2M29A

Nmr structure of ca2+ bound cabp4 n-domain
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
72
structure length
72
Chain Sequence
RELGPEELEELQAAFEEFDTDQDGYIGYRELGDCMRTLGYMPTEMELLEVSQHVKMRMGGFVDFEEFVELIS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Calcium-binding protein 4
publication title Chemical shift assignment of Ca2+ bound CaPB4
rcsb
source organism Mus musculus
molecule tags Metal binding protein
total genus 15
structure length 72
sequence length 72
ec nomenclature
pdb deposition date 2012-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2m29A00
2Y1NA 4YGDB 1JSAA 2JZIA 5G08A 2CXJA 2I18A 1CKKA 2L51A 1L7ZA 3LLEA 3RLZA 1AK8A 2JU0A 1PSBA 3SIAA 1CDMA 1MF8B 2F3ZA 5CSIA 1NX0A 2M8UA 3A8RA 4MN0A 2H2KA 3F45A 1QV0A 2MLFC 1NCZA 4E68A 2WNDA 1DJYA 3OB1B 4OKHA 5ER4X 2OS8B 1B7TZ 4P5OE 5PALA 1DMOA 3VRQA 2M1KB 1RFJA 2NCOA 1KSOA 2WOSA 4I5NB 2JOJA 1OZOA 4YGCB 2KHNA 1HT9A 2KFGA 1RWYA 2KSPA 3I5GC 3TZ1A 5JJGA 1K96A 1MXLC 1KQMC 1U5IB 1CFCA 2ZNDA 2EHBA 1BR4B 5JOLA 1BT6A 1V1FA 2WORA 1UHHA 3IF7A 1QS7A 5BPJA 1SR6B 2VRGA 1B8LA 4AQIA 1SL7A 4M2OA 2ZN9A 1YUSA 1IJ6A 4A4CA 2Y1MA 1FPWA 2AMIA 4WQ2A 3I5HB 1CFFA 2ZKMX 4QJ3B 1KFXL 4YI9A 1A75A 1A2XA 1OOJA 2K0JA 2LVKA 4TNCA 1VRKA 3TDUA 1S3PA 4YGEB 1H4BA 2OS8C 5D69A 3SG7A 4M2PA 4JQ0D 1F54A 4USLA 4MEWA 4PHJA 2NCPA 3O78A 1B47A 1XYDA 1DJHA 5CSJA 2V53A 4I5KA 1QATA 3NSKA 4C0LA 4DIRA 1K9UA 1SBJA 4XYNA 3NSOA 3MSEB 5HKZA 2RGIA 4PHMA 1AJ4A 5AANA 3TS5B 2TN4A 2GGMA 3PATA 2LE9B 1SR6C 1JWDA 3BYAA 2NLNA 2LUXA 3EK8A 1EG4A 3GK2A 4HRGA 2ZNEA 1DF0B 3BXKA 2WCEA 1LKJA 4GUKA 5AERA 2HF5A 1UURA 5HLVA 3DVKA 3RM1A 3I5HC 2PSRA 5KU1A 3SJSA 4ORCB 2PASA 3SG3A 3HCMA 5KSZA 1NP8A 1SK6D 2PRUA 3BOWA 1M31A 4JWQA 1KQVA 3OP0A 3CR2A 3IQOA 2MRDA 3O2PA 2WCFA 1WY9A 2L98A 2Y5IA 2E6WA 2LUCA 4HREE 1H8BA 2JXLA 1EXRA 2FJUB 1QX5B 1ZMZA 2JWWA 1F8HA 1PRWA 1TCFA 1YX7A 4ZCVA 3TS5C 2BE4A 1B9AA 1C7WA 1XA5A 4PE4A 1XK4A 3PM8A 1EH2A 1WDCB 1N65A 4F0ZB 2ZFDA 2M3WA 1QIVA 2M29A 1JFKA 3AKAA 1S6IA 1CDNA 4MZKA 1GJYA 2F2OA 2MLEC 4M2QA 4YGAA 1JBAA 2ZRTA 1TRFA 2LHLA 4I5LB 4AQJA 4PHNA 1K90D 1NUBA 1R2UA 1XFYO 2MBXA 3FWBA 1G8IA 2LVJA 5HKYA 1A29A 1ZACA 2GGZA 3DF0A 1TTXA 1PK0D 3CZTX 2R2IA 3WHTB 1A03A 1M63B 3D0YA 1NSHA 1Y1AA 2F2PA 1FF1A 1NWDA 1WRKA 2IS9A 2JNFA 1CTRA 1S36A 1CLMA 1MQ1A 1Y1UA 2KGRA 5DKRA 3C1VA 2CCMA 1G33A 2LCPA 4L9MA 4N1FA 1XVJA 3SG2A 4UPGA 1WDCC 4CFQA 2LLSA 3E3RA 3EVVA 3I5FB 1LA3A 2LAPA 2K7OA 4OVNF 2HQWA 2SASA 4PE0A 3EK7A 1YRUB 2L0PA 3A4UB 2KQYA 1K94A 1FI6A 4DRWA 2ZN8A 1TNWA 1JF2A 1CLLA 2LHIA 1IGVA 2COLB 5AXIA 3SG5A 1B4CA 3EVRA 1SL9A 2KQ6A 1ZFSA 2KDHA 2H61A 2WCBA 1F70A 2JC2A 1D1OA 1ZUZA 2O5GA 1X02A 1W7JB 3BUXB 2BL0C 2F3YA 1UP5A 3BUMB 1DGUA 2K7DA 1K9PA 3EVUA 1WLZA 4PDZA 3CWGA 3JVTB 1MXEA 3KEVA 2K2FA 2KYFA 1PVAA 1BODA 2LVVA 1IH0A 1XO5A 1SPYA 3I5FC 1J7QA 1L2OB 1CFPA 3M0WA 1SY9A 5D7FA 2ZRSA 3TDIA 3WHUB 1S1EA 2M1UA 1XFZO 1PVBA 3PSRA 3DVJA 3QRXA 1KWOB 4PHKA 1G4YR 2LANA 2LVIA 4CIDA 1IRJA 3VRPA 1SNLA 4U8DA 4MSPA 4HRHA 3K21A 4JPZB 1AP4A 1B1GA 2F8PA 4GNKB 5K89A 4BY5A 2FCEA 4MBEA 3LK0A 1QV1A 3OX5A 1TIZA 3JTDB 3KF9A 1K95A 3LK1A 4PE7A 4YI8A 3IQQA 3BUOB 1OMDA 2F33A 2G9BA 1PALA 1XFUO 2I7AA 2O60A 1NX3A 2DOQA 2KBMA 4ETOA 3JVTC 1DVIA 5CSFA 2KI4B 1DTLA 2M9GA 1IWQA 2I94A 2D8NA 2M0RA 2GV5A 1SCMB 2I2RE 3SG6A 1SKTA 1AVSA 1U5IA 2K7CA 4GPLB 2KAXA 1L2OC 3EK4A 5KTYA 3GOFA 1KCYA 1SL8A 1UHJA 2ISDA 1ALWA 4DUQA 2JT3A 1GGWA 1LA0A 1KWOC 1WRZA 5I8NA 3PALA 3NXAA 1EG3A 1M45A 1CM1A 5I2LA 4NDBA 2CT9A 2OTGB 1QVIY 1YVHA 4MLWA 2KFHA 2JT8A 2KAYA 2HPSA 2K61A 2OPOA 2LMUA 2EC6B 1QIWA 1MUXA 4WRIA 2KNEA 3VRRA 3JTDC 3PN7B 2L4HA 3DD4A 3OX6A 4XJKB 4D1EA 4QJ5B 3D0YB 4PE1A 2MHHA 1BJFA 5B8IB 1UHIA 1KFUS 4OV2A 1BMOA 2KI4C 2G2BA 2SCPA 2Q4UA 2HETA 1SCMC 1K93D 2A4JA 4ORBB 1PSRA 1NYAA 5F6TA 5CSNA 4DS7A 3KO0A 4OR9B 1B8RA 4PCWA 1TN4A 2CTNA 4CPVA 1CLBA 2LC5A 1JC2A 5IBWA 1OZSA 1LINA 3O4YA 1J7RA 1K2HA 1NIWA 1XFVO 2FOTA 4Q04A 1DF0A 3GK4X 2KFFA 4GGFA 2MA2A 1DJXA 1WLMA 4MZLA 3SIBA 2OTGC 1B7TY 1CMGA 2KBIA 1XFXO 3VRNA 5FYXA 1CDPA 3NSIA 2BL0B 1FW4A 1RK9A 2L50A 3PLFB 1BU3A 2BBNA 2EC6C 1S5GY 4NQGA 1DJIA 1KK7Y 1IKUA 1E8AA 3PN7C 2LLTA 4MZJA 2B1UA 1F55A 1UHNA 2LP2A 4FQOA 5ER5A 1F4QA 2KI6C 4ICBA 2LV7A 2L5XB 1BOCA 5GQQC 1YUTA 2NZ0A 2M49B 1CM4A 1ODBA 1TOPA 4ORAB 3CLNA 1M46A 4OCIA 1RTP1 1V1GA 4YBHB 1C7VA 2JQ6A 2PALA 4GGNA 2LMVA 4PALA 1N2DA 2JT0A 1CB1A 2LM5A 5J3XA 1QX2A 2K2AA 1TCOB 2LMTA 1A75B 2M7LA 2WC8A 1DJZA 4FTGA 1LXFC 2EGDA 5AEQA 5AFPA 3I5IB 4GAOA 3GK1A 1CMFA 2QACA 4P2YB 2JTZA 3TUYB 1OE9B 4N1GA 4NDCA 2E30A 2H61C 4C0KA 1PULA 2M97A 1EJ3A 3AKBA 1YURA 1CNPA 3D10A 1KFXS 3TDZA 2JXCA 1S26D 2MAZA 1TNPA 2BKHB 2JTTA 4BY4A 1DT7B 1UWOA 2KOTA 1S5GZ 2Q91A 1KK7Z 3SG4A 1DJWA 1M39A 2HQ8A 3FIAA 1FBVA 1QASA 1JFJA 1SYMA 1F4OA 5HKWA 1MWNA 1QJTA 2CBLA 1CFDA 4AOMA 3ZNIA 4CFRA 1SCVA 1RROA 2P6BB 1OQPA 2KGBC 4MVFA 1RECA 3WXAA 1S6CA 4YRUA 3H4SE 4I5JA 1AJ5A 3BOWB 2BKIB 1YVLA 4N5XA 4CLNA 1YX8A 1UUSA 1OMRA 1Q80A 1QXPA 1YR5A 1GQMA 3I5IC 2MJWB 4C0JA 1TNXA 1NCXA 1Y1XA 2QPTA 3EKJA 2M7NA 3TUYC 3KHEA 1ALVA 1IJ5A 1QLKA 1QX7A 2LP3A 3PFVA 3VGOA 1AHRA 2JULA 5I2OA 1DGVA 4ZCUA 2FCDA 1IQ3A 3LCPC 3OHMB 3AAJA 2PMYA 1K8UA 2BBMA 5TNCA 1J1DA 1NX2A 1B8CA 1K9KA 1Y0VH 2BE6A 4QJ4B 1F71A 1CDLA 3KPXA 1GGZA 2KYCA 3ZWHA 2LNKA 1KK8B 1S6JA 1IQ5A 2BCAA 3CGAA 1BF5A 1AUIB 4IL1A 2CNPA 1NPQA 4GBAA 1RJVA 2LLUA 2Y4QA 3LL8B 3DF0B 3AAKA 1HQVA 1NX1A 1YUUA 2JRFA 1YTZC 2JPTA 2AUCA 2L4IA 1BR1B 3CR5X 3CS1A 1BG1A 5I2QA 3CR4X 1QTXA 3NSLA 2K8MB 3ICBA 4NDDA 2JNXA 1R6PA 1FI5A 3DVEA 2NXQA 2AAOA 3FWCA 1OMVA 1XK4C 5DKQA 3VROA 2BCBA 5HYDA 1J55A 1NCYA 3HX4A 2K7BA 1ZOTB 1N0YA 3DVMA 5HLOA 3OB2B 1TNQA 1J7PA 4WQ3A 1EL4A 2L2EA 1KSMA 1MHOA 1KK8C 1SRAA 1SW8A 2PVBA 3EKHA 3FS7A 1XFWO 2KI6D 1DJGA 1IG5A 4GFTA 4DCKA 4GGFC 1BLQA 4R1EA 3BUWB 1WRLA 3BUNB 3CTNA 1A4PA 1KFUL 4A4BA 3O6BA 1LVCD 4YGBB 3WNXB 1J7OA 1JF0A 4HSZA 1QVIZ 5CPVA 2BCXA 1J1EA 1MR8A 3BQ3A 1SMGA 4MRXA 5DKNA 1OSAA 1QLSA 1YRTB 3I5GB 2BECA 4XJKA 1C07A 1Y6WA 1KQMB 2KAVA 1W7IB 1JUOA 4MRYA 1UHKA
