2M29A

Nmr structure of ca2+ bound cabp4 n-domain
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
72
structure length
72
Chain Sequence
b'RELGPEELEELQAAFEEFDTDQDGYIGYRELGDCMRTLGYMPTEMELLEVSQHVKMRMGGFVDFEEFVELIS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Calcium-binding protein 4
publication title Chemical shift assignment of Ca2+ bound CaPB4
rcsb
source organism Mus musculus
molecule tags Metal binding protein
total genus 15
structure length 72
sequence length 72
ec nomenclature
pdb deposition date 2012-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2m29A00
1ODBA 2K7CA 2CTNA 3OX6A 1IG5A 1J7QA 1WLMA 2B1UA 2SCPA 4CLNA 1A03A 2BBNA 2LNKA 1RTP1 3I5IC 2OS8C 3JTDB 4AQJA 1J55A 4YGBB 2ZNEA 4MN0A 4PHNA 2M49B 1CMGA 1A75B 1NUBA 1DJYA 1MXEA 2ZFDA 3VRNA 5B8IB 5TNCA 1NCYA 5D69A 3BOWA 1K8UA 1KK7Z 3DF0B 2K7OA 3CR4X 1CB1A 2JC2A 1SY9A 4N1GA 4YBHB 2BL0B 4AOMA 2L4IA 4GBAA 5KTYA 3D0YB 1JUOA 2LVVA 2PRUA 4PE1A 1TCFA 1VRKA 2VRGA 3CWGA 2KFHA 1BOCA 4NDBA 1K9KA 1S6JA 1WDCC 2LLTA 3LK0A 1A29A 4L9MA 2KYCA 1PK0D 2CXJA 1LKJA 1AJ4A 2FOTA 4YI8A 2M9GA 4I5NB 1AK8A 4NQGA 3D10A 3H4SE 2GGZA 2LE9B 1H4BA 2NZ0A 3I5HC 2O60A 1XFUO 3SG2A 1TNXA 4A4BA 2H61A 4M2PA 1TRFA 2JULA 2CBLA 2LMVA 1QLSA 2HQ8A 4R1EA 4TNCA 4BY5A 1CLBA 5HLOA 1GGWA 1SR6C 3PLFB 3EKHA 1M45A 2JTTA 3I5FC 1JFKA 1F4QA 3SG4A 1AJ5A 4JWQA 1WRZA 1ZUZA 1GGZA 2OTGB 1DF0A 2NXQA 3CTNA 2KDHA 2K61A 2KYFA 4N1FA 2Y1MA 1SRAA 3PATA 1ALWA 1IQ5A 2FCEA 4NDDA 1N0YA 2K7BA 1SL7A 2FJUB 2ZRSA 3BOWB 2D8NA 1SL8A 2L5XB 4MZLA 1U5IA 1K96A 2WORA 3JVTB 5PALA 4OV2A 3SG6A 3SJSA 1YRTB 4I5JA 2E6WA 4OKHA 1PVAA 2OPOA 1A4PA 1YR5A 2Y5IA 3E3RA 3FWBA 4QJ3B 4M2OA 4PHJA 3SIAA 1SBJA 4MLWA 1Q80A 1C7VA 3PN7B 3C1VA 2HETA 1SK6D 5CSFA 1RJVA 5GQQC 1BU3A 3TZ1A 2KI4B 1B9AA 1W7IB 1TNQA 2KI6D 2MLFC 2PVBA 5I2QA 1QX7A 2JT0A 2LCPA 2WCFA 1QV1A 1YRUB 5ER5A 2JWWA 1MQ1A 5DKNA 1F4OA 4PHMA 1R6PA 1EG3A 4HREE 4WRIA 2A4JA 1RROA 1KQMB 4DUQA 4YRUA 4C0JA 4P5OE 2LMUA 5K89A 1LA3A 4XJKA 4GPLB 1DF0B 1SPYA 1QLKA 1XYDA 2I18A 4GGFA 4OR9B 2HQWA 1NYAA 3EK7A 1NSHA 4GUKA 3TS5B 1UURA 4OCIA 3A4UB 3BUNB 1TNPA 3DVMA 1U5IB 3DD4A 1L2OB 2MHHA 1BMOA 2I2RE 2LP3A 3OP0A 1E8AA 2JZIA 2BE4A 1NX3A 1TNWA 1A2XA 2K7DA 1KQVA 1YX7A 1YURA 3RM1A 2M1UA 2L50A 3PALA 1LXFC 1WRLA 1L7ZA 2LVJA 4C0LA 2LM5A 1HQVA 1YUTA 5AEQA 1KFXL 1QTXA 3DVJA 1V1GA 4UPGA 1EH2A 1ZMZA 1KWOB 2O5GA 2MRDA 4MBEA 1TTXA 2JNXA 1KSMA 3DVKA 4GNKB 4GAOA 3JTDC 1GJYA 5HLVA 2KQYA 1DJWA 2L2EA 2L51A 1B8RA 3LLEA 1G4YR 3VRPA 2JQ6A 1YVHA 2BCXA 3TUYB 4ORAB 2PASA 4I5LB 3IF7A 1SW8A 4GGFC 1KFXS 3O6BA 3A8RA 4XJKB 2RGIA 1RECA 2L0PA 1LA0A 1WRKA 5FYXA 1F8HA 1XFZO 4FTGA 2BL0C 1QV0A 5I2LA 3SG5A 2V53A 5CSNA 1PRWA 3LL8B 1N2DA 2LP2A 2M8UA 3AAJA 1OMDA 4MZJA 4U8DA 1YVLA 4ZCUA 3VRRA 1EG4A 1SMGA 1MUXA 1RFJA 1CTRA 4F0ZB 1IJ6A 2DOQA 1PULA 1XVJA 2ZNDA 5JJGA 1BR4B 2P6BB 1F71A 2JT3A 1YUUA 2KFGA 3OX5A 3M0WA 1CNPA 4MZKA 2F3ZA 1UHKA 5D7FA 5BPJA 1XFYO 2MJWB 3K21A 1MHOA 1GQMA 4Q04A 1UUSA 3I5GB 4HSZA 4E68A 1KK8B 1DJHA 2KFFA 1IJ5A 4ORBB 1QX2A 2BCBA 5CSIA 4YGEB 3ZNIA 1OMVA 1CMFA 1KK7Y 2JNFA 2OTGC 1IH0A 2Y1NA 2Y4QA 1NP8A 4DCKA 2WC8A 1NPQA 1FI5A 2BECA 2PMYA 4HRGA 1DGVA 1WDCB 3WNXB 3MSEB 2BBMA 1UHNA 2BKHB 1J7PA 4PALA 4DS7A 1QIWA 1ZACA 1OZOA 4IL1A 1NX0A 2BE6A 3JVTC 4ICBA 4MEWA 3EVRA 1PSBA 5DKQA 2Q91A 1K9PA 1OQPA 4PDZA 3O2PA 1XFWO 3IQOA 2LVIA 2SASA 1S5GZ 3PN7C 4NDCA 3LK1A 2KAYA 4MRXA 1UWOA 2MBXA 2GV5A 2H2KA 3BUMB 1NX2A 1PSRA 1MR8A 2LVKA 3BYAA 2KGBC 2HPSA 1JWDA 2KI4C 1SKTA 3GK4X 2IS9A 2R2IA 2KNEA 2H61C 3FWCA 2FCDA 2CT9A 1LINA 1ZFSA 2KI6C 1Y1AA 2ZN9A 3TDUA 5KU1A 1KQMC 1QIVA 2F33A 2E30A 2WCBA 3CLNA 3NSIA 1K93D 3TDIA 1NCXA 4PE7A 1N65A 2LUCA 1KCYA 1NX1A 2Q4UA 3TS5C 1B7TZ 4DIRA 1NWDA 4PCWA 4CFQA 2JRFA 3DVEA 1UHJA 1L2OC 3OB2B 1Y1UA 1JF2A 1AP4A 5CPVA 4YGDB 3WHTB 3HX4A 2F8PA 1OE9B 1AHRA 2TN4A 1XFXO 3QRXA 2LAPA 2LHLA 4YI9A 1B8LA 1EJ3A 3FIAA 4N5XA 1K94A 3WXAA 3GK1A 3GOFA 1SCMB 5IBWA 1DJZA 1NIWA 1DTLA 1KWOC 3CR2A 3EVVA 1DGUA 4CFRA 1Y0VH 2ZRTA 3SG3A 2M1KB 2MLEC 2ZKMX 2M7NA 1S1EA 1TN4A 2EC6B 3SG7A 1F55A 2NLNA 1J7OA 4FQOA 1CM4A 2LUXA 1JFJA 2K0JA 2QACA 1B7TY 2M3WA 1DMOA 2F3YA 1IGVA 3TUYC 2L4HA 4MRYA 1M63B 1PVBA 1QJTA 1CLMA 3BXKA 3PM8A 1FPWA 4A4CA 1UHHA 2G2BA 5AERA 1H8BA 2NCOA 4BY4A 1BR1B 2M7LA 1QS7A 1CDNA 3CS1A 2CNPA 4HRHA 2CCMA 2M29A 1YUSA 4CIDA 4DRWA 2KOTA 4PE0A 1J1DA 1QX5B 4D1EA 1CDLA 1OMRA 1KSOA 2BCAA 1JSAA 4CPVA 2I7AA 5AFPA 1J7RA 1S3PA 1AUIB 1CM1A 1XK4A 2HF5A 3ICBA 1EXRA 2AAOA 3ZWHA 2KGRA 1CDMA 4WQ2A 3I5IB 2OS8B 3NSKA 5F6TA 3SIBA 1SL9A 3AAKA 4M2QA 1ZOTB 2ZN8A 1RK9A 3NSOA 1BJFA 1DJIA 1KFUS 4GGNA 1EL4A 3CR5X 2F2OA 3KEVA 1QASA 2MA2A 3I5GC 2I94A 1Y6WA 1KK8C 4PE4A 1Y1XA 1OZSA 5KSZA 2LC5A 1S26D 1F70A 1FBVA 4WQ3A 2PALA 2LLUA 2LANA 3O4YA 4YGCB 4MVFA 3RLZA 4AQIA 3KPXA 5DKRA 1CFFA 2GGMA 5HKYA 2KHNA 4GFTA 2JU0A 1S6IA 3BQ3A 3FS7A 5AXIA 3AKAA 2M0RA 2M97A 1K2HA 3AKBA 1OSAA 3TDZA 1S36A 2JXLA 1XFVO 2LMTA 3WHUB 1C07A 1QVIZ 1DJGA 1TCOB 2QPTA 2KAXA 3BUWB 1BODA 2JXCA 3CZTX 3I5HB 1S6CA 3BUXB 2JTZA 3IQQA 1M39A 2WOSA 2K8MB 1K9UA 1XK4C 2JOJA 2WCEA 1B47A 3BUOB 5CSJA 2LHIA 3EK4A 1HT9A 1J1EA 1SR6B 1YX8A 2K2AA 4ETOA 2G9BA 3I5FB 1D1OA 3EK8A 1X02A 1W7JB 4ORCB 1B8CA 4PHKA 1CFPA 1M46A 1QATA 1SYMA 3VGOA 3KHEA 2KQ6A 4JPZB 1BT6A 1LVCD 2JPTA 2BKIB 2LLSA 3F45A 2EHBA 1B1GA 5I2OA 1DT7B 1CFCA 2JT8A 2KBMA 1TOPA 4MSPA 1BG1A 1V1FA 1K95A 1FW4A 1MF8B 1QVIY 1WLZA 1M31A 1JF0A 2KAVA 2KBIA 4P2YB 2MAZA 1R2UA 3EVUA 1C7WA 3OHMB 1JBAA 3KF9A 1OOJA 1FI6A 4USLA 1AVSA 4XYNA 1IKUA 2PSRA 4I5KA 2AUCA 4JQ0D 1G8IA 2L98A 1S5GY 1CKKA 1BF5A 3VROA 3EKJA 5HYDA 3KO0A 1JC2A 2F2PA 2K2FA 1SCVA 1MWNA 5JOLA 4YGAA 4ZCVA 1YTZC 1A75A 1SCMC 5J3XA 1B4CA 1ALVA 3CGAA 1QXPA 3LCPC 4OVNF 1XA5A 3NSLA 1DJXA 1NCZA 1CDPA 1UHIA 5HKZA 1DVIA 2EGDA 3DF0A 5ER4X 2EC6C 1FF1A 1SNLA 1IRJA 3VRQA 2KSPA 2WNDA 3D0YA 2AMIA 1G33A 5AANA 2NCPA 1CFDA 4QJ5B 3GK2A 3NXAA 1BLQA 3PFVA 1CLLA 1PALA 2COLB 5HKWA 4C0KA 1MXLC 1IWQA 2ISDA 1IQ3A 1RWYA 5G08A 1KFUL 3O78A 3PSRA 1WY9A 1K90D 3OB1B 1TIZA 2LV7A 1XO5A 5I8NA 1F54A 1UP5A 4QJ4B 3HCMA
