2WC5A

Structure of bmori gobp2 (general odorant binding protein 2)
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
141
structure length
141
Chain Sequence
TAEVMSHVTAHFGKTLEECREESGLSVDILDEFKHFWSDDFDVVHRELGCAIICMSNKFSLMDDDVRMHHVNMDEYIKSFPNGQVLAEKMVKLIHNCEKQFDTETDDCTRVVKVAACFKEDSRKEGIAPEVAMVEAVIEKY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords GENERAL ODORANT-BINDING PROTEIN 1
publication title Characterisation of Bombyx Mori Odorant-Binding Proteins Reveals that a General Odorant-Binding Protein Discriminates between Sex Pheromone Components.
pubmed doi rcsb
source organism Bombyx mori
total genus 55
structure length 141
sequence length 141
ec nomenclature
pdb deposition date 2009-03-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01395 PBP_GOBP PBP/GOBP family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.20 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 Pheromone/general odorant binding protein domain 2wc5A00
3D78A 1OOGA 3CZ1A 2WCJA 1ORGA 1XFRA 2WCMA 1DQEA 3DXLA 1OOFA 1TWOA 3PJIA 1OOIX 1LS8A 3B7AA 4INXA 2WCKA 5DICA 3BFBA 3Q8IA 3R72A 4FQTA 3DZTA 3B87A 3L47A 3BFHA 2QEBA 3QMEA 3V2LA 2ERBA 2FJYA 3L4LA 3D77A 3B6XA 3FE9A 4OZDA 3L4AA 2QEVA 3S0GA 1P28A 3CDNA 3D74A 3CYZA 3D75A 3S0AA 1C3YA 3B88A 3N7HA 3CZ2A 3CZ0A 2JPOA 1C3ZA 3BFAA 3D73A 1GM0A 2L2CA 3R1PA 1T14A 3RZSA 3NHTA 1TUJA 3DYEA 3OGNA 3R1VA 2P71A 2KPHA 2WC6A 3K1EA 4INWA 2WC5A 2PQLA 3CABA 3NGVA 3R1OA 3D76A 2QEOA 2GTEA 3BJHA 2WCLA 1OW4A 2WCHA 3VB1A 1QWVA 4JD9A 4PT1A 3FE6A 1OOHA 3DY9A 3S0BA 3B86A 5EL2A 2P70A 4F7FA 3S0FA 2H8VA 3S0EA 3S0DA 2QDIA 2QEHA 3NHIA 3FE8A
chains in the Genus database with same CATH superfamily