chains in the Genus database with same CATH superfamily
2Y1NA 4YGDB 1JSAA 1LS8A 2JZIA 5G08A 2CXJA 2I18A 1CKKA 2WCKA 2L51A 1L7ZA 3LLEA 3RLZA 3VB1A 3S0AA 1AK8A 2JU0A 1PSBA 3SIAA 1CDMA 1MF8B 1W9ZA 2F3ZA 5CSIA 1NX0A 2M8UA 3A8RA 4MN0A 2H2KA 3F45A 1QV0A 3CZ1A 2FJYA 2MLFC 1NCZA 4E68A 2WNDA 1DJYA 3OB1B 4OKHA 3O4XA 5ER4X 2OS8B 1B7TZ 4P5OE 5PALA 1DMOA 3VRQA 2M1KB 1RFJA 2NCOA 1KSOA 2WOSA 4I5NB 2JOJA 1OZOA 4YGCB 2KHNA 1HT9A 2KFGA 1RWYA 2KSPA 3I5GC 2GTEA 3TZ1A 1TUJA 1K96A 1MXLC 5JJGA 1KQMC 1U5IB 1CFCA 2ZNDA 2EHBA 1BR4B 5JOLA 1BT6A 1V1FA 2WORA 1UHHA 3IF7A 1P28A 1QS7A 5BPJA 1SR6B 2VRGA 1B8LA 5FI6A 4AQIA 1SL7A 4M2OA 2ZN9A 1T14A 1YUSA 1IJ6A 2H8VA 2QEBA 2Y1MA 3CZ0A 3R72A 4A4CA 5I2LA 1FPWA 2AMIA 4WQ2A 3I5HB 1CFFA 2ZKMX 3NHIA 4QJ3B 1DQEA 3L4AA 1KFXL 4YI9A 1A75A 1A2XA 1OOJA 2K0JA 2LVKA 4TNCA 1VRKA 3TDUA 1S3PA 4YGEB 1H4BA 2OS8C 5D69A 3SG7A 4M2PA 4JQ0D 1F54A 3SS4A 4USLA 4MEWA 4PHJA 2NCPA 3O78A 4INXA 5EL2A 1B47A 1XYDA 1DEKA 1DJHA 5CSJA 2V53A 4I5KA 3FE8A 1QATA 3NSKA 4C0LA 4DIRA 1K9UA 1SBJA 4XYNA 3NSOA 3MSEB 5HKZA 2RGIA 4PHMA 1AJ4A 5AANA 3TS5B 2TN4A 2JPOA 2GGMA 3PATA 2LE9B 1SR6C 1JWDA 3BYAA 2NLNA 2LUXA 3EK8A 1EG4A 3GK2A 4HRGA 2ZNEA 1DF0B 3BXKA 2WCEA 1LKJA 4GUKA 5AERA 2HF5A 1UURA 5HLVA 3DVKA 3RM1A 3I5HC 2PSRA 5KU1A 3SJSA 4ORCB 2PASA 3SG3A 3HCMA 3SS3A 5KSZA 1NP8A 1SK6D 2PRUA 3BOWA 1M31A 4JWQA 1KQVA 3OP0A 3CR2A 3IQOA 2MRDA 3OGNA 3O2PA 2WCFA 2WCHA 1WY9A 2KLEA 2L98A 2E6WA 2LUCA 2Y5IA 4HREE 3UO9A 1H8BA 2JXLA 1EXRA 2FJUB 3CYZA 1QX5B 2ERBA 1OOHA 1ZMZA 2JWWA 1F8HA 3PM2A 1PRWA 1TCFA 1YX7A 4ZCVA 3TS5C 2BE4A 1B9AA 1C7WA 1XA5A 4PE4A 1XK4A 3PM8A 1EH2A 2BNXA 1WDCB 2QEOA 1N65A 2BAPA 4F0ZB 2ZFDA 2M3WA 1QIVA 2M29A 1JFKA 3AKAA 1S6IA 1CDNA 4MZKA 1GJYA 2F2OA 2MLEC 4M2QA 4YGAA 1JBAA 2ZRTA 1TRFA 2LHLA 4I5LB 4AQJA 4PHNA 1K90D 1NUBA 1R2UA 1XFYO 2MBXA 3FWBA 1G8IA 3BFAA 2LVJA 5HKYA 1Z4HA 1A29A 1ZACA 2GGZA 2WCMA 3D74A 3DF0A 1TTXA 1PK0D 3CZTX 2R2IA 3WHTB 2QEVA 1A03A 1M63B 3CDNA 3D0YA 1NSHA 1Y1AA 2F2PA 1FF1A 1NWDA 1WRKA 2IS9A 3L4LA 2JNFA 1CTRA 1S36A 1CLMA 1MQ1A 1Y1UA 2KGRA 5DKRA 3C1VA 2CCMA 5I94A 1G33A 2LCPA 2L5YA 3BJHA 4L9MA 4N1FA 1XVJA 3SG2A 4UPGA 3B86A 1WDCC 4CFQA 3NHTA 2LLSA 3E3RA 3EVVA 3I5FB 1LA3A 2LAPA 5DICA 2K7OA 4OVNF 2HQWA 3FE9A 2SASA 3K1EA 3S0BA 4PE0A 3EK7A 1YRUB 2P71A 2L0PA 3A4UB 2KQYA 1K94A 1FI6A 4DRWA 2ZN8A 1TNWA 3D78A 4IJ7A 1JF2A 1CLLA 2LHIA 1IGVA 2COLB 5AXIA 3S0EA 3SG5A 3EVRA 1B4CA 1SL9A 2KQ6A 1ZFSA 2KDHA 3S0FA 2H61A 2WCBA 1F70A 1Z2CB 2JC2A 1D1OA 1ZUZA 2O5GA 1X02A 1W7JB 3BUXB 2BL0C 2F3YA 1UP5A 3BUMB 1DGUA 2K7DA 1K9PA 3EVUA 1WLZA 4PDZA 3CWGA 3JVTB 1IIOA 3DZTA 1MXEA 3B88A 3DYEA 3KEVA 2K2FA 2KYFA 1PVAA 1BODA 3S0DA 1OOIX 2WCJA 2LVVA 1IH0A 1TUZA 1XO5A 1SPYA 3I5FC 1J7QA 1L2OB 1CFPA 3M0WA 1ORGA 1SY9A 5D7FA 2ZRSA 3TDIA 3WHUB 1S1EA 2M1UA 1XFZO 1PVBA 3PSRA 3DVJA 1DC1A 3QRXA 1KWOB 4PHKA 1G4YR 2LANA 2LVIA 4CIDA 3PJIA 1IRJA 5D3OA 3VRPA 1SNLA 4U8DA 4MSPA 4HRHA 3K21A 4JPZB 1AP4A 1B1GA 2F8PA 4GNKB 5K89A 4BY5A 2FCEA 4MBEA 3LK0A 1QV1A 3OX5A 1TIZA 3JTDB 2YGUA 3KF9A 1K95A 3LK1A 4PE7A 3DXLA 3IQQA 4YI8A 3BUOB 1OMDA 2F33A 3B87A 2G9BA 1PALA 1XFUO 4JKTA 2I7AA 2O60A 1NX3A 2DOQA 2KBMA 4ETOA 3JVTC 1DVIA 5CSFA 2KI4B 1DTLA 2M9GA 1IWQA 2I94A 2D8NA 2M0RA 2P70A 2GV5A 1SCMB 2I2RE 3SG6A 1SKTA 1AVSA 1U5IA 1TWOA 2K7CA 4GPLB 2KAXA 1L2OC 3EK4A 5KTYA 3GOFA 1KCYA 1OOFA 1SL8A 1UHJA 2ISDA 5HL1A 4INWA 1ALWA 4DUQA 2JT3A 1GGWA 1LA0A 1KWOC 1WRZA 5I8NA 3PALA 3NXAA 1EG3A 1M45A 1CM1A 3B7AA 2KLDA 2CT9A 2OTGB 3R1PA 4NDBA 1QVIY 1YVHA 4MLWA 2KFHA 2JT8A 2KAYA 2HPSA 2K61A 2OPOA 2QDIA 2LMUA 2EC6B 2K60A 1QIWA 1MUXA 4WRIA 2KNEA 3VRRA 3JTDC 3PN7B 2L4HA 3DD4A 1JC2A 3OX6A 4PT1A 4XJKB 4D1EA 4QJ5B 3D0YB 4PE1A 2MHHA 1BJFA 3CABA 5B8IB 1UHIA 1KFUS 4OV2A 1BMOA 2KI4C 2G2BA 2SCPA 2Q4UA 2HETA 1SCMC 1K93D 2A4JA 4ORBB 1PSRA 1NYAA 5F6TA 1C3YA 5CSNA 4DS7A 3KO0A 4OR9B 1B8RA 4PCWA 1TN4A 2CTNA 4CPVA 1CLBA 2LC5A 2PYQA 5IBWA 1OZSA 1LINA 3O4YA 1J7RA 1K2HA 1NIWA 1XFVO 2FOTA 4Q04A 1DF0A 3GK4X 2KFFA 4GGFA 2MA2A 1DJXA 1WLMA 4MZLA 3SIBA 2OTGC 1B7TY 1CMGA 2KBIA 1XFXO 3VRNA 5FYXA 1CDPA 3NSIA 1FW4A 2BL0B 1RK9A 2L50A 3PLFB 1BU3A 2BBNA 2EC6C 1S5GY 3EG5B 1DJIA 1KK7Y 4NQGA 1IKUA 1E8AA 3PN7C 2LLTA 4MZJA 2B1UA 1QWVA 1F55A 1UHNA 2LP2A 2WC6A 4FQOA 3D77A 5ER5A 1F4QA 2KI6C 3D73A 3R1OA 4ICBA 4F7FA 2LV7A 2L5XB 1BOCA 5GQQC 1YUTA 2NZ0A 2M49B 1CM4A 1ODBA 1TOPA 4ORAB 3CLNA 1M46A 4OCIA 1RTP1 1V1GA 4YBHB 1C7VA 2JQ6A 2PALA 4GGNA 2LMVA 3N7HA 1N2DA 2JT0A 4PALA 1CB1A 2LM5A 5J3XA 1QX2A 2K2AA 1TCOB 2LMTA 1A75B 2M7LA 2WC8A 1DJZA 4FTGA 1LXFC 2EGDA 4OZDA 5AEQA 5AFPA 3I5IB 4GAOA 3GK1A 1CMFA 2QACA 4P2YB 2JTZA 3TUYB 1OE9B 4N1GA 4NDCA 2E30A 2H61C 4C0KA 1PULA 2M97A 3CZ2A 1EJ3A 3AKBA 1OOGA 1YURA 1CNPA 3D10A 1KFXS 3TDZA 2JXCA 1S26D 2MAZA 1TNPA 2BKHB 2JTTA 3NGVA 4BY4A 1DT7B 1UWOA 2KOTA 2PQLA 1S5GZ 2Q91A 1KK7Z 3SG4A 1DJWA 1M39A 2HQ8A 3FIAA 1FBVA 1QASA 1JFJA 1SYMA 1F4OA 5HKWA 1MWNA 2WC5A 1QJTA 