2M29A

Nmr structure of ca2+ bound cabp4 n-domain
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
72
structure length
72
Chain Sequence
RELGPEELEELQAAFEEFDTDQDGYIGYRELGDCMRTLGYMPTEMELLEVSQHVKMRMGGFVDFEEFVELIS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Metal binding protein
molecule keywords Calcium-binding protein 4
publication title Chemical shift assignment of Ca2+ bound CaPB4
rcsb
source organism Mus musculus
total genus 15
structure length 72
sequence length 72
ec nomenclature
pdb deposition date 2012-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2m29A00
4C0KA 1PVBA 1EXRA 1HT9A 1NPQA 1K2HA 2G9BA 2KOTA 2JXLA 1L2OC 3VGOA 1UHKA 4DIRA 4PHJA 1CTRA 3F45A 1DGUA 3TDIA 1IKUA 2KGRA 5CSNA 1X02A 2HQ8A 3CGAA 2JT3A 3CR5X 3NSOA 2Q4UA 5GQQC 2M1KB 2HQWA 1UHJA 1MXLC 1CM1A 4PE7A 1MHOA 2M9GA 2NXQA 5KU1A 2A4JA 3ZNIA 1DJIA 2GGZA 4YGAA 4QJ5B 1ZUZA 1F70A 1R6PA 1F55A 1XFYO 1TTXA 4L9MA 3SIAA 1S6JA 3DVJA 3D0YA 3IF7A 1TCOB 2JQ6A 2LLUA 2RGIA 4ZCUA 2DOQA 4UPGA 2ZN9A 4DRWA 1A2XA 1DGVA 1J1DA 1SMGA 3OP0A 5I2OA 3BOWA 3I5IB 2L51A 1BR4B 5CSJA 2H61C 2HF5A 1KFUL 2K7DA 2FCEA 1K90D 2M3WA 3PN7B 3TDUA 1Q80A 2K61A 2BKHB 2MBXA 2LE9B 4I5LB 1IG5A 1S36A 1CNPA 4DUQA 4AOMA 3DF0A 1B7TY 1WRLA 1EJ3A 1ZFSA 2MAZA 1TNPA 2NZ0A 3JVTB 1BG1A 1SL9A 2FOTA 3HCMA 1KK7Z 1YX7A 4YI9A 1DF0A 3WNXB 3AKBA 1QVIZ 1S26D 3RM1A 2GV5A 2PVBA 2WORA 4N1FA 3ZWHA 1TRFA 1WY9A 4HREE 5DKRA 1QASA 2AMIA 1A75B 4E68A 1QIVA 2CXJA 1AHRA 1OQPA 2JU0A 2KI4B 3GK1A 3TS5B 2M0RA 1M31A 1YR5A 2BBNA 1PSRA 2LHLA 3I5IC 4GBAA 4N1GA 2M49B 4ORAB 2L0PA 3SG2A 1ALVA 1ZOTB 3TUYC 1A03A 5IBWA 1B9AA 2K2FA 4MZKA 2LANA 3IQQA 1SK6D 1PSBA 1SCVA 1J7QA 1CDMA 1QXPA 3M0WA 1CDNA 3BXKA 1Y1AA 3CR4X 4OCIA 2KQ6A 2KBMA 4YGEB 3I5GB 2OTGB 3I5HC 3BOWB 3WHTB 1OZOA 4OR9B 2OPOA 4XJKA 1XFWO 1SR6B 2FCDA 2G2BA 1YVHA 4CFRA 1NUBA 4USLA 1MQ1A 2KI4C 1XYDA 1FI6A 2L5XB 4MBEA 3GOFA 1NSHA 4MEWA 1OMRA 3K21A 5HYDA 2BCXA 2JXCA 2KFGA 3HX4A 2NCPA 3EVUA 2WCFA 2LUCA 1Y1UA 2LMTA 1IRJA 3DVKA 3PSRA 1RROA 1BT6A 1G8IA 2GGMA 2LUXA 2K7OA 1B47A 1BMOA 1Y6WA 4CPVA 1AVSA 5JJGA 4AQIA 5HKZA 1JUOA 3I5GC 1TIZA 1KFUS 2ZNDA 1NX0A 3NXAA 1G33A 4C0LA 4GAOA 1CKKA 1F54A 3JTDC 1EH2A 1KQVA 2KQYA 2LMUA 4JQ0D 4PHMA 2LAPA 1K94A 4WQ2A 1S3PA 1QX7A 4Q04A 1PALA 1DJHA 2H61A 1D1OA 2LHIA 2O5GA 2ZRTA 3AKAA 2LMVA 1RK9A 4IL1A 5D7FA 2CNPA 1RTP1 4AQJA 1K8UA 2EC6B 1QIWA 4GFTA 1K9PA 2QPTA 4CLNA 2JWWA 2KHNA 1S1EA 2MA2A 1YVLA 1MF8B 4I5NB 3EKJA 3IQOA 1KK7Y 4ZCVA 1J7PA 3BUMB 1GGWA 4XJKB 1JF2A 5HLVA 1TOPA 1H8BA 2SASA 1SKTA 4P2YB 1TNWA 1BODA 3H4SE 3O6BA 2H2KA 2WCEA 3SG7A 3KHEA 3RLZA 1DTLA 1N0YA 1AUIB 5JOLA 3NSIA 1M63B 1XFUO 3VRQA 3MSEB 4CFQA 4GPLB 1A4PA 1NCXA 3SG4A 4JWQA 2M29A 3C1VA 2NCOA 2PMYA 1XFZO 2V53A 2ZNEA 2ISDA 1YTZC 1SPYA 1KSOA 2LVKA 1CB1A 1E8AA 4A4CA 4MRYA 2KAVA 1JSAA 3BUXB 2P6BB 5B8IB 1DJXA 4QJ4B 2LC5A 4MLWA 2KGBC 1M39A 1YRTB 1UHNA 1M46A 1BJFA 4NQGA 4BY5A 3KF9A 2KSPA 4HSZA 1WDCB 5G08A 5J3XA 2JULA 4C0JA 1XVJA 1DJZA 1QV0A 1V1FA 2BL0B 2HPSA 3O2PA 4MZJA 1OOJA 1N2DA 5F6TA 4FQOA 3VROA 4DCKA 4GGFC 4WQ3A 1XFXO 1YUTA 4MSPA 1OMVA 1G4YR 1BF5A 1A29A 5TNCA 1GGZA 1RWYA 1VRKA 1AJ5A 2BBMA 2B1UA 3LK1A 2CTNA 4PE1A 3O4YA 4ORCB 2TN4A 5I2QA 1GJYA 1CFDA 2K7CA 3A4UB 2MLFC 5AEQA 3CWGA 1BU3A 1J55A 3BUWB 1WDCC 1CLLA 3CLNA 3PN7C 1JWDA 1RJVA 1AK8A 2M1UA 1UHIA 2BL0C 3PALA 3VRNA 1KK8B 3CS1A 2MLEC 5CSFA 1PK0D 4NDCA 1JC2A 1V1GA 3JVTC 3NSKA 2KI6D 3SG6A 2F8PA 1F8HA 1FBVA 2M97A 2JNFA 1B8CA 3D0YB 3EVRA 2F33A 3PFVA 1SRAA 4M2QA 4F0ZB 1WLZA 2BKIB 1F4OA 3SIBA 3DVEA 2L50A 1WRKA 4PHKA 5AANA 2M7NA 1M45A 2MHHA 2Y1MA 3SJSA 2KNEA 3TS5C 1OMDA 3I5FB 5K89A 3VRRA 3DF0B 5KTYA 2ZKMX 1DMOA 1K95A 1YURA 1NP8A 2LP2A 1YRUB 3ICBA 2F2OA 2MJWB 1DF0B 2Y1NA 1KK8C 1OE9B 1U5IA 2WOSA 2KYFA 1KFXL 4U8DA 2LVIA 1S5GZ 3EKHA 1PULA 1C07A 1UUSA 2SCPA 3DVMA 3OX5A 4QJ3B 2NLNA 1TNXA 2PALA 2QACA 1MUXA 2PSRA 4MVFA 4ETOA 3SG5A 3LL8B 3GK4X 3KPXA 4D1EA 2PASA 1SY9A 2OTGC 3O78A 5DKNA 1LINA 2KI6C 2EHBA 2LP3A 1CFFA 4OKHA 4JPZB 1SR6C 2JT8A 2K2AA 3LCPC 1DT7B 2F2PA 1K9KA 2L4HA 2F3YA 1K96A 3I5FC 5I2LA 1H4BA 4FTGA 1F4QA 5D69A 2K7BA 4GNKB 1L2OB 3BYAA 1BOCA 3AAKA 5DKQA 2JTTA 4MZLA 1K9UA 1NWDA 4YBHB 4P5OE 1IQ5A 3CZTX 2MRDA 5BPJA 2L4IA 4YI8A 1QX2A 1QVIY 1GQMA 3WHUB 1DJGA 1NX1A 2LNKA 4WRIA 3FWBA 2CT9A 3OHMB 5PALA 1HQVA 4A4BA 3OB2B 1LVCD 2JZIA 3PM8A 2BE6A 5HKYA 1QATA 3OB1B 4GUKA 1SCMB 1DJWA 2K8MB 1KQMB 1XK4C 1IH0A 3GK2A 5AXIA 1C7WA 1SNLA 1UP5A 4BY4A 4M2OA 1RECA 1SL8A 1YUUA 3FIAA 1F71A 2EC6C 3NSLA 1FW4A 3FWCA 5FYXA 1B8LA 4YGDB 4YGBB 4OV2A 1W7JB 4MRXA 2JPTA 2IS9A 4M2PA 1NIWA 1CLBA 4PDZA 1NCYA 1Y1XA 1CFPA 5CPVA 2D8NA 2Y4QA 5I8NA 1J1EA 1IGVA 1J7OA 1A75A 1IQ3A 5ER5A 5ER4X 3EVVA 1XO5A 1KSMA 1KFXS 1NCZA 1SCMC 3D10A 1KWOB 2AUCA 1KQMC 2KBIA 1CDLA 1RFJA 3EK7A 4HRHA 1LA3A 4PE0A 2KYCA 2BCAA 5CSIA 3QRXA 2E30A 3FS7A 2BECA 1UWOA 2AAOA 1XA5A 3PATA 1FI5A 1LXFC 1S5GY 3TZ1A 4PE4A 1SW8A 5KSZA 1B1GA 1B8RA 1AJ4A 5HLOA 3AAJA 1IWQA 1CM4A 4ICBA 2LV7A 3TUYB 4GGNA 2JOJA 2OS8B 2FJUB 4MN0A 1JFJA 3EK4A 3BQ3A 1L7ZA 4YGCB 4XYNA 5HKWA 4I5KA 4ORBB 2JNXA 2L2EA 2VRGA 1KWOC 2LM5A 3BUNB 1ZACA 1IJ5A 3WXAA 1BR1B 1S6IA 1CDPA 1UHHA 5AERA 2COLB 3TDZA 2KFFA 2JT0A 2WC8A 1YX8A 1SBJA 2CBLA 3I5HB 3KEVA 1TN4A 1QX5B 2I94A 1MR8A 1TCFA 1SL7A 2CCMA 3VRPA 3KO0A 2EGDA 2LVVA 1QS7A 1KCYA 3BUOB 3OX6A 2PRUA 2OS8C 1OSAA 2WCBA 3CR2A 1XK4A 1ZMZA 4NDDA 4YRUA 1BLQA 3E3RA 2I7AA 2ZRSA 4PHNA 1YUSA 1EG3A 2K0JA 1QTXA 1R2UA 1DJYA 1OZSA 4HRGA 2KAXA 1QLKA 2I18A 1B4CA 1PVAA 1FPWA 2JC2A 3JTDB 1J7RA 1N65A 1NYAA 2O60A 1JFKA 4CIDA 1FF1A 1QJTA 3PLFB 4N5XA 1QLSA 1EL4A 1DVIA 1NX2A 1B7TZ 1WRZA 1TNQA 1EG4A 4PCWA 5AFPA 1CLMA 2E6WA 2ZN8A 1JBAA 2LVJA 1SYMA 1ODBA 1MWNA 4I5JA 4GGFA 1UURA 4PALA 2M8UA 2JRFA 2L98A 3EK8A 3SG3A 1AP4A 2I2RE 1XFVO 3CTNA 4R1EA 4DS7A 2ZFDA 2F3ZA 2Y5IA 2BE4A 1WLMA 2KAYA 1NX3A 2WNDA 3A8RA 3DD4A 1CFCA 1PRWA 2R2IA 2Q91A 2LLTA 2JTZA 1LKJA 4OVNF 3LK0A 1C7VA 1MXEA 1ALWA 2HETA 2LLSA 3LLEA 1CMFA 2LCPA 1K93D 1QV1A 1W7IB 2M7LA 1Y0VH 2KFHA 1S6CA 4NDBA 1LA0A 4TNCA 1CMGA 1IJ6A 1U5IB 2KDHA 1JF0A 2BCBA