3TUYB 5I2OA 1DJWA 1NX2A 3JVTB 2I2RE 1MUXA 3AKBA 4PALA 1ZOTB 2KI4C 1KQVA 5JJGA 1XFXO 2EC6B 1RJVA 1A2XA 1W7IB 3E3RA 3FS7A 3LK1A 4DS7A 1R2UA 1ORGA 1XFRA 4PHNA 4XJKA 5B8IB 1PALA 1Z2CB 2HETA 3I5FB 3PATA 5FI2A 3WHTB 2KGBC 5GQQC 3SIAA 1JFJA 4MZKA 4OCIA 3O4XA 3SS3A 1B8LA 3AAKA 3I5HC 4XJKB 1CDNA 2MBXA 4ETOA 2PYQA 1IJ5A 2KBMA 2KLDA 3OBVA 1BF5A 2FCEA 2KLEA 1QJTA 1MR8A 1S3PA 4INXA 1TN4A 1TNXA 4HREE 2WCKA 2LE9B 2HF5A 1Y1XA 3LLEA 4YGCB 3NSLA 1KK7Y 1PULA 1KQMB 1WRLA 1YX7A 2Q4UA 3DZTA 1AJ5A 1DGUA 3L47A 1RTP1 2JRFA 5G08A 2LANA 1SCMB 5CSFA 1KWOC 2L4HA 3F45A 3FWCA 3PM2A 2K7CA 3FE9A 3B6XA 3BQ3A 1J7RA 1BR4B 2K8MB 3D0YB 1PVAA 3EKHA 3DD4A 3S0GA 5CPVA 2YGUA 1CM4A 4GBAA 4D1EA 5ER4X 1C3YA 1QASA 1QV0A 1YUUA 2KDHA 4USLA 1MQ1A 4WQ2A 1F4QA 2I94A 2KYCA 1WLMA 1C3ZA 1GQMA 3BFAA 1EJ3A 4P2YB 4WRIA 5BPJA 1CLBA 1K9KA 2M0RA 1YR5A 1G33A 2L5XB 2BL0C 3LL8B 2M7NA 1GM0A 1XFWO 3DF0A 2F2PA 1RFJA 1SRAA 2NCPA 3GK4X 4OR9B 1T14A 1SBJA 3ZNIA 2JOJA 2AUCA 5AEQA 1QX5B 1BJFA 2L2EA 1WLZA 3TDZA 2PRUA 2LV7A 1E8AA 3DF0B 3NHTA 2K61A 1TUJA 4GPLB 1D1OA 3DVMA 3IQOA 1XFUO 2BCXA 3EK8A 1OMDA 1W7JB 1PK0D 4I5LB 4GUKA 1S6CA 1G4YR 2D8NA 2JNFA 4M2OA 3OB1B 2JU0A 1RWYA 1MF8B 1U5IA 3NSOA 2M1UA 3KHEA 4INWA 1AVSA 1SR6C 2MLEC 5AERA 2ZN9A 1BU3A 3CLNA 2F2OA 4PE7A 1B7TY 3NGVA 1PRWA 3PN7C 1KSMA 4N1GA 2KFGA 5HYDA 1EXRA 3BUWB 1LINA 3D76A 1IKUA 1U5IB 1Y6WA 3SIBA 1UHHA 1OE9B 4ICBA 2WCLA 1K96A 2MHHA 2GV5A 4JPZB 4L9MA 1KCYA 3DVEA 3DVJA 1NP8A 1AJ4A 2K0JA 3HX4A 3M0WA 5I94A 5I8NA 1NWDA 1H8BA 1UURA 3VRRA 3AAJA 2FJUB 1QX7A 5DKQA 1TNPA 1XA5A 5HLOA 5HKYA 2ZRTA 3BUXB 3BOWA 2CTNA 3I5IB 1SCVA 1DGVA 3S0EA 2ZKMX 1K9UA 2QPTA 1RK9A 2LP3A 3IVTA 3SS4A 1K9PA 2KFHA 2LLSA 3BOWB 1DT7B 5CSIA 4Q04A 3D78A 1M63B 1J7QA 3CZ1A 2LNKA 1YVLA 2BE6A 4A4CA 1Y1UA 2JT8A 3O6BA 4JWQA 3GK2A 2M3WA 3DXLA 1DQEA 3PLFB 1DMOA 1CFDA 4YGEB 4CPVA 1VRKA 3TS5C 3VRNA 2PMYA 1LS8A 1SL9A 5KSZA 1OMVA 3TUYC 4NQGA 1M45A 4E68A 1C7WA 2MJWB 1IGVA 3ICBA 3WHUB 1ZUZA 2LVVA 1QLKA 4C0LA 2JT3A 4PE4A 2A4JA 1K8UA 3JTDB 1QXPA 2BE4A 1KK7Z 3IF7A 2PVBA 1ODBA 4DCKA 3QMEA 3V2LA 1M31A 2ERBA 1XK4A 2FJYA 3OP0A 5AXIA 3BYAA 3BUMB 1A4PA 1PVBA 2QACA 3D77A 4DIRA 1SL7A 3CZTX 1KSOA 1B47A 3H4SE 3WNXB 1KFXL 4AQJA 1BLQA 2BBMA 2LVIA 1P28A 2KI6D 3CYZA 2H61C 1SSEB 3D75A 3S0AA 2KI6C 