW8 A;  2CBL A;  1BG1 A;  1QLK A;  4UPG A;  1JC2 A;  1ZOT B;  3I5G C;  3A4U B;  1NCZ A;  5ER4 X;  1N65 A;  3EK8 A;  4PHJ A;  1OMR A;  1SRA A;  2KAX A;  2JNF A;  1CMG A;  2I2R E;  2K61 A;  1SCM B;  1K90 D;  4CID A;  1CM4 A;  3BXK A;  5HKY A;  3BUO B;  1S6J A;  2BCB A;  2FOT A;  1DF0 B;  1M45 A;  1MHO A;  3F45 A;  5TNC A;  1XO5 A;  2BE4 A;  1A75 A;  2L50 A;  2TN4 A;  1S5G Z;  3SIA A;  2LV7 A;  2JPT A;  1DGU A;  1J1D A;  1EXR A;  1IQ5 A;  1QJT A;  2A4J A;  2BKH B;  1L7Z A;  1TNW A;  2K8M B;  2F3Z A;  2ZFD A;  4DS7 A;  3OB2 B;  2ZNE A;  3DD4 A;  1OZS A;  2HQ8 A;  1K95 A;  1RJV A;  4M2O A;  4NQG A;  1UHJ A;  3TUY C;  1E8A A;  1MUX A;  1OZO A;  3BUX B;  4FQO A;  4HSZ A;  4YGB B;  1OQP A;  2DOQ A;  1CDL A;  3HCM A;  2WCF A;  4MZJ A;  4HRG A;  3OX6 A;  2F8P A;  3DVE A;  1WY9 A;  4A4B A;  2D8N A;  1CFP A;  3LK0 A;  2I94 A;  1M31 A;  1SYM A;  4I5K A;  3PN7 B;  1DMO A;  1K94 A;  1XFY O;  2M1U A;  1FI5 A;  4AOM A;  4ETO A;  3BUN B;  4OR9 B;  1UHK A;  1Y1U A;  4GUK A;  5GQQ C;  2BCX A;  1GGZ A;  3I5I B;  1SCM C;  1S6C A;  1M63 B;  1LKJ A;  1JFJ A;  1SCV A;  1FW4 A;  1FF1 A;  2BL0 B;  1QIW A;  4GGF C;  2Y1M A;  4ORC B;  4QJ3 B;  2MHH A;  3IF7 A;  1F4Q A;  2OTG C;  3KHE A;  2L4H A;  1IH0 A;  1LVC D;  3KO0 A;  1JFK A;  5I2O A;  1TNP A;  1S36 A;  1KK7 Z;  1G8I A;  2ZRT A;  1SKT A;  1AJ5 A;  3KF9 A;  5CPV A;  4WQ3 A;  1HQV A;  3JVT B;  1YX8 A;  1BU3 A;  3AKB A;  4M2Q A;  2KBI A;  5HLO A;  1S6I A;  3SG4 A;  4Q04 A;  2AUC A;  1RK9 A;  3WHT B;  2KI6 D;  2LMV A;  1B7T Y;  3FIA A;  4GAO A;  4CLN A;  1LA0 A;  1AJ4 A;  1ZMZ A;  4OKH A;  1NSH A;  1Y0V H;  2Q4U A;  2ZN8 A;  4YGA A;  3NXA A;  1QX5 B;  2JTZ A;  3FWB A;  4XYN A;  1K9U A;  2F2P A;  2H61 C;  2I7A A;  3PLF B;  1BR1 B;  3EK7 A;  1B8C A;  3OB1 B;  1ZAC A;  2KI6 C;  1J7P A;  1N2D A;  2BCA A;  3NSO A;  1SNL A;  2Q91 A;  2L5X B;  3TDZ A;  4CFQ A;  3LK1 A;  1QV1 A;  2JUL A;  1RRO A;  2M49 B;  1BLQ A;  1NCY A;  3WXA A;  2KFG A;  1N0Y A;  1RFJ A;  3FWC A;  3BUW B;  5CSN A;  1HT9 A;  4MLW A;  5I2Q A;  2LUX A;  2LMU A;  1ALV A;  3IQQ A;  4NDD A;  1WDC C;  3CR4 X;  3TS5 C;  3AAK A;  5CSJ A;  5JJG A;  2KYF A;  2BKI B;  1X02 A;  1KFX S;  2JRF A;  2SCP A;  3JVT C;  4GFT A;  1K9P A;  1OOJ A;  2QPT A;  3EVV A;  5KTY A;  1JWD A;  1QTX A;  1OSA A;  4ORA B;  5B8I B;  1A75 B;  1UWO A;  3EK4 A;  1DVI A;  2Y4Q A;  2MA2 A;  4GNK B;  1QX7 A;  2AAO A;  3RLZ A;  1S1E A;  4QJ4 B;  2HQW A;  3CWG A;  2MAZ A;  1NX3 A;  2LC5 A;  1XA5 A;  2VRG A;  3SG3 A;  2F33 A;  2KAV A;  1NWD A;  1B1G A;  1PK0 D;  2WND A;  1F71 A;  2LM5 A;  2M3W A;  2SAS A;  1TTX A;  2WCB A;  5DKQ A;  3D0Y A;  1B4C A;  5KU1 A;  1JF2 A;  4JPZ B;  1KFX L;  1H8B A;  2KOT A;  3ICB A;  3M0W A;  2B1U A;  4PHK A;  1B8L A;  2EC6 C;  3I5H B;  2K2A A;  3CGA A;  3NSL A;  1TN4 A;  1AHR A;  2L2E A;  4MSP A;  4OV2 A;  4TNC A;  3PAT A;  1QVI Y;  1A2X A;  1OMD A;  1QAT A;  1F4O A;  2M7N A;  3LCP C;  4YGD B;  1SL8 A;  2COL B;  4QJ5 