chains in the Genus database with same CATH superfamily
4C0KA 2L5YA 1PVBA 1EXRA 1HT9A 1NPQA 2WCKA 1K2HA 2G9BA 2KOTA 3B7AA 2JXLA 1L2OC 3VGOA 1UHKA 4DIRA 4PHJA 1CTRA 3F45A 1DGUA 3TDIA 1IKUA 3SS3A 2KGRA 5CSNA 1X02A 3D76A 2HQ8A 3CGAA 2KLDA 2JT3A 3CR5X 2QEVA 3NSOA 2Q4UA 3D73A 5GQQC 2M1KB 2HQWA 1UHJA 1MXLC 3R72A 1CM1A 5FI7A 4PE7A 1MHOA 2M9GA 2NXQA 5KU1A 2A4JA 3ZNIA 1DJIA 2GGZA 4YGAA 4QJ5B 1ZUZA 4KYNA 1F70A 1R6PA 1F55A 1XFYO 1TTXA 4L9MA 3SIAA 1S6JA 3DVJA 3D0YA 3IF7A 1TCOB 2JQ6A 2LLUA 2RGIA 3DZTA 1OW4A 2DOQA 3PM2A 4ZCUA 4UPGA 2ZN9A 3BJHA 1A2XA 1DGVA 1J1DA 1SMGA 3OP0A 4DRWA 5I2OA 3S0AA 2QEBA 3BOWA 2L51A 3I5IB 1P28A 1BR4B 5CSJA 2H61C 2HF5A 1KFUL 2K7DA 2FCEA 1K90D 2M3WA 3PN7B 3R1VA 3TDUA 1Q80A 2K61A 2BKHB 2MBXA 2LE9B 3DYEA 4I5LB 1IG5A 1S36A 1CNPA 4DUQA 4AOMA 3DF0A 3K1EA 1B7TY 1WRLA 1EJ3A 1ZFSA 2MAZA 1TNPA 2NZ0A 3JVTB 1BG1A 1SL9A 2H8VA 2FOTA 3HCMA 1KK7Z 1YX7A 4YI9A 1DF0A 3WNXB 3AKBA 1QVIZ 1S26D 3RM1A 3VB1A 2GV5A 2PVBA 2WORA 4N1FA 3ZWHA 2PQLA 1TRFA 1WY9A 2JPOA 4HREE 5DKRA 1QASA 2AMIA 1A75B 4E68A 1QIVA 2CXJA 1AHRA 1OQPA 2JU0A 2KI4B 3GK1A 3TS5B 2M0RA 4F7FA 1M31A 1YR5A 2BBNA 1PSRA 2LHLA 3I5IC 4GBAA 4N1GA 2M49B 1TUZA 2L0PA 2K60A 1ALVA 1ZOTB 3TUYC 1A03A 5IBWA 1B9AA 2K2FA 4MZKA 2LANA 3IQQA 1SK6D 4IJ7A 3OBVA 1PSBA 1SCVA 1J7QA 1CDMA 1QXPA 2FJYA 3M0WA 3N7HA 1CDNA 3BXKA 3S0DA 1Y1AA 3CR4X 2P70A 4OCIA 2KQ6A 1QWVA 2KBMA 4YGEB 3I5GB 2OTGB 2WCJA 3I5HC 3BOWB 3WHTB 1OZOA 4OR9B 2OPOA 3NGVA 4XJKA 1XFWO 1SR6B 3BFHA 2FCDA 2G2BA 1YVHA 4CFRA 1NUBA 4USLA 1MQ1A 2KI4C 1XYDA 1FI6A 2L5XB 4MBEA 3GOFA 1LS8A 1NSHA 3NHIA 4MEWA 5HL1A 1OMRA 3K21A 5HYDA 2BCXA 2JXCA 2KFGA 3HX4A 5D3OA 2NCPA 3EVUA 2WCFA 3R1PA 1OOIX 1DELA 2LUCA 1Y1UA 2LMTA 1IRJA 3DVKA 3PSRA 1RROA 1BT6A 1G8IA 2ERBA 2GGMA 2K7OA 2LUXA 3B87A 1B47A 1BMOA 1Y6WA 3BFBA 4CPVA 1AVSA 5JJGA 4AQIA 5HKZA 1JUOA 3I5GC 1TIZA 1KFUS 2ZNDA 1NX0A 3NXAA 1G33A 4C0LA 4GAOA 1CKKA 1F54A 3JTDC 2BNXA 1EH2A 1KQVA 2KQYA 2LMUA 4JQ0D 4PHMA 2LAPA 1K94A 4WQ2A 1SSEB 1S3PA 1QX7A 4Q04A 1PALA 1DJHA 2H61A 1D1OA 2LHIA 2O5GA 2ZRTA 3AKAA 2LMVA 1RK9A 4IL1A 5D7FA 2CNPA 1RTP1 4AQJA 1K8UA 2EC6B 1QIWA 3SS4A 4GFTA 1C3YA 3D75A 1K9PA 2QPTA 4CLNA 2JWWA 2KHNA 1S1EA 2MA2A 1YVLA 3CYZA 3UNWA 1MF8B 4I5NB 3EKJA 3IQOA 1KK7Y 4ZCVA 1J7PA 3BUMB 1GGWA 4XJKB 1JF2A 5HLVA 3FE9A 1TOPA 1H8BA 2SASA 1SKTA 4P2YB 1TNWA 1TUJA 1BODA 3H4SE 3O6BA 2H2KA 2WCEA 3SG7A 3KHEA 3RLZA 1DTLA 1N0YA 1AUIB 3R1OA 3NSIA 1M63B 1XFUO 5JOLA 3MSEB 3VRQA 4CFQA 4GPLB 1A4PA 1NCXA 3SG4A 4JWQA 2M29A 3C1VA 2NCOA 3B86A 2PMYA 1XFZO 2V53A 2ZNEA 2ISDA 1YTZC 3D74A 1SPYA 1KSOA 2LVKA 1CB1A 1E8AA 4A4CA 4MRYA 2KAVA 1JSAA 3BUXB 2P6BB 5B8IB 1DJXA 4QJ4B 3S0EA 2LC5A 4MLWA 2KGBC 1M39A 1YRTB 1UHNA 3FE6A 1M46A 2KLEA 1BJFA 4NQGA 4BY5A 3KF9A 2KSPA 4HSZA 1WDCB 5G08A 5J3XA 2JULA 4C0JA 1XVJA 3UO9A 1DJZA 1QV0A 1V1FA 2BL0B 2HPSA 3O2PA 4MZJA 1IIOA 1OOJA 1N2DA 5F6TA 4FQOA 3VROA 4DCKA 4GGFC 4WQ3A 1XFXO 1YUTA 4MSPA 1OMVA 1G4YR 1BF5A 1A29A 4ORAB 5TNCA 1GGZA 1RWYA 3D78A 1VRKA 1AJ5A 2BBMA 2B1UA 3LK1A 3RZSA 2CTNA 4PE1A 3O4YA 4ORCB 2TN4A 5I2QA 1GJYA 1CFDA 2GTEA 2K7CA 3A4UB 2MLFC 5AEQA 3CWGA 3EG5B 1ORGA 1BU3A 1J55A 3BUWB 1WDCC 1CLLA 1OOGA 3CLNA 3PN7C 1JWDA 1RJVA 1AK8A 2M1UA 1UHIA 2BL0C 3PALA 5FI6A 3VRNA 1KK8B 3CS1A 2MLEC 5CSFA 1PK0D 4NDCA 1JC2A 1V1GA 3JVTC 3NSKA 2KI6D 3L47A 3SG6A 2F8PA 1F8HA 1FBVA 2M97A 2JNFA 3BFAA 1B8CA 3D0YB 3EVRA 3CDNA 2F33A 3PFVA 1SRAA 4M2QA 4F0ZB 1WLZA 2BKIB 1F4OA 3SIBA 3S0FA 3DVEA 2L50A 1WRKA 4PHKA 5AANA 2M7NA 1M45A 2MHHA 2Y1MA 3SJSA 2KNEA 3S0BA 3TS5C 3SS5A 1OMDA 3I5FB 5K89A 3VRRA 3DF0B 5KTYA 2ZKMX 1DMOA 1K95A 1YURA 1NP8A 2LP2A 1YRUB 3ICBA 2F2OA 2MJWB 1DF0B 2Y1NA 4JKTA 1KK8C 1OE9B 1U5IA 2WOSA 2KYFA 1KFXL 4U8DA 2LVIA 1S5GZ 3EKHA 1PULA 1C07A 1UUSA 2SCPA 3DVMA 3OX5A 4QJ3B 2NLNA 1TNXA 2PALA 2QACA 1MUXA 2PSRA 4MVFA 4ETOA 3SG5A 3LL8B 3GK4X 3KPXA 4D1EA 2PASA 2WCHA 1SY9A 2OTGC 3O78A 4INXA 5DKNA 1LINA 2KI6C 2EHBA 2YGUA 2LP3A 1CFFA 4OKHA 4JPZB 1SR6C 2JT8A 2K2AA 3LCPC 1DT7B 2F2PA 1K9KA 2L4HA 2F3YA 1K96A 3I5FC 5I2LA 1H4BA 3DXLA 4FTGA 1F4QA 5D69A 2K7BA 4GNKB 1L2OB 3BYAA 1BOCA 2KPHA 3AAKA 3PJIA 3QMEA 5DKQA 2JTTA 4MZLA 1K9UA 1NWDA 4YBHB 4P5OE 1IQ5A 1W9ZA 3CZTX 2MRDA 5BPJA 2L4IA 4YI8A 1QX2A 1QVIY 3O4XA 1GQMA 3DY9A 3WHUB 1DJGA 1TWOA 1NX1A 2LNKA 2QDIA 3FWBA 2CT9A 4WRIA 3OHMB 3S0GA 5PALA 1HQVA 4A4BA 3OB2B 1LVCD 2JZIA 3PM8A 2BE6A 5HKYA 1QATA 3OB1B 4OZDA 2PYQA 4GUKA 1SCMB 1Z2CB 1DJWA 2K8MB 1KQMB 1XK4C 1IH0A 3GK2A 5AXIA 1C7WA 1SNLA 1UP5A 1OOHA 4BY4A 4M2OA 1RECA 1SL8A 1YUUA 3FIAA 5DICA 1F71A 2EC6C 3NSLA 1FW4A 3FWCA 3NHTA 5FYXA 1B8LA 4YGDB 3IVTA 4OV2A 1W7JB 4YGBB 5EL2A 3Q8IA 4MRXA 2JPTA 2IS9A 4M2PA 1NIWA 3CZ1A 4PDZA 1CLBA 1NCYA 1Y1XA 1CFPA 5CPVA 2D8NA 2Y4QA 5I8NA 1J1EA 1IGVA 1J7OA 1A75A 4PT1A 1IQ3A 5ER5A 5ER4X 3EVVA 3B6XA 1XO5A 1KSMA 3CABA 1KFXS 1NCZA 1SCMC 3D10A 1T14A 1KWOB 2AUCA 1KQMC 2KBIA 1CDLA 1RFJA 3EK7A 4HRHA 1LA3A 4PE0A 2KYCA 3B88A 