2WC5A

Structure of bmori gobp2 (general odorant binding protein 2)
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
141
structure length
141
Chain Sequence
TAEVMSHVTAHFGKTLEECREESGLSVDILDEFKHFWSDDFDVVHRELGCAIICMSNKFSLMDDDVRMHHVNMDEYIKSFPNGQVLAEKMVKLIHNCEKQFDTETDDCTRVVKVAACFKEDSRKEGIAPEVAMVEAVIEKY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GENERAL ODORANT-BINDING PROTEIN 1
publication title Characterisation of Bombyx Mori Odorant-Binding Proteins Reveals that a General Odorant-Binding Protein Discriminates between Sex Pheromone Components.
pubmed doi rcsb
source organism Bombyx mori
molecule tags Transport protein
total genus 55
structure length 141
sequence length 141
ec nomenclature
pdb deposition date 2009-03-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01395 PBP_GOBP PBP/GOBP family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.20 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 Pheromone/general odorant binding protein domain 2wc5A00
2FJYA 3FE8A 1P28A 3R1OA 2WCKA 3D75A 1GM0A 4OZDA 2QEOA 3CZ2A 3CZ0A 3B86A 3L4LA 2H8VA 1DQEA 3L4AA 1LS8A 3CABA 1OOIX 2WC5A 4FQTA 2ERBA 1C3ZA 3D78A 3OGNA 2WCJA 4F7FA 3D73A 3S0EA 3S0BA 3B7AA 3BFHA 2PQLA 3QMEA 3BJHA 2JPOA 3DZTA 4INXA 3L47A 1OOFA 2QEVA 1T14A 3Q8IA 3S0GA 3S0AA 2KPHA 3VB1A 3D76A 3RZSA 3CDNA 3B6XA 5EL2A 2GTEA 3R1PA 2WC6A 1C3YA 2P71A 3S0DA 2QDIA 1TUJA 3D77A 1OOHA 3FE6A 3V2LA 2QEBA 2WCHA 3NHTA 4JD9A 3DYEA 3R1VA 3DXLA 5DICA 1OW4A 3PJIA 1XFRA 3BFAA 3K1EA 3CYZA 3BFBA 3NHIA 3B87A 1QWVA 3S0FA 4PT1A 3R72A 4INWA 3NGVA 1ORGA 2P70A 2WCLA 1TWOA 2WCMA 1OOGA 3N7HA 3B88A 3FE9A 2QEHA 3DY9A 3CZ1A 2L2CA 3D74A
chains in the Genus database with same CATH superfamily
1NIWA 1BR4B 1SCMC 1SCMB 1GGZA 4I5LB 2WCBA 3PSRA 3EVUA 2F2PA 2JTTA 2L0PA 1TCOB 2Y1MA 3CR2A 3IQOA 3EG5B 2LHIA 1DJZA 1IGVA 3KPXA 1K2HA 2K7OA 1WRKA 4JPZB 1OOIX 1K94A 2M1KB 3WHUB 1CLBA 1FPWA 1K96A 1M46A 2KOTA 3I5FC 2BAPA 3CZTX 3I5FB 4GAOA 1SMGA 3D73A 2L4HA 4YGEB 1A4PA 2BKIB 2EC6B 4MEWA 1QVIZ 1WLMA 1MF8B 2KBMA 2MHHA 3KO0A 2FCEA 1MHOA 1QJTA 1OE9B 1DT7B 1H8BA 3VRPA 1LA0A 1NYAA 5I2QA 2LP3A 2JWWA 1SRAA 1LINA 1YTZC 2KAYA 4AOMA 4DUQA 1NPQA 3PM2A 2QEVA 2I18A 4NDBA 3S0GA 2TN4A 1KQMB 3F45A 2FOTA 1YUTA 2ZRSA 4YI9A 3D76A 5HKWA 3K21A 1QS7A 1B8LA 5AEQA 5EL2A 1DMOA 1K93D 2GTEA 1M39A 4N1FA 1YURA 1GQMA 3OB2B 1KFXS 1K9PA 2MJWB 5KTYA 1UP5A 4WQ3A 4ORCB 1IJ6A 3EVRA 1NSHA 1PVBA 3PALA 1OOHA 3TS5B 1FI6A 3V2LA 1F4QA 3OHMB 2K7CA 2BKHB 1TRFA 1J7RA 2KLDA 5DKNA 4QJ5B 