2CBLA 1CFDA 4AOMA 3ZNIA 4CFRA 1SCVA 1RROA 2P6BB 3FE6A 3R1VA 1OQPA 3QMEA 3Q8IA 2KGBC 3V2LA 4MVFA 1RECA 3WXAA 1S6CA 2L2CA 4YRUA 3H4SE 1C3ZA 4I5JA 1AJ5A 1XFRA 3BOWB 2BKIB 1YVLA 4N5XA 4CLNA 4JD9A 1YX8A 1UUSA 1OMRA 1Q80A 1QXPA 1YR5A 1GQMA 3I5IC 2MJWB 1OW4A 4C0JA 3SS5A 1TNXA 1NCXA 1Y1XA 2QPTA 3EKJA 2M7NA 3UNWA 3KHEA 3TUYC 1ALVA 3S0GA 1IJ5A 1QLKA 3D76A 1QX7A 2LP3A 3PFVA 3B6XA 3VGOA 1AHRA 2JULA 3D75A 5I2OA 1SSEB 1DGVA 4ZCUA 2FCDA 1IQ3A 3LCPC 3L47A 3AAJA 3OHMB 5FI2A 2PMYA 1K8UA 2BBMA 5TNCA 1J1DA 1NX2A 3OBVA 1B8CA 1K9KA 1Y0VH 2BE6A 4QJ4B 1F71A 1CDLA 3KPXA 1GGZA 1GM0A 2KYCA 3ZWHA 2LNKA 1KK8B 1S6JA 3DY9A 1IQ5A 2BCAA 3CGAA 1BF5A 1AUIB 4IL1A 2CNPA 1NPQA 4GBAA 1RJVA 2LLUA 2Y4QA 3LL8B 3DF0B 3AAKA 1HQVA 1NX1A 1YUUA 2JRFA 1YTZC 2JPTA 2AUCA 2L4IA 1BR1B 3CR5X 3CS1A 1BG1A 3BFHA 5I2QA 2WCLA 3CR4X 1QTXA 2QEHA 3NSLA 2K8MB 3BFBA 3ICBA 4FQTA 2JNXA 1R6PA 4NDDA 1FI5A 3DVEA 2NXQA 2AAOA 3FWCA 1OMVA 1XK4C 5DKQA 3VROA 2BCBA 5FI7A 5HYDA 1J55A 1NCYA 3HX4A 2K7BA 1ZOTB 1N0YA 3DVMA 5HLOA 3OB2B 1TNQA 1J7PA 4WQ3A 1EL4A 2L2EA 1KSMA 1MHOA 1KK8C 1SRAA 1SW8A 2PVBA 3EKHA 3FS7A 1DELA 1XFWO 2KI6D 1DJGA 1IG5A 4GFTA 4DCKA 4GGFC 1BLQA 4R1EA 3BUWB 1WRLA 3BUNB 3CTNA 1A4PA 1KFUL 4A4BA 3O6BA 1LVCD 4YGBB 3WNXB 3RZSA 1J7OA 1JF0A 4HSZA 1QVIZ 5CPVA 2BCXA 1J1EA 1MR8A 3BQ3A 1SMGA 4MRXA 5DKNA 1OSAA 1QLSA 1YRTB 3I5GB 2BECA 4XJKA 3IVTA 1C07A 1Y6WA 1KQMB 2KPHA 2KAVA 1W7IB 4KYNA 1JUOA 4MRYA 1UHKA
chains in the Genus database with same CATH topology
2Y1NA 4YGDB 1JSAA 2JZIA 5G08A 2CXJA 2I18A 1CKKA 2L51A 1L7ZA 3LLEA 3RLZA 1AK8A 2JU0A 1PSBA 3SIAA 1CDMA 1MF8B 2F3ZA 5CSIA 1NX0A 2M8UA 3A8RA 4MN0A 2H2KA 3F45A 1QV0A 2MLFC 1NCZA 4E68A 2WNDA 1DJYA 3OB1B 4OKHA 5ER4X 2OS8B 1B7TZ 4P5OE 5PALA 1DMOA 3VRQA 2M1KB 1RFJA 2NCOA 1KSOA 2WOSA 4I5NB 2JOJA 1OZOA 4YGCB 2KHNA 1HT9A 2KFGA 1RWYA 2KSPA 3I5GC 3TZ1A 5JJGA 1K96A 1MXLC 1KQMC 1U5IB 1CFCA 2ZNDA 2EHBA 1BR4B 5JOLA 1BT6A 1V1FA 2WORA 1UHHA 3IF7A 1QS7A 5BPJA 1SR6B 2VRGA 1B8LA 4AQIA 1SL7A 4M2OA 2ZN9A 1YUSA 1IJ6A 4A4CA 2Y1MA 1FPWA 2AMIA 4WQ2A 3I5HB 1CFFA 2ZKMX 4QJ3B 1KFXL 4YI9A 1A75A 1A2XA 1OOJA 2K0JA 2LVKA 4TNCA 1VRKA 3TDUA 1S3PA 4YGEB 1H4BA 2OS8C 5D69A 3SG7A 4M2PA 4JQ0D 1F54A 4USLA 4MEWA 4PHJA 2NCPA 3O78A 1B47A 1XYDA 1DJHA 5CSJA 2V53A 4I5KA 1QATA 3NSKA 4C0LA 4DIRA 1K9UA 1SBJA 4XYNA 3NSOA 3MSEB 5HKZA 2RGIA 4PHMA 1AJ4A 5AANA 3TS5B 2TN4A 2GGMA 3PATA 2LE9B 1SR6C 1JWDA 3BYAA 2NLNA 2LUXA 3EK8A 1EG4A 3GK2A 4HRGA 2ZNEA 1DF0B 3BXKA 2WCEA 1LKJA 4GUKA 5AERA 2HF5A 1UURA 5HLVA 3DVKA 3RM1A 3I5HC 2PSRA 5KU1A 3SJSA 4ORCB 2PASA 3SG3A 3HCMA 5KSZA 1NP8A 1SK6D 2PRUA 3BOWA 1M31A 4JWQA 1KQVA 3OP0A 3CR2A 3IQOA 2MRDA 3O2PA 2WCFA 1WY9A 2L98A 2Y5IA 2E6WA 2LUCA 4HREE 1H8BA 2JXLA 1EXRA 2FJUB 1QX5B 1ZMZA 2JWWA 1F8HA 1PRWA 1TCFA 1YX7A 4ZCVA 3TS5C 2BE4A 1B9AA 1C7WA 1XA5A 4PE4A 1XK4A 3PM8A 1EH2A 1WDCB 1N65A 4F0ZB 2ZFDA 2M3WA 1QIVA 2M29A 1JFKA 3AKAA 1S6IA 1CDNA 4MZKA 1GJYA 2F2OA 2MLEC 4M2QA 4YGAA 1JBAA 2ZRTA 1TRFA 2LHLA 4I5LB 4AQJA 4PHNA 1K90D 1NUBA 1R2UA 1XFYO 2MBXA 3FWBA 1G8IA 2LVJA 5HKYA 1A29A 1ZACA 2GGZA 3DF0A 1TTXA 1PK0D 3CZTX 2R2IA 3WHTB 1A03A 1M63B 3D0YA 1NSHA 1Y1AA 2F2PA 1FF1A 1NWDA 1WRKA 2IS9A 2JNFA 1CTRA 1S36A 1CLMA 1MQ1A 1Y1UA 2KGRA 5DKRA 3C1VA 2CCMA 1G33A 2LCPA 4L9MA 4N1FA 1XVJA 3SG2A 4UPGA 1WDCC 4CFQA 2LLSA 3E3RA 3EVVA 3I5FB 1LA3A 2LAPA 2K7OA 4OVNF 2HQWA 2SASA 4PE0A 3EK7A 1YRUB 2L0PA 3A4UB 2KQYA 1K94A 1FI6A 4DRWA 2ZN8A 1TNWA 1JF2A 1CLLA 2LHIA 1IGVA 2COLB 5AXIA 3SG5A 1B4CA 3EVRA 1SL9A 2KQ6A 1ZFSA 2KDHA 2H61A 2WCBA 1F70A 2JC2A 1D1OA 1ZUZA 2O5GA 1X02A 1W7JB 3BUXB 2BL0C 2F3YA 1UP5A 3BUMB 1DGUA 2K7DA 1K9PA 3EVUA 1WLZA 4PDZA 3CWGA 3JVTB 1MXEA 3KEVA 2K2FA 2KYFA 1PVAA 1BODA 2LVVA 1IH0A 1XO5A 1SPYA 3I5FC 1J7QA 1L2OB 1CFPA 3M0WA 1SY9A 5D7FA 2ZRSA 3TDIA 3WHUB 1S1EA 2M1UA 1XFZO 1PVBA 3PSRA 3DVJA 3QRXA 1KWOB 4PHKA 1G4YR 2LANA 2LVIA 4CIDA 1IRJA 3VRPA 1SNLA 4U8DA 4MSPA 4HRHA 3K21A 4JPZB 1AP4A 1B1GA 2F8PA 4GNKB 5K89A 4BY5A 2FCEA 4MBEA 3LK0A 1QV1A 3OX5A 1TIZA 3JTDB 3KF9A 1K95A 3LK1A 4PE7A 4YI8A 3IQQA 3BUOB 1OMDA 2F33A 2G9BA 1PALA 1XFUO 2I7AA 2O60A 1NX3A 2DOQA 2KBMA 4ETOA 3JVTC 1DVIA 5CSFA 2KI4B 1DTLA 2M9GA 1IWQA 2I94A 2D8NA 2M0RA 2GV5A 1SCMB 2I2RE 3SG6A 1SKTA 1AVSA 1U5IA 2K7CA 4GPLB 2KAXA 1L2OC 3EK4A 5KTYA 3GOFA 1KCYA 1SL8A 1UHJA 2ISDA 1ALWA 4DUQA 2JT3A 1GGWA 1LA0A 1KWOC 1WRZA 5I8NA 3PALA 3NXAA 1EG3A 1M45A 1CM1A 5I2LA 4NDBA 2CT9A 2OTGB 1QVIY 1YVHA 4MLWA 2KFHA 2JT8A 2KAYA 2HPSA 2K61A 2OPOA 2LMUA 2EC6B 1QIWA 1MUXA 4WRIA 2KNEA 3VRRA 3JTDC 3PN7B 2L4HA 3DD4A 3OX6A 4XJKB 4D1EA 4QJ5B 3D0YB 4PE1A 2MHHA 1BJFA 5B8IB 1UHIA 1KFUS 4OV2A 1BMOA 2KI4C 2G2BA 2SCPA 2Q4UA 2HETA 1SCMC 1K93D 2A4JA 4ORBB 1PSRA 1NYAA 5F6TA 5CSNA 4DS7A 3KO0A 4OR9B 1B8RA 4PCWA 1TN4A 2CTNA 4CPVA 1CLBA 2LC5A 1JC2A 5IBWA 1OZSA 1LINA 3O4YA 1J7RA 1K2HA 1NIWA 1XFVO 2FOTA 4Q04A 1DF0A 3GK4X 2KFFA 4GGFA 2MA2A 1DJXA 1WLMA 4MZLA 3SIBA 2OTGC 1B7TY 1CMGA 2KBIA 1XFXO 3VRNA 5FYXA 1CDPA 3NSIA 2BL0B 1FW4A 1RK9A 2L50A 3PLFB 1BU3A 2BBNA 2EC6C 1S5GY 4NQGA 1DJIA 1KK7Y 1IKUA 1E8AA 3PN7C 2LLTA 4MZJA 2B1UA 1F55A 1UHNA 2LP2A 4FQOA 5ER5A 1F4QA 2KI6C 4ICBA 2LV7A 2L5XB 1BOCA 5GQQC 1YUTA 2NZ0A 2M49B 1CM4A 1ODBA 1TOPA 4ORAB 3CLNA 1M46A 4OCIA 1RTP1 1V1GA 4YBHB 1C7VA 2JQ6A 2PALA 4GGNA 2LMVA 4PALA 1N2DA 2JT0A 1CB1A 2LM5A 5J3XA 1QX2A 2K2AA 1TCOB 2LMTA 1A75B 2M7LA 2WC8A 1DJZA 4FTGA 1LXFC 2EGDA 5AEQA 5AFPA 3I5IB 4GAOA 3GK1A 1CMFA 2QACA 4P2YB 2JTZA 3TUYB 1OE9B 4N1GA 4NDCA 2E30A 2H61C 4C0KA 1PULA 