2BCAA 5CSIA 3QRXA 2E30A 3FS7A 2BECA 1UWOA 4INWA 5FI2A 2AAOA 1XA5A 3PATA 1FI5A 1LXFC 1S5GY 3TZ1A 4PE4A 1SW8A 5KSZA 2BAPA 1B1GA 1GM0A 1B8RA 3CZ2A 1AJ4A 5HLOA 3AAJA 1IWQA 1CM4A 4ICBA 2LV7A 3TUYB 4GGNA 5I94A 2JOJA 2OS8B 2FJUB 4MN0A 1JFJA 3EK4A 3BQ3A 1L7ZA 4YGCB 4XYNA 5HKWA 4I5KA 4ORBB 2JNXA 2L2EA 2VRGA 2P71A 3SG2A 1KWOC 2LM5A 3BUNB 1ZACA 1IJ5A 3WXAA 1BR1B 1S6IA 1CDPA 1UHHA 4JD9A 5AERA 2COLB 3TDZA 2KFFA 2JT0A 2WC8A 1Z4HA 1YX8A 1SBJA 2CBLA 3I5HB 3KEVA 1TN4A 1QX5B 2I94A 1MR8A 1TCFA 1SL7A 1DEKA 2CCMA 2WCLA 3VRPA 3KO0A 1DC1A 2EGDA 2WCMA 2LVVA 1QS7A 1KCYA 3BUOB 3OX6A 2PRUA 2OS8C 3OGNA 3V2LA 3L4LA 1OSAA 2WCBA 3CR2A 1XK4A 1ZMZA 4NDDA 4YRUA 1BLQA 3E3RA 2I7AA 2ZRSA 4PHNA 1YUSA 1EG3A 2K0JA 1QTXA 1R2UA 1DJYA 1OZSA 4HRGA 2KAXA 1QLKA 2I18A 1B4CA 1PVAA 2QEHA 2JC2A 2WC6A 1FPWA 3JTDB 4FQTA 1J7RA 1N65A 1NYAA 2O60A 1JFKA 4CIDA 1FF1A 1QJTA 3PLFB 3L4AA 4N5XA 1QLSA 1EL4A 1DVIA 1NX2A 1B7TZ 1WRZA 1TNQA 1EG4A 2QEOA 4PCWA 5AFPA 1CLMA 2E6WA 2ZN8A 1C3ZA 1DQEA 1JBAA 2LVJA 1SYMA 1ODBA 1MWNA 4I5JA 4GGFA 1UURA 4PALA 3FE8A 2M8UA 2JRFA 2L98A 3EK8A 3SG3A 1AP4A 2I2RE 1XFVO 3CTNA 4R1EA 4DS7A 2ZFDA 2F3ZA 3CZ0A 2Y5IA 2BE4A 1WLMA 2KAYA 1NX3A 2WNDA 3A8RA 2L2CA 3D77A 3DD4A 1CFCA 1OOFA 1PRWA 2WC5A 2R2IA 2Q91A 2LLTA 2JTZA 1LKJA 1XFRA 4OVNF 3LK0A 1C7VA 1MXEA 1ALWA 2HETA 2LLSA 3LLEA 1CMFA 2LCPA 1K93D 1QV1A 1W7IB 2M7LA 1Y0VH 2KFHA 1S6CA 4NDBA 1LA0A 4TNCA 1CMGA 1IJ6A 1U5IB 2KDHA 1JF0A 2BCBA
chains in the Genus database with same CATH topology
4C0KA 1PVBA 1EXRA 1HT9A 1NPQA 1K2HA 2G9BA 2KOTA 2JXLA 1L2OC 3VGOA 1UHKA 4DIRA 4PHJA 1CTRA 3F45A 1DGUA 3TDIA 1IKUA 2KGRA 5CSNA 1X02A 2HQ8A 3CGAA 2JT3A 3CR5X 3NSOA 2Q4UA 5GQQC 2M1KB 2HQWA 1UHJA 1MXLC 1CM1A 4PE7A 1MHOA 2M9GA 2NXQA 5KU1A 2A4JA 3ZNIA 1DJIA 2GGZA 4YGAA 4QJ5B 1ZUZA 1F70A 1R6PA 1F55A 1XFYO 1TTXA 4L9MA 3SIAA 1S6JA 3DVJA 3D0YA 3IF7A 1TCOB 2JQ6A 2LLUA 2RGIA 4ZCUA 2DOQA 4UPGA 2ZN9A 4DRWA 1A2XA 1DGVA 1J1DA 1SMGA 3OP0A 5I2OA 3BOWA 3I5IB 2L51A 1BR4B 5CSJA 2H61C 2HF5A 1KFUL 2K7DA 2FCEA 1K90D 2M3WA 3PN7B 3TDUA 1Q80A 2K61A 2BKHB 2MBXA 2LE9B 4I5LB 1IG5A 1S36A 1CNPA 4DUQA 4AOMA 3DF0A 1B7TY 1WRLA 1EJ3A 1ZFSA 2MAZA 1TNPA 2NZ0A 3JVTB 1BG1A 1SL9A 2FOTA 3HCMA 1KK7Z 1YX7A 4YI9A 1DF0A 3WNXB 3AKBA 1QVIZ 1S26D 3RM1A 2GV5A 2PVBA 2WORA 4N1FA 3ZWHA 1TRFA 1WY9A 4HREE 5DKRA 1QASA 2AMIA 1A75B 4E68A 1QIVA 2CXJA 1AHRA 1OQPA 2JU0A 2KI4B 3GK1A 3TS5B 2M0RA 1M31A 1YR5A 2BBNA 1PSRA 2LHLA 3I5IC 4GBAA 4N1GA 2M49B 4ORAB 2L0PA 3SG2A 1ALVA 1ZOTB 3TUYC 1A03A 5IBWA 1B9AA 2K2FA 4MZKA 2LANA 3IQQA 1SK6D 1PSBA 1SCVA 1J7QA 1CDMA 1QXPA 3M0WA 1CDNA 3BXKA 1Y1AA 3CR4X 4OCIA 2KQ6A 2KBMA 4YGEB 3I5GB 2OTGB 3I5HC 3BOWB 3WHTB 1OZOA 4OR9B 2OPOA 4XJKA 1XFWO 1SR6B 2FCDA 2G2BA 1YVHA 4CFRA 1NUBA 4USLA 1MQ1A 2KI4C 1XYDA 1FI6A 2L5XB 4MBEA 3GOFA 1NSHA 4MEWA 1OMRA 3K21A 5HYDA 2BCXA 2JXCA 2KFGA 3HX4A 2NCPA 3EVUA 2WCFA 2LUCA 1Y1UA 2LMTA 1IRJA 3DVKA 3PSRA 1RROA 1BT6A 1G8IA 2GGMA 2LUXA 2K7OA 1B47A 1BMOA 1Y6WA 4CPVA 1AVSA 5JJGA 4AQIA 5HKZA 1JUOA 3I5GC 1TIZA 1KFUS 2ZNDA 1NX0A 3NXAA 1G33A 4C0LA 4GAOA 1CKKA 1F54A 3JTDC 1EH2A 1KQVA 2KQYA 2LMUA 4JQ0D 4PHMA 2LAPA 1K94A 4WQ2A 1S3PA 1QX7A 4Q04A 1PALA 1DJHA 2H61A 1D1OA 2LHIA 2O5GA 2ZRTA 3AKAA 2LMVA 1RK9A 4IL1A 5D7FA 2CNPA 1RTP1 4AQJA 1K8UA 2EC6B 1QIWA 4GFTA 1K9PA 2QPTA 4CLNA 2JWWA 2KHNA 1S1EA 2MA2A 1YVLA 1MF8B 4I5NB 3EKJA 3IQOA 1KK7Y 4ZCVA 1J7PA 3BUMB 1GGWA 4XJKB 1JF2A 5HLVA 1TOPA 1H8BA 2SASA 1SKTA 4P2YB 1TNWA 1BODA 3H4SE 3O6BA 2H2KA 2WCEA 3SG7A 3KHEA 3RLZA 1DTLA 1N0YA 1AUIB 5JOLA 3NSIA 1M63B 1XFUO 3VRQA 3MSEB 4CFQA 4GPLB 1A4PA 1NCXA 3SG4A 4JWQA 2M29A 3C1VA 2NCOA 2PMYA 1XFZO 2V53A 2ZNEA 2ISDA 1YTZC 1SPYA 1KSOA 2LVKA 1CB1A 1E8AA 4A4CA 4MRYA 2KAVA 1JSAA 3BUXB 2P6BB 5B8IB 1DJXA 4QJ4B 2LC5A 4MLWA 2KGBC 1M39A 1YRTB 1UHNA 1M46A 1BJFA 4NQGA 4BY5A 3KF9A 2KSPA 4HSZA 1WDCB 5G08A 5J3XA 2JULA 4C0JA 1XVJA 1DJZA 1QV0A 1V1FA 2BL0B 2HPSA 3O2PA 4MZJA 1OOJA 1N2DA 5F6TA 4FQOA 3VROA 4DCKA 4GGFC 4WQ3A 1XFXO 1YUTA 4MSPA 1OMVA 1G4YR 1BF5A 1A29A 5TNCA 1GGZA 1RWYA 1VRKA 1AJ5A 2BBMA 2B1UA 3LK1A 2CTNA 4PE1A 3O4YA 4ORCB 2TN4A 5I2QA 1GJYA 1CFDA 2K7CA 3A4UB 2MLFC 5AEQA 3CWGA 1BU3A 1J55A 3BUWB 1WDCC 1CLLA 3CLNA 3PN7C 1JWDA 1RJVA 1AK8A 2M1UA 1UHIA 2BL0C 3PALA 3VRNA 1KK8B 3CS1A 2MLEC 5CSFA 1PK0D 4NDCA 1JC2A 1V1GA 3JVTC 3NSKA 2KI6D 3SG6A 2F8PA 1F8HA 1FBVA 2M97A 2JNFA 1B8CA 3D0YB 3EVRA 2F33A 3PFVA 1SRAA 4M2QA 4F0ZB 1WLZA 2BKIB 1F4OA 3SIBA 3DVEA 2L50A 1WRKA 4PHKA 5AANA 2M7NA 1M45A 2MHHA 2Y1MA 3SJSA 2KNEA 3TS5C 1OMDA 3I5FB 5K89A 3VRRA 3DF0B 5KTYA 2ZKMX 1DMOA 1K95A 1YURA 1NP8A 2LP2A 1YRUB 3ICBA 2F2OA 2MJWB 1DF0B 2Y1NA 1KK8C 1OE9B 1U5IA 2WOSA 2KYFA 1KFXL 4U8DA 2LVIA 1S5GZ 3EKHA 1PULA 1C07A 1UUSA 2SCPA 3DVMA 3OX5A 4QJ3B 2NLNA 1TNXA 2PALA 2QACA 1MUXA 2PSRA 4MVFA 4ETOA 3SG5A 3LL8B 3GK4X 3KPXA 4D1EA 2PASA 1SY9A 2OTGC 3O78A 5DKNA 1LINA 2KI6C 2EHBA 2LP3A 1CFFA 4OKHA 4JPZB 1SR6C 2JT8A 2K2AA 3LCPC 1DT7B 2F2PA 1K9KA 2L4HA 2F3YA 1K96A 3I5FC 5I2LA 1H4BA 4FTGA 1F4QA 5D69A 2K7BA 4GNKB 1L2OB 3BYAA 1BOCA 3AAKA 5DKQA 2JTTA 4MZLA 1K9UA 1NWDA 4YBHB 4P5OE 1IQ5A 3CZTX 2MRDA 5BPJA 2L4IA 4YI8A 1QX2A 1QVIY 1GQMA 3WHUB 1DJGA 1NX1A 2LNKA 4WRIA 3FWBA 2CT9A 3OHMB 5PALA 1HQVA 4A4BA 3OB2B 1LVCD 2JZIA 3PM8A 2BE6A 5HKYA 1QATA 3OB1B 4GUKA 1SCMB 1DJWA 2K8MB 1KQMB 1XK4C 1IH0A 3GK2A 5AXIA 1C7WA 1SNLA 1UP5A 4BY4A 4M2OA 1RECA 1SL8A 1YUUA 3FIAA 1F71A 2EC6C 3NSLA 1FW4A 3FWCA 5FYXA 1B8LA 4YGDB 4YGBB 4OV2A 1W7JB 4MRXA 2JPTA 2IS9A 4M2PA 1NIWA 1CLBA 4PDZA 1NCYA 