B;  3PAL A;  1QS7 A;  2JZI A;  2NXQ A;  1KFU S;  1G33 A;  3VRO A;  1BOD A;  1C7V A;  3E3R A;  2JQ6 A;  2KDH A;  2KBM A;  2FCD A;  3JTD B;  5AER A;  1CNP A;  2LHL A;  1NUB A;  2LVK A;  4U8D A;  1SPY A;  3VRR A;  1ZUZ A;  2KHN A;  2KGR A;  4MZK A;  4IL1 A;  1UHH A;  1CFF A;  4GGN A;  1SL9 A;  1ALW A;  4YGE B;  1CFC A;  1L2O C;  3DVM A;  1MXE A;  3AAJ A;  1DJX A;  4MVF A;  1NX0 A;  2BEC A;  2M29 A;  1G4Y R;  5DKN A;  2KQ6 A;  1DT7 B;  2OS8 B;  1IKU A;  1KQM B;  1TIZ A;  1MR8 A;  3PSR A;  3QRX A;  4C0L A;  1S5G Y;  1KFU L;  1UUR A;  1JSA A;  3I5F B;  3BYA A;  3TDU A;  1PSB A;  2KGB C;  5IBW A;  1CDN A;  1NYA A;  2LUC A;  3H4S E;  2JC2 A;  1U5I A;  1NX1 A;  2CXJ A;  3DVJ A;  2LE9 B;  2MJW B;  3OHM B;  2F3Y A;  2LLT A;  2R2I A;  2KI4 B;  5G08 A;  1SK6 D;  1UP5 A;  1XFZ O;  2WOR A;  2K7O A;  1MQ1 A;  3LLE A;  4GPL B;  2O60 A;  1FI6 A;  4YI9 A;  1BR4 B;  1DTL A;  2LVV A;  4ZCU A;  3OX5 A;  1J7R A;  2ZRS A;  1AP4 A;  1CB1 A;  3AKA A;  1OMV A;  2PMY A;  4XJK A;  1CM1 A;  1SL7 A;  1J1E A;  1CTR A;  2MLF C;  1UUS A;  1TOP A;  1NCX A;  1OE9 B;  2K7C A;  4MRX A;  3GK2 A;  1Y1X A;  4JQ0 D;  1XFU O;  4YRU A;  1CLM A;  2JT8 A;  3SG6 A;  1QV0 A;  2P6B B;  1JBA A;  1F70 A;  1S3P A;  3KEV A;  4MEW A;  3CR2 A;  1QIV A;  4PAL A;  1KQM C;  4PE0 A;  3PN7 C;  4AQI A;  4C0K A;  2BBN A;  1PAL A;  4A4C A;  1NIW A;  2L98 A;  3O78 A;  3D10 A;  2WOS A;  1K93 D;  4PE4 A;  3SG7 A;  1Y6W A;  3I5I C;  3K21 A;  1YUR A;  2M0R A;  4AQJ A;  1JUO A;  1IJ5 A;  1KK7 Y;  2JOJ A;  1R2U A;  2JU0 A;  2JWW A;  1PVA A;  2NCP A;  1XK4 C;  2BL0 C;  2LHI A;  4P5O E;  3WNX B;  1QAS A;  5PAL A;  3SJS A;  3VRP A;  1DJH A;  1B47 A;  4CFR A;  2GGZ A;  2H61 A;  1D1O A;  1IG5 A;  2E30 A;  3D0Y B;  1F55 A;  2M1K B;  1EH2 A;  2NZ0 A;  4I5J A;  4PCW A;  3NSI A;  2RGI A;  2PAL A;  2JXL A;  2M7L A;  1GJY A;  1YUU A;  1K96 A;  1TCF A;  2Y1N A;  2L0P A;  4I5L B;  1KWO B;  1KQV A;  2LCP A;  3LL8 B;  3BQ3 A;  3EKJ A;  1PVB A;  2HPS A;  1YVH A;  2LP2 A;  3BOW A;  1YR5 A;  1YRU B;  4OCI A;  2NCO A;  2LVI A;  4MN0 A;  1V1F A;  3CTN A;  4PE1 A;  4L9M A;  1F8H A;  2L51 A;  5I2L A;  2M9G A;  1CLL A;  1M46 A;  1YUT A;  1FBV A;  3HX4 A;  3I5G B;  2FJU B;  2CNP A;  1M39 A;  3CZT X;  1F54 A;  4DUQ A;  1W7I B;  5F6T A;  4D1E A;  1XFW O;  3MSE B;  1IWQ A;  3ZWH A;  1Y1A A;  2ZND A;  4N1F A;  3EVR A;  2EGD A;  1VRK A;  1NX2 A;  5BPJ A;  3EKH A;  1GGW A;  2L4I A;  3PM8 A;  5D69 A;  2MBX A;  1LA3 A;  1TCO B;  2KFH A;  1WRK A;  4ZCV A;  2CT9 A;  1GQM A;  2LAP A;  2LAN A;  1C7W A;  4PHM A;  5KSZ A;  1AUI B;  2KSP A;  4M2P A;  4F0Z B;  5J3X A;  1LIN A;  1A4P A;  2GGM A;  2FCE A;  5I8N A;  4R1E A;  2KFF A;  2QAC A;  1YUS A;  4NDB A;  4HRE E;  1DJG A;  1CLB A;  4MZL A;  3GOF A;  1MXL C;  1YTZ C;  1U5I B;  1SBJ A;  3CLN A;  4N1G A;  5ER5 A;  3O4Y A;  4DCK A;  2WC8 A;  2KNE A;  5K89 A;  1K8U A;  5DKR A;  4PHN A;  1ODB A;  1TNX A;  1TNQ A;  2K7B A;  1XYD A;  1EL4 A;  3NSK A;  1A03 A;  2NLN A;  1YVL A;  1SY9 A;  1MWN A;  1W7J B;  1QLS A;  4XJK B;  1PRW A;  4DIR A;  1J7O A;  1K9K A;  2V53 A;  2MRD A;  1J7Q A;  1WRL A;  1DJZ A;  4PDZ A;  1B9A A;  1LXF C;  2OTG B;  3C1V A;  2HF5 A;  5CSI A;  3SG5 A;  1WLM A;  3I5H C;  1CKK A;  1EG4 A;  1SR6 B;  5AAN A;  4DRW A;  1YRT B;  2E6W A;  4FTG A;  1H4B A;  4C0J A;  1QXP A;  4P2Y B; 