1DJZA 2WCFA 3CWGA 2LVJA 4GFTA 1RROA 1XFYO 1KK8B 1RECA 2G9BA 2O5GA 1CFFA 3VRPA 2AAOA 5FI6A 1BODA 5I2LA 1OZSA 2Y4QA 2CXJA 3D73A 1YX8A 2EHBA 1NX0A 4YGAA 2KYFA 4KYNA 4C0JA 2K2FA 2K2AA 3PFVA 4M2QA 2I7AA 3MSEB 4OVNF 1BMOA 1S5GY 1QLSA 2L98A 1A29A 1DJHA 3CR4X 3TZ1A 3RZSA 4M2PA 3KO0A 5HKZA 3OX5A 1FI5A 1CMFA 1QVIZ 1JFKA 3TDIA 1TCFA 1XFVO 2KPHA 2NZ0A 2WC6A 3BUOB 2WCEA 3K1EA 2CBLA 4YGDB 3A8RA 4YI9A 3LCPC 1IQ5A 1H4BA 5DKNA 1DELA 1FF1A 5D69A 1ZMZA 3VRQA 3UO9A 1J55A 1WRKA 2GTEA 1B9AA 1B8RA 1OW4A 2LLUA 1SNLA 1CM1A 3KEVA 1K93D 1KFXS 1QIVA 1Z4HA 1DJIA 1TTXA 1X02A 2KQYA 2OTGB 2WCHA 3CTNA 3EKJA 3O4YA 1IIOA 2EGDA 3WXAA 2M49B 4GGNA 4YRUA 4P5OE 1GJYA 2LMTA 3EVUA 4ZCUA 2Y1MA 1KWOB 3NXAA 1NPQA 1OOHA 5AFPA 3OX6A 4PHMA 2CT9A 3DY9A 3S0BA 2ZRSA 3NSKA 2F3YA 4JQ0D 3IQQA 1YTZC 1NCYA 3A4UB 3VGOA 1TRFA 1OMRA 2H8VA 3S0DA 1SW8A 5J3XA 1NCZA 2NLNA 3PALA 4PHKA 2L50A 2HPSA 2F3ZA 1ZFSA 1WY9A 2K7OA 4F0ZB 1W9ZA 1YURA 2K7DA 1QS7A 5CSJA 1UUSA 1OOGA 5DKRA 3EK4A 1DC1A 3GOFA 2LUCA 1WRZA 3ZWHA 1JBAA 2WCJA 3RLZA 2LHLA 1JF2A 1N0YA 2WCMA 1NCXA 4MSPA 5D3OA 1S6IA 1FBVA 1MWNA 1OOFA 1LKJA 1Q80A 1QTXA 1OSAA 1TWOA 1UHIA 1J7PA 1F55A 2JULA 1IG5A 2BCBA 2OS8B 1OOIX 2KOTA 2Q91A 2LCPA 1SK6D 1IH0A 2GGZA 1NSHA 3BXKA 3BUNB 4GNKB 1J1DA 1CLMA 2I18A 3B7AA 1UHJA 2JXCA 1L2OC 1JWDA 1UHKA 1BR1B 3BFBA 3I5GC 1HT9A 4MZLA 1QIWA 2M29A 3R72A 4GGFA 1BG1A 4QJ5B 3B87A 4CFRA 1YUSA 4UPGA 2MAZA 3PN7B 1AUIB 1FI6A 2KBIA 4QJ3B 1XFZO 1J1EA 1MXEA 3NSIA 1NUBA 1CFCA 1DEKA 3CR5X 1GGZA 4MRYA 1N2DA 2JPTA 1F4OA 1TUZA 1KFUL 4IL1A 2M9GA 2FOTA 4OZDA 3L4AA 1JF0A 1OQPA 1Y1AA 2KSPA 2QEVA 3EG5B 4CLNA 2RGIA 2KAVA 3RM1A 1WDCB 3CDNA 2M97A 4C0KA 1BOCA 3B88A 3JTDC 3CZ2A 2K7BA 3JVTC 2JPOA 3CR2A 4CIDA 2JT0A 4MEWA 3LK0A 2SASA 2EC6C 1NYAA 1S26D 2L0PA 5AANA 4AQIA 4NDBA 3SJSA 2L2CA 3R1PA 2P6BB 4BY4A 5IBWA 3I5FC 1K2HA 2LM5A 1XK4C 2JQ6A 5JOLA 3PM8A 2HQ8A 1IQ3A 2E30A 4MRXA 4PDZA 3OGNA 1KK8C 1FW4A 1UP5A 2WNDA 2V53A 3CS1A 3R1VA 1R6PA 4I5KA 4WQ3A 3SG3A 5KU1A 3EVRA 2VRGA 2ISDA 