1Y1XA 1CFPA 5CPVA 2D8NA 2Y4QA 5I8NA 1J1EA 1IGVA 1J7OA 1A75A 1IQ3A 5ER5A 5ER4X 3EVVA 1XO5A 1KSMA 1KFXS 1NCZA 1SCMC 3D10A 1KWOB 2AUCA 1KQMC 2KBIA 1CDLA 1RFJA 3EK7A 4HRHA 1LA3A 4PE0A 2KYCA 2BCAA 5CSIA 3QRXA 2E30A 3FS7A 2BECA 1UWOA 2AAOA 1XA5A 3PATA 1FI5A 1LXFC 1S5GY 3TZ1A 4PE4A 1SW8A 5KSZA 1B1GA 1B8RA 1AJ4A 5HLOA 3AAJA 1IWQA 1CM4A 4ICBA 2LV7A 3TUYB 4GGNA 2JOJA 2OS8B 2FJUB 4MN0A 1JFJA 3EK4A 3BQ3A 1L7ZA 4YGCB 4XYNA 5HKWA 4I5KA 4ORBB 2JNXA 2L2EA 2VRGA 1KWOC 2LM5A 3BUNB 1ZACA 1IJ5A 3WXAA 1BR1B 1S6IA 1CDPA 1UHHA 5AERA 2COLB 3TDZA 2KFFA 2JT0A 2WC8A 1YX8A 1SBJA 2CBLA 3I5HB 3KEVA 1TN4A 1QX5B 2I94A 1MR8A 1TCFA 1SL7A 2CCMA 3VRPA 3KO0A 2EGDA 2LVVA 1QS7A 1KCYA 3BUOB 3OX6A 2PRUA 2OS8C 1OSAA 2WCBA 3CR2A 1XK4A 1ZMZA 4NDDA 4YRUA 1BLQA 3E3RA 2I7AA 2ZRSA 4PHNA 1YUSA 1EG3A 2K0JA 1QTXA 1R2UA 1DJYA 1OZSA 4HRGA 2KAXA 1QLKA 2I18A 1B4CA 1PVAA 1FPWA 2JC2A 3JTDB 1J7RA 1N65A 1NYAA 2O60A 1JFKA 4CIDA 1FF1A 1QJTA 3PLFB 4N5XA 1QLSA 1EL4A 1DVIA 1NX2A 1B7TZ 1WRZA 1TNQA 1EG4A 4PCWA 5AFPA 1CLMA 2E6WA 2ZN8A 1JBAA 2LVJA 1SYMA 1ODBA 1MWNA 4I5JA 4GGFA 1UURA 4PALA 2M8UA 2JRFA 2L98A 3EK8A 3SG3A 1AP4A 2I2RE 1XFVO 3CTNA 4R1EA 4DS7A 2ZFDA 2F3ZA 2Y5IA 2BE4A 1WLMA 2KAYA 1NX3A 2WNDA 3A8RA 3DD4A 1CFCA 1PRWA 2R2IA 2Q91A 2LLTA 2JTZA 1LKJA 4OVNF 3LK0A 1C7VA 1MXEA 1ALWA 2HETA 2LLSA 3LLEA 1CMFA 2LCPA 1K93D 1QV1A 1W7IB 2M7LA 1Y0VH 2KFHA 1S6CA 4NDBA 1LA0A 4TNCA 1CMGA 1IJ6A 1U5IB 2KDHA 1JF0A 2BCBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4C0K A;  1PVB A;  1EXR A;  1HT9 A;  1NPQ A;  1K2H A;  2G9B A;  2KOT A;  2JXL A;  1L2O C;  3VGO A;  1UHK A;  4DIR A;  4PHJ A;  1CTR A;  3F45 A;  1DGU A;  3TDI A;  1IKU A;  2KGR A;  5CSN A;  1X02 A;  2HQ8 A;  3CGA A;  2JT3 A;  3CR5 X;  3NSO A;  2Q4U A;  5GQQ C;  2M1K B;  2HQW A;  1UHJ A;  1MXL C;  1CM1 A;  4PE7 A;  1MHO A;  2M9G A;  2NXQ A;  5KU1 A;  2A4J A;  3ZNI A;  1DJI A;  2GGZ A;  4YGA A;  4QJ5 B;  1ZUZ A;  1F70 A;  1R6P A;  1F55 A;  1XFY O;  1TTX A;  4L9M A;  3SIA A;  1S6J A;  3DVJ A;  3D0Y A;  3IF7 A;  1TCO B;  2JQ6 A;  2LLU A;  2RGI A;  4ZCU A;  2DOQ A;  4UPG A;  2ZN9 A;  4DRW A;  1A2X A;  1DGV A;  1J1D A;  1SMG A;  3OP0 A;  5I2O A;  3BOW A;  3I5I B;  2L51 A;  1BR4 B;  5CSJ A;  2H61 C;  2HF5 A;  1KFU L;  2K7D A;  2FCE A;  1K90 D;  2M3W A;  3PN7 B;  3TDU A;  1Q80 A;  2K61 A;  2BKH B;  2MBX A;  2LE9 B;  4I5L B;  1IG5 A;  1S36 A;  1CNP A;  4DUQ A;  4AOM A;  3DF0 A;  1B7T Y;  1WRL A;  1EJ3 A;  1ZFS A;  2MAZ A;  1TNP A;  2NZ0 A;  3JVT B;  1BG1 A;  1SL9 A;  2FOT A;  3HCM A;  1KK7 Z;  1YX7 A;  4YI9 A;  1DF0 A;  3WNX B;  3AKB A;  1QVI Z;  1S26 D;  3RM1 A;  2GV5 A;  2PVB A;  2WOR A;  4N1F A;  3ZWH A;  1TRF A;  1WY9 A;  4HRE E;  5DKR A;  1QAS A;  2AMI A;  1A75 B;  4E68 A;  1QIV A;  2CXJ A;  1AHR A;  1OQP A;  2JU0 A;  2KI4 B;  3GK1 A;  3TS5 B;  2M0R A;  1M31 A;  1YR5 A;  2BBN A;  1PSR A;  2LHL A;  3I5I C;  4GBA A;  4N1G A;  2M49 B;  4ORA B;  2L0P A;  3SG2 A;  1ALV A;  1ZOT B;  3TUY C;  1A03 A;  5IBW A;  1B9A A;  2K2F A;  4MZK A;  2LAN A;  3IQQ A;  1SK6 D;  1PSB A;  1SCV A;  1J7Q A;  1CDM A;  1QXP A;  3M0W A;  1CDN A;  3BXK A;  1Y1A A;  3CR4 X;  4OCI A;  2KQ6 A;  2KBM A;  4YGE B;  3I5G B;  2OTG B;  3I5H C;  3BOW B;  3WHT B;  1OZO A;  4OR9 B;  2OPO A;  4XJK A;  1XFW O;  1SR6 B;  2FCD A;  2G2B A;  1YVH A;  4CFR A;  1NUB A;  4USL A;  1MQ1 A;  2KI4 C;  1XYD A;  1FI6 A;  2L5X B;  4MBE A;  3GOF A;  1NSH A;  4MEW A;  1OMR A;  3K21 A;  5HYD A;  2BCX A;  2JXC A;  2KFG A;  3HX4 A;  2NCP A;  3EVU A;  2WCF A;  2LUC A;  1Y1U A;  2LMT A;  1IRJ A;  3DVK A;  3PSR A;  1RRO A;  1BT6 A;  1G8I A;  2GGM A;  2LUX A;  2K7O A;  1B47 A;  1BMO A;  1Y6W A;  4CPV A;  1AVS A;  5JJG A;  4AQI A;  5HKZ A;  1JUO A;  3I5G C;  1TIZ A;  1KFU S;  2ZND A;  1NX0 A;  3NXA A;  1G33 A;  4C0L A;  4GAO A;  1CKK A;  1F54 A;  3JTD C;  1EH2 A;  1KQV A;  2KQY A;  2LMU A;  4JQ0 D;  4PHM A;  2LAP A;  1K94 A;  4WQ2 A;  1S3P A;  1QX7 A;  4Q04 A;  1PAL A;  1DJH A;  2H61 A;  1D1O A;  2LHI A;  2O5G A;  2ZRT A;  3AKA A;  2LMV A;  1RK9 A;  4IL1 A;  5D7F A;  2CNP A;  1RTP 1;  4AQJ A;  1K8U A;  2EC6 B;  1QIW A;  4GFT A;  1K9P A;  2QPT A;  4CLN A;  2JWW A;  2KHN A;  1S1E A;  2MA2 A;  1YVL A;  1MF8 B;  4I5N B;  3EKJ A;  3IQO A;  1KK7 Y;  4ZCV A;  1J7P A;  3BUM B;  1GGW A;  4XJK B;  1JF2 A;  5HLV A;  1TOP A;  1H8B A;  2SAS A;  1SKT A;  4P2Y B;  1TNW A;  1BOD A;  3H4S E;  3O6B A;  2H2K A;  2WCE A;  3SG7 A;  3KHE A;  3RLZ A;  1DTL A;  1N0Y A;  1AUI B;  5JOL A;  3NSI A;  1M63 B;  1XFU O;  3VRQ A;  3MSE B;  4CFQ A;  4GPL B;  1A4P A;  1NCX A;  3SG4 A;  4JWQ A;  2M29 A;  3C1V A;  2NCO A;  2PMY A;  1XFZ O;  2V53 A;  2ZNE A;  2ISD A;  1YTZ C;  1SPY A;  1KSO A;  2LVK A;  1CB1 A;  1E8A A;  4A4C A;  4MRY A;  2KAV A;  1JSA A;  3BUX B;  2P6B B;  5B8I B;  1DJX A;  4QJ4 B;  2LC5 A;  4MLW A;  2KGB C;  1M39 A;  1YRT B;  1UHN A;  1M46 A;  1BJF A;  4NQG A;  4BY5 A;  3KF9 A;  2KSP A;  4HSZ A;  1WDC B;  5G08 A;  5J3X A;  2JUL A;  4C0J A;  1XVJ A;  1DJZ A;  1QV0 A;  1V1F A;  2BL0 B;  2HPS A;  3O2P A;  4MZJ A;  1OOJ A;  1N2D A;  5F6T A;  4FQO A;  3VRO A;  4DCK A;  4GGF C;  4WQ3 A;  1XFX O;  1YUT A;  4MSP A;  1OMV A;  1G4Y R;  1BF5 A;  1A29 A;  5TNC A;  1GGZ A;  1RWY A;  1VRK A;  1AJ5 A;  2BBM A;  2B1U A;  3LK1 A;  2CTN A;  4PE1 A;  3O4Y A;  4ORC B;  2TN4 A;  5I2Q A;  1GJY A;  1CFD A;  2K7C A;  3A4U B;  2MLF C;  5AEQ A;  3CWG A;  1BU3 A;  1J55 A;  3BUW