1XO5A 3R1VA 4ORBB 1XFYO 2H2KA 3BOWA 4HRHA 2I2RE 2KFGA 3OBVA 3SG7A 4XYNA 1RFJA 5JOLA 1A29A 1CM4A 2KGRA 1VRKA 3E3RA 3ZWHA 2M0RA 5CSNA 1B8CA 2AAOA 3CYZA 3K1EA 1F71A 1SKTA 3D0YA 1N65A 2RGIA 1B4CA 4HRGA 3OB1B 1EH2A 1NWDA 1QATA 2LVKA 2K2AA 3BOWB 1B9AA 1AK8A 4YGDB 4ETOA 1SY9A 3NGVA 2JXCA 1LA3A 1NCYA 1SW8A 1CDLA 3GK2A 4HSZA 2GGZA 2F33A 1AJ4A 5D7FA 1XFWO 1R2UA 2WCLA 1MUXA 2E6WA 2PYQA 4QJ3B 4PHJA 3D0YB 3SIAA 1IRJA 1AP4A 1TUZA 1YX7A 1OZSA 2YGUA 3OX5A 4GNKB 1N0YA 4PCWA 1W9ZA 3NSLA 3JTDB 3OX6A 1SR6C 1SR6B 3CZ1A 3I5HB 2DOQA 2SCPA 2FJYA 1NUBA 1WDCC 3FE8A 2LLSA 4FTGA 2L50A 2O60A 3KEVA 1QVIY 1B1GA 2KLEA 1P28A 5D3OA 3SG4A 3VRNA 1LVCD 1DGUA 2GGMA 1KSOA 1OZOA 1W7JB 1ZFSA 3BYAA 2LLTA 1Z2CB 4GFTA 2QEOA 4NDDA 3CZ0A 2KFHA 2IS9A 2OS8C 4GGFA 5AXIA 1C07A 2I7AA 1A2XA 2KAVA 2G9BA 1CKKA 2KGBC 3BUWB 1FI5A 1TOPA 2QACA 4ZCUA 1Q80A 4JQ0D 2K7BA 1RJVA 2PALA 1QIWA 5D69A 3CABA 4GGNA 2LV7A 3GK1A 1IQ5A 1C7WA 4YGCB 1QX7A 1NX0A 2JT3A 4FQTA 5AFPA 1F55A 2ERBA 2EGDA 1C3ZA 1UWOA 2F3ZA 3EVVA 3UO9A 2WCJA 3HCMA 1PULA 2LUCA 1LKJA 1BLQA 2LE9B 3S0EA 3S0BA 4KYNA 2BBNA 1S6JA 2LHLA 5CSFA 5FYXA 3WNXB 2Y1NA 5G08A 1EL4A 2PQLA 2OPOA 2LAPA 1OMDA 5GQQC 2F3YA 3SS5A 4MLWA 3ZNIA 1A03A 2JPOA 4M2PA 1CMFA 1J7PA 2L5XB 3L47A 3IQQA 2PVBA 1S36A 2COLB 2JRFA 1T14A 4MRYA 5HYDA 2I94A 1CNPA 3LK1A 3Q8IA 1KFUL 2AUCA 1DJYA 1S5GY 1EXRA 2KPHA 2BBMA 3EK7A 1XK4A 4MBEA 4D1EA 1KQVA 1AVSA 1BT6A 3NSKA 3B6XA 2LP2A 4QJ4B 4PHNA 2KYCA 3RM1A 1CLLA 4E68A 1SYMA 2WC6A 4MSPA 2NXQA 2ZN9A 2P71A 1C7VA 1PRWA 4MRXA 2EC6C 1BF5A 2LANA 2JNFA 3BUMB 3FE6A 1IG5A 2LUXA 2QEBA 1PK0D 1TIZA 4MZKA 1NX1A 2F2OA 1B7TZ 1EG4A 1K95A 1XK4C 2K61A 1S1EA 2NCPA 2Q4UA 1CDMA 2WCHA 3NHTA 2JU0A 3DYEA 5CSJA 5FI2A 4C0KA 1ALVA 1HQVA 1KK7Z 3DXLA 1F54A 1XA5A 3SG5A 3WHTB 1DTLA 1S6IA 2ZKMX 1SL9A 1JF0A 5JJGA 1IWQA 1KQMC 1OOJA 1IQ3A 2LMVA 2MRDA 1IIOA 4UPGA 3PATA 3M0WA 4JWQA 2KAXA 1LXFC 2L98A 3NHIA 1BR1B 3DVMA 2M29A 1J7QA 2K7DA 1SL7A 2KI4B 3OP0A 1XFVO 4MZLA 4PDZA 3CTNA 4C0JA 1AHRA 4CFRA 2JQ6A 2MA2A 2PRUA 3TS5C 1PALA 1S3PA 2NCOA 1QLSA 3D10A 3FWBA 3SG2A 1JBAA 1DELA 1DF0A 1ORGA 2P70A 3VRRA 3O6BA 1IKUA 1XYDA 4TNCA 2WCMA 1B47A 4IJ7A 3CR4X 4YGAA 1OOGA 3NSIA 4AQJA 2BCAA 1G8IA 1AJ5A 5DKQA 3B88A 1S5GZ 2CXJA 1CFCA 2K8MB 5HLOA 1NX2A 4IL1A 3DY9A 3UNWA 1BODA 1KFUS 3C1VA 2R2IA 2A4JA 1R6PA 2LLUA 1DF0B 3BUNB 4OKHA 4MVFA 1JFKA 1DJIA 3DVEA 4N1GA 1CFPA 2WCKA 2P6BB 1Y6WA 5K89A 5I2OA 5FI6A 1J7OA 2LVJA 1ZUZA 3I5GB 1WRLA 2M97A 2PMYA 1ODBA 2KFFA 1MXLC 1DJXA 1U5IA 3B86A 2M7NA 3BQ3A 3L4LA 1DQEA 2ISDA 2LMTA 