2M97A 1EJ3A 3AKBA 1YURA 1CNPA 3D10A 1KFXS 3TDZA 2JXCA 1S26D 2MAZA 1TNPA 2BKHB 2JTTA 4BY4A 1DT7B 1UWOA 2KOTA 1S5GZ 2Q91A 1KK7Z 3SG4A 1DJWA 1M39A 2HQ8A 3FIAA 1FBVA 1QASA 1JFJA 1SYMA 1F4OA 5HKWA 1MWNA 1QJTA 2CBLA 1CFDA 4AOMA 3ZNIA 4CFRA 1SCVA 1RROA 2P6BB 1OQPA 2KGBC 4MVFA 1RECA 3WXAA 1S6CA 4YRUA 3H4SE 4I5JA 1AJ5A 3BOWB 2BKIB 1YVLA 4N5XA 4CLNA 1YX8A 1UUSA 1OMRA 1Q80A 1QXPA 1YR5A 1GQMA 3I5IC 2MJWB 4C0JA 1TNXA 1NCXA 1Y1XA 2QPTA 3EKJA 2M7NA 3TUYC 3KHEA 1ALVA 1IJ5A 1QLKA 1QX7A 2LP3A 3PFVA 3VGOA 1AHRA 2JULA 5I2OA 1DGVA 4ZCUA 2FCDA 1IQ3A 3LCPC 3OHMB 3AAJA 2PMYA 1K8UA 2BBMA 5TNCA 1J1DA 1NX2A 1B8CA 1K9KA 1Y0VH 2BE6A 4QJ4B 1F71A 1CDLA 3KPXA 1GGZA 2KYCA 3ZWHA 2LNKA 1KK8B 1S6JA 1IQ5A 2BCAA 3CGAA 1BF5A 1AUIB 4IL1A 2CNPA 1NPQA 4GBAA 1RJVA 2LLUA 2Y4QA 3LL8B 3DF0B 3AAKA 1HQVA 1NX1A 1YUUA 2JRFA 1YTZC 2JPTA 2AUCA 2L4IA 1BR1B 3CR5X 3CS1A 1BG1A 5I2QA 3CR4X 1QTXA 3NSLA 2K8MB 3ICBA 4NDDA 2JNXA 1R6PA 1FI5A 3DVEA 2NXQA 2AAOA 3FWCA 1OMVA 1XK4C 5DKQA 3VROA 2BCBA 5HYDA 1J55A 1NCYA 3HX4A 2K7BA 1ZOTB 1N0YA 3DVMA 5HLOA 3OB2B 1TNQA 1J7PA 4WQ3A 1EL4A 2L2EA 1KSMA 1MHOA 1KK8C 1SRAA 1SW8A 2PVBA 3EKHA 3FS7A 1XFWO 2KI6D 1DJGA 1IG5A 4GFTA 4DCKA 4GGFC 1BLQA 4R1EA 3BUWB 1WRLA 3BUNB 3CTNA 1A4PA 1KFUL 4A4BA 3O6BA 1LVCD 4YGBB 3WNXB 1J7OA 1JF0A 4HSZA 1QVIZ 5CPVA 2BCXA 1J1EA 1MR8A 3BQ3A 1SMGA 4MRXA 5DKNA 1OSAA 1QLSA 1YRTB 3I5GB 2BECA 4XJKA 1C07A 1Y6WA 1KQMB 2KAVA 1W7IB 1JUOA 4MRYA 1UHKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Y1N A;  4YGD B;  1JSA A;  2JZI A;  5G08 A;  2CXJ A;  2I18 A;  1CKK A;  2L51 A;  1L7Z A;  3LLE A;  3RLZ A;  1AK8 A;  2JU0 A;  1PSB A;  3SIA A;  1CDM A;  1MF8 B;  2F3Z A;  5CSI A;  1NX0 A;  2M8U A;  3A8R A;  4MN0 A;  2H2K A;  3F45 A;  1QV0 A;  2MLF C;  1NCZ A;  4E68 A;  2WND A;  1DJY A;  3OB1 B;  4OKH A;  5ER4 X;  2OS8 B;  1B7T Z;  4P5O E;  5PAL A;  1DMO A;  3VRQ A;  2M1K B;  1RFJ A;  2NCO A;  1KSO A;  2WOS A;  4I5N B;  2JOJ A;  1OZO A;  4YGC B;  2KHN A;  1HT9 A;  2KFG A;  1RWY A;  2KSP A;  3I5G C;  3TZ1 A;  5JJG A;  1K96 A;  1MXL C;  1KQM C;  1U5I B;  1CFC A;  2ZND A;  2EHB A;  1BR4 B;  5JOL A;  1BT6 A;  1V1F A;  2WOR A;  1UHH A;  3IF7 A;  1QS7 A;  5BPJ A;  1SR6 B;  2VRG A;  1B8L A;  4AQI A;  1SL7 A;  4M2O A;  2ZN9 A;  1YUS A;  1IJ6 A;  4A4C A;  2Y1M A;  1FPW A;  2AMI A;  4WQ2 A;  3I5H B;  1CFF A;  2ZKM X;  4QJ3 B;  1KFX L;  4YI9 A;  1A75 A;  1A2X A;  1OOJ A;  2K0J A;  2LVK A;  4TNC A;  1VRK A;  3TDU A;  1S3P A;  4YGE B;  1H4B A;  2OS8 C;  5D69 A;  3SG7 A;  4M2P A;  4JQ0 D;  1F54 A;  4USL A;  4MEW A;  4PHJ A;  2NCP A;  3O78 A;  1B47 A;  1XYD A;  1DJH A;  5CSJ A;  2V53 A;  4I5K A;  1QAT A;  3NSK A;  4C0L A;  4DIR A;  1K9U A;  1SBJ A;  4XYN A;  3NSO A;  3MSE B;  5HKZ A;  2RGI A;  4PHM A;  1AJ4 A;  5AAN A;  3TS5 B;  2TN4 A;  2GGM A;  3PAT A;  2LE9 B;  1SR6 C;  1JWD A;  3BYA A;  2NLN A;  2LUX A;  3EK8 A;  1EG4 A;  3GK2 A;  4HRG A;  2ZNE A;  1DF0 B;  3BXK A;  2WCE A;  1LKJ A;  4GUK A;  5AER A;  2HF5 A;  1UUR A;  5HLV A;  3DVK A;  3RM1 A;  3I5H C;  2PSR A;  5KU1 A;  3SJS A;  4ORC B;  2PAS A;  3SG3 A;  3HCM A;  5KSZ A;  1NP8 A;  1SK6 D;  2PRU A;  3BOW A;  1M31 A;  4JWQ A;  1KQV A;  3OP0 A;  3CR2 A;  3IQO A;  2MRD A;  3O2P A;  2WCF A;  1WY9 A;  2L98 A;  2Y5I A;  2E6W A;  2LUC A;  4HRE E;  1H8B A;  2JXL A;  1EXR A;  2FJU B;  1QX5 B;  1ZMZ A;  2JWW A;  1F8H A;  1PRW A;  1TCF A;  1YX7 A;  4ZCV A;  3TS5 C;  2BE4 A;  1B9A A;  1C7W A;  1XA5 A;  4PE4 A;  1XK4 A;  3PM8 A;  1EH2 A;  1WDC B;  1N65 A;  4F0Z B;  2ZFD A;  2M3W A;  1QIV A;  2M29 A;  1JFK A;  3AKA A;  1S6I A;  1CDN A;  4MZK A;  1GJY A;  2F2O A;  2MLE C;  4M2Q A;  4YGA A;  1JBA A;  2ZRT A;  1TRF A;  2LHL A;  4I5L B;  4AQJ A;  4PHN A;  1K90 D;  1NUB A;  1R2U A;  1XFY O;  2MBX A;  3FWB A;  1G8I A;  2LVJ A;  5HKY A;  1A29 A;  1ZAC A;  2GGZ A;  3DF0 A;  1TTX A;  1PK0 D;  3CZT X;  2R2I A;  3WHT B;  1A03 A;  1M63 B;  3D0Y A;  1NSH A;  1Y1A A;  2F2P A;  1FF1 A;  1NWD A;  1WRK A;  2IS9 A;  2JNF A;  1CTR A;  1S36 A;  1CLM A;  1MQ1 A;  1Y1U A;  2KGR A;  5DKR A;  3C1V A;  2CCM A;  1G33 A;  2LCP A;  4L9M A;  4N1F A;  1XVJ A;  3SG2 A;  4UPG A;  1WDC C;  4CFQ A;  2LLS A;  3E3R A;  3EVV A;  3I5F B;  1LA3 A;  2LAP A;  2K7O A;  4OVN F;  2HQW A;  2SAS A;  4PE0 A;  3EK7 A;  1YRU B;  2L0P A;  3A4U B;  2KQY A;  1K94 A;  1FI6 A;  4DRW A;  2ZN8 A;  1TNW A;  1JF2 A;  1CLL A;  2LHI A;  1IGV A;  2COL B;  5AXI A;  3SG5 A;  1B4C A;  3EVR A;  1SL9 A;  2KQ6 A;  1ZFS A;  2KDH A;  2H61 A;  2WCB A;  1F70 A;  2JC2 A;  1D1O A;  1ZUZ A;  2O5G A;  1X02 A;  1W7J B;  3BUX B;  2BL0 C;  2F3Y A;  1UP5 A;  3BUM B;  1DGU A;  2K7D A;  1K9P A;  3EVU A;  1WLZ A;  4PDZ A;  3CWG A;  3JVT B;  1MXE A;  3KEV A;  2K2F A;  2KYF A;  1PVA A;  1BOD A;  2LVV A;  1IH0 A;  1XO5 A;  1SPY A;  3I5F C;  1J7Q A;  1L2O B;  1CFP A;  3M0W A;  1SY9 A;  5D7F A;  2ZRS A;  3TDI A;  3WHU B;  1S1E A;  2M1U A;  1XFZ O;  1PVB A;  3PSR A;  3DVJ A;  3QRX A;  1KWO B;  4PHK A;  1G4Y R;  2LAN A;  2LVI A;  4CID A;  1IRJ A;  3VRP A;  1SNL A;  4U8D A;  4MSP A;  4HRH A;  3K21 A;  4JPZ B;  1AP4 A;  1B1G A;  2F8P A;  4GNK B;  5K89 A;  4BY5 A;  2FCE A;  4MBE A;  3LK0 A;  1QV1 A;  3OX5 A;  1TIZ A;  3JTD B;  3KF9 A;  1K95 A;  3LK1 A;  4PE7 A;  4YI8 A;  3IQQ A;  3BUO B;  1OMD A;  2F33 A;  2G9B A;  1PAL A;  1XFU O;  2I7A A;  2O60 A;  1NX3 A;  2DOQ A;  2KBM A;  4ETO A;  3JVT C;  1DVI A;  5CSF A;  2KI4 B;  1DTL A;  