B;  1WDC C;  1CLL A;  3CLN A;  3PN7 C;  1JWD A;  1RJV A;  1AK8 A;  2M1U A;  1UHI A;  2BL0 C;  3PAL A;  3VRN A;  1KK8 B;  3CS1 A;  2MLE C;  5CSF A;  1PK0 D;  4NDC A;  1JC2 A;  1V1G A;  3JVT C;  3NSK A;  2KI6 D;  3SG6 A;  2F8P A;  1F8H A;  1FBV A;  2M97 A;  2JNF A;  1B8C A;  3D0Y B;  3EVR A;  2F33 A;  3PFV A;  1SRA A;  4M2Q A;  4F0Z B;  1WLZ A;  2BKI B;  1F4O A;  3SIB A;  3DVE A;  2L50 A;  1WRK A;  4PHK A;  5AAN A;  2M7N A;  1M45 A;  2MHH A;  2Y1M A;  3SJS A;  2KNE A;  3TS5 C;  1OMD A;  3I5F B;  5K89 A;  3VRR A;  3DF0 B;  5KTY A;  2ZKM X;  1DMO A;  1K95 A;  1YUR A;  1NP8 A;  2LP2 A;  1YRU B;  3ICB A;  2F2O A;  2MJW B;  1DF0 B;  2Y1N A;  1KK8 C;  1OE9 B;  1U5I A;  2WOS A;  2KYF A;  1KFX L;  4U8D A;  2LVI A;  1S5G Z;  3EKH A;  1PUL A;  1C07 A;  1UUS A;  2SCP A;  3DVM A;  3OX5 A;  4QJ3 B;  2NLN A;  1TNX A;  2PAL A;  2QAC A;  1MUX A;  2PSR A;  4MVF A;  4ETO A;  3SG5 A;  3LL8 B;  3GK4 X;  3KPX A;  4D1E A;  2PAS A;  1SY9 A;  2OTG C;  3O78 A;  5DKN A;  1LIN A;  2KI6 C;  2EHB A;  2LP3 A;  1CFF A;  4OKH A;  4JPZ B;  1SR6 C;  2JT8 A;  2K2A A;  3LCP C;  1DT7 B;  2F2P A;  1K9K A;  2L4H A;  2F3Y A;  1K96 A;  3I5F C;  5I2L A;  1H4B A;  4FTG A;  1F4Q A;  5D69 A;  2K7B A;  4GNK B;  1L2O B;  3BYA A;  1BOC A;  3AAK A;  5DKQ A;  2JTT A;  4MZL A;  1K9U A;  1NWD A;  4YBH B;  4P5O E;  1IQ5 A;  3CZT X;  2MRD A;  5BPJ A;  2L4I A;  4YI8 A;  1QX2 A;  1QVI Y;  1GQM A;  3WHU B;  1DJG A;  1NX1 A;  2LNK A;  4WRI A;  3FWB A;  2CT9 A;  3OHM B;  5PAL A;  1HQV A;  4A4B A;  3OB2 B;  1LVC D;  2JZI A;  3PM8 A;  2BE6 A;  5HKY A;  1QAT A;  3OB1 B;  4GUK A;  1SCM B;  1DJW A;  2K8M B;  1KQM B;  1XK4 C;  1IH0 A;  3GK2 A;  5AXI A;  1C7W A;  1SNL A;  1UP5 A;  4BY4 A;  4M2O A;  1REC A;  1SL8 A;  1YUU A;  3FIA A;  1F71 A;  2EC6 C;  3NSL A;  1FW4 A;  3FWC A;  5FYX A;  1B8L A;  4YGD B;  4YGB B;  4OV2 A;  1W7J B;  4MRX A;  2JPT A;  2IS9 A;  4M2P A;  1NIW A;  1CLB A;  4PDZ A;  1NCY A;  1Y1X A;  1CFP A;  5CPV A;  2D8N A;  2Y4Q A;  5I8N A;  1J1E A;  1IGV A;  1J7O A;  1A75 A;  1IQ3 A;  5ER5 A;  5ER4 X;  3EVV A;  1XO5 A;  1KSM A;  1KFX S;  1NCZ A;  1SCM C;  3D10 A;  1KWO B;  2AUC A;  1KQM C;  2KBI A;  1CDL A;  1RFJ A;  3EK7 A;  4HRH A;  1LA3 A;  4PE0 A;  2KYC A;  2BCA A;  5CSI A;  3QRX A;  2E30 A;  3FS7 A;  2BEC A;  1UWO A;  2AAO A;  1XA5 A;  3PAT A;  1FI5 A;  1LXF C;  1S5G Y;  3TZ1 A;  4PE4 A;  1SW8 A;  5KSZ A;  1B1G A;  1B8R A;  1AJ4 A;  5HLO A;  3AAJ A;  1IWQ A;  1CM4 A;  4ICB A;  2LV7 A;  3TUY B;  4GGN A;  2JOJ A;  2OS8 B;  2FJU B;  4MN0 A;  1JFJ A;  3EK4 A;  3BQ3 A;  1L7Z A;  4YGC B;  4XYN A;  5HKW A;  4I5K A;  4ORB B;  2JNX A;  2L2E A;  2VRG A;  1KWO C;  2LM5 A;  3BUN B;  1ZAC A;  1IJ5 A;  3WXA A;  1BR1 B;  1S6I A;  1CDP A;  1UHH A;  5AER A;  2COL B;  3TDZ A;  2KFF A;  2JT0 A;  2WC8 A;  1YX8 A;  1SBJ A;  2CBL A;  3I5H B;  3KEV A;  1TN4 A;  1QX5 B;  2I94 A;  1MR8 A;  1TCF A;  1SL7 A;  2CCM A;  3VRP A;  3KO0 A;  2EGD A;  2LVV A;  1QS7 A;  1KCY A;  3BUO B;  3OX6 A;  2PRU A;  2OS8 C;  1OSA A;  2WCB A;  3CR2 A;  1XK4 A;  1ZMZ A;  4NDD A;  4YRU A;  1BLQ A;  3E3R A;  2I7A A;  2ZRS A;  4PHN A;  1YUS A;  1EG3 A;  2K0J A;  1QTX A;  1R2U A;  1DJY A;  1OZS A;  4HRG A;  2KAX A;  1QLK A;  2I18 A;  1B4C A;  1PVA A;  1FPW A;  2JC2 A;  3JTD B;  1J7R A;  1N65 A;  1NYA A;  2O60 A;  1JFK A;  4CID A;  1FF1 A;  1QJT A;  3PLF B;  4N5X A;  1QLS A;  1EL4 A;  1DVI A;  1NX2 A;  1B7T Z;  1WRZ A;  1TNQ A;  1EG4 A;  4PCW A;  5AFP A;  1CLM A;  2E6W A;  2ZN8 A;  1JBA A;  2LVJ A;  1SYM A;  1ODB A;  1MWN A;  4I5J A;  4GGF A;  1UUR A;  4PAL A;  2M8U A;  2JRF A;  2L98 A;  3EK8 A;  3SG3 A;  1AP4 A;  2I2R E;  1XFV O;  3CTN A;  4R1E A;  4DS7 A;  2ZFD A;  2F3Z A;  2Y5I A;  2BE4 A;  1WLM A;  2KAY A;  1NX3 A;  2WND A;  3A8R A;  3DD4 A;  1CFC A;  1PRW A;  2R2I A;  2Q91 A;  2LLT A;  2JTZ A;  1LKJ A;  4OVN F;  3LK0 A;  1C7V A;  1MXE A;  1ALW A;  2HET A;  2LLS A;  3LLE A;  1CMF A;  2LCP A;  1K93 D;  1QV1 A;  1W7I B;  2M7L A;  1Y0V H;  2KFH A;  1S6C A;  4NDB A;  1LA0 A;  4TNC A;  1CMG A;  1IJ6 A;  1U5I B;  2KDH A;  1JF0 A;  2BCB A; 
#chains in the Genus database with same CATH topology
 4C0K A;  2L5Y A;  1PVB A;  1EXR A;  1HT9 A;  1NPQ A;  2WCK A;  1K2H A;  2G9B A;  2KOT A;  3B7A A;  2JXL A;  1L2O C;  3VGO A;  1UHK A;  4DIR A;  4PHJ A;  1CTR A;  3F45 A;  1DGU A;  3TDI A;  1IKU A;  3SS3 A;  2KGR A;  5CSN A;  1X02 A;  3D76 A;  2HQ8 A;  3CGA A;  2KLD A;  2JT3 A;  3CR5 X;  2QEV A;  3NSO A;  2Q4U A;  3D73 A;  5GQQ C;  2M1K B;  2HQW A;  1UHJ A;  1MXL C;  3R72 A;  1CM1 A;  5FI7 A;  4PE7 A;  1MHO A;  2M9G A;  2NXQ A;  5KU1 A;  2A4J A;  3ZNI A;  1DJI A;  2GGZ A;  4YGA A;  4QJ5 B;  1ZUZ A;  4KYN A;  1F70 A;  1R6P A;  1F55 A;  1XFY O;  1TTX A;  4L9M A;  3SIA A;  1S6J A;  3DVJ A;  3D0Y A;  3IF7 A;  1TCO B;  2JQ6 A;  2LLU A;  2RGI A;  3DZT A;  1OW4 A;  2DOQ A;  3PM2 A;  4ZCU A;  4UPG A;  2ZN9 A;  3BJH A;  1A2X A;  1DGV A;  1J1D A;  1SMG A;  3OP0 A;  4DRW A;  5I2O A;  3S0A A;  2QEB A;  3BOW A;  2L51 A;  3I5I B;  1P28 A;  1BR4 B;  5CSJ A;  2H61 C;  2HF5 A;  1KFU L;  2K7D A;  2FCE A;  1K90 D;  2M3W A;  3PN7 B;  3R1V A;  3TDU A;  1Q80 A;  2K61 A;  2BKH B;  2MBX A;  2LE9 B;  3DYE A;  4I5L B;  1IG5 A;  1S36 A;  1CNP A;  4DUQ A;  4AOM A;  3DF0 A;  3K1E A;  1B7T Y;  1WRL A;  1EJ3 A;  1ZFS A;  2MAZ A;  1TNP A;  2NZ0 A;  3JVT B;  1BG1 A;  1SL9 A;  2H8V A;  2FOT A;  3HCM