2LUXA 2KHNA 1A03A 2KAXA 1KQMC 5F6TA 2WC5A 2PQLA 3SG7A 3PSRA 4PE0A 3HCMA 3R1OA 1K90D 1ZACA 2WORA 2QEOA 2Y1NA 1SCMC 2ZNDA 1LXFC 1KFUS 3O2PA 3SS5A 1CFPA 1IWQA 5HL1A 1N65A 1MHOA 2L51A 1LA3A 1QWVA 4XYNA 5HKWA 2WOSA 4JD9A 4PT1A 1FPWA 3FE6A 2JC2A 1PSRA 2BNXA 2KI4B 4FQOA 1V1FA 2LC5A 1XO5A 1JUOA 2FCDA 2L4IA 2H61A 2BAPA 1CNPA 2NCOA 4MBEA 4A4BA 1J7OA 1F54A 3B86A 5EL2A 3S0FA 4F7FA 1TIZA 2BECA 1EL4A 3AKAA 2PASA 2TN4A 1NX3A 1DJGA 1QV1A 3I5HB 1M46A 3CGAA 1SMGA 2BCAA 2OTGC 1B7TZ 3DVKA 1ALVA 4NDCA 1G8IA 1IJ6A 4ORAB 1DF0A 1PSBA 3D0YA 1TOPA 4N1FA 4OKHA 1EG3A 1YRTB 2MLFC 3QRXA 1C07A 1F71A 1DJXA 3KPXA 3C1VA 1DF0B 1GGWA 1M39A 1LVCD 3SG6A 3O78A 3PJIA 4N5XA 5FYXA 1CB1A 1A75A 1YUTA 2LMVA 4AOMA 4YBHB 3OHMB 2ZN8A 2CNPA 4ORCB 2OPOA 1SPYA 5DICA 5I2QA 1AK8A 2LP2A 1A75B 1K94A 1LA0A 2F8PA 3Q8IA 2AMIA 1CTRA 4FQTA 1AHRA 4CFQA 3BFHA 1B8CA 2QEBA 3TDUA 1DTLA 1K95A 1TNWA 2DOQA 2K60A 2LVKA 1IRJA 3D10A 4PCWA 3K21A 1V1GA 1XVJA 3L4LA 2OS8C 4QJ4B 1F70A 1OZOA 1NIWA 2BL0B 2COLB 3UNWA 4DRWA 1QVIY 1DVIA 1SYMA 3EVVA 2JWWA 3I5IC 3VROA 2WCBA 5CSNA 4ORBB 3D74A 1EH2A 1S6JA 2JZIA 2Y5IA 3SG2A 1S36A 2WC8A 4HRGA 2ZFDA 3N7HA 4I5NB 2JXLA 3CZ0A 2JTTA 2M8UA 2MRDA 4HSZA 3OB2B 4MLWA 1DJYA 4OV2A 4R1EA 2G2BA 2KNEA 4YGBB 1EG4A 4GGFC 2B1UA 1UWOA 1AP4A 1SR6B 2KAYA 1NX1A 4HRHA 4PHJA 1B1GA 1CMGA 1L7ZA 1S1EA 4MVFA 1SKTA 3SG4A 1BT6A 2HQWA 1WDCC 4ZCVA 2ZNEA 5HLVA 2IS9A 4TNCA 3DYEA 1C7VA 1B4CA 2F33A 2GGMA 1JC2A 2P71A 2O60A 1QX2A 1JSAA 2MA2A 4JKTA 2JTZA 2LLTA 4U8DA 1CKKA 1SL8A 3SG5A 4DUQA 2BKIB 2M7LA 2BKHB 1SY9A 3CABA 5D7FA 2R2IA 2PALA 1CDLA 1XYDA 1CDMA 2KGRA 4FTGA 2CCMA 1CDPA 3KF9A 5ER5A 4BY5A 1OOJA 3BJHA 3FWBA 2E6WA 1L2OB 2KQ6A 1CLLA 1HQVA 3I5GB 1MXLC 4I5JA 2JNXA 3VB1A 2LHIA 1S5GZ 2NXQA 4NDDA 1UHNA 3GK1A 2L5YA 1YVHA 5FI7A 4GAOA 2PSRA 5KTYA 1QATA 1F8HA 2LMUA 4MZJA 2H2KA 1Y0VH 3FIAA 2SCPA 5TNCA 2P70A 4YI8A 4IJ7A 2LAPA 1ALWA 1YRUB 2QDIA 1TNQA 2KFFA 4PE1A 3TS5B 2QEHA 2BBNA 4MN0A 5PALA 3EK7A 3NHIA 3FE8A 1TCOB 5K89A 2M1KB