#chains in the Genus database with same CATH topology
 3IQO A;  2KPH A;  1BJF A;  2K2F A;  2Y5I A;  1XFV O;  3CR5 X;  1KSO A;  2KQY A;  2EHB A;  2WCE A;  1CDM A;  2K0J A;  1W9Z A;  3A8R A;  3JTD C;  5FYX A;  1DF0 A;  1TRF A;  2JXC A;  1V1G A;  4YI8 A;  2KYC A;  4GGF A;  3S0E A;  1B7T Z;  2PRU A;  1CMF A;  1IQ3 A;  2HET A;  1FPW A;  2K7D A;  1BMO A;  4JWQ A;  4BY4 A;  1BOC A;  1REC A;  3SIB A;  3BOW B;  1DJI A;  5HLV A;  2OS8 C;  3KPX A;  4MBE A;  4I5N B;  3CAB A;  2G2B A;  1PSR A;  1WLZ A;  2F2O A;  2BE6 A;  2WCL A;  3VGO A;  1KCY A;  3SG2 A;  1DJW A;  4CPV A;  3I5F C;  1WDC B;  1Q80 A;  2PYQ A;  3TS5 B;  5HYD A;  1NP8 A;  1SR6 C;  2I18 A;  3BUM B;  1EG3 A;  5HKZ A;  2KI4 C;  1RTP 1;  2ZN9 A;  1DJY A;  2CTN A;  2LLU A;  1EJ3 A;  2LLS A;  2O5G A;  2LMT A;  3GK1 A;  2LVJ A;  2G9B A;  3DF0 B;  5AFP A;  3CYZ A;  4JKT A;  3D73 A;  1XFX O;  5HKW A;  1KSM A;  4PT1 A;  1K2H A;  3RM1 A;  4ICB A;  2ZKM X;  3PFV A;  1BT6 A;  4BY5 A;  2LNK A;  1RWY A;  1IJ6 A;  2PSR A;  1C07 A;  1XK4 A;  3QME A;  2GV5 A;  3OP0 A;  1QX2 A;  1B8R A;  2JTT A;  1C3Z A;  4USL A;  2M97 A;  4NDC A;  5JOL A;  3ZNI A;  1YX7 A;  2AMI A;  4ORB B;  4OVN F;  1KK8 B;  4E68 A;  1JF0 A;  4YGC B;  3WHU B;  5D7F A;  1ZFS A;  1PUL A;  1DGV A;  4YBH B;  2EC6 B;  1AVS A;  2OPO A;  2WCM A;  2KAY A;  3CS1 A;  5AXI A;  2H2K A;  2ISD A;  3L4A A;  1NPQ A;  3CZ0 A;  2PQL A;  4PE7 A;  5CSF A;  1BF5 A;  1MF8 B;  2JT0 A;  3D76 A;  1IGV A;  2P70 A;  4MRY A;  1CDP A;  4HRH A;  1SMG A;  3DF0 A;  1CFD A;  3O2P A;  4WQ2 A;  5AEQ A;  2CCM A;  1T14 A;  2BBM A;  1A29 A;  3VRN A;  1XVJ A;  3DVK A;  3NHI A;  2IS9 A;  2JNX A;  3EVU A;  3TDI A;  2MLE C;  1C3Y A;  3GK4 X;  4N5X A;  3SS4 A;  1UHN A;  1AK8 A;  1QVI Z;  3VRQ A;  1IRJ A;  3TUY B;  4WRI A;  4GBA A;  3O6B A;  1UHI A;  2M8U A;  3FS7 A;  4F7F A;  2PVB A;  2LP3 A;  1S26 D;  1KWO C;  3TZ1 A;  1OOF A;  2PAS A;  3PM2 A;  1L2O B;  1WRZ A;  3OBV A;  1Z4H A;  1R6P A;  2JT3 A;  1J55 A;  1KK8 C;  1SW8 A;  2CBL A;  1BG1 A;  1QLK A;  4UPG A;  1JC2 A;  1ZOT B;  3I5G C;  3A4U B;  1NCZ A;  5ER4 X;  1N65 A;  3EK8 A;  4PHJ A;  1OMR A;  1SRA A;  2KAX A;  4OZD A;  2JNF A;  1CMG A;  3DY9 A;  2I2R E;  3FE6 A;  2K61 A;  1SCM B;  1K90 D;  4CID A;  3S0A A;  1CM4 A;  3BXK A;  5HKY A;  1OOG A;  3BUO B;  1S6J A;  2BCB A;  2FOT A;  1DF0 B;  1M45 A;  1MHO A;  3F45 A;  5TNC A;  1XO5 A;  2BE4 A;  1A75 A;  2L50 A;  2TN4 A;  1S5G Z;  3SIA A;  2LV7 A;  2JPT A;  1DGU A;  1J1D A;  1EXR A;  1IQ5 A;  1QJT A;  2A4J A;  2BKH B;  3OGN A;  1GM0 A;  1L7Z A;  1TNW A;  2K8M B;  2F3Z A;  2ZFD A;  