A;  1KK7 Z;  1YX7 A;  4YI9 A;  1DF0 A;  3WNX B;  3AKB A;  1QVI Z;  1S26 D;  3RM1 A;  3VB1 A;  2GV5 A;  2PVB A;  2WOR A;  4N1F A;  3ZWH A;  2PQL A;  1TRF A;  1WY9 A;  2JPO A;  4HRE E;  5DKR A;  1QAS A;  2AMI A;  1A75 B;  4E68 A;  1QIV A;  2CXJ A;  1AHR A;  1OQP A;  2JU0 A;  2KI4 B;  3GK1 A;  3TS5 B;  2M0R A;  4F7F A;  1M31 A;  1YR5 A;  2BBN A;  1PSR A;  2LHL A;  3I5I C;  4GBA A;  4N1G A;  2M49 B;  1TUZ A;  2L0P A;  2K60 A;  1ALV A;  1ZOT B;  3TUY C;  1A03 A;  5IBW A;  1B9A A;  2K2F A;  4MZK A;  2LAN A;  3IQQ A;  1SK6 D;  4IJ7 A;  3OBV A;  1PSB A;  1SCV A;  1J7Q A;  1CDM A;  1QXP A;  2FJY A;  3M0W A;  3N7H A;  1CDN A;  3BXK A;  3S0D A;  1Y1A A;  3CR4 X;  2P70 A;  4OCI A;  2KQ6 A;  1QWV A;  2KBM A;  4YGE B;  3I5G B;  2OTG B;  2WCJ A;  3I5H C;  3BOW B;  3WHT B;  1OZO A;  4OR9 B;  2OPO A;  3NGV A;  4XJK A;  1XFW O;  1SR6 B;  3BFH A;  2FCD A;  2G2B A;  1YVH A;  4CFR A;  1NUB A;  4USL A;  1MQ1 A;  2KI4 C;  1XYD A;  1FI6 A;  2L5X B;  4MBE A;  3GOF A;  1LS8 A;  1NSH A;  3NHI A;  4MEW A;  5HL1 A;  1OMR A;  3K21 A;  5HYD A;  2BCX A;  2JXC A;  2KFG A;  3HX4 A;  5D3O A;  2NCP A;  3EVU A;  2WCF A;  3R1P A;  1OOI X;  1DEL A;  2LUC A;  1Y1U A;  2LMT A;  1IRJ A;  3DVK A;  3PSR A;  1RRO A;  1BT6 A;  1G8I A;  2ERB A;  2GGM A;  2K7O A;  2LUX A;  3B87 A;  1B47 A;  1BMO A;  1Y6W A;  3BFB A;  4CPV A;  1AVS A;  5JJG A;  4AQI A;  5HKZ A;  1JUO A;  3I5G C;  1TIZ A;  1KFU S;  2ZND A;  1NX0 A;  3NXA A;  1G33 A;  4C0L A;  4GAO A;  1CKK A;  1F54 A;  3JTD C;  2BNX A;  1EH2 A;  1KQV A;  2KQY A;  2LMU A;  4JQ0 D;  4PHM A;  2LAP A;  1K94 A;  4WQ2 A;  1SSE B;  1S3P A;  1QX7 A;  4Q04 A;  1PAL A;  1DJH A;  2H61 A;  1D1O A;  2LHI A;  2O5G A;  2ZRT A;  3AKA A;  2LMV A;  1RK9 A;  4IL1 A;  5D7F A;  2CNP A;  1RTP 1;  4AQJ A;  1K8U A;  2EC6 B;  1QIW A;  3SS4 A;  4GFT A;  1C3Y A;  3D75 A;  1K9P A;  2QPT A;  4CLN A;  2JWW A;  2KHN A;  1S1E A;  2MA2 A;  1YVL A;  3CYZ A;  3UNW A;  1MF8 B;  4I5N B;  3EKJ A;  3IQO A;  1KK7 Y;  4ZCV A;  1J7P A;  3BUM B;  1GGW A;  4XJK B;  1JF2 A;  5HLV A;  3FE9 A;  1TOP A;  1H8B A;  2SAS A;  1SKT A;  4P2Y B;  1TNW A;  1TUJ A;  1BOD A;  3H4S E;  3O6B A;  2H2K A;  2WCE A;  3SG7 A;  3KHE A;  3RLZ A;  1DTL A;  1N0Y A;  1AUI B;  3R1O A;  3NSI A;  1M63 B;  1XFU O;  5JOL A;  3MSE B;  3VRQ A;  4CFQ A;  4GPL B;  1A4P A;  1NCX A;  3SG4 A;  4JWQ A;  2M29 A;  3C1V A;  2NCO A;  3B86 A;  2PMY A;  1XFZ O;  2V53 A;  2ZNE A;  2ISD A;  1YTZ C;  3D74 A;  1SPY A;  1KSO A;  2LVK A;  1CB1 A;  1E8A A;  4A4C A;  4MRY A;  2KAV A;  1JSA A;  3BUX B;  2P6B B;  5B8I B;  1DJX A;  4QJ4 B;  3S0E A;  2LC5 A;  4MLW A;  2KGB C;  1M39 A;  1YRT B;  1UHN A;  3FE6 A;  1M46 A;  2KLE A;  1BJF A;  4NQG A;  4BY5 A;  3KF9 A;  2KSP A;  4HSZ A;  1WDC B;  5G08 A;  5J3X A;  2JUL A;  4C0J A;  1XVJ A;  3UO9 A;  1DJZ A;  1QV0 A;  1V1F A;  2BL0 B;  2HPS A;  3O2P A;  4MZJ A;  1IIO A;  1OOJ A;  1N2D A;  5F6T A;  4FQO A;  3VRO A;  4DCK A;  4GGF C;  4WQ3 A;  1XFX O;  1YUT A;  4MSP A;  1OMV A;  1G4Y R;  1BF5 A;  1A29 A;  4ORA B;  5TNC A;  1GGZ A;  1RWY A;  3D78 A;  1VRK A;  1AJ5 A;  2BBM A;  2B1U A;  3LK1 A;  3RZS A;  2CTN A;  4PE1 A;  3O4Y A;  4ORC B;  2TN4 A;  5I2Q A;  1GJY A;  1CFD A;  2GTE A;  2K7C A;  3A4U B;  2MLF C;  5AEQ A;  3CWG A;  3EG5 B;  1ORG A;  1BU3 A;  1J55 A;  3BUW B;  1WDC C;  1CLL A;  1OOG A;  3CLN A;  3PN7 C;  1JWD A;  1RJV A;  1AK8 A;  2M1U A;  1UHI A;  2BL0 C;  3PAL A;  5FI6 A;  3VRN A;  1KK8 B;  3CS1 A;  2MLE C;  5CSF A;  1PK0 D;  4NDC A;  1JC2 A;  1V1G A;  3JVT C;  3NSK A;  2KI6 D;  3L47 A;  3SG6 A;  2F8P A;  1F8H A;  1FBV A;  2M97 A;  2JNF A;  3BFA A;  1B8C A;  3D0Y B;  3EVR A;  3CDN A;  2F33 A;  3PFV A;  1SRA A;  4M2Q A;  4F0Z B;  1WLZ A;  2BKI B;  1F4O A;  3SIB A;  3S0F A;  3DVE A;  2L50 A;  1WRK A;  4PHK A;  5AAN A;  2M7N A;  1M45 A;  2MHH A;  2Y1M A;  3SJS A;  2KNE A;  3S0B A;  3TS5 C;  3SS5 A;  1OMD A;  3I5F B;  5K89 A;  3VRR A;  3DF0 B;  5KTY A;  2ZKM X;  1DMO A;  1K95 A;  1YUR A;  1NP8 A;  2LP2 A;  1YRU B;  3ICB A;  2F2O A;  2MJW B;  1DF0 B;  2Y1N A;  4JKT A;  1KK8 C;  1OE9 B;  1U5I A;  2WOS A;  2KYF A;  1KFX L;  4U8D A;  2LVI A;  1S5G Z;  3EKH A;  1PUL A;  1C07 A;  1UUS A;  2SCP A;  3DVM A;  3OX5 A;  4QJ3 B;  2NLN A;  1TNX A;  2PAL A;  2QAC A;  1MUX A;  2PSR A;  4MVF A;  4ETO A;  3SG5 A;  3LL8 B;  3GK4 X;  3KPX A;  4D1E A;  2PAS A;  2WCH A;  1SY9 A;  2OTG C;  3O78 A;  4INX A;  5DKN A;  1LIN A;  2KI6 C;  2EHB A;  2YGU A;  2LP3 A;  1CFF A;  4OKH A;  4JPZ B;  1SR6 C;  2JT8 A;  2K2A A;  3LCP C;  1DT7 B;  2F2P A;  1K9K A;  2L4H A;  2F3Y A;  1K96 A;  3I5F C;  5I2L A;  1H4B A;  3DXL A;  4FTG A;  1F4Q A;  5D69 A;  2K7B A;  4GNK B;  1L2O B;  3BYA A;  1BOC A;  2KPH A;  3AAK A;  3PJI A;  3QME A;  5DKQ A;  2JTT A;  4MZL A;  1K9U A;  1NWD A;  4YBH B;  4P5O E;  1IQ5 A;  1W9Z A;  3CZT X;  2MRD A;  5BPJ A;  2L4I A;  4YI8 A;  1QX2 A;  1QVI Y;  3O4X A;  1GQM A;  3DY9 A;  3WHU B;  1DJG A;  1TWO A;  1NX1 A;  2LNK A;  2QDI A;  3FWB A;  2CT9 A;  4WRI A;  3OHM B;  3S0G A;  5PAL A;  1HQV A;  4A4B A;  3OB2 B;  1LVC D;  2JZI A;  3PM8 A;  2BE6 A;  5HKY A;  1QAT A;  3OB1 B;  4OZD A;  2PYQ A;  4GUK A;  1SCM B;  1Z2C B;  1DJW A;  2K8M B;  1KQM B;  1XK4 C;  1IH0 A;  3GK2 A;  5AXI A;  1C7W A;  1SNL A;  1UP5 A;  1OOH A;  4BY4 A;  4M2O A;  1REC A;  1SL8 A;  1YUU A;  3FIA A;  5DIC A;  1F71 A;  2EC6 C;  3NSL A;  1FW4 A;  