1GGWA 2BNXA 4YGBB 1AUIB 1LS8A 1BJFA 5AANA 1UHNA 4BY5A 2LVVA 5J3XA 3QRXA 1DJGA 1UHHA 4AQIA 1L2OB 3OGNA 2BECA 3JTDC 1TNWA 4F7FA 3I5HC 1KCYA 1YVHA 2JT0A 2MBXA 1QLKA 3DD4A 1MXEA 3PM8A 5FI7A 4PHMA 1BOCA 1TCFA 1FW4A 2D8NA 4MN0A 1U5IB 2CTNA 4PE1A 5HKZA 1ALWA 3QMEA 3PFVA 3BJHA 1B7TY 3DZTA 2VRGA 3O4YA 4INXA 1SCVA 4XJKA 3I5IB 4PALA 1CDNA 1OOFA 4GUKA 1KK7Y 2KBIA 1JUOA 1YUSA 1V1FA 1YRTB 1CFDA 4HREE 3AKBA 1X02A 3NXAA 1XFUO 3VB1A 2MLFC 3CDNA 1QIVA 1CM1A 1F4OA 1L7ZA 1M63B 1NP8A 4M2QA 1MQ1A 3JVTB 2BE4A 2OTGB 3CLNA 3LK0A 4PE4A 4YI8A 1C3YA 1DEKA 1EJ3A 2LC5A 4XJKB 3S0DA 2B1UA 3SIBA 4GGFC 3SS4A 2K60A 1TUJA 2QDIA 1OMRA 4M2OA 3O4XA 1DJHA 4F0ZB 4CFQA 1KSMA 4ORAB 2BCBA 2JULA 1KWOB 4OR9B 2KI6D 2Q91A 5DKRA 4JD9A 2MAZA 2O5GA 3SG3A 1MWNA 2JOJA 5DICA 1OW4A 1PSRA 1ZMZA 1XFZO 2WOSA 1UUSA 1M31A 4R1EA 2JZIA 1A75A 1PVAA 2BL0B 3PN7C 3PN7B 1KK8B 3AKAA 3GOFA 1ZACA 3B87A 1E8AA 1QWVA 1CB1A 3S0FA 1EG3A 3R72A 3SJSA 1QXPA 5KU1A 1JFJA 4INWA 1RECA 5CPVA 1S26D 4DS7A 1W7IB 1CFFA 3A8RA 2LCPA 1A75B 3AAJA 1SL8A 1TNQA 3EKHA 1MR8A 2KQ6A 2HPSA 2KNEA 1CMGA 2LVIA 5I8NA 5TNCA 1GJYA 2WCFA 3O78A 1QV1A 2NLNA 1FF1A 1QX5B 2FCDA 2CCMA 4GBAA 4P2YB 3KF9A 1DJWA 1SSEB 1QASA 2BCXA 1Y0VH 2L5YA 2CT9A 1J1EA 1DVIA 3RLZA 4N5XA 3D74A 5HL1A 4A4CA 2H61A 3NSOA 1UHIA 2KI4C 2KI6C 4CIDA 3R1OA 1NCXA 4DCKA 2M9GA 3D75A 4L9MA 1GM0A 3MSEB 5F6TA 5I2LA 4OZDA 1TTXA 3CZ2A 5HLVA 2WC8A 1PSBA 2KHNA 4PE7A 2LNKA 2CNPA 2H8VA 2JT8A 5ER4X 1M45A 1ZOTB 1IH0A 3L4AA 2HF5A 3KHEA 1CTRA 1RTP1 1SBJA 2KQYA 5KSZA 2H61C 3TDZA 2WC5A 1Y1UA 4I5NB 3IVTA 2AMIA 1SPYA 4CLNA 2V53A 2Y4QA 3D78A 3LCPC 1TNXA 2FJUB 2PASA 3AAKA 1Y1AA 3DVJA 1N2DA 2M7LA 3SG6A 3BXKA 1Z4HA 1YR5A 3B7AA 5AERA 1YVLA 2JXLA 1J55A 3BFHA 1OMVA 3CWGA 2Y5IA 3HX4A 3EK4A 4MZJA 4PE0A 2JNXA 2WORA 1YX8A 3VROA 3FS7A 4BY4A 2CBLA 1TNPA 1OSAA 1WRZA 3I5GC 5BPJA 3TDUA 5B8IB 5HKYA 2K2FA 2L2EA 2KSPA 3BUOB 1JWDA 3VRQA 1NCZA 1RK9A 3DF0A 1SK6D 4NQGA 4YBHB 2JPTA 5CSIA 3S0AA 3FWCA 1SNLA 4WRIA 2ZNEA 2E30A 2MLEC 2WCEA 3RZSA 1NX3A 2JC2A 3CGAA 4ZCVA 1QX2A 2ZFDA 1OQPA 1Y1XA 1L2OC 2ZRTA 3R1PA 1CDPA 1K9KA 2EHBA 3ICBA 2ZN8A 1B8RA 3GK4X 3LLEA 2L51A 3O2PA 1UHKA 3PLFB 5ER5A 1F8HA 1XVJA 2HQWA 3D77A 2LM5A 4FQOA 3BUXB 4CPVA 1CLMA 2SASA 2HETA 4PHKA 3DF0B 1K90D 3H4SE 1WLZA 1YRUB 3CR5X 3EK8A 2QPTA 3DVKA 2BE6A 4A4BA 4C0LA 1JC2A 3EKJA 2M1UA 2JTZA 1TN4A 3I5IC 1H4BA 1DC1A 1QTXA 3WXAA 3LL8B 1JSAA 3PJIA 2M3WA 4OV2A 1RWYA 2G2BA 2F8PA 1XFRA 4OVNF 4OCIA 3BFAA 1YUUA 2GV5A 4P5OE 2KYFA 4DRWA 1G33A 2PSRA 1UHJA 3IF7A 1D1OA 3BFBA 2ZNDA 3JVTC 1WDCB 