chains in the Genus database with same CATH superfamily
1ODBA 2K7CA 2CTNA 3OX6A 2JPOA 1IG5A 1J7QA 1WLMA 2B1UA 2SCPA 4CLNA 1A03A 2BBNA 2LNKA 2P70A 1RTP1 3I5IC 2OS8C 3OGNA 3JTDB 4AQJA 1J55A 4YGBB 2ZNEA 4MN0A 4PHNA 2M49B 1CMGA 1A75B 1NUBA 1DJYA 1MXEA 2ZFDA 3VRNA 5B8IB 5TNCA 4JD9A 1NCYA 5D69A 1LS8A 3BOWA 1K8UA 1KK7Z 3DF0B 2K7OA 3CR4X 1CB1A 2JC2A 1SY9A 4N1GA 4YBHB 2BL0B 4AOMA 1GM0A 2L4IA 4GBAA 5KTYA 1Z2CB 1JUOA 2LVVA 2PRUA 3D0YB 4PE1A 1TCFA 1VRKA 2VRGA 3CWGA 2KFHA 1BOCA 4NDBA 1K9KA 1S6JA 1WDCC 2LLTA 2WCLA 1A29A 3LK0A 4L9MA 2KYCA 1PK0D 2CXJA 1LKJA 1AJ4A 2FOTA 4YI8A 2M9GA 4I5NB 1AK8A 4NQGA 3D10A 3R1VA 3H4SE 2GGZA 2LE9B 3SS3A 2PQLA 1H4BA 2NZ0A 3DXLA 3I5HC 2O60A 1XFUO 3SG2A 1TNXA 4A4BA 2H61A 4M2PA 3SS5A 3UNWA 1TRFA 2JULA 2CBLA 2LMVA 2YGUA 1QLSA 2HQ8A 4R1EA 4TNCA 4BY5A 3R1PA 1CLBA 5HLOA 1GGWA 1SR6C 3PLFB 3EKHA 1M45A 2JTTA 3I5FC 1JFKA 1F4QA 2QEHA 4KYNA 3SG4A 2WC6A 1AJ5A 2FJYA 4JWQA 3S0BA 1WRZA 1ZUZA 3CZ0A 1GGZA 2OTGB 1DF0A 2NXQA 3CTNA 2KDHA 3CABA 2K61A 2KYFA 4N1FA 2Y1MA 1SRAA 3BFAA 3PATA 2ERBA 1ALWA 1IQ5A 2FCEA 4NDDA 1N0YA 2K7BA 1SL7A 1P28A 2FJUB 2ZRSA 3BOWB 2D8NA 1SL8A 2L5XB 4MZLA 1U5IA 2WCKA 3B6XA 3CDNA 1K96A 2WORA 3JVTB 5PALA 2BAPA 4OV2A 3SG6A 3SJSA 1DC1A 1YRTB 4I5JA 2E6WA 4OKHA 1PVAA 2OPOA 1A4PA 1YR5A 2Y5IA 3E3RA 3FWBA 4QJ3B 3VB1A 3DY9A 4F7FA 4M2OA 4PHJA 3SIAA 1SBJA 4MLWA 1Q80A 1C7VA 3PN7B 2WCHA 3C1VA 5DICA 2HETA 1SK6D 5CSFA 3CYZA 1RJVA 5GQQC 1BU3A 3TZ1A 2KI4B 1B9AA 1W7IB 1TNQA 2BNXA 2KI6D 2MLFC 2PVBA 5I2QA 5I94A 1QX7A 2JT0A 2LCPA 2WCFA 1QV1A 1YRUB 5ER5A 2QDIA 2JWWA 1MQ1A 3B86A 5DKNA 1F4OA 4PHMA 1R6PA 1EG3A 4HREE 4WRIA 2A4JA 1RROA 1KQMB 4DUQA 4YRUA 4C0JA 4P5OE 2QEOA 2LMUA 5K89A 1LA3A 2PYQA 4XJKA 4GPLB 1DF0B 1SPYA 1QLKA 1XYDA 2I18A 4GGFA 4OR9B 2HQWA 1NYAA 1TWOA 3D75A 3EK7A 1NSHA 4GUKA 3TS5B 1UURA 4OCIA 3UO9A 4INXA 3A4UB 3BUNB 2WCJA 1TNPA 3DVMA 3QMEA 1U5IB 3DD4A 1L2OB 2MHHA 1BMOA 2I2RE 2LP3A 3OP0A 1E8AA 2JZIA 2BE4A 1NX3A 1TNWA 1A2XA 2K7DA 1KQVA 1YX7A 1YURA 3RM1A 2M1UA 2L50A 3PALA 1LXFC 1WRLA 1L7ZA 2LVJA 4C0LA 2LM5A 1HQVA 1YUTA 3FE9A 1KFXL 5AEQA 1QTXA 3DVJA 1C3YA 2QEVA 1V1GA 4UPGA 1EH2A 1ZMZA 1KWOB 2O5GA 2MRDA 4MBEA 1TTXA 2JNXA 1KSMA 2K60A 3DVKA 4GNKB 4GAOA 3JTDC 1GJYA 1SSEB 5HLVA 2KQYA 1DJWA 2L2EA 2L51A 1B8RA 3LLEA 1G4YR 3VRPA 2JQ6A 1YVHA 2BCXA 3TUYB 4ORAB 2PASA 4I5LB 3IF7A 1SW8A 4GGFC 1KFXS 3O6BA 3A8RA 4XJKB 2RGIA 1RECA 2L0PA 1LA0A 1WRKA 5FYXA 3NGVA 1F8HA 1XFZO 4FTGA 2BL0C 1QV0A 5I2LA 3SG5A 2V53A 5CSNA 2KPHA 1PRWA 3LL8B 1N2DA 2LP2A 1DQEA 2M8UA 3AAJA 1OMDA 4MZJA 4U8DA 1YVLA 4ZCUA 3VRRA 1EG4A 1SMGA 1MUXA 1RFJA 1CTRA 4F0ZB 1IJ6A 2DOQA 1PULA 1XVJA 2ZNDA 5JJGA 1BR4B 2P6BB 1F71A 2JT3A 1ORGA 1YUUA 2KFGA 3OX5A 3M0WA 1CNPA 4MZKA 2F3ZA 1UHKA 5D7FA 5CSJA 5BPJA 1XFYO 2MJWB 3K21A 1MHOA 1GQMA 4Q04A 1UUSA 3I5GB 4HSZA 4E68A 1KK8B 1DJHA 2KFFA 3CZ2A 1IJ5A 3D78A 1QX2A 2BCBA 4ORBB 5CSIA 4YGEB 3ZNIA 1OMVA 1CMFA 5FI7A 1KK7Y 2JNFA 2OTGC 5FI2A 2Y1NA 2Y4QA 1IH0A 1NP8A 4DCKA 2WC8A 3B88A 1NPQA 1FI5A 2BECA 3K1EA 2PMYA 4HRGA 1DGVA 1WDCB 3WNXB 3MSEB 2BBMA 1UHNA 2BKHB 1J7PA 4PALA 1OW4A 4DS7A 3PJIA 1QIWA 1ZACA 1OZOA 4IL1A 1NX0A 2BE6A 3JVTC 3FE6A 4ICBA 4MEWA 3EVRA 1PSBA 2QEBA 5DKQA 2Q91A 1K9PA 1OQPA 4PDZA 3O2PA 1XFWO 3IQOA 3L47A 2LVIA 2SASA 1S5GZ 3PN7C 4NDCA 3LK1A 2KAYA 4MRXA 1UWOA 2MBXA 2GV5A 2H2KA 3BUMB 3DZTA 1NX2A 1PSRA 1MR8A 2LVKA 3BYAA 2KGBC 3D74A 2HPSA 1JWDA 2KI4C 1SKTA 3GK4X 2IS9A 3BFHA 2R2IA 2KNEA 2H61C 3FWCA 1TUZA 2FCDA 2CT9A 1LINA 1ZFSA 1QWVA 2KI6C 1Y1AA 2ZN9A 3TDUA 5KU1A 1OOHA 3SS4A 1KQMC 1QIVA 2F33A 3L4LA 2E30A 2WCBA 3CLNA 3NSIA 1K93D 3TDIA 1NCXA 4PE7A 1N65A 2LUCA 1KCYA 4INWA 1NX1A 2Q4UA 3TS5C 1B7TZ 4DIRA 1OOGA 1NWDA 4PCWA 4CFQA 2JRFA 3DVEA 1DEKA 1UHJA 1L2OC 3OB2B 2KLEA 1Y1UA 3OBVA 1JF2A 1OOIX 1AP4A 5CPVA 4YGDB 3WHTB 3HX4A 2F8PA 1OE9B 3D77A 1AHRA 2TN4A 1XFXO 3QRXA 2LAPA 2LHLA 4YI9A 1B8LA 1EJ3A 3FIAA 4N5XA 1K94A 3WXAA 3GK1A 3S0FA 3GOFA 1SCMB 5IBWA 3DYEA 1DJZA 1NIWA 1DTLA 1KWOC 3CR2A 3EVVA 1DGUA 4CFRA 1Y0VH 3D73A 2ZRTA 3SG3A 2M1KB 2MLEC 2ZKMX 2M7NA 1S1EA 1TN4A 3L4AA 2EC6B 3SG7A 5FI6A 1F55A 2NLNA 1J7OA 4FQOA 1CM4A 2LUXA 1JFJA 2K0JA 3V2LA 2QACA 3NHTA 1B7TY 2M3WA 1DMOA 2F3YA 5D3OA 4IJ7A 1IGVA 3TUYC 2L4HA 2L5YA 4MRYA 1M63B 1PVBA 1QJTA 1CLMA 3BXKA 3PM8A 1FPWA 4A4CA 1UHHA 2G2BA 5AERA 3S0EA 1H8BA 2NCOA 4BY4A 1BR1B 2M7LA 1QS7A 1CDNA 3CS1A 2CNPA 4HRHA 2CCMA 4FQTA 2M29A 1YUSA 4CIDA 2H8VA 2KOTA 4DRWA 4PE0A 1J1DA 1QX5B 4D1EA 1CDLA 1OMRA 1KSOA 2BCAA 1JSAA 4CPVA 2I7AA 5AFPA 1J7RA 1S3PA 1AUIB 1CM1A 1XK4A 2HF5A 3ICBA 1EXRA 2AAOA 3ZWHA 2KGRA 1CDMA 4WQ2A 2L2CA 2OS8B 3I5IB 3NSKA 5F6TA 3SIBA 1SL9A 3AAKA 4M2QA 1ZOTB 2ZN8A 1RK9A 3NSOA 1BJFA 1DJIA 1XFRA 1KFUS 4GGNA 1EL4A 3CR5X 2F2OA 3KEVA 1QASA 2MA2A 3I5GC 2I94A 4JKTA 1Y6WA 1KK8C 4PE4A 1Y1XA 1OZSA 5KSZA 2LC5A 1S26D 1F70A 1FBVA 4WQ3A 2PALA 2LLUA 2LANA 3O4YA 4YGCB 4MVFA 3RLZA 4AQIA 3KPXA 5DKRA 1CFFA 2GGMA 5HKYA 2KHNA 4GFTA 2JU0A 