3FWC A;  3NHT A;  5FYX A;  1B8L A;  4YGD B;  3IVT A;  4OV2 A;  1W7J B;  4YGB B;  5EL2 A;  3Q8I A;  4MRX A;  2JPT A;  2IS9 A;  4M2P A;  1NIW A;  3CZ1 A;  4PDZ A;  1CLB A;  1NCY A;  1Y1X A;  1CFP A;  5CPV A;  2D8N A;  2Y4Q A;  5I8N A;  1J1E A;  1IGV A;  1J7O A;  1A75 A;  4PT1 A;  1IQ3 A;  5ER5 A;  5ER4 X;  3EVV A;  3B6X A;  1XO5 A;  1KSM A;  3CAB A;  1KFX S;  1NCZ A;  1SCM C;  3D10 A;  1T14 A;  1KWO B;  2AUC A;  1KQM C;  2KBI A;  1CDL A;  1RFJ A;  3EK7 A;  4HRH A;  1LA3 A;  4PE0 A;  2KYC A;  3B88 A;  2BCA A;  5CSI A;  3QRX A;  2E30 A;  3FS7 A;  2BEC A;  1UWO A;  4INW A;  5FI2 A;  2AAO A;  1XA5 A;  3PAT A;  1FI5 A;  1LXF C;  1S5G Y;  3TZ1 A;  4PE4 A;  1SW8 A;  5KSZ A;  2BAP A;  1B1G A;  1GM0 A;  1B8R A;  3CZ2 A;  1AJ4 A;  5HLO A;  3AAJ A;  1IWQ A;  1CM4 A;  4ICB A;  2LV7 A;  3TUY B;  4GGN A;  5I94 A;  2JOJ A;  2OS8 B;  2FJU B;  4MN0 A;  1JFJ A;  3EK4 A;  3BQ3 A;  1L7Z A;  4YGC B;  4XYN A;  5HKW A;  4I5K A;  4ORB B;  2JNX A;  2L2E A;  2VRG A;  2P71 A;  3SG2 A;  1KWO C;  2LM5 A;  3BUN B;  1ZAC A;  1IJ5 A;  3WXA A;  1BR1 B;  1S6I A;  1CDP A;  1UHH A;  4JD9 A;  5AER A;  2COL B;  3TDZ A;  2KFF A;  2JT0 A;  2WC8 A;  1Z4H A;  1YX8 A;  1SBJ A;  2CBL A;  3I5H B;  3KEV A;  1TN4 A;  1QX5 B;  2I94 A;  1MR8 A;  1TCF A;  1SL7 A;  1DEK A;  2CCM A;  2WCL A;  3VRP A;  3KO0 A;  1DC1 A;  2EGD A;  2WCM A;  2LVV A;  1QS7 A;  1KCY A;  3BUO B;  3OX6 A;  2PRU A;  2OS8 C;  3OGN A;  3V2L A;  3L4L A;  1OSA A;  2WCB A;  3CR2 A;  1XK4 A;  1ZMZ A;  4NDD A;  4YRU A;  1BLQ A;  3E3R A;  2I7A A;  2ZRS A;  4PHN A;  1YUS A;  1EG3 A;  2K0J A;  1QTX A;  1R2U A;  1DJY A;  1OZS A;  4HRG A;  2KAX A;  1QLK A;  2I18 A;  1B4C A;  1PVA A;  2QEH A;  2JC2 A;  2WC6 A;  1FPW A;  3JTD B;  4FQT A;  1J7R A;  1N65 A;  1NYA A;  2O60 A;  1JFK A;  4CID A;  1FF1 A;  1QJT A;  3PLF B;  3L4A A;  4N5X A;  1QLS A;  1EL4 A;  1DVI A;  1NX2 A;  1B7T Z;  1WRZ A;  1TNQ A;  1EG4 A;  2QEO A;  4PCW A;  5AFP A;  1CLM A;  2E6W A;  2ZN8 A;  1C3Z A;  1DQE A;  1JBA A;  2LVJ A;  1SYM A;  1ODB A;  1MWN A;  4I5J A;  4GGF A;  1UUR A;  4PAL A;  3FE8 A;  2M8U A;  2JRF A;  2L98 A;  3EK8 A;  3SG3 A;  1AP4 A;  2I2R E;  1XFV O;  3CTN A;  4R1E A;  4DS7 A;  2ZFD A;  2F3Z A;  3CZ0 A;  2Y5I A;  2BE4 A;  1WLM A;  2KAY A;  1NX3 A;  2WND A;  3A8R A;  2L2C A;  3D77 A;  3DD4 A;  1CFC A;  1OOF A;  1PRW A;  2WC5 A;  2R2I A;  2Q91 A;  2LLT A;  2JTZ A;  1LKJ A;  1XFR A;  4OVN F;  3LK0 A;  1C7V A;  1MXE A;  1ALW A;  2HET A;  2LLS A;  3LLE A;  1CMF A;  2LCP A;  1K93 D;  1QV1 A;  1W7I B;  2M7L A;  1Y0V H;  2KFH A;  1S6C A;  4NDB A;  1LA0 A;  4TNC A;  1CMG A;  1IJ6 A;  1U5I B;  2KDH A;  1JF0 A;  2BCB A; 
#chains in the Genus database with same CATH homology
 4C0K A;  1PVB A;  1EXR A;  1HT9 A;  1NPQ A;  1K2H A;  2G9B A;  2KOT A;  2JXL A;  1L2O C;  3VGO A;  1UHK A;  4DIR A;  4PHJ A;  1CTR A;  3F45 A;  1DGU A;  3TDI A;  1IKU A;  2KGR A;  5CSN A;  1X02 A;  2HQ8 A;  3CGA A;  2JT3 A;  3CR5 X;  3NSO A;  2Q4U A;  5GQQ C;  2M1K B;  2HQW A;  1UHJ A;  1MXL C;  1CM1 A;  4PE7 A;  1MHO A;  2M9G A;  2NXQ A;  5KU1 A;  2A4J A;  3ZNI A;  1DJI A;  2GGZ A;  4YGA A;  4QJ5 B;  1ZUZ A;  1F70 A;  1R6P A;  1F55 A;  1XFY O;  1TTX A;  4L9M A;  3SIA A;  1S6J A;  3DVJ A;  3D0Y A;  3IF7 A;  1TCO B;  2JQ6 A;  2LLU A;  2RGI A;  4ZCU A;  2DOQ A;  4UPG A;  2ZN9 A;  4DRW A;  1A2X A;  1DGV A;  1J1D A;  1SMG A;  3OP0 A;  5I2O A;  3BOW A;  3I5I B;  2L51 A;  1BR4 B;  5CSJ A;  2H61 C;  2HF5 A;  1KFU L;  2K7D A;  2FCE A;  1K90 D;  2M3W A;  3PN7 B;  3TDU A;  1Q80 A;  2K61 A;  2BKH B;  2MBX A;  2LE9 B;  4I5L B;  1IG5 A;  1S36 A;  1CNP A;  4DUQ A;  4AOM A;  3DF0 A;  1B7T Y;  1WRL A;  1EJ3 A;  1ZFS A;  2MAZ A;  1TNP A;  2NZ0 A;  3JVT B;  1BG1 A;  1SL9 A;  2FOT A;  3HCM A;  1KK7 Z;  1YX7 A;  4YI9 A;  1DF0 A;  3WNX B;  3AKB A;  1QVI Z;  1S26 D;  3RM1 A;  2GV5 A;  2PVB A;  2WOR A;  4N1F A;  3ZWH A;  1TRF A;  1WY9 A;  4HRE E;  5DKR A;  1QAS A;  2AMI A;  1A75 B;  4E68 A;  1QIV A;  2CXJ A;  1AHR A;  1OQP A;  2JU0 A;  2KI4 B;  3GK1 A;  3TS5 B;  2M0R A;  1M31 A;  1YR5 A;  2BBN A;  1PSR A;  2LHL A;  3I5I C;  4GBA A;  4N1G A;  2M49 B;  4ORA B;  2L0P A;  3SG2 A;  1ALV A;  1ZOT B;  3TUY C;  1A03 A;  5IBW A;  1B9A A;  2K2F A;  4MZK A;  2LAN A;  3IQQ A;  1SK6 D;  1PSB A;  1SCV A;  1J7Q A;  1CDM A;  1QXP A;  3M0W A;  1CDN A;  3BXK A;  1Y1A A;  3CR4 X;  4OCI A;  2KQ6 A;  2KBM A;  4YGE B;  3I5G B;  2OTG B;  3I5H C;  3BOW B;  3WHT B;  1OZO A;  4OR9 B;  2OPO A;  4XJK A;  1XFW O;  1SR6 B;  2FCD A;  2G2B A;  1YVH A;  4CFR A;  1NUB A;  4USL A;  1MQ1 A;  2KI4 C;  1XYD A;  1FI6 A;  2L5X B;  4MBE A;  3GOF A;  1NSH A;  4MEW A;  1OMR A;  3K21 A;  5HYD A;  2BCX A;  2JXC A;  2KFG A;  3HX4 A;  2NCP A;  3EVU A;  2WCF A;  2LUC A;  1Y1U A;  2LMT A;  1IRJ A;  3DVK A;  3PSR A;  1RRO A;  1BT6 A;  1G8I A;  2GGM A;  2LUX A;  2K7O A;  1B47 A;  1BMO A;  1Y6W A;  4CPV A;  1AVS A;  5JJG A;  4AQI A;  5HKZ A;  1JUO A;  3I5G C;  1TIZ A;  1KFU S;  2ZND A;  1NX0 A;  3NXA A;  1G33 A;  4C0L A;  4GAO A;  1CKK A;  1F54 A;  3JTD C;  1EH2 A;  1KQV A;  2KQY A;  2LMU A;  4JQ0 D;  4PHM A;  2LAP A;  1K94 A;  4WQ2 A;  1S3P A;  1QX7 A;  4Q04 A;  1PAL A;  1DJH A;  2H61 A;  1D1O A;  2LHI A;  2O5G A;  2ZRT A;  3AKA A;  2LMV A;  1RK9 A;  4IL1 A;  5D7F A;  2CNP A;  1RTP 1;  4AQJ A;  1K8U A;  2EC6 B;  1QIW A;  4GFT A;  1K9P A;  2QPT A;  4CLN A;  2JWW A;  2KHN A;  