2OTGC 3A4UB 4I5JA 3FIAA 4PT1A 4NDCA 1FBVA 1S6CA 2HQ8A 2M49B 1BMOA 4JKTA 1IJ5A 4YRUA 1BU3A 2LMUA 3TUYC 1RROA 4I5KA 3TUYB 1F70A 2OS8B 2M8UA 2L4IA 1KWOC 4U8DA 3SS3A 1JF2A 3TZ1A 1TWOA 1K8UA 2K0JA 2WNDA 5IBWA 3CS1A 3VGOA 1K9UA 1HT9A 1QV0A 2KDHA 1XFXO 4USLA 4ICBA 3TDIA 4DIRA 1BG1A 1KFXL 5I94A 1J1DA 2NZ0A 1G4YR 1DGVA 3N7HA 1WY9A 3FE9A 2BL0C 2QEHA 4GPLB 4WQ2A 5PALA 1V1GA 1KK8C 1UURA 2L2CA 4Q04A
chains in the Genus database with same CATH topology
2FJYA 3FE8A 1P28A 3R1OA 2WCKA 3D75A 1GM0A 4OZDA 2QEOA 3CZ2A 3CZ0A 3B86A 3L4LA 2H8VA 1DQEA 3L4AA 1LS8A 3CABA 1OOIX 2WC5A 4FQTA 2ERBA 1C3ZA 3D78A 3OGNA 2WCJA 4F7FA 3D73A 3S0EA 3S0BA 3B7AA 3BFHA 2PQLA 3QMEA 3BJHA 2JPOA 3DZTA 4INXA 3L47A 1OOFA 2QEVA 1T14A 3Q8IA 3S0GA 3S0AA 2KPHA 3VB1A 3D76A 3RZSA 3CDNA 3B6XA 5EL2A 2GTEA 3R1PA 2WC6A 1C3YA 2P71A 3S0DA 2QDIA 1TUJA 3D77A 1OOHA 3FE6A 3V2LA 2QEBA 2WCHA 3NHTA 4JD9A 3DYEA 3R1VA 3DXLA 5DICA 1OW4A 3PJIA 1XFRA 3BFAA 3K1EA 3CYZA 3BFBA 3NHIA 3B87A 1QWVA 3S0FA 4PT1A 3R72A 4INWA 3NGVA 1ORGA 2P70A 2WCLA 1TWOA 2WCMA 1OOGA 3N7HA 3B88A 3FE9A 2QEHA 3DY9A 3CZ1A 2L2CA 3D74A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FJY A;  3FE8 A;  1P28 A;  3R1O A;  2WCK A;  3D75 A;  1GM0 A;  4OZD A;  2QEO A;  3CZ2 A;  3CZ0 A;  3B86 A;  3L4L A;  2H8V A;  1DQE A;  3L4A A;  1LS8 A;  3CAB A;  1OOI X;  2WC5 A;  4FQT A;  2ERB A;  1C3Z A;  3D78 A;  3OGN A;  2WCJ A;  4F7F A;  3D73 A;  3S0E A;  3S0B A;  3B7A A;  3BFH A;  2PQL A;  3QME A;  3BJH A;  2JPO A;  3DZT A;  4INX A;  3L47 A;  1OOF A;  2QEV A;  1T14 A;  3Q8I A;  3S0G A;  3S0A A;  2KPH A;  3VB1 A;  3D76 A;  3RZS A;  3CDN A;  3B6X A;  5EL2 A;  2GTE A;  3R1P A;  2WC6 A;  1C3Y A;  2P71 A;  3S0D A;  2QDI A;  1TUJ A;  3D77 A;  1OOH A;  3FE6 A;  3V2L A;  2QEB A;  2WCH A;  3NHT A;  4JD9 A;  3DYE A;  3R1V A;  3DXL A;  5DIC A;  1OW4 A;  3PJI A;  1XFR A;  3BFA A;  3K1E A;  3CYZ A;  3BFB A;  3NHI A;  3B87 A;  1QWV A;  3S0F A;  4PT1 A;  3R72 A;  4INW A;  3NGV A;  1ORG A;  2P70 A;  2WCL A;  1TWO A;  2WCM A;  1OOG A;  3N7H A;  3B88 A;  3FE9 A;  2QEH A;  3DY9 A;  3CZ1 A;  2L2C A;  3D74 A; 
#chains in the Genus database with same CATH topology