1S6IA 3BQ3A 3FS7A 3NHIA 3AKAA 5AXIA 2M0RA 2M97A 3R1OA 1K2HA 3AKBA 1OSAA 1T14A 1S36A 2GTEA 3BFBA 2JXLA 1XFVO 2LMTA 3TDZA 3WHUB 1C07A 1QVIZ 1DJGA 1TCOB 1W9ZA 2QPTA 2KAXA 2WC5A 4OZDA 3BUWB 3D76A 3Q8IA 1BODA 2JXCA 3CZTX 3I5HB 1S6CA 3BUXB 2JTZA 3IQQA 1M39A 2WOSA 1DELA 1K9UA 1XK4C 2JOJA 1TUJA 1B47A 2K8MB 2WCEA 3BUOB 2LHIA 3EK4A 1HT9A 3FE8A 1J1EA 1SR6B 1YX8A 2K2AA 4ETOA 2G9BA 3I5FB 1D1OA 3S0AA 3EK8A 1X02A 1W7JB 4ORCB 1B8CA 4PHKA 1CFPA 1M46A 1QATA 1SYMA 3VGOA 3KHEA 3B7AA 2KQ6A 4JPZB 1BT6A 1LVCD 2JPTA 1IIOA 2BKIB 2LLSA 3F45A 2EHBA 1B1GA 5I2OA 1DT7B 1CFCA 3N7HA 2JT8A 2KBMA 1TOPA 4MSPA 1BG1A 1V1FA 1K95A 1FW4A 1MF8B 1QVIY 1WLZA 1M31A 1JF0A 2KAVA 2KBIA 3EG5B 3IVTA 4P2YB 2MAZA 1R2UA 3EVUA 1C7WA 3OHMB 1JBAA 1C3ZA 3KF9A 1OOJA 1FI6A 4USLA 1AVSA 1OOFA 4XYNA 1IKUA 2PSRA 4I5KA 2AUCA 4JQ0D 1G8IA 2L98A 1S5GY 1CKKA 1BF5A 3PM2A 3VROA 3EKJA 5HYDA 3KO0A 1JC2A 1Z4HA 5EL2A 2F2PA 2K2FA 1SCVA 1MWNA 5JOLA 4YGAA 4ZCVA 5HL1A 3S0DA 3CZ1A 1YTZC 1A75A 1SCMC 5J3XA 1B4CA 2KLDA 1ALVA 3CGAA 1QXPA 3LCPC 4OVNF 1XA5A 3NSLA 1DJXA 1NCZA 1CDPA 1UHIA 5HKZA 1DVIA 2EGDA 3DF0A 5ER4X 2EC6C 4PT1A 1SNLA 1FF1A 3O4XA 1IRJA 3VRQA 2KSPA 2WNDA 3B87A 3D0YA 2AMIA 1G33A 5AANA 2NCPA 1CFDA 2P71A 3S0GA 4QJ5B 3GK2A 3NXAA 1BLQA 3PFVA 1CLLA 1PALA 2COLB 5HKWA 4C0KA 1MXLC 1IWQA 3R72A 2WCMA 2ISDA 1IQ3A 1RWYA 5G08A 1KFUL 3O78A 3PSRA 1WY9A 1K90D 3OB1B 1TIZA 2LV7A 3RZSA 1XO5A 5I8NA 3BJHA 1UP5A 1F54A 4QJ4B 3HCMA
chains in the Genus database with same CATH topology
1ODBA 2K7CA 2CTNA 3OX6A 1IG5A 1J7QA 1WLMA 2B1UA 2SCPA 4CLNA 1A03A 2BBNA 2LNKA 1RTP1 3I5IC 2OS8C 3JTDB 4AQJA 1J55A 4YGBB 2ZNEA 4MN0A 4PHNA 2M49B 1CMGA 1A75B 1NUBA 1DJYA 1MXEA 2ZFDA 3VRNA 5B8IB 5TNCA 1NCYA 5D69A 3BOWA 1K8UA 1KK7Z 3DF0B 2K7OA 3CR4X 1CB1A 2JC2A 1SY9A 4N1GA 4YBHB 2BL0B 4AOMA 2L4IA 4GBAA 5KTYA 3D0YB 1JUOA 2LVVA 2PRUA 4PE1A 1TCFA 1VRKA 2VRGA 3CWGA 2KFHA 1BOCA 4NDBA 1K9KA 1S6JA 1WDCC 2LLTA 3LK0A 1A29A 4L9MA 2KYCA 1PK0D 2CXJA 1LKJA 1AJ4A 2FOTA 4YI8A 2M9GA 4I5NB 1AK8A 4NQGA 3D10A 3H4SE 2GGZA 2LE9B 1H4BA 2NZ0A 3I5HC 2O60A 1XFUO 3SG2A 1TNXA 4A4BA 2H61A 4M2PA 1TRFA 2JULA 2CBLA 2LMVA 1QLSA 2HQ8A 4R1EA 4TNCA 4BY5A 1CLBA 5HLOA 1GGWA 1SR6C 3PLFB 3EKHA 1M45A 2JTTA 3I5FC 1JFKA 1F4QA 3SG4A 1AJ5A 4JWQA 1WRZA 1ZUZA 1GGZA 2OTGB 1DF0A 2NXQA 3CTNA 2KDHA 2K61A 2KYFA 4N1FA 2Y1MA 1SRAA 3PATA 1ALWA 1IQ5A 2FCEA 4NDDA 1N0YA 2K7BA 1SL7A 2FJUB 2ZRSA 3BOWB 2D8NA 1SL8A 2L5XB 4MZLA 1U5IA 1K96A 2WORA 3JVTB 5PALA 4OV2A 3SG6A 3SJSA 1YRTB 4I5JA 2E6WA 4OKHA 1PVAA 2OPOA 1A4PA 1YR5A 2Y5IA 3E3RA 3FWBA 4QJ3B 4M2OA 4PHJA 3SIAA 1SBJA 4MLWA 1Q80A 1C7VA 3PN7B 3C1VA 2HETA 1SK6D 5CSFA 1RJVA 5GQQC 1BU3A 3TZ1A 2KI4B 1B9AA 1W7IB 1TNQA 2KI6D 2MLFC 2PVBA 5I2QA 1QX7A 2JT0A 2LCPA 2WCFA 1QV1A 1YRUB 5ER5A 2JWWA 1MQ1A 5DKNA 1F4OA 4PHMA 1R6PA 1EG3A 4HREE 4WRIA 2A4JA 1RROA 1KQMB 4DUQA 4YRUA 4C0JA 4P5OE 2LMUA 5K89A 1LA3A 4XJKA 4GPLB 1DF0B 1SPYA 1QLKA 1XYDA 2I18A 4GGFA 4OR9B 2HQWA 1NYAA 3EK7A 1NSHA 4GUKA 3TS5B 1UURA 4OCIA 3A4UB 3BUNB 1TNPA 3DVMA 1U5IB 3DD4A 1L2OB 2MHHA 1BMOA 2I2RE 2LP3A 3OP0A 1E8AA 2JZIA 2BE4A 1NX3A 1TNWA 1A2XA 2K7DA 1KQVA 1YX7A 1YURA 3RM1A 2M1UA 2L50A 3PALA 1LXFC 1WRLA 1L7ZA 2LVJA 4C0LA 2LM5A 1HQVA 1YUTA 5AEQA 1KFXL 1QTXA 3DVJA 1V1GA 4UPGA 1EH2A 1ZMZA 1KWOB 2O5GA 2MRDA 4MBEA 1TTXA 2JNXA 1KSMA 3DVKA 4GNKB 4GAOA 3JTDC 1GJYA 5HLVA 2KQYA 1DJWA 2L2EA 2L51A 1B8RA 3LLEA 1G4YR 3VRPA 2JQ6A 1YVHA 2BCXA 3TUYB 4ORAB 2PASA 4I5LB 3IF7A 1SW8A 4GGFC 1KFXS 3O6BA 3A8RA 4XJKB 2RGIA 1RECA 2L0PA 1LA0A 1WRKA 5FYXA 1F8HA 1XFZO 4FTGA 2BL0C 1QV0A 5I2LA 3SG5A 2V53A 5CSNA 1PRWA 3LL8B 1N2DA 2LP2A 2M8UA 3AAJA 1OMDA 4MZJA 4U8DA 1YVLA 4ZCUA 3VRRA 1EG4A 1SMGA 1MUXA 1RFJA 1CTRA 4F0ZB 1IJ6A 2DOQA 1PULA 1XVJA 2ZNDA 5JJGA 1BR4B 2P6BB 1F71A 2JT3A 1YUUA 2KFGA 3OX5A 3M0WA 1CNPA 4MZKA 2F3ZA 1UHKA 5D7FA 5BPJA 1XFYO 2MJWB 3K21A 1MHOA 1GQMA 4Q04A 1UUSA 3I5GB 4HSZA 4E68A 1KK8B 1DJHA 2KFFA 1IJ5A 4ORBB 1QX2A 2BCBA 5CSIA 4YGEB 3ZNIA 1OMVA 1CMFA 1KK7Y 2JNFA 2OTGC 1IH0A 2Y1NA 2Y4QA 1NP8A 4DCKA 2WC8A 1NPQA 1FI5A 2BECA 2PMYA 4HRGA 1DGVA 1WDCB 3WNXB 3MSEB 2BBMA 1UHNA 2BKHB 1J7PA 4PALA 4DS7A 1QIWA 1ZACA 1OZOA 4IL1A 1NX0A 2BE6A 3JVTC 4ICBA 4MEWA 3EVRA 1PSBA 5DKQA 2Q91A 1K9PA 1OQPA 4PDZA 3O2PA 1XFWO 3IQOA 2LVIA 2SASA 1S5GZ 3PN7C 4NDCA 3LK1A 2KAYA 4MRXA 1UWOA 2MBXA 2GV5A 2H2KA 3BUMB 1NX2A 1PSRA 1MR8A 2LVKA 3BYAA 2KGBC 2HPSA 1JWDA 2KI4C 1SKTA 3GK4X 2IS9A 2R2IA 2KNEA 2H61C 3FWCA 2FCDA 2CT9A 1LINA 1ZFSA 2KI6C 1Y1AA 2ZN9A 3TDUA 5KU1A 1KQMC 1QIVA 2F33A 2E30A 2WCBA 3CLNA 3NSIA 1K93D 3TDIA 1NCXA 4PE7A 1N65A 2LUCA 1KCYA 1NX1A 2Q4UA 3TS5C 1B7TZ 4DIRA 1NWDA 4PCWA 4CFQA 2JRFA 3DVEA 1UHJA 1L2OC 3OB2B 1Y1UA 1JF2A 1AP4A 5CPVA 4YGDB 3WHTB 3HX4A 2F8PA 1OE9B 1AHRA 2TN4A 1XFXO 3QRXA 2LAPA 2LHLA 4YI9A 1B8LA 1EJ3A 3FIAA 4N5XA 1K94A 3WXAA 3GK1A 3GOFA 1SCMB 5IBWA 1DJZA 1NIWA 1DTLA 1KWOC 3CR2A 3EVVA 1DGUA 4CFRA 1Y0VH 2ZRTA 3SG3A 2M1KB 2MLEC 2ZKMX 2M7NA 1S1EA 1TN4A 2EC6B 3SG7A 1F55A 2NLNA 1J7OA 4FQOA 1CM4A 2LUXA 1JFJA 2K0JA 2QACA 1B7TY 2M3WA 1DMOA 2F3YA 1IGVA 3TUYC 2L4HA 4MRYA 1M63B 1PVBA 1QJTA 1CLMA 3BXKA 3PM8A 1FPWA 4A4CA 1UHHA 2G2BA 5AERA 1H8BA 2NCOA 4BY4A 1BR1B 2M7LA 1QS7A 1CDNA 3CS1A 2CNPA 4HRHA 2CCMA 2M29A 1YUSA 4CIDA 4DRWA 2KOTA 4PE0A 1J1DA 1QX5B 4D1EA 1CDLA 1OMRA 1KSOA 2BCAA 1JSAA 4CPVA 2I7AA 5AFPA 1J7RA 1S3PA 1AUIB 1CM1A 1XK4A 2HF5A 3ICBA 1EXRA 2AAOA 3ZWHA 2KGRA 1CDMA 4WQ2A 3I5IB 2OS8B 3NSKA 5F6TA 3SIBA 1SL9A 3AAKA 4M2QA 1ZOTB 2ZN8A 1RK9A 3NSOA 1BJFA 1DJIA 1KFUS 