1S1E A;  2MA2 A;  1YVL A;  1MF8 B;  4I5N B;  3EKJ A;  3IQO A;  1KK7 Y;  4ZCV A;  1J7P A;  3BUM B;  1GGW A;  4XJK B;  1JF2 A;  5HLV A;  1TOP A;  1H8B A;  2SAS A;  1SKT A;  4P2Y B;  1TNW A;  1BOD A;  3H4S E;  3O6B A;  2H2K A;  2WCE A;  3SG7 A;  3KHE A;  3RLZ A;  1DTL A;  1N0Y A;  1AUI B;  5JOL A;  3NSI A;  1M63 B;  1XFU O;  3VRQ A;  3MSE B;  4CFQ A;  4GPL B;  1A4P A;  1NCX A;  3SG4 A;  4JWQ A;  2M29 A;  3C1V A;  2NCO A;  2PMY A;  1XFZ O;  2V53 A;  2ZNE A;  2ISD A;  1YTZ C;  1SPY A;  1KSO A;  2LVK A;  1CB1 A;  1E8A A;  4A4C A;  4MRY A;  2KAV A;  1JSA A;  3BUX B;  2P6B B;  5B8I B;  1DJX A;  4QJ4 B;  2LC5 A;  4MLW A;  2KGB C;  1M39 A;  1YRT B;  1UHN A;  1M46 A;  1BJF A;  4NQG A;  4BY5 A;  3KF9 A;  2KSP A;  4HSZ A;  1WDC B;  5G08 A;  5J3X A;  2JUL A;  4C0J A;  1XVJ A;  1DJZ A;  1QV0 A;  1V1F A;  2BL0 B;  2HPS A;  3O2P A;  4MZJ A;  1OOJ A;  1N2D A;  5F6T A;  4FQO A;  3VRO A;  4DCK A;  4GGF C;  4WQ3 A;  1XFX O;  1YUT A;  4MSP A;  1OMV A;  1G4Y R;  1BF5 A;  1A29 A;  5TNC A;  1GGZ A;  1RWY A;  1VRK A;  1AJ5 A;  2BBM A;  2B1U A;  3LK1 A;  2CTN A;  4PE1 A;  3O4Y A;  4ORC B;  2TN4 A;  5I2Q A;  1GJY A;  1CFD A;  2K7C A;  3A4U B;  2MLF C;  5AEQ A;  3CWG A;  1BU3 A;  1J55 A;  3BUW B;  1WDC C;  1CLL A;  3CLN A;  3PN7 C;  1JWD A;  1RJV A;  1AK8 A;  2M1U A;  1UHI A;  2BL0 C;  3PAL A;  3VRN A;  1KK8 B;  3CS1 A;  2MLE C;  5CSF A;  1PK0 D;  4NDC A;  1JC2 A;  1V1G A;  3JVT C;  3NSK A;  2KI6 D;  3SG6 A;  2F8P A;  1F8H A;  1FBV A;  2M97 A;  2JNF A;  1B8C A;  3D0Y B;  3EVR A;  2F33 A;  3PFV A;  1SRA A;  4M2Q A;  4F0Z B;  1WLZ A;  2BKI B;  1F4O A;  3SIB A;  3DVE A;  2L50 A;  1WRK A;  4PHK A;  5AAN A;  2M7N A;  1M45 A;  2MHH A;  2Y1M A;  3SJS A;  2KNE A;  3TS5 C;  1OMD A;  3I5F B;  5K89 A;  3VRR A;  3DF0 B;  5KTY A;  2ZKM X;  1DMO A;  1K95 A;  1YUR A;  1NP8 A;  2LP2 A;  1YRU B;  3ICB A;  2F2O A;  2MJW B;  1DF0 B;  2Y1N A;  1KK8 C;  1OE9 B;  1U5I A;  2WOS A;  2KYF A;  1KFX L;  4U8D A;  2LVI A;  1S5G Z;  3EKH A;  1PUL A;  1C07 A;  1UUS A;  2SCP A;  3DVM A;  3OX5 A;  4QJ3 B;  2NLN A;  1TNX A;  2PAL A;  2QAC A;  1MUX A;  2PSR A;  4MVF A;  4ETO A;  3SG5 A;  3LL8 B;  3GK4 X;  3KPX A;  4D1E A;  2PAS A;  1SY9 A;  2OTG C;  3O78 A;  5DKN A;  1LIN A;  2KI6 C;  2EHB A;  2LP3 A;  1CFF A;  4OKH A;  4JPZ B;  1SR6 C;  2JT8 A;  2K2A A;  3LCP C;  1DT7 B;  2F2P A;  1K9K A;  2L4H A;  2F3Y A;  1K96 A;  3I5F C;  5I2L A;  1H4B A;  4FTG A;  1F4Q A;  5D69 A;  2K7B A;  4GNK B;  1L2O B;  3BYA A;  1BOC A;  3AAK A;  5DKQ A;  2JTT A;  4MZL A;  1K9U A;  1NWD A;  4YBH B;  4P5O E;  1IQ5 A;  3CZT X;  2MRD A;  5BPJ A;  2L4I A;  4YI8 A;  1QX2 A;  1QVI Y;  1GQM A;  3WHU B;  1DJG A;  1NX1 A;  2LNK A;  4WRI A;  3FWB A;  2CT9 A;  3OHM B;  5PAL A;  1HQV A;  4A4B A;  3OB2 B;  1LVC D;  2JZI A;  3PM8 A;  2BE6 A;  5HKY A;  1QAT A;  3OB1 B;  4GUK A;  1SCM B;  1DJW A;  2K8M B;  1KQM B;  1XK4 C;  1IH0 A;  3GK2 A;  5AXI A;  1C7W A;  1SNL A;  1UP5 A;  4BY4 A;  4M2O A;  1REC A;  1SL8 A;  1YUU A;  3FIA A;  1F71 A;  2EC6 C;  3NSL A;  1FW4 A;  3FWC A;  5FYX A;  1B8L A;  4YGD B;  4YGB B;  4OV2 A;  1W7J B;  4MRX A;  2JPT A;  2IS9 A;  4M2P A;  1NIW A;  1CLB A;  4PDZ A;  1NCY A;  1Y1X A;  1CFP A;  5CPV A;  2D8N A;  2Y4Q A;  5I8N A;  1J1E A;  1IGV A;  1J7O A;  1A75 A;  1IQ3 A;  5ER5 A;  5ER4 X;  3EVV A;  1XO5 A;  1KSM A;  1KFX S;  1NCZ A;  1SCM C;  3D10 A;  1KWO B;  2AUC A;  1KQM C;  2KBI A;  1CDL A;  1RFJ A;  3EK7 A;  4HRH A;  1LA3 A;  4PE0 A;  2KYC A;  2BCA A;  5CSI A;  3QRX A;  2E30 A;  3FS7 A;  2BEC A;  1UWO A;  2AAO A;  1XA5 A;  3PAT A;  1FI5 A;  1LXF C;  1S5G Y;  3TZ1 A;  4PE4 A;  1SW8 A;  5KSZ A;  1B1G A;  1B8R A;  1AJ4 A;  5HLO A;  3AAJ A;  1IWQ A;  1CM4 A;  4ICB A;  2LV7 A;  3TUY B;  4GGN A;  2JOJ A;  2OS8 B;  2FJU B;  4MN0 A;  1JFJ A;  3EK4 A;  3BQ3 A;  1L7Z A;  4YGC B;  4XYN A;  5HKW A;  4I5K A;  4ORB B;  2JNX A;  2L2E A;  2VRG A;  1KWO C;  2LM5 A;  3BUN B;  1ZAC A;  1IJ5 A;  3WXA A;  1BR1 B;  1S6I A;  1CDP A;  1UHH A;  5AER A;  2COL B;  3TDZ A;  2KFF A;  2JT0 A;  2WC8 A;  1YX8 A;  1SBJ A;  2CBL A;  3I5H B;  3KEV A;  1TN4 A;  1QX5 B;  2I94 A;  1MR8 A;  1TCF A;  1SL7 A;  2CCM A;  3VRP A;  3KO0 A;  2EGD A;  2LVV A;  1QS7 A;  1KCY A;  3BUO B;  3OX6 A;  2PRU A;  2OS8 C;  1OSA A;  2WCB A;  3CR2 A;  1XK4 A;  1ZMZ A;  4NDD A;  4YRU A;  1BLQ A;  3E3R A;  2I7A A;  2ZRS A;  4PHN A;  1YUS A;  1EG3 A;  2K0J A;  1QTX A;  1R2U A;  1DJY A;  1OZS A;  4HRG A;  2KAX A;  1QLK A;  2I18 A;  1B4C A;  1PVA A;  1FPW A;  2JC2 A;  3JTD B;  1J7R A;  1N65 A;  1NYA A;  2O60 A;  1JFK A;  4CID A;  1FF1 A;  1QJT A;  3PLF B;  4N5X A;  1QLS A;  1EL4 A;  1DVI A;  1NX2 A;  1B7T Z;  1WRZ A;  1TNQ A;  1EG4 A;  4PCW A;  5AFP A;  1CLM A;  2E6W A;  2ZN8 A;  1JBA A;  2LVJ A;  1SYM A;  1ODB A;  1MWN A;  4I5J A;  4GGF A;  1UUR A;  4PAL A;  2M8U A;  2JRF A;  2L98 A;  3EK8 A;  3SG3 A;  1AP4 A;  2I2R E;  1XFV O;  3CTN A;  4R1E A;  4DS7 A;  2ZFD A;  2F3Z A;  2Y5I A;  2BE4 A;  1WLM A;  2KAY A;  1NX3 A;  2WND A;  3A8R A;  3DD4 A;  1CFC A;  1PRW A;  2R2I A;  2Q91 A;  2LLT A;  2JTZ A;  1LKJ A;  4OVN F;  3LK0 A;  1C7V A;  1MXE A;  1ALW A;  2HET A;  2LLS A;  3LLE A;  1CMF A;  2LCP A;  1K93 D;  1QV1 A;  1W7I B;  2M7L A;  1Y0V H;  2KFH A;  1S6C A;  4NDB A;  1LA0 A;  4TNC A;  1CMG A;  1IJ6 A;  1U5I B;  2KDH A;  1JF0 A;  2BCB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...