2M9G A;  1IWQ A;  2I94 A;  2D8N A;  2M0R A;  2GV5 A;  1SCM B;  2I2R E;  3SG6 A;  1SKT A;  1AVS A;  1U5I A;  2K7C A;  4GPL B;  2KAX A;  1L2O C;  3EK4 A;  5KTY A;  3GOF A;  1KCY A;  1SL8 A;  1UHJ A;  2ISD A;  1ALW A;  4DUQ A;  2JT3 A;  1GGW A;  1LA0 A;  1KWO C;  1WRZ A;  5I8N A;  3PAL A;  3NXA A;  1EG3 A;  1M45 A;  1CM1 A;  5I2L A;  4NDB A;  2CT9 A;  2OTG B;  1QVI Y;  1YVH A;  4MLW A;  2KFH A;  2JT8 A;  2KAY A;  2HPS A;  2K61 A;  2OPO A;  2LMU A;  2EC6 B;  1QIW A;  1MUX A;  4WRI A;  2KNE A;  3VRR A;  3JTD C;  3PN7 B;  2L4H A;  3DD4 A;  3OX6 A;  4XJK B;  4D1E A;  4QJ5 B;  3D0Y B;  4PE1 A;  2MHH A;  1BJF A;  5B8I B;  1UHI A;  1KFU S;  4OV2 A;  1BMO A;  2KI4 C;  2G2B A;  2SCP A;  2Q4U A;  2HET A;  1SCM C;  1K93 D;  2A4J A;  4ORB B;  1PSR A;  1NYA A;  5F6T A;  5CSN A;  4DS7 A;  3KO0 A;  4OR9 B;  1B8R A;  4PCW A;  1TN4 A;  2CTN A;  4CPV A;  1CLB A;  2LC5 A;  1JC2 A;  5IBW A;  1OZS A;  1LIN A;  3O4Y A;  1J7R A;  1K2H A;  1NIW A;  1XFV O;  2FOT A;  4Q04 A;  1DF0 A;  3GK4 X;  2KFF A;  4GGF A;  2MA2 A;  1DJX A;  1WLM A;  4MZL A;  3SIB A;  2OTG C;  1B7T Y;  1CMG A;  2KBI A;  1XFX O;  3VRN A;  5FYX A;  1CDP A;  3NSI A;  2BL0 B;  1FW4 A;  1RK9 A;  2L50 A;  3PLF B;  1BU3 A;  2BBN A;  2EC6 C;  1S5G Y;  4NQG A;  1DJI A;  1KK7 Y;  1IKU A;  1E8A A;  3PN7 C;  2LLT A;  4MZJ A;  2B1U A;  1F55 A;  1UHN A;  2LP2 A;  4FQO A;  5ER5 A;  1F4Q A;  2KI6 C;  4ICB A;  2LV7 A;  2L5X B;  1BOC A;  5GQQ C;  1YUT A;  2NZ0 A;  2M49 B;  1CM4 A;  1ODB A;  1TOP A;  4ORA B;  3CLN A;  1M46 A;  4OCI A;  1RTP 1;  1V1G A;  4YBH B;  1C7V A;  2JQ6 A;  2PAL A;  4GGN A;  2LMV A;  4PAL A;  1N2D A;  2JT0 A;  1CB1 A;  2LM5 A;  5J3X A;  1QX2 A;  2K2A A;  1TCO B;  2LMT A;  1A75 B;  2M7L A;  2WC8 A;  1DJZ A;  4FTG A;  1LXF C;  2EGD A;  5AEQ A;  5AFP A;  3I5I B;  4GAO A;  3GK1 A;  1CMF A;  2QAC A;  4P2Y B;  2JTZ A;  3TUY B;  1OE9 B;  4N1G A;  4NDC A;  2E30 A;  2H61 C;  4C0K A;  1PUL A;  2M97 A;  1EJ3 A;  3AKB A;  1YUR A;  1CNP A;  3D10 A;  1KFX S;  3TDZ A;  2JXC A;  1S26 D;  2MAZ A;  1TNP A;  2BKH B;  2JTT A;  4BY4 A;  1DT7 B;  1UWO A;  2KOT A;  1S5G Z;  2Q91 A;  1KK7 Z;  3SG4 A;  1DJW A;  1M39 A;  2HQ8 A;  3FIA A;  1FBV A;  1QAS A;  1JFJ A;  1SYM A;  1F4O A;  5HKW A;  1MWN A;  1QJT A;  2CBL A;  1CFD A;  4AOM A;  3ZNI A;  4CFR A;  1SCV A;  1RRO A;  2P6B B;  1OQP A;  2KGB C;  4MVF A;  1REC A;  3WXA A;  1S6C A;  4YRU A;  3H4S E;  4I5J A;  1AJ5 A;  3BOW B;  2BKI B;  1YVL A;  4N5X A;  4CLN A;  1YX8 A;  1UUS A;  1OMR A;  1Q80 A;  1QXP A;  1YR5 A;  1GQM A;  3I5I C;  2MJW B;  4C0J A;  1TNX A;  1NCX A;  1Y1X A;  2QPT A;  3EKJ A;  2M7N A;  3TUY C;  3KHE A;  1ALV A;  1IJ5 A;  1QLK A;  1QX7 A;  2LP3 A;  3PFV A;  3VGO A;  1AHR A;  2JUL A;  5I2O A;  1DGV A;  4ZCU A;  2FCD A;  1IQ3 A;  3LCP C;  3OHM B;  3AAJ A;  2PMY A;  1K8U A;  2BBM A;  5TNC A;  1J1D A;  1NX2 A;  1B8C A;  1K9K A;  1Y0V H;  2BE6 A;  4QJ4 B;  1F71 A;  1CDL A;  3KPX A;  1GGZ A;  2KYC A;  3ZWH A;  2LNK A;  1KK8 B;  1S6J A;  1IQ5 A;  2BCA A;  3CGA A;  1BF5 A;  1AUI B;  4IL1 A;  2CNP A;  1NPQ A;  4GBA A;  1RJV A;  2LLU A;  2Y4Q A;  3LL8 B;  3DF0 B;  3AAK A;  1HQV A;  1NX1 A;  1YUU A;  2JRF A;  1YTZ C;  2JPT A;  2AUC A;  2L4I A;  1BR1 B;  3CR5 X;  3CS1 A;  1BG1 A;  5I2Q A;  3CR4 X;  1QTX A;  3NSL A;  2K8M B;  3ICB A;  4NDD A;  2JNX A;  1R6P A;  1FI5 A;  3DVE A;  2NXQ A;  2AAO A;  3FWC A;  1OMV A;  1XK4 C;  5DKQ A;  3VRO A;  2BCB A;  5HYD A;  1J55 A;  1NCY A;  3HX4 A;  2K7B A;  1ZOT B;  1N0Y A;  3DVM A;  5HLO A;  3OB2 B;  1TNQ A;  1J7P A;  4WQ3 A;  1EL4 A;  2L2E A;  1KSM A;  1MHO A;  1KK8 C;  1SRA A;  1SW8 A;  2PVB A;  3EKH A;  3FS7 A;  1XFW O;  2KI6 D;  1DJG A;  1IG5 A;  4GFT A;  4DCK A;  4GGF C;  1BLQ A;  4R1E A;  3BUW B;  1WRL A;  3BUN B;  3CTN A;  1A4P A;  1KFU L;  4A4B A;  3O6B A;  1LVC D;  4YGB B;  3WNX B;  1J7O A;  1JF0 A;  4HSZ A;  1QVI Z;  5CPV A;  2BCX A;  1J1E A;  1MR8 A;  3BQ3 A;  1SMG A;  4MRX A;  5DKN A;  1OSA A;  1QLS A;  1YRT B;  3I5G B;  2BEC A;  4XJK A;  1C07 A;  1Y6W A;  1KQM B;  2KAV A;  1W7I B;  1JUO A;  4MRY A;  1UHK A; 
#chains in the Genus database with same CATH topology
 2Y1N A;  4YGD B;  1JSA A;  1LS8 A;  2JZI A;  5G08 A;  2CXJ A;  2I18 A;  1CKK A;  2WCK A;  2L51 A;  1L7Z A;  3LLE A;  3RLZ A;  3VB1 A;  3S0A A;  1AK8 A;  2JU0 A;  1PSB A;  3SIA A;  1CDM A;  1MF8 B;  1W9Z A;  2F3Z A;  5CSI A;  1NX0 A;  2M8U A;  3A8R A;  4MN0 A;  2H2K A;  3F45 A;  1QV0 A;  3CZ1 A;  2FJY A;  2MLF C;  1NCZ A;  4E68 A;  2WND A;  1DJY A;  3OB1 B;  4OKH A;  3O4X A;  5ER4 X;  2OS8 B;  1B7T Z;  4P5O E;  5PAL A;  1DMO A;  3VRQ A;  2M1K B;  1RFJ A;  2NCO A;  1KSO A;  2WOS A;  4I5N B;  2JOJ A;  1OZO A;  4YGC B;  2KHN A;  1HT9 A;  2KFG A;  1RWY A;  2KSP A;  3I5G C;  2GTE A;  3TZ1 A;  1TUJ A;  1K96 A;  1MXL C;  5JJG A;  1KQM C;  1U5I B;  1CFC A;  2ZND A;  2EHB A;  1BR4 B;  5JOL A;  1BT6 A;  1V1F A;  2WOR A;  1UHH A;  3IF7 A;  1P28 A;  1QS7 A;  5BPJ A;  1SR6 B;  2VRG A;  1B8L A;  5FI6 A;  4AQI A;  1SL7 A;  4M2O A;  2ZN9 A;  1T14 A;  1YUS A;  1IJ6 A;  2H8V A;  2QEB A;  2Y1M A;  3CZ0 A;  3R72 A;  4A4C A;  5I2L A;  1FPW A;  2AMI A;  4WQ2 A;  3I5H B;  1CFF A;  2ZKM X;  3NHI A;  4QJ3 B;  1DQE A;  3L4A A;  1KFX L;  4YI9 A;  1A75 A;  1A2X A;  1OOJ A;  2K0J A;  2LVK A;  4TNC A;  1VRK A;  3TDU A;  1S3P A;  4YGE B;  1H4B A;  2OS8 C;  5D69 A;  3SG7 A;  4M2P A;  4JQ0 D;  1F54 