4DS7 A;  3OB2 B;  2ZNE A;  3DD4 A;  1OZS A;  2HQ8 A;  1K95 A;  1RJV A;  4M2O A;  4NQG A;  1UHJ A;  3TUY C;  1E8A A;  1MUX A;  1OZO A;  3BUX B;  4FQO A;  4HSZ A;  4YGB B;  1OQP A;  2DOQ A;  1CDL A;  3HCM A;  2WCF A;  4MZJ A;  4HRG A;  3OX6 A;  2WCJ A;  2F8P A;  3DVE A;  1WY9 A;  4INX A;  4A4B A;  2D8N A;  1CFP A;  3LK0 A;  2I94 A;  1M31 A;  1SYM A;  4I5K A;  3PN7 B;  1DMO A;  1K94 A;  1XFY O;  2M1U A;  1FI5 A;  4AOM A;  4ETO A;  3BUN B;  4OR9 B;  1UHK A;  1Y1U A;  4GUK A;  5GQQ C;  2BCX A;  3EG5 B;  1GGZ A;  3I5I B;  1SCM C;  1S6C A;  1M63 B;  1LKJ A;  1JFJ A;  1P28 A;  1SCV A;  1FW4 A;  3BJH A;  1FF1 A;  2BL0 B;  1QIW A;  4GGF C;  3D74 A;  2Y1M A;  4ORC B;  4QJ3 B;  1OW4 A;  2MHH A;  3IF7 A;  1F4Q A;  2OTG C;  2WCK A;  3KHE A;  2L4H A;  1IH0 A;  1LVC D;  3KO0 A;  3UO9 A;  1JFK A;  5I2O A;  1TNP A;  1S36 A;  2BAP A;  1KK7 Z;  1G8I A;  2ZRT A;  1SKT A;  3FE8 A;  1AJ5 A;  3KF9 A;  3BFH A;  5CPV A;  4WQ3 A;  1HQV A;  3JVT B;  1YX8 A;  1BU3 A;  3AKB A;  4M2Q A;  2KBI A;  5HLO A;  1S6I A;  3SG4 A;  4Q04 A;  2AUC A;  1RK9 A;  3WHT B;  2KI6 D;  2LMV A;  1B7T Y;  3FIA A;  4GAO A;  4CLN A;  1LA0 A;  3FE9 A;  1AJ4 A;  1ZMZ A;  4OKH A;  1NSH A;  1Y0V H;  2Q4U A;  2ZN8 A;  3L47 A;  4YGA A;  3NXA A;  1QX5 B;  2JTZ A;  3FWB A;  4XYN A;  2GTE A;  3NHT A;  1K9U A;  2F2P A;  2H61 C;  2I7A A;  3PLF B;  1BR1 B;  3S0G A;  3EK7 A;  1B8C A;  2ERB A;  3OB1 B;  1ZAC A;  2KI6 C;  1J7P A;  1N2D A;  2BCA A;  2QEB A;  1SNL A;  2Q91 A;  2L5X B;  3B86 A;  3NSO A;  3TDZ A;  3LK1 A;  1QV1 A;  4CFQ A;  2JUL A;  1RRO A;  2M49 B;  1BLQ A;  2QDI A;  1NCY A;  3WXA A;  2KFG A;  1N0Y A;  1RFJ A;  2H8V A;  3FWC A;  3BUW B;  5CSN A;  1HT9 A;  4MLW A;  5I2Q A;  2LUX A;  3BFB A;  2LMU A;  1ALV A;  3IQQ A;  4NDD A;  1WDC C;  1LS8 A;  3B88 A;  3CR4 X;  3TS5 C;  3AAK A;  5CSJ A;  5JJG A;  2WC6 A;  2KYF A;  2BKI B;  1X02 A;  1KFX S;  2JRF A;  2SCP A;  3JVT C;  4GFT A;  1K9P A;  1OOJ A;  2QPT A;  3EVV A;  5KTY A;  1JWD A;  2WCH A;  1QTX A;  1OSA A;  2JPO A;  4ORA B;  1A75 B;  5B8I B;  3N7H A;  1UWO A;  3EK4 A;  1DVI A;  3R1O A;  2Y4Q A;  2MA2 A;  4GNK B;  1QX7 A;  2AAO A;  3RLZ A;  1S1E A;  4QJ4 B;  2HQW A;  3CWG A;  2MAZ A;  1NX3 A;  2LC5 A;  1XA5 A;  4FQT A;  2VRG A;  3SG3 A;  2F33 A;  5I94 A;  2KAV A;  1NWD A;  1B1G A;  1PK0 D;  2WND A;  1F71 A;  2LM5 A;  2M3W A;  2SAS A;  1TTX A;  2WCB A;  5DKQ A;  3D0Y A;  1DC1 A;  1B4C A;  5KU1 A;  1JF2 A;  4JPZ B;  1KFX L;  1H8B A;  2KOT A;  3ICB A;  3K1E A;  3M0W A;  2B1U A;  4PHK A;  1B8L A;  2EC6 C;  3I5H B;  2K2A A;  3R1P A;  3CGA A;  3NSL A;  1TN4 A;  1AHR A;  2L2E A;  4MSP A;  4OV2 A;  4TNC A;  3PAT A;  3CDN A;  1QVI Y;  1A2X A;  1OMD A;  1QAT A;  1F4O A;  2M7N A;  3LCP C;  4YGD B;  3UNW A;  1SL8 A;  3DXL A;  3S0B A;  2COL B;  4QJ5 B;  3PAL A;  1QS7 A;  2JZI A;  2NXQ A;  1KFU S;  1G33 A;  3VRO A;  5HL1 A;  1BOD A;  1C7V A;  3E3R A;  2JQ6 A;  2KDH A;  2KBM A;  2FCD A;  3IVT A;  3JTD B;  4INW