chains in the Genus database with same CATH topology
3D78A 1OOGA 3CZ1A 2WCJA 1ORGA 1XFRA 2WCMA 1DQEA 3DXLA 1OOFA 1TWOA 3PJIA 1OOIX 1LS8A 3B7AA 4INXA 2WCKA 5DICA 3BFBA 3Q8IA 3R72A 4FQTA 3DZTA 3B87A 3L47A 3BFHA 2QEBA 3QMEA 3V2LA 2ERBA 2FJYA 3L4LA 3D77A 3B6XA 3FE9A 4OZDA 3L4AA 2QEVA 3S0GA 1P28A 3CDNA 3D74A 3CYZA 3D75A 3S0AA 1C3YA 3B88A 3N7HA 3CZ2A 3CZ0A 2JPOA 1C3ZA 3BFAA 3D73A 1GM0A 2L2CA 3R1PA 1T14A 3RZSA 3NHTA 1TUJA 3DYEA 3OGNA 3R1VA 2P71A 2KPHA 2WC6A 3K1EA 4INWA 2WC5A 2PQLA 3CABA 3NGVA 3R1OA 3D76A 2QEOA 2GTEA 3BJHA 2WCLA 1OW4A 2WCHA 3VB1A 1QWVA 4JD9A 4PT1A 3FE6A 1OOHA 3DY9A 3S0BA 3B86A 5EL2A 2P70A 4F7FA 3S0FA 2H8VA 3S0EA 3S0DA 2QDIA 2QEHA 3NHIA 3FE8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3D78 A;  1OOG A;  3CZ1 A;  2WCJ A;  1ORG A;  1XFR A;  2WCM A;  1DQE A;  3DXL A;  1OOF A;  1TWO A;  3PJI A;  1OOI X;  1LS8 A;  3B7A A;  4INX A;  2WCK A;  5DIC A;  3BFB A;  3Q8I A;  3R72 A;  4FQT A;  3DZT A;  3B87 A;  3L47 A;  3BFH A;  2QEB A;  3QME A;  3V2L A;  2ERB A;  2FJY A;  3L4L A;  3D77 A;  3B6X A;  3FE9 A;  4OZD A;  3L4A A;  2QEV A;  3S0G A;  1P28 A;  3CDN A;  3D74 A;  3CYZ A;  3D75 A;  3S0A A;  1C3Y A;  3B88 A;  3N7H A;  3CZ2 A;  3CZ0 A;  2JPO A;  1C3Z A;  3BFA A;  3D73 A;  1GM0 A;  2L2C A;  3R1P A;  1T14 A;  3RZS A;  3NHT A;  1TUJ A;  3DYE A;  3OGN A;  3R1V A;  2P71 A;  2KPH A;  2WC6 A;  3K1E A;  4INW A;  2WC5 A;  2PQL A;  3CAB A;  3NGV A;  3R1O A;  3D76 A;  2QEO A;  2GTE A;  3BJH A;  2WCL A;  1OW4 A;  2WCH A;  3VB1 A;  1QWV A;  4JD9 A;  4PT1 A;  3FE6 A;  1OOH A;  3DY9 A;  3S0B A;  3B86 A;  5EL2 A;  2P70 A;  4F7F A;  3S0F A;  2H8V A;  3S0E A;  3S0D A;  2QDI A;  2QEH A;  3NHI A;  3FE8 A; 
#chains in the Genus database with same CATH topology