4GGNA 1EL4A 3CR5X 2F2OA 3KEVA 1QASA 2MA2A 3I5GC 2I94A 1Y6WA 1KK8C 4PE4A 1Y1XA 1OZSA 5KSZA 2LC5A 1S26D 1F70A 1FBVA 4WQ3A 2PALA 2LLUA 2LANA 3O4YA 4YGCB 4MVFA 3RLZA 4AQIA 3KPXA 5DKRA 1CFFA 2GGMA 5HKYA 2KHNA 4GFTA 2JU0A 1S6IA 3BQ3A 3FS7A 5AXIA 3AKAA 2M0RA 2M97A 1K2HA 3AKBA 1OSAA 3TDZA 1S36A 2JXLA 1XFVO 2LMTA 3WHUB 1C07A 1QVIZ 1DJGA 1TCOB 2QPTA 2KAXA 3BUWB 1BODA 2JXCA 3CZTX 3I5HB 1S6CA 3BUXB 2JTZA 3IQQA 1M39A 2WOSA 2K8MB 1K9UA 1XK4C 2JOJA 2WCEA 1B47A 3BUOB 5CSJA 2LHIA 3EK4A 1HT9A 1J1EA 1SR6B 1YX8A 2K2AA 4ETOA 2G9BA 3I5FB 1D1OA 3EK8A 1X02A 1W7JB 4ORCB 1B8CA 4PHKA 1CFPA 1M46A 1QATA 1SYMA 3VGOA 3KHEA 2KQ6A 4JPZB 1BT6A 1LVCD 2JPTA 2BKIB 2LLSA 3F45A 2EHBA 1B1GA 5I2OA 1DT7B 1CFCA 2JT8A 2KBMA 1TOPA 4MSPA 1BG1A 1V1FA 1K95A 1FW4A 1MF8B 1QVIY 1WLZA 1M31A 1JF0A 2KAVA 2KBIA 4P2YB 2MAZA 1R2UA 3EVUA 1C7WA 3OHMB 1JBAA 3KF9A 1OOJA 1FI6A 4USLA 1AVSA 4XYNA 1IKUA 2PSRA 4I5KA 2AUCA 4JQ0D 1G8IA 2L98A 1S5GY 1CKKA 1BF5A 3VROA 3EKJA 5HYDA 3KO0A 1JC2A 2F2PA 2K2FA 1SCVA 1MWNA 5JOLA 4YGAA 4ZCVA 1YTZC 1A75A 1SCMC 5J3XA 1B4CA 1ALVA 3CGAA 1QXPA 3LCPC 4OVNF 1XA5A 3NSLA 1DJXA 1NCZA 1CDPA 1UHIA 5HKZA 1DVIA 2EGDA 3DF0A 5ER4X 2EC6C 1FF1A 1SNLA 1IRJA 3VRQA 2KSPA 2WNDA 3D0YA 2AMIA 1G33A 5AANA 2NCPA 1CFDA 4QJ5B 3GK2A 3NXAA 1BLQA 3PFVA 1CLLA 1PALA 2COLB 5HKWA 4C0KA 1MXLC 1IWQA 2ISDA 1IQ3A 1RWYA 5G08A 1KFUL 3O78A 3PSRA 1WY9A 1K90D 3OB1B 1TIZA 2LV7A 1XO5A 5I8NA 1F54A 1UP5A 4QJ4B 3HCMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ODB A;  2K7C A;  2CTN A;  3OX6 A;  1IG5 A;  1J7Q A;  1WLM A;  2B1U A;  2SCP A;  4CLN A;  1A03 A;  2BBN A;  2LNK A;  1RTP 1;  3I5I C;  2OS8 C;  3JTD B;  4AQJ A;  1J55 A;  4YGB B;  2ZNE A;  4MN0 A;  4PHN A;  2M49 B;  1CMG A;  1A75 B;  1NUB A;  1DJY A;  1MXE A;  2ZFD A;  3VRN A;  5B8I B;  5TNC A;  1NCY A;  5D69 A;  3BOW A;  1K8U A;  1KK7 Z;  3DF0 B;  2K7O A;  3CR4 X;  1CB1 A;  2JC2 A;  1SY9 A;  4N1G A;  4YBH B;  2BL0 B;  4AOM A;  2L4I A;  4GBA A;  5KTY A;  3D0Y B;  1JUO A;  2LVV A;  2PRU A;  4PE1 A;  1TCF A;  1VRK A;  2VRG A;  3CWG A;  2KFH A;  1BOC A;  4NDB A;  1K9K A;  1S6J A;  1WDC C;  2LLT A;  3LK0 A;  1A29 A;  4L9M A;  2KYC A;  1PK0 D;  2CXJ A;  1LKJ A;  1AJ4 A;  2FOT A;  4YI8 A;  2M9G A;  4I5N B;  1AK8 A;  4NQG A;  3D10 A;  3H4S E;  2GGZ A;  2LE9 B;  1H4B A;  2NZ0 A;  3I5H C;  2O60 A;  1XFU O;  3SG2 A;  1TNX A;  4A4B A;  2H61 A;  4M2P A;  1TRF A;  2JUL A;  2CBL A;  2LMV A;  1QLS A;  2HQ8 A;  4R1E A;  4TNC A;  4BY5 A;  1CLB A;  5HLO A;  1GGW A;  1SR6 C;  3PLF B;  3EKH A;  1M45 A;  2JTT A;  3I5F C;  1JFK A;  1F4Q A;  3SG4 A;  1AJ5 A;  4JWQ A;  1WRZ A;  1ZUZ A;  1GGZ A;  2OTG B;  1DF0 A;  2NXQ A;  3CTN A;  2KDH A;  2K61 A;  2KYF A;  4N1F A;  2Y1M A;  1SRA A;  3PAT A;  1ALW A;  1IQ5 A;  2FCE A;  4NDD A;  1N0Y A;  2K7B A;  1SL7 A;  2FJU B;  2ZRS A;  3BOW B;  2D8N A;  1SL8 A;  2L5X B;  4MZL A;  1U5I A;  1K96 A;  2WOR A;  3JVT B;  5PAL A;  4OV2 A;  3SG6 A;  3SJS A;  1YRT B;  4I5J A;  2E6W A;  4OKH A;  1PVA A;  2OPO A;  1A4P A;  1YR5 A;  2Y5I A;  3E3R A;  3FWB A;  4QJ3 B;  4M2O A;  4PHJ A;  3SIA A;  1SBJ A;  4MLW A;  1Q80 A;  1C7V A;  3PN7 B;  3C1V A;  2HET A;  1SK6 D;  5CSF A;  1RJV A;  5GQQ C;  1BU3 A;  3TZ1 A;  2KI4 B;  1B9A A;  1W7I B;  1TNQ A;  2KI6 D;  2MLF C;  2PVB A;  5I2Q A;  1QX7 A;  2JT0 A;  2LCP A;  2WCF A;  1QV1 A;  1YRU B;  5ER5 A;  2JWW A;  1MQ1 A;  5DKN A;  1F4O A;  4PHM A;  1R6P A;  1EG3 A;  4HRE E;  4WRI A;  2A4J A;  1RRO A;  1KQM B;  4DUQ A;  4YRU A;  4C0J A;  4P5O E;  2LMU A;  5K89 A;  1LA3 A;  4XJK A;  4GPL B;  1DF0 B;  1SPY A;  1QLK A;  1XYD A;  2I18 A;  4GGF A;  4OR9 B;  2HQW A;  1NYA A;  3EK7 A;  1NSH A;  4GUK A;  3TS5 B;  1UUR A;  4OCI A;  3A4U B;  3BUN B;  1TNP A;  3DVM A;  1U5I B;  3DD4 A;  1L2O B;  2MHH A;  1BMO A;  2I2R E;  2LP3 A;  3OP0 A;  1E8A A;  2JZI A;  2BE4 A;  1NX3 A;  1TNW A;  1A2X A;  2K7D A;  1KQV A;  1YX7 A;  1YUR A;  3RM1 A;  2M1U A;  2L50 A;  3PAL A;  1LXF C;  1WRL A;  1L7Z A;  2LVJ A;  4C0L A;  2LM5 A;  1HQV A;  1YUT A;  5AEQ A;  1KFX L;  1QTX A;  3DVJ A;  1V1G A;  4UPG A;  1EH2 A;  1ZMZ A;  1KWO B;  2O5G A;  2MRD A;  4MBE A;  1TTX A;  2JNX A;  1KSM A;  3DVK A;  4GNK B;  4GAO A;  3JTD C;  1GJY A;  5HLV A;  2KQY A;  1DJW A;  2L2E A;  2L51 A;  1B8R A;  3LLE A;  1G4Y R;  3VRP A;  2JQ6 A;  1YVH A;  2BCX A;  3TUY B;  4ORA B;  2PAS A;  4I5L B;  3IF7 A;  1SW8 A;  4GGF C;  1KFX S;  3O6B A;  3A8R A;  4XJK B;  2RGI A;  1REC A;  2L0P A;  1LA0 A;  1WRK A;  5FYX A;  1F8H A;  1XFZ O;  4FTG A;  2BL0 C;  1QV0 A;  5I2L A;  3SG5 A;  2V53 A;  5CSN A;  1PRW A;  3LL8 B;  1N2D A;  2LP2 A;  2M8U A;  3AAJ A;  1OMD A;  4MZJ A;  4U8D A;  1YVL A;  4ZCU A;  3VRR A;  1EG4 A;  1SMG A;  1MUX A;  1RFJ A;  1CTR A;  4F0Z B;  1IJ6 A;  2DOQ A;  1PUL A;  1XVJ A;  2ZND A;  5JJG A;  1BR4 B;  2P6B B;  1F71 A;  2JT3 A;  1YUU A;  2KFG A;  3OX5 A;  3M0W A;  1CNP A;  4MZK A;  2F3Z A;  1UHK A;  5D7F A;  5BPJ A;  1XFY O;  2MJW B;  3K21 A;  1MHO A;  1GQM A;  4Q04 A;  1UUS A;  3I5G B;  4HSZ A;  4E68 A;  1KK8 B;  1DJH A;  2KFF A;  1IJ5 A;  4ORB B;  1QX2 A;  2BCB A;  5CSI A;  4YGE B;  3ZNI A;  1OMV A;  1CMF A;  1KK7 Y;  2JNF A;  2OTG C;  1IH0 A;  2Y1N A;  2Y4Q A;  1NP8 A;  4DCK A;  2WC8 A;  1NPQ A;  1FI5 A;  2BEC A;  2PMY A;  4HRG A;  1DGV A;  1WDC B;  3WNX B;  3MSE B;  2BBM A;  1UHN A;  2BKH B;  1J7P A;  4PAL A;  4DS7 A;  1QIW A;  1ZAC A;  1OZO A;  4IL1 A;  1NX0 A;  2BE6 A;  