A;  2LHL A;  1NUB A;  2BNX A;  2LVK A;  5AER A;  4U8D A;  1SPY A;  3VRR A;  1ZUZ A;  2KHN A;  1Z2C B;  2KGR A;  4MZK A;  4IL1 A;  1UHH A;  1CFF A;  4GGN A;  1SL9 A;  1ALW A;  4YGE B;  1CFC A;  1L2O C;  3DVM A;  5FI2 A;  1MXE A;  2YGU A;  1XFR A;  3BFA A;  3AAJ A;  1DJX A;  4MVF A;  1NX0 A;  2BEC A;  2M29 A;  1G4Y R;  1OOH A;  2KQ6 A;  5DKN A;  2L5Y A;  2P71 A;  2OS8 B;  1DT7 B;  1IKU A;  1KQM B;  1TIZ A;  1MR8 A;  3PSR A;  3QRX A;  4C0L A;  2QEH A;  1S5G Y;  1KFU L;  1UUR A;  3L4L A;  1JSA A;  3I5F B;  3BYA A;  3SS5 A;  1PSB A;  4JD9 A;  2KGB C;  5D3O A;  3TDU A;  5IBW A;  1NYA A;  2LUC A;  3H4S E;  2JC2 A;  1CDN A;  1U5I A;  1NX1 A;  3VB1 A;  2CXJ A;  3DVJ A;  2LE9 B;  2MJW B;  3OHM B;  2F3Y A;  2LLT A;  2R2I A;  2KI4 B;  5G08 A;  1SK6 D;  1UP5 A;  1XFZ O;  4KYN A;  2KLD A;  2WOR A;  2K7O A;  1MQ1 A;  2K60 A;  3LLE A;  4GPL B;  2O60 A;  1FI6 A;  2FJY A;  1IIO A;  4YI9 A;  3Q8I A;  1BR4 B;  1DTL A;  2LVV A;  4ZCU A;  3OX5 A;  1J7R A;  2ZRS A;  3S0F A;  3B7A A;  3AKA A;  1OMV A;  1AP4 A;  1CB1 A;  2PMY A;  4XJK A;  1CM1 A;  1SL7 A;  3O4X A;  1J1E A;  1CTR A;  2L2C A;  2MLF C;  3D75 A;  1UUS A;  1TOP A;  1NCX A;  1OE9 B;  1TWO A;  2K7C A;  4MRX A;  3GK2 A;  1Y1X A;  4JQ0 D;  1XFU O;  4YRU A;  1CLM A;  2JT8 A;  3SG6 A;  1QV0 A;  1QWV A;  2P6B B;  1JBA A;  1F70 A;  1S3P A;  3KEV A;  4MEW A;  3CR2 A;  1QIV A;  4PAL A;  1KQM C;  4PE0 A;  3PN7 C;  4AQI A;  4C0K A;  2BBN A;  1PAL A;  4A4C A;  3D77 A;  1CNP A;  1NIW A;  2L98 A;  3O78 A;  3D10 A;  2WOS A;  1K93 D;  4PE4 A;  3SG7 A;  1Y6W A;  3I5I C;  3K21 A;  1YUR A;  2M0R A;  4AQJ A;  1JUO A;  1IJ5 A;  1KK7 Y;  2JOJ A;  1R2U A;  2JU0 A;  2JWW A;  1PVA A;  2NCP A;  1XK4 C;  2BL0 C;  2LHI A;  4P5O E;  3WNX B;  1QAS A;  5PAL A;  1DEK A;  3SJS A;  3VRP A;  1DJH A;  1B47 A;  3R72 A;  4CFR A;  2GGZ A;  2H61 A;  1D1O A;  1IG5 A;  2E30 A;  3D0Y B;  5EL2 A;  2KLE A;  1F55 A;  2M1K B;  1EH2 A;  2NZ0 A;  4I5J A;  4PCW A;  3NSI A;  2RGI A;  2PAL A;  2JXL A;  2M7L A;  1GJY A;  1SSE B;  1YUU A;  1K96 A;  1TCF A;  2Y1N A;  2L0P A;  4I5L B;  1KWO B;  1KQV A;  2LCP A;  3LL8 B;  3DZT A;  3BQ3 A;  3EKJ A;  1PVB A;  2HPS A;  1YVH A;  2LP2 A;  3BOW A;  1YR5 A;  1YRU B;  4OCI A;  2NCO A;  2LVI A;  4MN0 A;  1V1F A;  3CTN A;  3PJI A;  4IJ7 A;  4L9M A;  4PE1 A;  1F8H A;  2L51 A;  5I2L A;  2M9G A;  1CLL A;  1M46 A;  1YUT A;  1FBV A;  3HX4 A;  3I5G B;  2FJU B;  2CNP A;  1M39 A;  3CZT X;  1F54 A;  5FI7 A;  4DUQ A;  1W7I B;  5F6T A;  4D1E A;  1XFW O;  3MSE B;  1IWQ A;  3ZWH A;  1DQE A;  1Y1A A;  2ZND A;  3CZ2 A;  4N1F A;  3EVR A;  2EGD A;  1ORG A;  1VRK A;  1NX2 A;  5BPJ A;  3EKH A;  1GGW A;  2L4I A;  2WC5 A;  3PM8 A;  5D69 A;  2MBX A;  1LA3 A;  1TCO B;  2KFH A;  3DYE A;  1WRK A;  4ZCV A;  2CT9 A;  1GQM A;  2LAP A;  2LAN A;  3NGV A;  1C7W A;  3CZ1 A;  4PHM A;  3V2L A;  5KSZ A;  1AUI B;  2KSP A;  4M2P A;  4F0Z B;  5J3X A;  1LIN A;  1A4P A;  2GGM A;  2FCE A;  5DIC A;  5I8N A;  