 1NIW A;  1BR4 B;  1SCM C;  1SCM B;  1GGZ A;  4I5L B;  2WCB A;  3PSR A;  3EVU A;  2F2P A;  2JTT A;  2L0P A;  1TCO B;  2Y1M A;  3CR2 A;  3IQO A;  3EG5 B;  2LHI A;  1DJZ A;  1IGV A;  3KPX A;  1K2H A;  2K7O A;  1WRK A;  4JPZ B;  1OOI X;  1K94 A;  2M1K B;  3WHU B;  1CLB A;  1FPW A;  1K96 A;  1M46 A;  2KOT A;  3I5F C;  2BAP A;  3CZT X;  3I5F B;  4GAO A;  1SMG A;  3D73 A;  2L4H A;  4YGE B;  1A4P A;  2BKI B;  2EC6 B;  4MEW A;  1QVI Z;  1WLM A;  1MF8 B;  2KBM A;  2MHH A;  3KO0 A;  2FCE A;  1MHO A;  1QJT A;  1OE9 B;  1DT7 B;  1H8B A;  3VRP A;  1LA0 A;  1NYA A;  5I2Q A;  2LP3 A;  2JWW A;  1SRA A;  1LIN A;  1YTZ C;  2KAY A;  4AOM A;  4DUQ A;  1NPQ A;  3PM2 A;  2QEV A;  2I18 A;  4NDB A;  3S0G A;  2TN4 A;  1KQM B;  3F45 A;  2FOT A;  1YUT A;  2ZRS A;  4YI9 A;  3D76 A;  5HKW A;  3K21 A;  1QS7 A;  1B8L A;  5AEQ A;  5EL2 A;  1DMO A;  1K93 D;  2GTE A;  1M39 A;  4N1F A;  1YUR A;  1GQM A;  3OB2 B;  1KFX S;  1K9P A;  2MJW B;  5KTY A;  1UP5 A;  4WQ3 A;  4ORC B;  1IJ6 A;  3EVR A;  1NSH A;  1PVB A;  3PAL A;  1OOH A;  3TS5 B;  1FI6 A;  3V2L A;  1F4Q A;  3OHM B;  2K7C A;  2BKH B;  1TRF A;  1J7R A;  2KLD A;  5DKN A;  4QJ5 B;  1XO5 A;  3R1V A;  4ORB B;  1XFY O;  2H2K A;  3BOW A;  4HRH A;  2I2R E;  2KFG A;  3OBV A;  3SG7 A;  4XYN A;  1RFJ A;  5JOL A;  1A29 A;  1CM4 A;  2KGR A;  1VRK A;  3E3R A;  3ZWH A;  2M0R A;  5CSN A;  1B8C A;  2AAO A;  3CYZ A;  3K1E A;  1F71 A;  1SKT A;  3D0Y A;  1N65 A;  2RGI A;  1B4C A;  4HRG A;  3OB1 B;  1EH2 A;  1NWD A;  1QAT A;  2LVK A;  2K2A A;  3BOW B;  1B9A A;  1AK8 A;  4YGD B;  4ETO A;  1SY9 A;  3NGV A;  2JXC A;  1LA3 A;  1NCY A;  1SW8 A;  1CDL A;  3GK2 A;  4HSZ A;  2GGZ A;  2F33 A;  1AJ4 A;  5D7F A;  1XFW O;  1R2U A;  2WCL A;  1MUX A;  2E6W A;  2PYQ A;  4QJ3 B;  4PHJ A;  3D0Y B;  3SIA A;  1IRJ A;  1AP4 A;  1TUZ A;  1YX7 A;  1OZS A;  2YGU A;  3OX5 A;  4GNK B;  1N0Y A;  4PCW A;  1W9Z A;  3NSL A;  3JTD B;  3OX6 A;  1SR6 C;  1SR6 B;  3CZ1 A;  3I5H B;  2DOQ A;  2SCP A;  2FJY A;  1NUB A;  1WDC C;  3FE8 A;  2LLS A;  4FTG A;  2L50 A;  2O60 A;  3KEV A;  1QVI Y;  1B1G A;  2KLE A;  1P28 A;  5D3O A;  3SG4 A;  3VRN A;  1LVC D;  1DGU A;  2GGM A;  1KSO A;  1OZO A;  1W7J B;  1ZFS A;  3BYA A;  2LLT A;  1Z2C B;  4GFT A;  2QEO A;  4NDD A;  3CZ0 A;  2KFH A;  2IS9 A;  2OS8 C;  4GGF A;  5AXI A;  1C07 A;  2I7A A;  1A2X A;  2KAV A;  2G9B A;  1CKK A;  2KGB C;  3BUW B;  1FI5 A;  1TOP A;  2QAC A;  4ZCU A;  1Q80 A;  4JQ0 D;  2K7B A;  1RJV A;  2PAL A;  1QIW A;  5D69 A;  3CAB A;  4GGN A;  2LV7 A;  3GK1 A;  1IQ5 A;  1C7W A;  4YGC B;  1QX7 A;  1NX0 A;  2JT3 A;  4FQT A;  5AFP A;  1F55 A;  2ERB A;  2EGD A;  1C3Z A;  1UWO A;  2F3Z A;  3EVV A;  3UO9 A;  2WCJ A;  3HCM A;  1PUL A;  2LUC A;  1LKJ A;  1BLQ A;  2LE9 B;  3S0E A;  3S0B A;  4KYN A;  2BBN A;  1S6J A;  2LHL A;  5CSF A;  5FYX A;  3WNX B;  2Y1N A;  