3JVT C;  4ICB A;  4MEW A;  3EVR A;  1PSB A;  5DKQ A;  2Q91 A;  1K9P A;  1OQP A;  4PDZ A;  3O2P A;  1XFW O;  3IQO A;  2LVI A;  2SAS A;  1S5G Z;  3PN7 C;  4NDC A;  3LK1 A;  2KAY A;  4MRX A;  1UWO A;  2MBX A;  2GV5 A;  2H2K A;  3BUM B;  1NX2 A;  1PSR A;  1MR8 A;  2LVK A;  3BYA A;  2KGB C;  2HPS A;  1JWD A;  2KI4 C;  1SKT A;  3GK4 X;  2IS9 A;  2R2I A;  2KNE A;  2H61 C;  3FWC A;  2FCD A;  2CT9 A;  1LIN A;  1ZFS A;  2KI6 C;  1Y1A A;  2ZN9 A;  3TDU A;  5KU1 A;  1KQM C;  1QIV A;  2F33 A;  2E30 A;  2WCB A;  3CLN A;  3NSI A;  1K93 D;  3TDI A;  1NCX A;  4PE7 A;  1N65 A;  2LUC A;  1KCY A;  1NX1 A;  2Q4U A;  3TS5 C;  1B7T Z;  4DIR A;  1NWD A;  4PCW A;  4CFQ A;  2JRF A;  3DVE A;  1UHJ A;  1L2O C;  3OB2 B;  1Y1U A;  1JF2 A;  1AP4 A;  5CPV A;  4YGD B;  3WHT B;  3HX4 A;  2F8P A;  1OE9 B;  1AHR A;  2TN4 A;  1XFX O;  3QRX A;  2LAP A;  2LHL A;  4YI9 A;  1B8L A;  1EJ3 A;  3FIA A;  4N5X A;  1K94 A;  3WXA A;  3GK1 A;  3GOF A;  1SCM B;  5IBW A;  1DJZ A;  1NIW A;  1DTL A;  1KWO C;  3CR2 A;  3EVV A;  1DGU A;  4CFR A;  1Y0V H;  2ZRT A;  3SG3 A;  2M1K B;  2MLE C;  2ZKM X;  2M7N A;  1S1E A;  1TN4 A;  2EC6 B;  3SG7 A;  1F55 A;  2NLN A;  1J7O A;  4FQO A;  1CM4 A;  2LUX A;  1JFJ A;  2K0J A;  2QAC A;  1B7T Y;  2M3W A;  1DMO A;  2F3Y A;  1IGV A;  3TUY C;  2L4H A;  4MRY A;  1M63 B;  1PVB A;  1QJT A;  1CLM A;  3BXK A;  3PM8 A;  1FPW A;  4A4C A;  1UHH A;  2G2B A;  5AER A;  1H8B A;  2NCO A;  4BY4 A;  1BR1 B;  2M7L A;  1QS7 A;  1CDN A;  3CS1 A;  2CNP A;  4HRH A;  2CCM A;  2M29 A;  1YUS A;  4CID A;  4DRW A;  2KOT A;  4PE0 A;  1J1D A;  1QX5 B;  4D1E A;  1CDL A;  1OMR A;  1KSO A;  2BCA A;  1JSA A;  4CPV A;  2I7A A;  5AFP A;  1J7R A;  1S3P A;  1AUI B;  1CM1 A;  1XK4 A;  2HF5 A;  3ICB A;  1EXR A;  2AAO A;  3ZWH A;  2KGR A;  1CDM A;  4WQ2 A;  3I5I B;  2OS8 B;  3NSK A;  5F6T A;  3SIB A;  1SL9 A;  3AAK A;  4M2Q A;  1ZOT B;  2ZN8 A;  1RK9 A;  3NSO A;  1BJF A;  1DJI A;  1KFU S;  4GGN A;  1EL4 A;  3CR5 X;  2F2O A;  3KEV A;  1QAS A;  2MA2 A;  3I5G C;  2I94 A;  1Y6W A;  1KK8 C;  4PE4 A;  1Y1X A;  1OZS A;  5KSZ A;  2LC5 A;  1S26 D;  1F70 A;  1FBV A;  4WQ3 A;  2PAL A;  2LLU A;  2LAN A;  3O4Y A;  4YGC B;  4MVF A;  3RLZ A;  4AQI A;  3KPX A;  5DKR A;  1CFF A;  2GGM A;  5HKY A;  2KHN A;  4GFT A;  2JU0 A;  1S6I A;  3BQ3 A;  3FS7 A;  5AXI A;  3AKA A;  2M0R A;  2M97 A;  1K2H A;  3AKB A;  1OSA A;  3TDZ A;  1S36 A;  2JXL A;  1XFV O;  2LMT A;  3WHU B;  1C07 A;  1QVI Z;  1DJG A;  1TCO B;  2QPT A;  2KAX A;  3BUW B;  1BOD A;  2JXC A;  3CZT X;  3I5H B;  1S6C A;  3BUX B;  2JTZ A;  3IQQ A;  1M39 A;  2WOS A;  2K8M B;  1K9U A;  1XK4 C;  2JOJ A;  2WCE A;  1B47 A;  3BUO B;  5CSJ A;  2LHI A;  3EK4 A;  1HT9 A;  1J1E A;  1SR6 B;  1YX8 A;  2K2A A;  4ETO A;  2G9B A;  3I5F B;  1D1O A;  3EK8 A;  1X02 A;  1W7J B;  4ORC B;  1B8C A;  4PHK A;  1CFP A;  1M46 A;  1QAT A;  1SYM A;  3VGO A;  3KHE A;  2KQ6 A;  4JPZ B;  1BT6 A;  1LVC D;  2JPT A;  2BKI B;  2LLS A;  3F45 A;  2EHB A;  1B1G A;  5I2O A;  1DT7 B;  1CFC A;  2JT8 A;  2KBM A;  1TOP A;  4MSP A;  1BG1 A;  1V1F A;  1K95 A;  1FW4 A;  1MF8 B;  1QVI Y;  1WLZ A;  1M31 A;  1JF0 A;  2KAV A;  2KBI A;  4P2Y B;  2MAZ A;  1R2U A;  3EVU A;  1C7W A;  3OHM B;  1JBA A;  3KF9 A;  1OOJ A;  1FI6 A;  4USL A;  1AVS A;  4XYN A;  1IKU A;  2PSR A;  4I5K A;  2AUC A;  4JQ0 D;  1G8I A;  2L98 A;  1S5G Y;  1CKK A;  1BF5 A;  3VRO A;  3EKJ A;  5HYD A;  3KO0 A;  1JC2 A;  2F2P A;  2K2F A;  1SCV A;  1MWN A;  5JOL A;  4YGA A;  4ZCV A;  1YTZ C;  1A75 A;  1SCM C;  5J3X A;  1B4C A;  1ALV A;  3CGA A;  1QXP A;  3LCP C;  4OVN F;  1XA5 A;  3NSL A;  1DJX A;  1NCZ A;  1CDP A;  1UHI A;  5HKZ A;  1DVI A;  2EGD A;  3DF0 A;  5ER4 X;  2EC6 C;  1FF1 A;  1SNL A;  1IRJ A;  3VRQ A;  2KSP A;  2WND A;  3D0Y A;  2AMI A;  1G33 A;  5AAN A;  2NCP A;  1CFD A;  4QJ5 B;  3GK2 A;  3NXA A;  1BLQ A;  3PFV A;  1CLL A;  1PAL A;  2COL B;  5HKW A;  4C0K A;  1MXL C;  1IWQ A;  2ISD A;  1IQ3 A;  1RWY A;  5G08 A;  1KFU L;  3O78 A;  3PSR A;  1WY9 A;  1K90 D;  3OB1 B;  1TIZ A;  2LV7 A;  1XO5 A;  5I8N A;  1F54 A;  1UP5 A;  4QJ4 B;  3HCM A; 
#chains in the Genus database with same CATH topology
 1ODB A;  2K7C A;  2CTN A;  3OX6 A;  2JPO A;  1IG5 A;  1J7Q A;  1WLM A;  2B1U A;  2SCP A;  4CLN A;  1A03 A;  2BBN A;  2LNK A;  2P70 A;  1RTP 1;  3I5I C;  2OS8 C;  3OGN A;  3JTD B;  4AQJ A;  1J55 A;  4YGB B;  2ZNE A;  4MN0 A;  4PHN A;  2M49 B;  1CMG A;  1A75 B;  1NUB A;  1DJY A;  1MXE A;  2ZFD A;  3VRN A;  5B8I B;  5TNC A;  4JD9 A;  1NCY A;  5D69 A;  1LS8 A;  3BOW A;  1K8U A;  1KK7 Z;  3DF0 B;  2K7O A;  3CR4 X;  1CB1 A;  2JC2 A;  1SY9 A;  4N1G A;  4YBH B;  2BL0 B;  4AOM A;  1GM0 A;  2L4I A;  4GBA A;  5KTY A;  1Z2C B;  1JUO A;  2LVV A;  2PRU A;  3D0Y B;  4PE1 A;  1TCF A;  1VRK A;  2VRG A;  3CWG A;  2KFH A;  1BOC A;  4NDB A;  1K9K A;  1S6J A;  1WDC C;  2LLT A;  2WCL A;  1A29 A;  3LK0 A;  4L9M A;  2KYC A;  1PK0 D;  2CXJ A;  1LKJ A;  1AJ4 A;  2FOT A;  4YI8 A;  2M9G A;  4I5N B;  1AK8 A;  4NQG A;  3D10 A;  3R1V A;  3H4S E;  2GGZ A;  2LE9 B;  3SS3 A;  2PQL A;  1H4B A;  2NZ0 A;  3DXL A;  3I5H C;  2O60 A;  1XFU O;  3SG2 A;  1TNX A;  4A4B A;  2H61 A;  4M2P A;  3SS5 A;  3UNW A;  1TRF A;  2JUL A;  2CBL A;  2LMV A;  2YGU A;  1QLS A;  2HQ8 A;  4R1E A;  4TNC A;  4BY5 A;  3R1P A;  1CLB A;  5HLO A;  1GGW A;  1SR6 C;  3PLF B;  3EKH A;  1M45 A;  2JTT A;  3I5F C;  1JFK A;  1F4Q A;  2QEH