4R1E A;  2KFF A;  2QAC A;  1YUS A;  4NDB A;  1TUZ A;  1DJG A;  4HRE E;  1CLB A;  4MZL A;  3GOF A;  1MXL C;  3D78 A;  1YTZ C;  1U5I B;  1SBJ A;  3CLN A;  4N1G A;  5ER5 A;  3O4Y A;  4DCK A;  2WC8 A;  2KNE A;  1TUJ A;  5K89 A;  1K8U A;  5DKR A;  4PHN A;  1ODB A;  1TNX A;  1TNQ A;  3R1V A;  1OOI X;  2K7B A;  1XYD A;  1EL4 A;  2QEO A;  3B6X A;  3NSK A;  3RZS A;  1A03 A;  2NLN A;  1YVL A;  1SY9 A;  1MWN A;  1W7J B;  1QLS A;  4XJK B;  1PRW A;  1DEL A;  4DIR A;  1K9K A;  2V53 A;  2MRD A;  1J7O A;  1J7Q A;  1WRL A;  3SS3 A;  1DJZ A;  4PDZ A;  1B9A A;  3B87 A;  1LXF C;  2OTG B;  5FI6 A;  3C1V A;  2HF5 A;  2QEV A;  5CSI A;  3S0D A;  3SG5 A;  1WLM A;  3I5H C;  1CKK A;  1EG4 A;  1SR6 B;  5AAN A;  4DRW A;  1YRT B;  2E6W A;  4FTG A;  1H4B A;  4C0J A;  1QXP A;  4P2Y B; 
#chains in the Genus database with same CATH homology
 3IQO A;  1BJF A;  2K2F A;  2Y5I A;  1XFV O;  3CR5 X;  1KSO A;  2KQY A;  2EHB A;  2WCE A;  1CDM A;  2K0J A;  3A8R A;  3JTD C;  5FYX A;  1DF0 A;  1TRF A;  2JXC A;  1V1G A;  4YI8 A;  2KYC A;  4GGF A;  1B7T Z;  2PRU A;  1CMF A;  1IQ3 A;  2HET A;  1FPW A;  2K7D A;  1BMO A;  4JWQ A;  4BY4 A;  1BOC A;  1REC A;  3SIB A;  3BOW B;  1DJI A;  5HLV A;  2OS8 C;  3KPX A;  4MBE A;  4I5N B;  2G2B A;  1PSR A;  1WLZ A;  2F2O A;  2BE6 A;  1KCY A;  3VGO A;  3SG2 A;  1DJW A;  4CPV A;  3I5F C;  1WDC B;  1Q80 A;  5HYD A;  3TS5 B;  1NP8 A;  1SR6 C;  2I18 A;  3BUM B;  1EG3 A;  5HKZ A;  2KI4 C;  1RTP 1;  2ZN9 A;  1DJY A;  2CTN A;  2LLU A;  1EJ3 A;  2LLS A;  2O5G A;  2LMT A;  3GK1 A;  2LVJ A;  2G9B A;  3DF0 B;  5AFP A;  5HKW A;  1XFX O;  1KSM A;  1K2H A;  3RM1 A;  4ICB A;  2ZKM X;  3PFV A;  1BT6 A;  4BY5 A;  2LNK A;  1RWY A;  1IJ6 A;  2PSR A;  1C07 A;  1XK4 A;  2GV5 A;  3OP0 A;  1QX2 A;  1B8R A;  2JTT A;  4USL A;  2M97 A;  4NDC A;  5JOL A;  3ZNI A;  1YX7 A;  2AMI A;  4ORB B;  4OVN F;  1KK8 B;  4E68 A;  1JF0 A;  4YGC B;  3WHU B;  5D7F A;  1ZFS A;  1PUL A;  1DGV A;  4YBH B;  2EC6 B;  1AVS A;  2OPO A;  2KAY A;  3CS1 A;  5AXI A;  2H2K A;  2ISD A;  1NPQ A;  4PE7 A;  5CSF A;  1BF5 A;  1MF8 B;  2JT0 A;  4MRY A;  1IGV A;  1CDP A;  4HRH A;  1SMG A;  3DF0 A;  1CFD A;  3O2P A;  4WQ2 A;  5AEQ A;  2CCM A;  2BBM A;  1A29 A;  3VRN A;  1XVJ A;  3DVK A;  2IS9 A;  2JNX A;  3EVU A;  3TDI A;  2MLE C;  3GK4 X;  4N5X A;  1UHN A;  1AK8 A;  1QVI Z;  3VRQ A;  1IRJ A;  3TUY B;  4WRI A;  4GBA A;  3O6B A;  1UHI A;  2M8U A;  3FS7 A;  2PVB A;  2LP3 A;  1S26 D;  1KWO C;  3TZ1 A;  2PAS A;  1L2O B;  1WRZ A;  1R6P A;  2JT3 A;  1J55 A;  1KK8 C;  1SW8 A;  2CBL A;  1BG1 A;  1QLK A;  4UPG A;  1JC2 A;  1ZOT B;  3I5G C;  3A4U B;  1NCZ A;  5ER4 X;  1N65 A;  3EK8 A;  4PHJ A;  1OMR A;  1SRA A;  2KAX A;  2JNF A;  1CMG A;  2I2R E;  2K61 A;  1SCM B;  1K90 D;  4CID A;  1CM4 A;  3BXK A;  5HKY A;  3BUO B;  1S6J A;  2BCB A;  2FOT A;  1DF0 B;  1M45 A;  1MHO A;  3F45 A;  5TNC A;  1XO5 A;  2BE4 A;  1A75 A;  2L50 A;  2TN4 A;  1S5G Z;  3SIA A;  2LV7 A;  2JPT A;  