5G08 A;  1EL4 A;  2PQL A;  2OPO A;  2LAP A;  1OMD A;  5GQQ C;  2F3Y A;  3SS5 A;  4MLW A;  3ZNI A;  1A03 A;  2JPO A;  4M2P A;  1CMF A;  1J7P A;  2L5X B;  3L47 A;  3IQQ A;  2PVB A;  1S36 A;  2COL B;  2JRF A;  1T14 A;  4MRY A;  5HYD A;  2I94 A;  1CNP A;  3LK1 A;  3Q8I A;  1KFU L;  2AUC A;  1DJY A;  1S5G Y;  1EXR A;  2KPH A;  2BBM A;  3EK7 A;  1XK4 A;  4MBE A;  4D1E A;  1KQV A;  1AVS A;  1BT6 A;  3NSK A;  3B6X A;  2LP2 A;  4QJ4 B;  4PHN A;  2KYC A;  3RM1 A;  1CLL A;  4E68 A;  1SYM A;  2WC6 A;  4MSP A;  2NXQ A;  2ZN9 A;  2P71 A;  1C7V A;  1PRW A;  4MRX A;  2EC6 C;  1BF5 A;  2LAN A;  2JNF A;  3BUM B;  3FE6 A;  1IG5 A;  2LUX A;  2QEB A;  1PK0 D;  1TIZ A;  4MZK A;  1NX1 A;  2F2O A;  1B7T Z;  1EG4 A;  1K95 A;  1XK4 C;  2K61 A;  1S1E A;  2NCP A;  2Q4U A;  1CDM A;  2WCH A;  3NHT A;  2JU0 A;  3DYE A;  5CSJ A;  5FI2 A;  4C0K A;  1ALV A;  1HQV A;  1KK7 Z;  3DXL A;  1F54 A;  1XA5 A;  3SG5 A;  3WHT B;  1DTL A;  1S6I A;  2ZKM X;  1SL9 A;  1JF0 A;  5JJG A;  1IWQ A;  1KQM C;  1OOJ A;  1IQ3 A;  2LMV A;  2MRD A;  1IIO A;  4UPG A;  3PAT A;  3M0W A;  4JWQ A;  2KAX A;  1LXF C;  2L98 A;  3NHI A;  1BR1 B;  3DVM A;  2M29 A;  1J7Q A;  2K7D A;  1SL7 A;  2KI4 B;  3OP0 A;  1XFV O;  4MZL A;  4PDZ A;  3CTN A;  4C0J A;  1AHR A;  4CFR A;  2JQ6 A;  2MA2 A;  2PRU A;  3TS5 C;  1PAL A;  1S3P A;  2NCO A;  1QLS A;  3D10 A;  3FWB A;  3SG2 A;  1JBA A;  1DEL A;  1DF0 A;  1ORG A;  2P70 A;  3VRR A;  3O6B A;  1IKU A;  1XYD A;  4TNC A;  2WCM A;  1B47 A;  4IJ7 A;  3CR4 X;  4YGA A;  1OOG A;  3NSI A;  4AQJ A;  2BCA A;  1G8I A;  1AJ5 A;  5DKQ A;  3B88 A;  1S5G Z;  2CXJ A;  1CFC A;  2K8M B;  5HLO A;  1NX2 A;  4IL1 A;  3DY9 A;  3UNW A;  1BOD A;  1KFU S;  3C1V A;  2R2I A;  2A4J A;  1R6P A;  2LLU A;  1DF0 B;  3BUN B;  4OKH A;  4MVF A;  1JFK A;  1DJI A;  3DVE A;  4N1G A;  1CFP A;  2WCK A;  2P6B B;  1Y6W A;  5K89 A;  5I2O A;  5FI6 A;  1J7O A;  2LVJ A;  1ZUZ A;  3I5G B;  1WRL A;  2M97 A;  2PMY A;  1ODB A;  2KFF A;  1MXL C;  1DJX A;  1U5I A;  3B86 A;  2M7N A;  3BQ3 A;  3L4L A;  1DQE A;  2ISD A;  2LMT A;  1GGW A;  2BNX A;  4YGB B;  1AUI B;  1LS8 A;  1BJF A;  5AAN A;  1UHN A;  4BY5 A;  2LVV A;  5J3X A;  3QRX A;  1DJG A;  1UHH A;  4AQI A;  1L2O B;  3OGN A;  2BEC A;  3JTD C;  1TNW A;  4F7F A;  3I5H C;  1KCY A;  1YVH A;  2JT0 A;  2MBX A;  1QLK A;  3DD4 A;  1MXE A;  3PM8 A;  5FI7 A;  4PHM A;  1BOC A;  1TCF A;  1FW4 A;  2D8N A;  4MN0 A;  1U5I B;  2CTN A;  4PE1 A;  5HKZ A;  1ALW A;  3QME A;  3PFV A;  3BJH A;  1B7T