A;  3SS4 A;  4USL A;  4MEW A;  4PHJ A;  2NCP A;  3O78 A;  4INX A;  5EL2 A;  1B47 A;  1XYD A;  1DEK A;  1DJH A;  5CSJ A;  2V53 A;  4I5K A;  3FE8 A;  1QAT A;  3NSK A;  4C0L A;  4DIR A;  1K9U A;  1SBJ A;  4XYN A;  3NSO A;  3MSE B;  5HKZ A;  2RGI A;  4PHM A;  1AJ4 A;  5AAN A;  3TS5 B;  2TN4 A;  2JPO A;  2GGM A;  3PAT A;  2LE9 B;  1SR6 C;  1JWD A;  3BYA A;  2NLN A;  2LUX A;  3EK8 A;  1EG4 A;  3GK2 A;  4HRG A;  2ZNE A;  1DF0 B;  3BXK A;  2WCE A;  1LKJ A;  4GUK A;  5AER A;  2HF5 A;  1UUR A;  5HLV A;  3DVK A;  3RM1 A;  3I5H C;  2PSR A;  5KU1 A;  3SJS A;  4ORC B;  2PAS A;  3SG3 A;  3HCM A;  3SS3 A;  5KSZ A;  1NP8 A;  1SK6 D;  2PRU A;  3BOW A;  1M31 A;  4JWQ A;  1KQV A;  3OP0 A;  3CR2 A;  3IQO A;  2MRD A;  3OGN A;  3O2P A;  2WCF A;  2WCH A;  1WY9 A;  2KLE A;  2L98 A;  2E6W A;  2LUC A;  2Y5I A;  4HRE E;  3UO9 A;  1H8B A;  2JXL A;  1EXR A;  2FJU B;  3CYZ A;  1QX5 B;  2ERB A;  1OOH A;  1ZMZ A;  2JWW A;  1F8H A;  3PM2 A;  1PRW A;  1TCF A;  1YX7 A;  4ZCV A;  3TS5 C;  2BE4 A;  1B9A A;  1C7W A;  1XA5 A;  4PE4 A;  1XK4 A;  3PM8 A;  1EH2 A;  2BNX A;  1WDC B;  2QEO A;  1N65 A;  2BAP A;  4F0Z B;  2ZFD A;  2M3W A;  1QIV A;  2M29 A;  1JFK A;  3AKA A;  1S6I A;  1CDN A;  4MZK A;  1GJY A;  2F2O A;  2MLE C;  4M2Q A;  4YGA A;  1JBA A;  2ZRT A;  1TRF A;  2LHL A;  4I5L B;  4AQJ A;  4PHN A;  1K90 D;  1NUB A;  1R2U A;  1XFY O;  2MBX A;  3FWB A;  1G8I A;  3BFA A;  2LVJ A;  5HKY A;  1Z4H A;  1A29 A;  1ZAC A;  2GGZ A;  2WCM A;  3D74 A;  3DF0 A;  1TTX A;  1PK0 D;  3CZT X;  2R2I A;  3WHT B;  2QEV A;  1A03 A;  1M63 B;  3CDN A;  3D0Y A;  1NSH A;  1Y1A A;  2F2P A;  1FF1 A;  1NWD A;  1WRK A;  2IS9 A;  3L4L A;  2JNF A;  1CTR A;  1S36 A;  1CLM A;  1MQ1 A;  1Y1U A;  2KGR A;  5DKR A;  3C1V A;  2CCM A;  5I94 A;  1G33 A;  2LCP A;  2L5Y A;  3BJH A;  4L9M A;  4N1F A;  1XVJ A;  3SG2 A;  4UPG A;  3B86 A;  1WDC C;  4CFQ A;  3NHT A;  2LLS A;  3E3R A;  3EVV A;  3I5F B;  1LA3 A;  2LAP A;  5DIC A;  2K7O A;  4OVN F;  2HQW A;  3FE9 A;  2SAS A;  3K1E A;  3S0B A;  4PE0 A;  3EK7 A;  1YRU B;  2P71 A;  2L0P A;  3A4U B;  2KQY A;  1K94 A;  1FI6 A;  4DRW A;  2ZN8 A;  1TNW A;  3D78 A;  4IJ7 A;  1JF2 A;  1CLL A;  2LHI A;  1IGV A;  2COL B;  5AXI A;  3S0E A;  3SG5 A;  3EVR A;  1B4C A;  1SL9 A;  2KQ6 A;  1ZFS A;  2KDH A;  3S0F A;  2H61 A;  2WCB A;  1F70 A;  1Z2C B;  2JC2 A;  1D1O A;  1ZUZ A;  2O5G A;  1X02 A;  1W7J B;  3BUX B;  2BL0 C;  2F3Y A;  1UP5 A;  3BUM B;  1DGU A;  2K7D A;  1K9P A;  3EVU A;  1WLZ A;  4PDZ A;  3CWG A;  3JVT B;  1IIO A;  3DZT A;  1MXE A;  3B88 A;  3DYE A;  3KEV A;  2K2F A;  2KYF A;  1PVA A;  1BOD A;  3S0D A;  1OOI X;  2WCJ A;  2LVV A;  1IH0 A;  1TUZ A;  1XO5 A;  1SPY A;  3I5F C;  1J7Q A;  1L2O B;  1CFP A;  3M0W A;  1ORG A;  1SY9 A;  5D7F A;  2ZRS A;  3TDI A;  3WHU B;  1S1E A;  2M1U A;  1XFZ O;  1PVB A;  3PSR A;  3DVJ A;  1DC1 A;  3QRX A;  1KWO B;  4PHK A;  1G4Y R;  2LAN A;  2LVI A;  4CID A;  3PJI A;  1IRJ A;  5D3O A;  3VRP A;  1SNL A;  4U8D A;  4MSP A;  4HRH A;  3K21 A;  4JPZ B;  1AP4 A;  1B1G A;  2F8P A;  4GNK B;  5K89 A;  4BY5 A;  2FCE A;  4MBE A;  3LK0 A;  1QV1 A;  3OX5 A;  1TIZ A;  3JTD B;  2YGU A;  3KF9 A;  1K95 A;  3LK1 A;  4PE7 A;  3DXL A;  3IQQ A;  4YI8 A;  3BUO B;  1OMD A;  2F33 A;  3B87 A;  2G9B A;  1PAL A;  1XFU O;  4JKT A;  2I7A A;  2O60 A;  1NX3 A;  2DOQ A;  2KBM A;  4ETO A;  3JVT C;  1DVI A;  5CSF A;  2KI4 B;  1DTL A;  2M9G A;  1IWQ A;  2I94 A;  2D8N A;  2M0R A;  2P70 A;  2GV5 A;  1SCM B;  2I2R E;  3SG6 A;  1SKT A;  1AVS A;  1U5I A;  1TWO A;  2K7C A;  4GPL B;  2KAX A;  1L2O C;  3EK4 A;  5KTY A;  3GOF A;  1KCY A;  1OOF A;  1SL8 A;  1UHJ A;  2ISD A;  5HL1 A;  4INW A;  1ALW A;  4DUQ A;  2JT3 A;  1GGW A;  1LA0 A;  1KWO C;  1WRZ A;  5I8N A;  3PAL A;  3NXA A;  1EG3 A;  1M45 A;  1CM1 A;  3B7A A;  2KLD A;  2CT9 A;  2OTG B;  3R1P A;  4NDB A;  1QVI Y;  1YVH A;  4MLW A;  2KFH A;  2JT8 A;  2KAY A;  2HPS A;  2K61 A;  2OPO A;  2QDI A;  2LMU A;  2EC6 B;  2K60 A;  1QIW A;  1MUX A;  4WRI A;  2KNE A;  3VRR A;  3JTD C;  3PN7 B;  2L4H A;  3DD4 A;  1JC2 A;  3OX6 A;  4PT1 A;  4XJK B;  4D1E A;  4QJ5 B;  3D0Y B;  4PE1 A;  2MHH A;  1BJF A;  3CAB A;  5B8I B;  1UHI A;  1KFU S;  4OV2 A;  1BMO A;  2KI4 C;  2G2B A;  2SCP A;  2Q4U A;  2HET A;  1SCM C;  1K93 D;  2A4J A;  4ORB B;  1PSR A;  1NYA A;  5F6T A;  1C3Y A;  5CSN A;  4DS7 A;  3KO0 A;  4OR9 B;  1B8R A;  4PCW A;  1TN4 A;  2CTN A;  4CPV A;  1CLB A;  2LC5 A;  2PYQ A;  5IBW A;  1OZS A;  1LIN A;  3O4Y A;  1J7R A;  1K2H A;  1NIW A;  1XFV O;  2FOT A;  4Q04 A;  1DF0 A;  3GK4 X;  2KFF A;  4GGF A;  2MA2 A;  1DJX A;  1WLM A;  4MZL A;  3SIB A;  2OTG C;  1B7T Y;  1CMG A;  2KBI A;  1XFX O;  3VRN A;  5FYX A;  1CDP A;  3NSI A;  1FW4 A;  2BL0 B;  1RK9 A;  2L50 A;  3PLF B;  1BU3 A;  2BBN A;  2EC6 C;  1S5G Y;  3EG5 B;  1DJI A;  1KK7 Y;  4NQG A;  1IKU A;  1E8A A;  3PN7 C;  2LLT A;  4MZJ A;  2B1U A;  1QWV A;  1F55 A;  1UHN A;  2LP2 A;  2WC6 A;  4FQO A;  3D77 A;  5ER5 A;  1F4Q A;  2KI6 C;  3D73 A;  3R1O A;  4ICB A;  4F7F A;  2LV7 A;  2L5X B;  1BOC A;  5GQQ C;  1YUT A;  2NZ0 A;  2M49 B;  1CM4 A;  1ODB A;  1TOP A;  4ORA B;  3CLN A;  1M46 A;  4OCI A;  1RTP 1;  1V1G A;  4YBH B;  1C7V A;  2JQ6 A;  2PAL A;  4GGN A;  2LMV A;  3N7H A;  1N2D A;  2JT0 A;  4PAL A;  1CB1 A;  2LM5 A;  5J3X A;  1QX2 A;  2K2A A;  1TCO B;  2LMT A;  1A75 B;  2M7L A;  2WC8 A;  1DJZ A;  4FTG A;  1LXF C;  2EGD A;  4OZD