1DGU A;  1J1D A;  1EXR A;  1IQ5 A;  1QJT A;  2A4J A;  2BKH B;  1L7Z A;  1TNW A;  2K8M B;  2F3Z A;  2ZFD A;  4DS7 A;  3OB2 B;  2ZNE A;  3DD4 A;  1OZS A;  2HQ8 A;  1K95 A;  1RJV A;  4M2O A;  4NQG A;  1UHJ A;  3TUY C;  1E8A A;  1MUX A;  1OZO A;  3BUX B;  4FQO A;  4HSZ A;  4YGB B;  1OQP A;  2DOQ A;  1CDL A;  3HCM A;  2WCF A;  4MZJ A;  4HRG A;  3OX6 A;  2F8P A;  3DVE A;  1WY9 A;  4A4B A;  2D8N A;  1CFP A;  3LK0 A;  2I94 A;  1M31 A;  1SYM A;  4I5K A;  3PN7 B;  1DMO A;  1K94 A;  1XFY O;  2M1U A;  1FI5 A;  4AOM A;  4ETO A;  3BUN B;  4OR9 B;  1UHK A;  1Y1U A;  4GUK A;  5GQQ C;  2BCX A;  1GGZ A;  3I5I B;  1SCM C;  1S6C A;  1M63 B;  1LKJ A;  1JFJ A;  1SCV A;  1FW4 A;  1FF1 A;  2BL0 B;  1QIW A;  4GGF C;  2Y1M A;  4ORC B;  4QJ3 B;  2MHH A;  3IF7 A;  1F4Q A;  2OTG C;  3KHE A;  2L4H A;  1IH0 A;  1LVC D;  3KO0 A;  1JFK A;  5I2O A;  1TNP A;  1S36 A;  1KK7 Z;  1G8I A;  2ZRT A;  1SKT A;  1AJ5 A;  3KF9 A;  5CPV A;  4WQ3 A;  1HQV A;  3JVT B;  1YX8 A;  1BU3 A;  3AKB A;  4M2Q A;  2KBI A;  5HLO A;  1S6I A;  3SG4 A;  4Q04 A;  2AUC A;  1RK9 A;  3WHT B;  2KI6 D;  2LMV A;  1B7T Y;  3FIA A;  4GAO A;  4CLN A;  1LA0 A;  1AJ4 A;  1ZMZ A;  4OKH A;  1NSH A;  1Y0V H;  2Q4U A;  2ZN8 A;  4YGA A;  3NXA A;  1QX5 B;  2JTZ A;  3FWB A;  4XYN A;  1K9U A;  2F2P A;  2H61 C;  2I7A A;  3PLF B;  1BR1 B;  3EK7 A;  1B8C A;  3OB1 B;  1ZAC A;  2KI6 C;  1J7P A;  1N2D A;  2BCA A;  3NSO A;  1SNL A;  2Q91 A;  2L5X B;  3TDZ A;  4CFQ A;  3LK1 A;  1QV1 A;  2JUL A;  1RRO A;  2M49 B;  1BLQ A;  1NCY A;  3WXA A;  2KFG A;  1N0Y A;  1RFJ A;  3FWC A;  3BUW B;  5CSN A;  1HT9 A;  4MLW A;  5I2Q A;  2LUX A;  2LMU A;  1ALV A;  3IQQ A;  4NDD A;  1WDC C;  3CR4 X;  3TS5 C;  3AAK A;  5CSJ A;  5JJG A;  2KYF A;  2BKI B;  1X02 A;  1KFX S;  2JRF A;  2SCP A;  3JVT C;  4GFT A;  1K9P A;  1OOJ A;  2QPT A;  3EVV A;  5KTY A;  1JWD A;  1QTX A;  1OSA A;  4ORA B;  5B8I B;  1A75 B;  1UWO A;  3EK4 A;  1DVI A;  2Y4Q A;  2MA2 A;  4GNK B;  1QX7 A;  2AAO A;  3RLZ A;  1S1E A;  4QJ4 B;  2HQW A;  3CWG A;  2MAZ A;  1NX3 A;  2LC5 A;  1XA5 A;  2VRG A;  3SG3 A;  2F33 A;  2KAV A;  1NWD A;  1B1G A;  1PK0 D;  2WND A;  1F71 A;  2LM5 A;  2M3W A;  2SAS A;  1TTX A;  2WCB A;  5DKQ A;  3D0Y A;  1B4C A;  5KU1 A;  1JF2 A;  4JPZ B;  1KFX L;  1H8B A;  2KOT A;  3ICB A;  3M0W A;  2B1U A;  4PHK A;  1B8L A;  2EC6 C;  3I5H B;  2K2A A;  3CGA A;  3NSL A;  1TN4 A;  1AHR A;  2L2E A;  4MSP A;  4OV2 A;  4TNC A;  3PAT A;  1QVI Y;  1A2X A;  1OMD A;  1QAT A;  1F4O A;  2M7N A;  3LCP C;  4YGD B;  1SL8 A;  2COL B;  4QJ5 B;  3PAL A;  1QS7 A;  2JZI A;  2NXQ A;  1KFU S;  1G33 A;  3VRO A;  1BOD A;  1C7V A;  3E3R A;  2JQ6 A;  2KDH A;  2KBM A;  2FCD A;  3JTD B;  5AER A;  1CNP A;  2LHL A;  1NUB A;  2LVK A;  4U8D A;  1SPY A;  3VRR A;  1ZUZ A;  2KHN A;  2KGR A;  4MZK A;  4IL1 A;  1UHH A;  1CFF A;  4GGN A;  1SL9 A;  1ALW A;  4YGE B;  1CFC A;  1L2O C;  3DVM A;  1MXE A;  3AAJ A;  1DJX A;  4MVF A;  1NX0 A;  2BEC A;  2M29 A;  1G4Y