 3TUY B;  5I2O A;  1DJW A;  1NX2 A;  3JVT B;  2I2R E;  1MUX A;  3AKB A;  4PAL A;  1ZOT B;  2KI4 C;  1KQV A;  5JJG A;  1XFX O;  2EC6 B;  1RJV A;  1A2X A;  1W7I B;  3E3R A;  3FS7 A;  3LK1 A;  4DS7 A;  1R2U A;  1ORG A;  1XFR A;  4PHN A;  4XJK A;  5B8I B;  1PAL A;  1Z2C B;  2HET A;  3I5F B;  3PAT A;  5FI2 A;  3WHT B;  2KGB C;  5GQQ C;  3SIA A;  1JFJ A;  4MZK A;  4OCI A;  3O4X A;  3SS3 A;  1B8L A;  3AAK A;  3I5H C;  4XJK B;  1CDN A;  2MBX A;  4ETO A;  2PYQ A;  1IJ5 A;  2KBM A;  2KLD A;  3OBV A;  1BF5 A;  2FCE A;  2KLE A;  1QJT A;  1MR8 A;  1S3P A;  4INX A;  1TN4 A;  1TNX A;  4HRE E;  2WCK A;  2LE9 B;  2HF5 A;  1Y1X A;  3LLE A;  4YGC B;  3NSL A;  1KK7 Y;  1PUL A;  1KQM B;  1WRL A;  1YX7 A;  2Q4U A;  3DZT A;  1AJ5 A;  1DGU A;  3L47 A;  1RTP 1;  2JRF A;  5G08 A;  2LAN A;  1SCM B;  5CSF A;  1KWO C;  2L4H A;  3F45 A;  3FWC A;  3PM2 A;  2K7C A;  3FE9 A;  3B6X A;  3BQ3 A;  1J7R A;  1BR4 B;  2K8M B;  3D0Y B;  1PVA A;  3EKH A;  3DD4 A;  3S0G A;  5CPV A;  2YGU A;  1CM4 A;  4GBA A;  4D1E A;  5ER4 X;  1C3Y A;  1QAS A;  1QV0 A;  1YUU A;  2KDH A;  4USL A;  1MQ1 A;  4WQ2 A;  1F4Q A;  2I94 A;  2KYC A;  1WLM A;  1C3Z A;  1GQM A;  3BFA A;  1EJ3 A;  4P2Y B;  4WRI A;  5BPJ A;  1CLB A;  1K9K A;  2M0R A;  1YR5 A;  1G33 A;  2L5X B;  2BL0 C;  3LL8 B;  2M7N A;  1GM0 A;  1XFW O;  3DF0 A;  2F2P A;  1RFJ A;  1SRA A;  2NCP A;  3GK4 X;  4OR9 B;  1T14 A;  1SBJ A;  3ZNI A;  2JOJ A;  2AUC A;  5AEQ A;  1QX5 B;  1BJF A;  2L2E A;  1WLZ A;  3TDZ A;  2PRU A;  2LV7 A;  1E8A A;  3DF0 B;  3NHT A;  2K61 A;  1TUJ A;  4GPL B;  1D1O A;  3DVM A;  3IQO A;  1XFU O;  2BCX A;  3EK8 A;  1OMD A;  1W7J B;  1PK0 D;  4I5L B;  4GUK A;  1S6C A;  1G4Y R;  2D8N A;  2JNF A;  4M2O A;  3OB1 B;  2JU0 A;  1RWY A;  1MF8 B;  1U5I A;  3NSO A;  2M1U A;  3KHE A;  4INW A;  1AVS A;  1SR6 C;  2MLE C;  5AER A;  2ZN9 A;  1BU3 A;  3CLN A;  2F2O A;  4PE7 A;  1B7T Y;  3NGV A;  1PRW A;  3PN7 C;  1KSM A;  4N1G A;  2KFG A;  5HYD A;  1EXR A;  3BUW B;  1LIN A;  3D76 A;  1IKU A;  1U5I B;  1Y6W A;  3SIB A;  1UHH A;  1OE9 B;  4ICB A;  2WCL A;  1K96 A;  2MHH A;  2GV5 A;  4JPZ B;  4L9M A;  1KCY A;  3DVE A;  3DVJ A;  1NP8 A;  1AJ4 A;  2K0J A;  3HX4 A;  3M0W A;  