A;  4KYN A;  3SG4 A;  2WC6 A;  1AJ5 A;  2FJY A;  4JWQ A;  3S0B A;  1WRZ A;  1ZUZ A;  3CZ0 A;  1GGZ A;  2OTG B;  1DF0 A;  2NXQ A;  3CTN A;  2KDH A;  3CAB A;  2K61 A;  2KYF A;  4N1F A;  2Y1M A;  1SRA A;  3BFA A;  3PAT A;  2ERB A;  1ALW A;  1IQ5 A;  2FCE A;  4NDD A;  1N0Y A;  2K7B A;  1SL7 A;  1P28 A;  2FJU B;  2ZRS A;  3BOW B;  2D8N A;  1SL8 A;  2L5X B;  4MZL A;  1U5I A;  2WCK A;  3B6X A;  3CDN A;  1K96 A;  2WOR A;  3JVT B;  5PAL A;  2BAP A;  4OV2 A;  3SG6 A;  3SJS A;  1DC1 A;  1YRT B;  4I5J A;  2E6W A;  4OKH A;  1PVA A;  2OPO A;  1A4P A;  1YR5 A;  2Y5I A;  3E3R A;  3FWB A;  4QJ3 B;  3VB1 A;  3DY9 A;  4F7F A;  4M2O A;  4PHJ A;  3SIA A;  1SBJ A;  4MLW A;  1Q80 A;  1C7V A;  3PN7 B;  2WCH A;  3C1V A;  5DIC A;  2HET A;  1SK6 D;  5CSF A;  3CYZ A;  1RJV A;  5GQQ C;  1BU3 A;  3TZ1 A;  2KI4 B;  1B9A A;  1W7I B;  1TNQ A;  2BNX A;  2KI6 D;  2MLF C;  2PVB A;  5I2Q A;  5I94 A;  1QX7 A;  2JT0 A;  2LCP A;  2WCF A;  1QV1 A;  1YRU B;  5ER5 A;  2QDI A;  2JWW A;  1MQ1 A;  3B86 A;  5DKN A;  1F4O A;  4PHM A;  1R6P A;  1EG3 A;  4HRE E;  4WRI A;  2A4J A;  1RRO A;  1KQM B;  4DUQ A;  4YRU A;  4C0J A;  4P5O E;  2QEO A;  2LMU A;  5K89 A;  1LA3 A;  2PYQ A;  4XJK A;  4GPL B;  1DF0 B;  1SPY A;  1QLK A;  1XYD A;  2I18 A;  4GGF A;  4OR9 B;  2HQW A;  1NYA A;  1TWO A;  3D75 A;  3EK7 A;  1NSH A;  4GUK A;  3TS5 B;  1UUR A;  4OCI A;  3UO9 A;  4INX A;  3A4U B;  3BUN B;  2WCJ A;  1TNP A;  3DVM A;  3QME A;  1U5I B;  3DD4 A;  1L2O B;  2MHH A;  1BMO A;  2I2R E;  2LP3 A;  3OP0 A;  1E8A A;  2JZI A;  2BE4 A;  1NX3 A;  1TNW A;  1A2X A;  2K7D A;  1KQV A;  1YX7 A;  1YUR A;  3RM1 A;  2M1U A;  2L50 A;  3PAL A;  1LXF C;  1WRL A;  1L7Z A;  2LVJ A;  4C0L A;  2LM5 A;  1HQV A;  1YUT A;  3FE9 A;  1KFX L;  5AEQ A;  1QTX A;  3DVJ A;  1C3Y A;  2QEV A;  1V1G A;  4UPG A;  1EH2 A;  1ZMZ A;  1KWO B;  2O5G A;  2MRD A;  4MBE A;  1TTX A;  2JNX A;  1KSM A;  2K60 A;  3DVK A;  4GNK B;  4GAO A;  3JTD C;  1GJY A;  1SSE B;  5HLV A;  2KQY A;  1DJW A;  2L2E A;  2L51 A;  1B8R A;  3LLE A;  1G4Y R;  3VRP A;  2JQ6 A;  1YVH A;  2BCX A;  3TUY B;  4ORA B;  2PAS A;  4I5L B;  3IF7 A;  1SW8 A;  4GGF C;  1KFX S;  3O6B A;  3A8R A;  4XJK B;  2RGI A;  1REC A;  2L0P A;  1LA0 A;  1WRK A;  5FYX A;  3NGV A;  1F8H A;  1XFZ O;  4FTG A;  2BL0 C;  1QV0 A;  5I2L A;  3SG5 A;  2V53 A;  5CSN A;  2KPH A;  1PRW A;  3LL8 B;  1N2D A;  2LP2 A;  1DQE A;  2M8U A;  3AAJ A;  1OMD A;  4MZJ A;  4U8D A;  1YVL A;  4ZCU A;  3VRR A;  1EG4 A;  1SMG A;  1MUX A;  1RFJ A;  1CTR A;  4F0Z B;  1IJ6 A;  2DOQ A;  1PUL A;  1XVJ A;  2ZND A;  5JJG A;  1BR4 B;  2P6B B;  1F71 A;  2JT3 A;  1ORG A;  1YUU A;  2KFG A;  3OX5 A;  3M0W A;  1CNP A;  4MZK A;  2F3Z A;  1UHK A;  5D7F A;  5CSJ A;  5BPJ A;  1XFY O;  2MJW B;  3K21 A;  1MHO A;  1GQM A;  4Q04 A;  1UUS A;  3I5G B;  4HSZ A;  4E68 A;  1KK8 B;  1DJH A;  2KFF A;  3CZ2 A;  1IJ5 A;  3D78 A;  1QX2 A;  2BCB A;  4ORB B;  5CSI A;  4YGE B;  3ZNI A;  1OMV A;  1CMF A;  5FI7 A;  1KK7 Y;  2JNF A;  2OTG C;  5FI2 A;  2Y1N A;  2Y4Q A;  1IH0 A;  1NP8 A;  4DCK A;  2WC8 A;  3B88 A;  1NPQ A;  1FI5 A;  2BEC A;  3K1E A;  2PMY A;  4HRG A;  1DGV A;  1WDC B;  3WNX B;  3MSE B;  2BBM A;  1UHN A;  2BKH B;  1J7P A;  4PAL A;  1OW4 A;  4DS7 A;  3PJI A;  1QIW A;  1ZAC A;  1OZO A;  4IL1 A;  1NX0 A;  2BE6 A;  3JVT C;  3FE6 A;  4ICB A;  4MEW A;  3EVR A;  1PSB A;  2QEB A;  5DKQ A;  2Q91 A;  1K9P A;  1OQP A;  4PDZ A;  3O2P A;  1XFW O;  3IQO A;  3L47 A;  2LVI A;  2SAS A;  1S5G Z;  3PN7 C;  4NDC A;  3LK1 A;  2KAY A;  4MRX A;  1UWO A;  2MBX A;  2GV5 A;  2H2K A;  3BUM B;  3DZT A;  1NX2 A;  1PSR A;  1MR8 A;  2LVK A;  3BYA A;  2KGB C;  3D74 A;  2HPS A;  1JWD A;  2KI4 C;  1SKT A;  3GK4 X;  2IS9 A;  3BFH A;  2R2I A;  2KNE A;  2H61 C;  3FWC A;  1TUZ A;  2FCD A;  2CT9 A;  1LIN A;  1ZFS A;  1QWV A;  2KI6 C;  1Y1A A;  2ZN9 A;  3TDU A;  5KU1 A;  1OOH A;  3SS4 A;  1KQM C;  1QIV A;  2F33 A;  3L4L A;  2E30 A;  2WCB A;  3CLN A;  3NSI A;  1K93 D;  3TDI A;  1NCX A;  4PE7 A;  1N65 A;  2LUC A;  1KCY A;  4INW A;  1NX1 A;  2Q4U A;  3TS5 C;  1B7T Z;  4DIR A;  1OOG A;  1NWD A;  4PCW A;  4CFQ A;  2JRF A;  3DVE A;  1DEK A;  1UHJ A;  1L2O C;  3OB2 B;  2KLE A;  1Y1U A;  3OBV A;  1JF2 A;  1OOI X;  1AP4 A;  5CPV A;  4YGD B;  3WHT B;  3HX4 A;  2F8P A;  1OE9 B;  3D77 A;  1AHR A;  2TN4 A;  1XFX O;  3QRX A;  2LAP A;  2LHL A;  4YI9 A;  1B8L A;  1EJ3 A;  3FIA A;  4N5X A;  1K94 A;  3WXA A;  3GK1 A;  3S0F A;  3GOF A;  1SCM B;  5IBW A;  3DYE A;  1DJZ A;  1NIW A;  1DTL A;  1KWO C;  3CR2 A;  3EVV A;  1DGU A;  4CFR A;  1Y0V H;  3D73 A;  2ZRT A;  3SG3 A;  2M1K B;  2MLE C;  2ZKM X;  2M7N A;  1S1E A;  1TN4 A;  3L4A A;  2EC6 B;  3SG7 A;  5FI6 A;  1F55 A;  2NLN A;  1J7O A;  4FQO A;  1CM4 A;  2LUX A;  1JFJ A;  2K0J A;  3V2L A;  2QAC A;  3NHT A;  1B7T Y;  2M3W A;  1DMO A;  2F3Y A;  5D3O A;  4IJ7 A;  1IGV A;  3TUY C;  2L4H A;  2L5Y A;  4MRY A;  1M63 B;  1PVB A;  1QJT A;  1CLM A;  3BXK A;  3PM8 A;  1FPW A;  4A4C A;  1UHH A;  2G2B A;  5AER A;  3S0E A;  1H8B A;  2NCO A;  4BY4 A;  1BR1 B;  2M7L A;  1QS7 A;  1CDN A;  3CS1 A;  2CNP A;  4HRH A;  2CCM A;  4FQT A;  2M29 A;  1YUS A;  4CID A;  2H8V A;  2KOT A;  4DRW A;  4PE0 A;  1J1D A;  1QX5 B;  4D1E A;  1CDL A;  1OMR A;  1KSO A;  2BCA A;  1JSA A;  4CPV A;  2I7A A;  5AFP A;  1J7R A;  1S3P A;  1AUI B;  1CM1 A;  1XK4 A;  2HF5 A;  3ICB A;  1EXR A;  2AAO A;  3ZWH A;  2KGR A;  1CDM