A;  5AEQ A;  5AFP A;  3I5I B;  4GAO A;  3GK1 A;  1CMF A;  2QAC A;  4P2Y B;  2JTZ A;  3TUY B;  1OE9 B;  4N1G A;  4NDC A;  2E30 A;  2H61 C;  4C0K A;  1PUL A;  2M97 A;  3CZ2 A;  1EJ3 A;  3AKB A;  1OOG A;  1YUR A;  1CNP A;  3D10 A;  1KFX S;  3TDZ A;  2JXC A;  1S26 D;  2MAZ A;  1TNP A;  2BKH B;  2JTT A;  3NGV A;  4BY4 A;  1DT7 B;  1UWO A;  2KOT A;  2PQL A;  1S5G Z;  2Q91 A;  1KK7 Z;  3SG4 A;  1DJW A;  1M39 A;  2HQ8 A;  3FIA A;  1FBV A;  1QAS A;  1JFJ A;  1SYM A;  1F4O A;  5HKW A;  1MWN A;  2WC5 A;  1QJT A;  2CBL A;  1CFD A;  4AOM A;  3ZNI A;  4CFR A;  1SCV A;  1RRO A;  2P6B B;  3FE6 A;  3R1V A;  1OQP A;  3QME A;  3Q8I A;  2KGB C;  3V2L A;  4MVF A;  1REC A;  3WXA A;  1S6C A;  2L2C A;  4YRU A;  3H4S E;  1C3Z A;  4I5J A;  1AJ5 A;  1XFR A;  3BOW B;  2BKI B;  1YVL A;  4N5X A;  4CLN A;  4JD9 A;  1YX8 A;  1UUS A;  1OMR A;  1Q80 A;  1QXP A;  1YR5 A;  1GQM A;  3I5I C;  2MJW B;  1OW4 A;  4C0J A;  3SS5 A;  1TNX A;  1NCX A;  1Y1X A;  2QPT A;  3EKJ A;  2M7N A;  3UNW A;  3KHE A;  3TUY C;  1ALV A;  3S0G A;  1IJ5 A;  1QLK A;  3D76 A;  1QX7 A;  2LP3 A;  3PFV A;  3B6X A;  3VGO A;  1AHR A;  2JUL A;  3D75 A;  5I2O A;  1SSE B;  1DGV A;  4ZCU A;  2FCD A;  1IQ3 A;  3LCP C;  3L47 A;  3AAJ A;  3OHM B;  5FI2 A;  2PMY A;  1K8U A;  2BBM A;  5TNC A;  1J1D A;  1NX2 A;  3OBV A;  1B8C A;  1K9K A;  1Y0V H;  2BE6 A;  4QJ4 B;  1F71 A;  1CDL A;  3KPX A;  1GGZ A;  1GM0 A;  2KYC A;  3ZWH A;  2LNK A;  1KK8 B;  1S6J A;  3DY9 A;  1IQ5 A;  2BCA A;  3CGA A;  1BF5 A;  1AUI B;  4IL1 A;  2CNP A;  1NPQ A;  4GBA A;  1RJV A;  2LLU A;  2Y4Q A;  3LL8 B;  3DF0 B;  3AAK A;  1HQV A;  1NX1 A;  1YUU A;  2JRF A;  1YTZ C;  2JPT A;  2AUC A;  2L4I A;  1BR1 B;  3CR5 X;  3CS1 A;  1BG1 A;  3BFH A;  5I2Q A;  2WCL A;  3CR4 X;  1QTX A;  2QEH A;  3NSL A;  2K8M B;  3BFB A;  3ICB A;  4FQT A;  2JNX A;  1R6P A;  4NDD A;  1FI5 A;  3DVE A;  2NXQ A;  2AAO A;  3FWC A;  1OMV A;  1XK4 C;  5DKQ A;  3VRO A;  2BCB A;  5FI7 A;  5HYD A;  1J55 A;  1NCY A;  3HX4 A;  2K7B A;  1ZOT B;  1N0Y A;  3DVM A;  5HLO A;  3OB2 B;  1TNQ A;  1J7P A;  4WQ3 A;  1EL4 A;  2L2E A;  1KSM A;  1MHO A;  1KK8 C;  1SRA A;  1SW8 A;  2PVB A;  3EKH A;  3FS7 A;  1DEL A;  1XFW O;  2KI6 D;  1DJG A;  1IG5 A;  4GFT A;  4DCK A;  4GGF C;  1BLQ A;  4R1E A;  3BUW B;  1WRL A;  3BUN B;  3CTN A;  1A4P A;  1KFU L;  4A4B A;  3O6B A;  1LVC D;  4YGB B;  3WNX B;  3RZS A;  1J7O A;  1JF0 A;  4HSZ A;  1QVI Z;  5CPV A;  2BCX A;  1J1E A;  1MR8 A;  3BQ3 A;  1SMG A;  4MRX A;  5DKN A;  1OSA A;  1QLS A;  1YRT B;  3I5G B;  2BEC A;  4XJK A;  3IVT A;  1C07 A;  1Y6W A;  1KQM B;  2KPH A;  2KAV A;  1W7I B;  4KYN A;  1JUO A;  4MRY A;  1UHK A; 
#chains in the Genus database with same CATH homology
 2Y1N A;  4YGD B;  1JSA A;  2JZI A;  5G08 A;  2CXJ A;  2I18 A;  1CKK A;  2L51 A;  1L7Z A;  3LLE A;  3RLZ A;  1AK8 A;  2JU0 A;  1PSB A;  3SIA A;  1CDM A;  1MF8 B;  2F3Z A;  5CSI A;  1NX0 A;  2M8U A;  3A8R A;  4MN0 A;  2H2K A;  3F45 A;  1QV0 A;  2MLF C;  1NCZ A;  4E68 A;  2WND A;  1DJY A;  3OB1 B;  4OKH A;  5ER4 X;  2OS8 B;  1B7T Z;  4P5O E;  5PAL A;  1DMO A;  3VRQ A;  2M1K B;  1RFJ A;  2NCO A;  1KSO A;  2WOS A;  4I5N B;  2JOJ A;  1OZO A;  4YGC B;  2KHN A;  1HT9 A;  2KFG A;  1RWY A;  2KSP A;  3I5G C;  3TZ1 A;  5JJG A;  1K96 A;  1MXL C;  1KQM C;  1U5I B;  1CFC A;  2ZND A;  2EHB A;  1BR4 B;  5JOL A;  1BT6 A;  1V1F A;  2WOR A;  1UHH A;  3IF7 A;  1QS7 A;  5BPJ A;  1SR6 B;  2VRG A;  1B8L A;  4AQI A;  1SL7 A;  4M2O A;  2ZN9 A;  1YUS A;  1IJ6 A;  4A4C A;  2Y1M A;  1FPW A;  2AMI A;  4WQ2 A;  3I5H B;  1CFF A;  2ZKM X;  4QJ3 B;  1KFX L;  4YI9 A;  1A75 A;  1A2X A;  1OOJ A;  2K0J A;  2LVK A;  4TNC A;  1VRK A;  3TDU A;  1S3P A;  4YGE B;  1H4B A;  2OS8 C;  5D69 A;  3SG7 A;  4M2P A;  4JQ0 D;  1F54 A;  4USL A;  4MEW A;  4PHJ A;  2NCP A;  3O78 A;  1B47 A;  1XYD A;  1DJH A;  5CSJ A;  2V53 A;  4I5K A;  1QAT A;  3NSK A;  4C0L A;  4DIR A;  1K9U A;  1SBJ A;  4XYN A;  3NSO A;  3MSE B;  5HKZ A;  2RGI A;  4PHM A;  1AJ4 A;  5AAN A;  3TS5 B;  2TN4 A;  2GGM A;  3PAT A;  2LE9 B;  1SR6 C;  1JWD A;  3BYA A;  2NLN A;  2LUX A;  3EK8 A;  1EG4 A;  3GK2 A;  4HRG A;  2ZNE A;  1DF0 B;  3BXK A;  2WCE A;  1LKJ A;  4GUK A;  5AER A;  2HF5 A;  1UUR A;  5HLV A;  3DVK A;  3RM1 A;  3I5H C;  2PSR A;  5KU1 A;  3SJS A;  4ORC B;  2PAS A;  3SG3 A;  3HCM A;  5KSZ A;  1NP8 A;  1SK6 D;  2PRU A;  3BOW A;  1M31 A;  4JWQ A;  1KQV A;  3OP0 A;  3CR2 A;  3IQO A;  2MRD A;  3O2P A;  2WCF A;  1WY9 A;  2L98 A;  2Y5I A;  2E6W A;  2LUC A;  4HRE E;  1H8B A;  2JXL A;  1EXR A;  2FJU B;  1QX5 B;  1ZMZ A;  2JWW A;  1F8H A;  1PRW A;  1TCF A;  1YX7 A;  4ZCV A;  3TS5 C;  2BE4 A;  1B9A A;  1C7W A;  1XA5 A;  4PE4 A;  1XK4 A;  3PM8 A;  1EH2 A;  1WDC B;  1N65 A;  4F0Z B;  2ZFD A;  2M3W A;  1QIV A;  2M29 A;  1JFK A;  3AKA A;  1S6I A;  1CDN A;  4MZK A;  1GJY A;  2F2O A;  2MLE C;  4M2Q A;  4YGA A;  1JBA A;  2ZRT A;  1TRF A;  2LHL A;  4I5L B;  4AQJ A;  4PHN A;  1K90 D;  1NUB A;  1R2U A;  1XFY O;  2MBX A;  3FWB A;  1G8I A;  2LVJ A;  5HKY A;  1A29 A;  1ZAC A;  2GGZ A;  3DF0 A;  1TTX A;  1PK0 D;  3CZT X;  2R2I A;  3WHT B;  1A03 A;  1M63 B;  3D0Y A;  1NSH A;  1Y1A A;  2F2P A;  1FF1 A;  1NWD A;  1WRK A;  2IS9 A;  2JNF A;  1CTR A;  1S36 A;  1CLM A;  1MQ1 A;  1Y1U A;  2KGR A;  5DKR A;  3C1V A;  2CCM A;  1G33 A;  2LCP A;  4L9M A;  4N1F A;  1XVJ A;  3SG2 A;  4UPG A;  1WDC C;  4CFQ A;  2LLS A;  