5I94 A;  5I8N A;  1NWD A;  1H8B A;  1UUR A;  3VRR A;  3AAJ A;  2FJU B;  1QX7 A;  5DKQ A;  1TNP A;  1XA5 A;  5HLO A;  5HKY A;  2ZRT A;  3BUX B;  3BOW A;  2CTN A;  3I5I B;  1SCV A;  1DGV A;  3S0E A;  2ZKM X;  1K9U A;  2QPT A;  1RK9 A;  2LP3 A;  3IVT A;  3SS4 A;  1K9P A;  2KFH A;  2LLS A;  3BOW B;  1DT7 B;  5CSI A;  4Q04 A;  3D78 A;  1M63 B;  1J7Q A;  3CZ1 A;  2LNK A;  1YVL A;  2BE6 A;  4A4C A;  1Y1U A;  2JT8 A;  3O6B A;  4JWQ A;  3GK2 A;  2M3W A;  3DXL A;  1DQE A;  3PLF B;  1DMO A;  1CFD A;  4YGE B;  4CPV A;  1VRK A;  3TS5 C;  3VRN A;  2PMY A;  1LS8 A;  1SL9 A;  5KSZ A;  1OMV A;  3TUY C;  4NQG A;  1M45 A;  4E68 A;  1C7W A;  2MJW B;  1IGV A;  3ICB A;  3WHU B;  1ZUZ A;  2LVV A;  1QLK A;  4C0L A;  2JT3 A;  4PE4 A;  2A4J A;  1K8U A;  3JTD B;  1QXP A;  2BE4 A;  1KK7 Z;  3IF7 A;  2PVB A;  1ODB A;  4DCK A;  3QME A;  3V2L A;  1M31 A;  2ERB A;  1XK4 A;  2FJY A;  3OP0 A;  5AXI A;  3BYA A;  3BUM B;  1A4P A;  1PVB A;  2QAC A;  3D77 A;  4DIR A;  1SL7 A;  3CZT X;  1KSO A;  1B47 A;  3H4S E;  3WNX B;  1KFX L;  4AQJ A;  1BLQ A;  2BBM A;  2LVI A;  1P28 A;  2KI6 D;  3CYZ A;  2H61 C;  1SSE B;  3D75 A;  3S0A A;  2KI6 C;  1DJZ A;  2WCF A;  3CWG A;  2LVJ A;  4GFT A;  1RRO A;  1XFY O;  1KK8 B;  1REC A;  2G9B A;  2O5G A;  1CFF A;  3VRP A;  2AAO A;  5FI6 A;  1BOD A;  5I2L A;  1OZS A;  2Y4Q A;  2CXJ A;  3D73 A;  1YX8 A;  2EHB A;  1NX0 A;  4YGA A;  2KYF A;  4KYN A;  4C0J A;  2K2F A;  2K2A A;  3PFV A;  4M2Q A;  2I7A A;  3MSE B;  4OVN F;  1BMO A;  1S5G Y;  1QLS A;  2L98 A;  1A29 A;  1DJH A;  3CR4 X;  3TZ1 A;  3RZS A;  4M2P A;  3KO0 A;  5HKZ A;  3OX5 A;  1FI5 A;  1CMF A;  1QVI Z;  1JFK A;  3TDI A;  1TCF A;  1XFV O;  2KPH A;  2NZ0 A;  2WC6 A;  3BUO B;  2WCE A;  3K1E A;  2CBL A;  4YGD B;  3A8R A;  4YI9 A;  3LCP C;  1IQ5 A;  1H4B A;  5DKN A;  1DEL A;  1FF1 A;  5D69 A;  1ZMZ A;  3VRQ A;  3UO9 A;  1J55 A;  1WRK A;  2GTE A;  1B9A A;  1B8R A;  1OW4 A;  2LLU A;  1SNL A;  1CM1 A;  3KEV A;  1K93 