Y;  3DZT A;  2VRG A;  3O4Y A;  4INX A;  1SCV A;  4XJK A;  3I5I B;  4PAL A;  1CDN A;  1OOF A;  4GUK A;  1KK7 Y;  2KBI A;  1JUO A;  1YUS A;  1V1F A;  1YRT B;  1CFD A;  4HRE E;  3AKB A;  1X02 A;  3NXA A;  1XFU O;  3VB1 A;  2MLF C;  3CDN A;  1QIV A;  1CM1 A;  1F4O A;  1L7Z A;  1M63 B;  1NP8 A;  4M2Q A;  1MQ1 A;  3JVT B;  2BE4 A;  2OTG B;  3CLN A;  3LK0 A;  4PE4 A;  4YI8 A;  1C3Y A;  1DEK A;  1EJ3 A;  2LC5 A;  4XJK B;  3S0D A;  2B1U A;  3SIB A;  4GGF C;  3SS4 A;  2K60 A;  1TUJ A;  2QDI A;  1OMR A;  4M2O A;  3O4X A;  1DJH A;  4F0Z B;  4CFQ A;  1KSM A;  4ORA B;  2BCB A;  2JUL A;  1KWO B;  4OR9 B;  2KI6 D;  2Q91 A;  5DKR A;  4JD9 A;  2MAZ A;  2O5G A;  3SG3 A;  1MWN A;  2JOJ A;  5DIC A;  1OW4 A;  1PSR A;  1ZMZ A;  1XFZ O;  2WOS A;  1UUS A;  1M31 A;  4R1E A;  2JZI A;  1A75 A;  1PVA A;  2BL0 B;  3PN7 C;  3PN7 B;  1KK8 B;  3AKA A;  3GOF A;  1ZAC A;  3B87 A;  1E8A A;  1QWV A;  1CB1 A;  3S0F A;  1EG3 A;  3R72 A;  3SJS A;  1QXP A;  5KU1 A;  1JFJ A;  4INW A;  1REC A;  5CPV A;  1S26 D;  4DS7 A;  1W7I B;  1CFF A;  3A8R A;  2LCP A;  1A75 B;  3AAJ A;  1SL8 A;  1TNQ A;  3EKH A;  1MR8 A;  2KQ6 A;  2HPS A;  2KNE A;  1CMG A;  2LVI A;  5I8N A;  5TNC A;  1GJY A;  2WCF A;  3O78 A;  1QV1 A;  2NLN A;  1FF1 A;  1QX5 B;  2FCD A;  2CCM A;  4GBA A;  4P2Y B;  3KF9 A;  1DJW A;  1SSE B;  1QAS A;  2BCX A;  1Y0V H;  2L5Y A;  2CT9 A;  1J1E A;  1DVI A;  3RLZ A;  4N5X A;  3D74 A;  5HL1 A;  4A4C A;  2H61 A;  3NSO A;  1UHI A;  2KI4 C;  2KI6 C;  4CID A;  3R1O A;  1NCX A;  4DCK A;  2M9G A;  3D75 A;  4L9M A;  1GM0 A;  3MSE B;  5F6T A;  5I2L A;  4OZD A;  1TTX A;  3CZ2 A;  5HLV A;  2WC8 A;  1PSB A;  2KHN A;  4PE7 A;  2LNK A;  2CNP A;  2H8V A;  2JT8 A;  5ER4 X;  1M45 A;  1ZOT B;  1IH0 A;  3L4A A;  2HF5 A;  3KHE A;  1CTR A;  1RTP 1;  1SBJ A;  2KQY A;  5KSZ A;  2H61 C;  3TDZ A;  2WC5 A;  1Y1U A;  4I5N B;  3IVT A;  2AMI A;  1SPY A;  4CLN A;  2V53 A;  2Y4Q A;  3D78 A;  3LCP C;  1TNX A;  2FJU B;  2PAS A;  3AAK A;  1Y1A A;  3DVJ A;  1N2D A;  2M7L A;  3SG6 A;  3BXK A;  1Z4H A;  1YR5 A;  3B7A A;  5AER A;  1YVL A;  2JXL A;  1J55 A;  3BFH A;  1OMV A;  3CWG A;  2Y5I A;  3HX4 A;  3EK4 A;  4MZJ A;  4PE0 A;  2JNX A;  2WOR A;  1YX8 A;  3VRO A;  3FS7 A;  4BY4 A;  2CBL A;  1TNP A;  1OSA A;  1WRZ A;  3I5G C;  5BPJ A;  3TDU A;  5B8I B;  5HKY A;  2K2F A;  2L2E A;  2KSP A;  3BUO B;  1JWD A;  3VRQ A;  1NCZ A;  1RK9 A;  3DF0 A;  1SK6 D;  4NQG A;  4YBH B;  2JPT A;  5CSI A;  3S0A A;  3FWC A;  1SNL A;  4WRI A;  2ZNE A;  