R;  5DKN A;  2KQ6 A;  1DT7 B;  2OS8 B;  1IKU A;  1KQM B;  1TIZ A;  1MR8 A;  3PSR A;  3QRX A;  4C0L A;  1S5G Y;  1KFU L;  1UUR A;  1JSA A;  3I5F B;  3BYA A;  3TDU A;  1PSB A;  2KGB C;  5IBW A;  1CDN A;  1NYA A;  2LUC A;  3H4S E;  2JC2 A;  1U5I A;  1NX1 A;  2CXJ A;  3DVJ A;  2LE9 B;  2MJW B;  3OHM B;  2F3Y A;  2LLT A;  2R2I A;  2KI4 B;  5G08 A;  1SK6 D;  1UP5 A;  1XFZ O;  2WOR A;  2K7O A;  1MQ1 A;  3LLE A;  4GPL B;  2O60 A;  1FI6 A;  4YI9 A;  1BR4 B;  1DTL A;  2LVV A;  4ZCU A;  3OX5 A;  1J7R A;  2ZRS A;  1AP4 A;  1CB1 A;  3AKA A;  1OMV A;  2PMY A;  4XJK A;  1CM1 A;  1SL7 A;  1J1E A;  1CTR A;  2MLF C;  1UUS A;  1TOP A;  1NCX A;  1OE9 B;  2K7C A;  4MRX A;  3GK2 A;  1Y1X A;  4JQ0 D;  1XFU O;  4YRU A;  1CLM A;  2JT8 A;  3SG6 A;  1QV0 A;  2P6B B;  1JBA A;  1F70 A;  1S3P A;  3KEV A;  4MEW A;  3CR2 A;  1QIV A;  4PAL A;  1KQM C;  4PE0 A;  3PN7 C;  4AQI A;  4C0K A;  2BBN A;  1PAL A;  4A4C A;  1NIW A;  2L98 A;  3O78 A;  3D10 A;  2WOS A;  1K93 D;  4PE4 A;  3SG7 A;  1Y6W A;  3I5I C;  3K21 A;  1YUR A;  2M0R A;  4AQJ A;  1JUO A;  1IJ5 A;  1KK7 Y;  2JOJ A;  1R2U A;  2JU0 A;  2JWW A;  1PVA A;  2NCP A;  1XK4 C;  2BL0 C;  2LHI A;  4P5O E;  3WNX B;  1QAS A;  5PAL A;  3SJS A;  3VRP A;  1DJH A;  1B47 A;  4CFR A;  2GGZ A;  2H61 A;  1D1O A;  1IG5 A;  2E30 A;  3D0Y B;  1F55 A;  2M1K B;  1EH2 A;  2NZ0 A;  4I5J A;  4PCW A;  3NSI A;  2RGI A;  2PAL A;  2JXL A;  2M7L A;  1GJY A;  1YUU A;  1K96 A;  1TCF A;  2Y1N A;  2L0P A;  4I5L B;  1KWO B;  1KQV A;  2LCP A;  3LL8 B;  3BQ3 A;  3EKJ A;  1PVB A;  2HPS A;  1YVH A;  2LP2 A;  3BOW A;  1YR5 A;  1YRU B;  4OCI A;  2NCO A;  2LVI A;  4MN0 A;  1V1F A;  3CTN A;  4PE1 A;  4L9M A;  1F8H A;  2L51 A;  5I2L A;  2M9G A;  1CLL A;  1M46 A;  1YUT A;  1FBV A;  3HX4 A;  3I5G B;  2FJU B;  2CNP A;  1M39 A;  3CZT X;  1F54 A;  4DUQ A;  1W7I B;  5F6T A;  4D1E A;  1XFW O;  3MSE B;  1IWQ A;  3ZWH A;  1Y1A A;  2ZND A;  4N1F A;  3EVR A;  2EGD A;  1VRK A;  1NX2 A;  5BPJ A;  3EKH A;  1GGW A;  2L4I A;  3PM8 A;  5D69 A;  2MBX A;  1LA3 A;  1TCO B;  2KFH A;  1WRK A;  4ZCV A;  2CT9 A;  1GQM A;  2LAP A;  2LAN A;  1C7W A;  4PHM A;  5KSZ A;  1AUI B;  2KSP A;  4M2P A;  4F0Z B;  5J3X A;  1LIN A;  1A4P A;  2GGM A;  2FCE A;  5I8N A;  4R1E A;  2KFF A;  2QAC A;  1YUS A;  4NDB A;  4HRE E;  1DJG A;  1CLB A;  4MZL A;  3GOF A;  1MXL C;  1YTZ C;  1U5I B;  1SBJ A;  3CLN A;  4N1G A;  5ER5 A;  3O4Y A;  4DCK A;  2WC8 A;  2KNE A;  5K89 A;  1K8U A;  5DKR A;  4PHN A;  1ODB A;  1TNX A;  1TNQ A;  2K7B A;  1XYD A;  1EL4 A;  3NSK A;  1A03 A;  2NLN A;  1YVL A;  1SY9 A;  1MWN A;  1W7J B;  1QLS A;  4XJK B;  1PRW A;  4DIR A;  1J7O A;  1K9K A;  2V53 A;  2MRD A;  1J7Q A;  1WRL A;  1DJZ A;  4PDZ A;  1B9A A;  1LXF C;  2OTG B;  3C1V A;  2HF5 A;  5CSI A;  3SG5 A;  1WLM A;  3I5H C;  1CKK A;  1EG4 A;  1SR6 B;  5AAN A;  4DRW A;  1YRT B;  2E6W A;  4FTG A;  1H4B A;  4C0J A;  1QXP A;  4P2Y B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...