3E3R A;  3EVV A;  3I5F B;  1LA3 A;  2LAP A;  2K7O A;  4OVN F;  2HQW A;  2SAS A;  4PE0 A;  3EK7 A;  1YRU B;  2L0P A;  3A4U B;  2KQY A;  1K94 A;  1FI6 A;  4DRW A;  2ZN8 A;  1TNW A;  1JF2 A;  1CLL A;  2LHI A;  1IGV A;  2COL B;  5AXI A;  3SG5 A;  1B4C A;  3EVR A;  1SL9 A;  2KQ6 A;  1ZFS A;  2KDH A;  2H61 A;  2WCB A;  1F70 A;  2JC2 A;  1D1O A;  1ZUZ A;  2O5G A;  1X02 A;  1W7J B;  3BUX B;  2BL0 C;  2F3Y A;  1UP5 A;  3BUM B;  1DGU A;  2K7D A;  1K9P A;  3EVU A;  1WLZ A;  4PDZ A;  3CWG A;  3JVT B;  1MXE A;  3KEV A;  2K2F A;  2KYF A;  1PVA A;  1BOD A;  2LVV A;  1IH0 A;  1XO5 A;  1SPY A;  3I5F C;  1J7Q A;  1L2O B;  1CFP A;  3M0W A;  1SY9 A;  5D7F A;  2ZRS A;  3TDI A;  3WHU B;  1S1E A;  2M1U A;  1XFZ O;  1PVB A;  3PSR A;  3DVJ A;  3QRX A;  1KWO B;  4PHK A;  1G4Y R;  2LAN A;  2LVI A;  4CID A;  1IRJ A;  3VRP A;  1SNL A;  4U8D A;  4MSP A;  4HRH A;  3K21 A;  4JPZ B;  1AP4 A;  1B1G A;  2F8P A;  4GNK B;  5K89 A;  4BY5 A;  2FCE A;  4MBE A;  3LK0 A;  1QV1 A;  3OX5 A;  1TIZ A;  3JTD B;  3KF9 A;  1K95 A;  3LK1 A;  4PE7 A;  4YI8 A;  3IQQ A;  3BUO B;  1OMD A;  2F33 A;  2G9B A;  1PAL A;  1XFU O;  2I7A A;  2O60 A;  1NX3 A;  2DOQ A;  2KBM A;  4ETO A;  3JVT C;  1DVI A;  5CSF A;  2KI4 B;  1DTL A;  2M9G A;  1IWQ A;  2I94 A;  2D8N A;  2M0R A;  2GV5 A;  1SCM B;  2I2R E;  3SG6 A;  1SKT A;  1AVS A;  1U5I A;  2K7C A;  4GPL B;  2KAX A;  1L2O C;  3EK4 A;  5KTY A;  3GOF A;  1KCY A;  1SL8 A;  1UHJ A;  2ISD A;  1ALW A;  4DUQ A;  2JT3 A;  1GGW A;  1LA0 A;  1KWO C;  1WRZ A;  5I8N A;  3PAL A;  3NXA A;  1EG3 A;  1M45 A;  1CM1 A;  5I2L A;  4NDB A;  2CT9 A;  2OTG B;  1QVI Y;  1YVH A;  4MLW A;  2KFH A;  2JT8 A;  2KAY A;  2HPS A;  2K61 A;  2OPO A;  2LMU A;  2EC6 B;  1QIW A;  1MUX A;  4WRI A;  2KNE A;  3VRR A;  3JTD C;  3PN7 B;  2L4H A;  3DD4 A;  3OX6 A;  4XJK B;  4D1E A;  4QJ5 B;  3D0Y B;  4PE1 A;  2MHH A;  1BJF A;  5B8I B;  1UHI A;  1KFU S;  4OV2 A;  1BMO A;  2KI4 C;  2G2B A;  2SCP A;  2Q4U A;  2HET A;  1SCM C;  1K93 D;  2A4J A;  4ORB B;  1PSR A;  1NYA A;  5F6T A;  5CSN A;  4DS7 A;  3KO0 A;  4OR9 B;  1B8R A;  4PCW A;  1TN4 A;  2CTN A;  4CPV A;  1CLB A;  2LC5 A;  1JC2 A;  5IBW A;  1OZS A;  1LIN A;  3O4Y A;  1J7R A;  1K2H A;  1NIW A;  1XFV O;  2FOT A;  4Q04 A;  1DF0 A;  3GK4 X;  2KFF A;  4GGF A;  2MA2 A;  1DJX A;  1WLM A;  4MZL A;  3SIB A;  2OTG C;  1B7T Y;  1CMG A;  2KBI A;  1XFX O;  3VRN A;  5FYX A;  1CDP A;  3NSI A;  2BL0 B;  1FW4 A;  1RK9 A;  2L50 A;  3PLF B;  1BU3 A;  2BBN A;  2EC6 C;  1S5G Y;  4NQG A;  1DJI A;  1KK7 Y;  1IKU A;  1E8A A;  3PN7 C;  2LLT A;  4MZJ A;  2B1U A;  1F55 A;  1UHN A;  2LP2 A;  4FQO A;  5ER5 A;  1F4Q A;  2KI6 C;  4ICB A;  2LV7 A;  2L5X B;  1BOC A;  5GQQ C;  1YUT A;  2NZ0 A;  2M49 B;  1CM4 A;  1ODB A;  1TOP A;  4ORA B;  3CLN A;  1M46 A;  4OCI A;  1RTP 1;  1V1G A;  4YBH B;  1C7V A;  2JQ6 A;  2PAL A;  4GGN A;  2LMV A;  4PAL A;  1N2D A;  2JT0 A;  1CB1 A;  2LM5 A;  5J3X A;  1QX2 A;  2K2A A;  1TCO B;  2LMT A;  1A75 B;  2M7L A;  2WC8 A;  1DJZ A;  4FTG A;  1LXF C;  2EGD A;  5AEQ A;  5AFP A;  3I5I B;  4GAO A;  3GK1 A;  1CMF A;  2QAC A;  4P2Y B;  2JTZ A;  3TUY B;  1OE9 B;  4N1G A;  4NDC A;  2E30 A;  2H61 C;  4C0K A;  1PUL A;  2M97 A;  1EJ3 A;  3AKB A;  1YUR A;  1CNP A;  3D10 A;  1KFX S;  3TDZ A;  2JXC A;  1S26 D;  2MAZ A;  1TNP A;  2BKH B;  2JTT A;  4BY4 A;  1DT7 B;  1UWO A;  2KOT A;  1S5G Z;  2Q91 A;  1KK7 Z;  3SG4 A;  1DJW A;  1M39 A;  2HQ8 A;  3FIA A;  1FBV A;  1QAS A;  1JFJ A;  1SYM A;  1F4O A;  5HKW A;  1MWN A;  1QJT A;  2CBL A;  1CFD A;  4AOM A;  3ZNI A;  4CFR A;  1SCV A;  1RRO A;  2P6B B;  1OQP A;  2KGB C;  4MVF A;  1REC A;  3WXA A;  1S6C A;  4YRU A;  3H4S E;  4I5J A;  1AJ5 A;  3BOW B;  2BKI B;  1YVL A;  4N5X A;  4CLN A;  1YX8 A;  1UUS A;  1OMR A;  1Q80 A;  1QXP A;  1YR5 A;  1GQM A;  3I5I C;  2MJW B;  4C0J A;  1TNX A;  1NCX A;  1Y1X A;  2QPT A;  3EKJ A;  2M7N A;  3TUY C;  3KHE A;  1ALV A;  1IJ5 A;  1QLK A;  1QX7 A;  2LP3 A;  3PFV A;  3VGO A;  1AHR A;  2JUL A;  5I2O A;  1DGV A;  4ZCU A;  2FCD A;  1IQ3 A;  3LCP C;  3OHM B;  3AAJ A;  2PMY A;  1K8U A;  2BBM A;  5TNC A;  1J1D A;  1NX2 A;  1B8C A;  1K9K A;  1Y0V H;  2BE6 A;  4QJ4 B;  1F71 A;  1CDL A;  3KPX A;  1GGZ A;  2KYC A;  3ZWH A;  2LNK A;  1KK8 B;  1S6J A;  1IQ5 A;  2BCA A;  3CGA A;  1BF5 A;  1AUI B;  4IL1 A;  2CNP A;  1NPQ A;  4GBA A;  1RJV A;  2LLU A;  2Y4Q A;  3LL8 B;  3DF0 B;  3AAK A;  1HQV A;  1NX1 A;  1YUU A;  2JRF A;  1YTZ C;  2JPT A;  2AUC A;  2L4I A;  1BR1 B;  3CR5 X;  3CS1 A;  1BG1 A;  5I2Q A;  3CR4 X;  1QTX A;  3NSL A;  2K8M B;  3ICB A;  4NDD A;  2JNX A;  1R6P A;  1FI5 A;  3DVE A;  2NXQ A;  2AAO A;  3FWC A;  1OMV A;  1XK4 C;  5DKQ A;  3VRO A;  2BCB A;  5HYD A;  1J55 A;  1NCY A;  3HX4 A;  2K7B A;  1ZOT B;  1N0Y A;  3DVM A;  5HLO A;  3OB2 B;  1TNQ A;  1J7P A;  4WQ3 A;  1EL4 A;  2L2E A;  1KSM A;  1MHO A;  1KK8 C;  1SRA A;  1SW8 A;  2PVB A;  3EKH A;  3FS7 A;  1XFW O;  2KI6 D;  1DJG A;  1IG5 A;  4GFT A;  4DCK A;  4GGF C;  1BLQ A;  4R1E A;  3BUW B;  1WRL A;  3BUN B;  3CTN A;  1A4P A;  1KFU L;  4A4B A;  3O6B A;  1LVC D;  4YGB B;  3WNX B;  1J7O A;  1JF0 A;  4HSZ A;  1QVI Z;  5CPV A;  2BCX A;  1J1E A;  1MR8 A;  3BQ3 A;  1SMG A;  4MRX A;  5DKN A;  1OSA A;  1QLS A;  1YRT B;  3I5G B;  2BEC A;  4XJK A;  1C07 A;  1Y6W A;  1KQM B;  2KAV A;  1W7I B;  1JUO A;  4MRY A;  1UHK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...