A;  4WQ2 A;  2L2C A;  2OS8 B;  3I5I B;  3NSK A;  5F6T A;  3SIB A;  1SL9 A;  3AAK A;  4M2Q A;  1ZOT B;  2ZN8 A;  1RK9 A;  3NSO A;  1BJF A;  1DJI A;  1XFR A;  1KFU S;  4GGN A;  1EL4 A;  3CR5 X;  2F2O A;  3KEV A;  1QAS A;  2MA2 A;  3I5G C;  2I94 A;  4JKT A;  1Y6W A;  1KK8 C;  4PE4 A;  1Y1X A;  1OZS A;  5KSZ A;  2LC5 A;  1S26 D;  1F70 A;  1FBV A;  4WQ3 A;  2PAL A;  2LLU A;  2LAN A;  3O4Y A;  4YGC B;  4MVF A;  3RLZ A;  4AQI A;  3KPX A;  5DKR A;  1CFF A;  2GGM A;  5HKY A;  2KHN A;  4GFT A;  2JU0 A;  1S6I A;  3BQ3 A;  3FS7 A;  3NHI A;  3AKA A;  5AXI A;  2M0R A;  2M97 A;  3R1O A;  1K2H A;  3AKB A;  1OSA A;  1T14 A;  1S36 A;  2GTE A;  3BFB A;  2JXL A;  1XFV O;  2LMT A;  3TDZ A;  3WHU B;  1C07 A;  1QVI Z;  1DJG A;  1TCO B;  1W9Z A;  2QPT A;  2KAX A;  2WC5 A;  4OZD A;  3BUW B;  3D76 A;  3Q8I A;  1BOD A;  2JXC A;  3CZT X;  3I5H B;  1S6C A;  3BUX B;  2JTZ A;  3IQQ A;  1M39 A;  2WOS A;  1DEL A;  1K9U A;  1XK4 C;  2JOJ A;  1TUJ A;  1B47 A;  2K8M B;  2WCE A;  3BUO B;  2LHI A;  3EK4 A;  1HT9 A;  3FE8 A;  1J1E A;  1SR6 B;  1YX8 A;  2K2A A;  4ETO A;  2G9B A;  3I5F B;  1D1O A;  3S0A A;  3EK8 A;  1X02 A;  1W7J B;  4ORC B;  1B8C A;  4PHK A;  1CFP A;  1M46 A;  1QAT A;  1SYM A;  3VGO A;  3KHE A;  3B7A A;  2KQ6 A;  4JPZ B;  1BT6 A;  1LVC D;  2JPT A;  1IIO A;  2BKI B;  2LLS A;  3F45 A;  2EHB A;  1B1G A;  5I2O A;  1DT7 B;  1CFC A;  3N7H A;  2JT8 A;  2KBM A;  1TOP A;  4MSP A;  1BG1 A;  1V1F A;  1K95 A;  1FW4 A;  1MF8 B;  1QVI Y;  1WLZ A;  1M31 A;  1JF0 A;  2KAV A;  2KBI A;  3EG5 B;  3IVT A;  4P2Y B;  2MAZ A;  1R2U A;  3EVU A;  1C7W A;  3OHM B;  1JBA A;  1C3Z A;  3KF9 A;  1OOJ A;  1FI6 A;  4USL A;  1AVS A;  1OOF A;  4XYN A;  1IKU A;  2PSR A;  4I5K A;  2AUC A;  4JQ0 D;  1G8I A;  2L98 A;  1S5G Y;  1CKK A;  1BF5 A;  3PM2 A;  3VRO A;  3EKJ A;  5HYD A;  3KO0 A;  1JC2 A;  1Z4H A;  5EL2 A;  2F2P A;  2K2F A;  1SCV A;  1MWN A;  5JOL A;  4YGA A;  4ZCV A;  5HL1 A;  3S0D A;  3CZ1 A;  1YTZ C;  1A75 A;  1SCM C;  5J3X A;  1B4C A;  2KLD A;  1ALV A;  3CGA A;  1QXP A;  3LCP C;  4OVN F;  1XA5 A;  3NSL A;  1DJX A;  1NCZ A;  1CDP A;  1UHI A;  5HKZ A;  1DVI A;  2EGD A;  3DF0 A;  5ER4 X;  2EC6 C;  4PT1 A;  1SNL A;  1FF1 A;  3O4X A;  1IRJ A;  3VRQ A;  2KSP A;  2WND A;  3B87 A;  3D0Y A;  2AMI A;  1G33 A;  5AAN A;  2NCP A;  1CFD A;  2P71 A;  3S0G A;  4QJ5 B;  3GK2 A;  3NXA A;  1BLQ A;  3PFV A;  1CLL A;  1PAL A;  2COL B;  5HKW A;  4C0K A;  1MXL C;  1IWQ A;  3R72 A;  2WCM A;  2ISD A;  1IQ3 A;  1RWY A;  5G08 A;  1KFU L;  3O78 A;  3PSR A;  1WY9 A;  1K90 D;  3OB1 B;  1TIZ A;  2LV7 A;  3RZS A;  1XO5 A;  5I8N A;  3BJH A;  1UP5 A;  1F54 A;  4QJ4 B;  3HCM A; 
#chains in the Genus database with same CATH homology
 1ODB A;  2K7C A;  2CTN A;  3OX6 A;  1IG5 A;  1J7Q A;  1WLM A;  2B1U A;  2SCP A;  4CLN A;  1A03 A;  2BBN A;  2LNK A;  1RTP 1;  3I5I C;  2OS8 C;  3JTD B;  4AQJ A;  1J55 A;  4YGB B;  2ZNE A;  4MN0 A;  4PHN A;  2M49 B;  1CMG A;  1A75 B;  1NUB A;  1DJY A;  1MXE A;  2ZFD A;  3VRN A;  5B8I B;  5TNC A;  1NCY A;  5D69 A;  3BOW A;  1K8U A;  1KK7 Z;  3DF0 B;  2K7O A;  3CR4 X;  1CB1 A;  2JC2 A;  1SY9 A;  4N1G A;  4YBH B;  2BL0 B;  4AOM A;  2L4I A;  4GBA A;  5KTY A;  3D0Y B;  1JUO A;  2LVV A;  2PRU A;  4PE1 A;  1TCF A;  1VRK A;  2VRG A;  3CWG A;  2KFH A;  1BOC A;  4NDB A;  1K9K A;  1S6J A;  1WDC C;  2LLT A;  3LK0 A;  1A29 A;  4L9M A;  2KYC A;  1PK0 D;  2CXJ A;  1LKJ A;  1AJ4 A;  2FOT A;  4YI8 A;  2M9G A;  4I5N B;  1AK8 A;  4NQG A;  3D10 A;  3H4S E;  2GGZ A;  2LE9 B;  1H4B A;  2NZ0 A;  3I5H C;  2O60 A;  1XFU O;  3SG2 A;  1TNX A;  4A4B A;  2H61 A;  4M2P A;  1TRF A;  2JUL A;  2CBL A;  2LMV A;  1QLS A;  2HQ8 A;  4R1E A;  4TNC A;  4BY5 A;  1CLB A;  5HLO A;  1GGW A;  1SR6 C;  3PLF B;  3EKH A;  1M45 A;  2JTT A;  3I5F C;  1JFK A;  1F4Q A;  3SG4 A;  1AJ5 A;  4JWQ A;  1WRZ A;  1ZUZ A;  1GGZ A;  2OTG B;  1DF0 A;  2NXQ A;  3CTN A;  2KDH A;  2K61 A;  2KYF A;  4N1F A;  2Y1M A;  1SRA A;  3PAT A;  1ALW A;  1IQ5 A;  2FCE A;  4NDD A;  1N0Y A;  2K7B A;  1SL7 A;  2FJU B;  2ZRS A;  3BOW B;  2D8N A;  1SL8 A;  2L5X B;  4MZL A;  1U5I A;  1K96 A;  2WOR A;  3JVT B;  5PAL A;  4OV2 A;  3SG6 A;  3SJS A;  1YRT B;  4I5J A;  2E6W A;  4OKH A;  1PVA A;  2OPO A;  1A4P A;  1YR5 A;  2Y5I A;  3E3R A;  3FWB A;  4QJ3 B;  4M2O A;  4PHJ A;  3SIA A;  1SBJ A;  4MLW A;  1Q80 A;  1C7V A;  3PN7 B;  3C1V A;  2HET A;  1SK6 D;  5CSF A;  1RJV A;  5GQQ C;  1BU3 A;  3TZ1 A;  2KI4 B;  1B9A A;  1W7I B;  1TNQ A;  2KI6 D;  2MLF C;  2PVB A;  5I2Q A;  1QX7 A;  2JT0 A;  2LCP A;  2WCF A;  1QV1 A;  1YRU B;  5ER5 A;  2JWW A;  1MQ1 A;  5DKN A;  1F4O A;  4PHM A;  1R6P A;  1EG3 A;  4HRE E;  4WRI A;  2A4J A;  1RRO A;  1KQM B;  4DUQ A;  4YRU A;  4C0J A;  4P5O E;  2LMU A;  5K89 A;  1LA3 A;  4XJK A;  4GPL B;  1DF0 B;  1SPY A;  1QLK A;  1XYD A;  2I18 A;  4GGF A;  4OR9 B;  2HQW A;  1NYA A;  3EK7 A;  1NSH A;  4GUK A;  3TS5 B;  1UUR A;  4OCI A;  3A4U B;  3BUN B;  1TNP A;  3DVM A;  1U5I B;  3DD4 A;  1L2O B;  2MHH A;  1BMO A;  2I2R E;  2LP3 A;  3OP0 A;  1E8A A;  2JZI A;  2BE4 A;  1NX3 A;  1TNW A;  1A2X A;  2K7D A;  1KQV A;  1YX7 A;  1YUR A;  3RM1 A;  2M1U A;  2L50 A;  3PAL A;  1LXF C;  1WRL A;  1L7Z A;  2LVJ A;  4C0L A;  2LM5 A;  1HQV A;  1YUT A;  5AEQ A;  1KFX L;  1QTX A;  3DVJ A;  1V1G A;  4UPG A;  1EH2 A;  1ZMZ A;  1KWO B;  2O5G A;  2MRD A;  4MBE A;  1TTX A;  2JNX A;  1KSM A;  3DVK A;  