2E30 A;  2MLE C;  2WCE A;  3RZS A;  1NX3 A;  2JC2 A;  3CGA A;  4ZCV A;  1QX2 A;  2ZFD A;  1OQP A;  1Y1X A;  1L2O C;  2ZRT A;  3R1P A;  1CDP A;  1K9K A;  2EHB A;  3ICB A;  2ZN8 A;  1B8R A;  3GK4 X;  3LLE A;  2L51 A;  3O2P A;  1UHK A;  3PLF B;  5ER5 A;  1F8H A;  1XVJ A;  2HQW A;  3D77 A;  2LM5 A;  4FQO A;  3BUX B;  4CPV A;  1CLM A;  2SAS A;  2HET A;  4PHK A;  3DF0 B;  1K90 D;  3H4S E;  1WLZ A;  1YRU B;  3CR5 X;  3EK8 A;  2QPT A;  3DVK A;  2BE6 A;  4A4B A;  4C0L A;  1JC2 A;  3EKJ A;  2M1U A;  2JTZ A;  1TN4 A;  3I5I C;  1H4B A;  1DC1 A;  1QTX A;  3WXA A;  3LL8 B;  1JSA A;  3PJI A;  2M3W A;  4OV2 A;  1RWY A;  2G2B A;  2F8P A;  1XFR A;  4OVN F;  4OCI A;  3BFA A;  1YUU A;  2GV5 A;  4P5O E;  2KYF A;  4DRW A;  1G33 A;  2PSR A;  1UHJ A;  3IF7 A;  1D1O A;  3BFB A;  2ZND A;  3JVT C;  1WDC B;  2OTG C;  3A4U B;  4I5J A;  3FIA A;  4PT1 A;  4NDC A;  1FBV A;  1S6C A;  2HQ8 A;  2M49 B;  1BMO A;  4JKT A;  1IJ5 A;  4YRU A;  1BU3 A;  2LMU A;  3TUY C;  1RRO A;  4I5K A;  3TUY B;  1F70 A;  2OS8 B;  2M8U A;  2L4I A;  1KWO C;  4U8D A;  3SS3 A;  1JF2 A;  3TZ1 A;  1TWO A;  1K8U A;  2K0J A;  2WND A;  5IBW A;  3CS1 A;  3VGO A;  1K9U A;  1HT9 A;  1QV0 A;  2KDH A;  1XFX O;  4USL A;  4ICB A;  3TDI A;  4DIR A;  1BG1 A;  1KFX L;  5I94 A;  1J1D A;  2NZ0 A;  1G4Y R;  1DGV A;  3N7H A;  1WY9 A;  3FE9 A;  2BL0 C;  2QEH A;  4GPL B;  4WQ2 A;  5PAL A;  1V1G A;  1KK8 C;  1UUR A;  2L2C A;  4Q04 A; 
#chains in the Genus database with same CATH homology
 2FJY A;  3FE8 A;  1P28 A;  3R1O A;  2WCK A;  3D75 A;  1GM0 A;  4OZD A;  2QEO A;  3CZ2 A;  3CZ0 A;  3B86 A;  3L4L A;  2H8V A;  1DQE A;  3L4A A;  1LS8 A;  3CAB A;  1OOI X;  2WC5 A;  4FQT A;  2ERB A;  1C3Z A;  3D78 A;  3OGN A;  2WCJ A;  4F7F A;  3D73 A;  3S0E A;  3S0B A;  3B7A A;  3BFH A;  2PQL A;  3QME A;  3BJH A;  2JPO A;  3DZT A;  4INX A;  3L47 A;  1OOF A;  2QEV A;  1T14 A;  3Q8I A;  3S0G A;  3S0A A;  2KPH A;  3VB1 A;  3D76 A;  3RZS A;  3CDN A;  3B6X A;  5EL2 A;  2GTE A;  3R1P A;  2WC6 A;  1C3Y A;  2P71 A;  3S0D A;  2QDI A;  1TUJ A;  3D77 A;  1OOH A;  3FE6 A;  3V2L A;  2QEB A;  2WCH A;  3NHT A;  4JD9 A;  3DYE A;  3R1V A;  3DXL A;  5DIC A;  1OW4 A;  3PJI A;  1XFR A;  3BFA A;  3K1E A;  3CYZ A;  3BFB A;  3NHI A;  3B87 A;  1QWV A;  3S0F A;  4PT1 A;  3R72 A;  4INW A;  3NGV A;  1ORG A;  2P70 A;  2WCL A;  1TWO A;  2WCM A;  1OOG A;  3N7H A;  3B88 A;  3FE9 A;  2QEH A;  3DY9 A;  3CZ1 A;  2L2C A;  3D74 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...