4GNK B;  4GAO A;  3JTD C;  1GJY A;  5HLV A;  2KQY A;  1DJW A;  2L2E A;  2L51 A;  1B8R A;  3LLE A;  1G4Y R;  3VRP A;  2JQ6 A;  1YVH A;  2BCX A;  3TUY B;  4ORA B;  2PAS A;  4I5L B;  3IF7 A;  1SW8 A;  4GGF C;  1KFX S;  3O6B A;  3A8R A;  4XJK B;  2RGI A;  1REC A;  2L0P A;  1LA0 A;  1WRK A;  5FYX A;  1F8H A;  1XFZ O;  4FTG A;  2BL0 C;  1QV0 A;  5I2L A;  3SG5 A;  2V53 A;  5CSN A;  1PRW A;  3LL8 B;  1N2D A;  2LP2 A;  2M8U A;  3AAJ A;  1OMD A;  4MZJ A;  4U8D A;  1YVL A;  4ZCU A;  3VRR A;  1EG4 A;  1SMG A;  1MUX A;  1RFJ A;  1CTR A;  4F0Z B;  1IJ6 A;  2DOQ A;  1PUL A;  1XVJ A;  2ZND A;  5JJG A;  1BR4 B;  2P6B B;  1F71 A;  2JT3 A;  1YUU A;  2KFG A;  3OX5 A;  3M0W A;  1CNP A;  4MZK A;  2F3Z A;  1UHK A;  5D7F A;  5BPJ A;  1XFY O;  2MJW B;  3K21 A;  1MHO A;  1GQM A;  4Q04 A;  1UUS A;  3I5G B;  4HSZ A;  4E68 A;  1KK8 B;  1DJH A;  2KFF A;  1IJ5 A;  4ORB B;  1QX2 A;  2BCB A;  5CSI A;  4YGE B;  3ZNI A;  1OMV A;  1CMF A;  1KK7 Y;  2JNF A;  2OTG C;  1IH0 A;  2Y1N A;  2Y4Q A;  1NP8 A;  4DCK A;  2WC8 A;  1NPQ A;  1FI5 A;  2BEC A;  2PMY A;  4HRG A;  1DGV A;  1WDC B;  3WNX B;  3MSE B;  2BBM A;  1UHN A;  2BKH B;  1J7P A;  4PAL A;  4DS7 A;  1QIW A;  1ZAC A;  1OZO A;  4IL1 A;  1NX0 A;  2BE6 A;  3JVT C;  4ICB A;  4MEW A;  3EVR A;  1PSB A;  5DKQ A;  2Q91 A;  1K9P A;  1OQP A;  4PDZ A;  3O2P A;  1XFW O;  3IQO A;  2LVI A;  2SAS A;  1S5G Z;  3PN7 C;  4NDC A;  3LK1 A;  2KAY A;  4MRX A;  1UWO A;  2MBX A;  2GV5 A;  2H2K A;  3BUM B;  1NX2 A;  1PSR A;  1MR8 A;  2LVK A;  3BYA A;  2KGB C;  2HPS A;  1JWD A;  2KI4 C;  1SKT A;  3GK4 X;  2IS9 A;  2R2I A;  2KNE A;  2H61 C;  3FWC A;  2FCD A;  2CT9 A;  1LIN A;  1ZFS A;  2KI6 C;  1Y1A A;  2ZN9 A;  3TDU A;  5KU1 A;  1KQM C;  1QIV A;  2F33 A;  2E30 A;  2WCB A;  3CLN A;  3NSI A;  1K93 D;  3TDI A;  1NCX A;  4PE7 A;  1N65 A;  2LUC A;  1KCY A;  1NX1 A;  2Q4U A;  3TS5 C;  1B7T Z;  4DIR A;  1NWD A;  4PCW A;  4CFQ A;  2JRF A;  3DVE A;  1UHJ A;  1L2O C;  3OB2 B;  1Y1U A;  1JF2 A;  1AP4 A;  5CPV A;  4YGD B;  3WHT B;  3HX4 A;  2F8P A;  1OE9 B;  1AHR A;  2TN4 A;  1XFX O;  3QRX A;  2LAP A;  2LHL A;  4YI9 A;  1B8L A;  1EJ3 A;  3FIA A;  4N5X A;  1K94 A;  3WXA A;  3GK1 A;  3GOF A;  1SCM B;  5IBW A;  1DJZ A;  1NIW A;  1DTL A;  1KWO C;  3CR2 A;  3EVV A;  1DGU A;  4CFR A;  1Y0V H;  2ZRT A;  3SG3 A;  2M1K B;  2MLE C;  2ZKM X;  2M7N A;  1S1E A;  1TN4 A;  2EC6 B;  3SG7 A;  1F55 A;  2NLN A;  1J7O A;  4FQO A;  1CM4 A;  2LUX A;  1JFJ A;  2K0J A;  2QAC A;  1B7T Y;  2M3W A;  1DMO A;  2F3Y A;  1IGV A;  3TUY C;  2L4H A;  4MRY A;  1M63 B;  1PVB A;  1QJT A;  1CLM A;  3BXK A;  3PM8 A;  1FPW A;  4A4C A;  1UHH A;  2G2B A;  5AER A;  1H8B A;  2NCO A;  4BY4 A;  1BR1 B;  2M7L A;  1QS7 A;  1CDN A;  3CS1 A;  2CNP A;  4HRH A;  2CCM A;  2M29 A;  1YUS A;  4CID A;  4DRW A;  2KOT A;  4PE0 A;  1J1D A;  1QX5 B;  4D1E A;  1CDL A;  1OMR A;  1KSO A;  2BCA A;  1JSA A;  4CPV A;  2I7A A;  5AFP A;  1J7R A;  1S3P A;  1AUI B;  1CM1 A;  1XK4 A;  2HF5 A;  3ICB A;  1EXR A;  2AAO A;  3ZWH A;  2KGR A;  1CDM A;  4WQ2 A;  3I5I B;  2OS8 B;  3NSK A;  5F6T A;  3SIB A;  1SL9 A;  3AAK A;  4M2Q A;  1ZOT B;  2ZN8 A;  1RK9 A;  3NSO A;  1BJF A;  1DJI A;  1KFU S;  4GGN A;  1EL4 A;  3CR5 X;  2F2O A;  3KEV A;  1QAS A;  2MA2 A;  3I5G C;  2I94 A;  1Y6W A;  1KK8 C;  4PE4 A;  1Y1X A;  1OZS A;  5KSZ A;  2LC5 A;  1S26 D;  1F70 A;  1FBV A;  4WQ3 A;  2PAL A;  2LLU A;  2LAN A;  3O4Y A;  4YGC B;  4MVF A;  3RLZ A;  4AQI A;  3KPX A;  5DKR A;  1CFF A;  2GGM A;  5HKY A;  2KHN A;  4GFT A;  2JU0 A;  1S6I A;  3BQ3 A;  3FS7 A;  5AXI A;  3AKA A;  2M0R A;  2M97 A;  1K2H A;  3AKB A;  1OSA A;  3TDZ A;  1S36 A;  2JXL A;  1XFV O;  2LMT A;  3WHU B;  1C07 A;  1QVI Z;  1DJG A;  1TCO B;  2QPT A;  2KAX A;  3BUW B;  1BOD A;  2JXC A;  3CZT X;  3I5H B;  1S6C A;  3BUX B;  2JTZ A;  3IQQ A;  1M39 A;  2WOS A;  2K8M B;  1K9U A;  1XK4 C;  2JOJ A;  2WCE A;  1B47 A;  3BUO B;  5CSJ A;  2LHI A;  3EK4 A;  1HT9 A;  1J1E A;  1SR6 B;  1YX8 A;  2K2A A;  4ETO A;  2G9B A;  3I5F B;  1D1O A;  3EK8 A;  1X02 A;  1W7J B;  4ORC B;  1B8C A;  4PHK A;  1CFP A;  1M46 A;  1QAT A;  1SYM A;  3VGO A;  3KHE A;  2KQ6 A;  4JPZ B;  1BT6 A;  1LVC D;  2JPT A;  2BKI B;  2LLS A;  3F45 A;  2EHB A;  1B1G A;  5I2O A;  1DT7 B;  1CFC A;  2JT8 A;  2KBM A;  1TOP A;  4MSP A;  1BG1 A;  1V1F A;  1K95 A;  1FW4 A;  1MF8 B;  1QVI Y;  1WLZ A;  1M31 A;  1JF0 A;  2KAV A;  2KBI A;  4P2Y B;  2MAZ A;  1R2U A;  3EVU A;  1C7W A;  3OHM B;  1JBA A;  3KF9 A;  1OOJ A;  1FI6 A;  4USL A;  1AVS A;  4XYN A;  1IKU A;  2PSR A;  4I5K A;  2AUC A;  4JQ0 D;  1G8I A;  2L98 A;  1S5G Y;  1CKK A;  1BF5 A;  3VRO A;  3EKJ A;  5HYD A;  3KO0 A;  1JC2 A;  2F2P A;  2K2F A;  1SCV A;  1MWN A;  5JOL A;  4YGA A;  4ZCV A;  1YTZ C;  1A75 A;  1SCM C;  5J3X A;  1B4C A;  1ALV A;  3CGA A;  1QXP A;  3LCP C;  4OVN F;  1XA5 A;  3NSL A;  1DJX A;  1NCZ A;  1CDP A;  1UHI A;  5HKZ A;  1DVI A;  2EGD A;  3DF0 A;  5ER4 X;  2EC6 C;  1FF1 A;  1SNL A;  1IRJ A;  3VRQ A;  2KSP A;  2WND A;  3D0Y A;  2AMI A;  1G33 A;  5AAN A;  2NCP A;  1CFD A;  4QJ5 B;  3GK2 A;  3NXA A;  1BLQ A;  3PFV A;  1CLL A;  1PAL A;  2COL B;  5HKW A;  4C0K A;  1MXL C;  1IWQ A;  2ISD A;  1IQ3 A;  1RWY A;  5G08 A;  1KFU L;  3O78 A;  3PSR A;  1WY9 A;  1K90 D;  3OB1 B;  1TIZ A;  2LV7 A;  1XO5 A;  5I8N A;  1F54 A;  1UP5 A;  4QJ4 B;  3HCM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...