D;  1KFX S;  1QIV A;  1Z4H A;  1DJI A;  1TTX A;  1X02 A;  2KQY A;  2OTG B;  2WCH A;  3CTN A;  3EKJ A;  3O4Y A;  1IIO A;  2EGD A;  3WXA A;  2M49 B;  4GGN A;  4YRU A;  4P5O E;  1GJY A;  2LMT A;  3EVU A;  4ZCU A;  2Y1M A;  1KWO B;  3NXA A;  1NPQ A;  1OOH A;  5AFP A;  3OX6 A;  4PHM A;  2CT9 A;  3DY9 A;  3S0B A;  2ZRS A;  3NSK A;  2F3Y A;  4JQ0 D;  3IQQ A;  1YTZ C;  1NCY A;  3A4U B;  3VGO A;  1TRF A;  1OMR A;  2H8V A;  3S0D A;  1SW8 A;  5J3X A;  1NCZ A;  2NLN A;  3PAL A;  4PHK A;  2L50 A;  2HPS A;  2F3Z A;  1ZFS A;  1WY9 A;  2K7O A;  4F0Z B;  1W9Z A;  1YUR A;  2K7D A;  1QS7 A;  5CSJ A;  1UUS A;  1OOG A;  5DKR A;  3EK4 A;  1DC1 A;  3GOF A;  2LUC A;  1WRZ A;  3ZWH A;  1JBA A;  2WCJ A;  3RLZ A;  2LHL A;  1JF2 A;  1N0Y A;  2WCM A;  1NCX A;  4MSP A;  5D3O A;  1S6I A;  1FBV A;  1MWN A;  1OOF A;  1LKJ A;  1Q80 A;  1QTX A;  1OSA A;  1TWO A;  1UHI A;  1J7P A;  1F55 A;  2JUL A;  1IG5 A;  2BCB A;  2OS8 B;  1OOI X;  2KOT A;  2Q91 A;  2LCP A;  1SK6 D;  1IH0 A;  2GGZ A;  1NSH A;  3BXK A;  3BUN B;  4GNK B;  1J1D A;  1CLM A;  2I18 A;  3B7A A;  1UHJ A;  2JXC A;  1L2O C;  1JWD A;  1UHK A;  1BR1 B;  3BFB A;  3I5G C;  1HT9 A;  4MZL A;  1QIW A;  2M29 A;  3R72 A;  4GGF A;  1BG1 A;  4QJ5 B;  3B87 A;  4CFR A;  1YUS A;  4UPG A;  2MAZ A;  3PN7 B;  1AUI B;  1FI6 A;  2KBI A;  4QJ3 B;  1XFZ O;  1J1E A;  1MXE A;  3NSI A;  1NUB A;  1CFC A;  1DEK A;  3CR5 X;  1GGZ A;  4MRY A;  1N2D A;  2JPT A;  1F4O A;  1TUZ A;  1KFU L;  4IL1 A;  2M9G A;  2FOT A;  4OZD A;  3L4A A;  1JF0 A;  1OQP A;  1Y1A A;  2KSP A;  2QEV A;  3EG5 B;  4CLN A;  2RGI A;  2KAV A;  3RM1 A;  1WDC B;  3CDN A;  2M97 A;  4C0K A;  1BOC A;  3B88 A;  3JTD C;  3CZ2 A;  2K7B A;  3JVT C;  2JPO A;  3CR2 A;  4CID A;  2JT0 A;  4MEW A;  3LK0 A;  2SAS A;  2EC6 C;  1NYA A;  1S26 D;  2L0P A;  5AAN A;  4AQI A;  4NDB A;  3SJS A;  2L2C A;  3R1P A;  2P6B B;  4BY4 A;  5IBW A;  3I5F C;  1K2H A;  2LM5 A;  1XK4 C;  2JQ6 A;  5JOL A;  3PM8 A;  2HQ8 A;  1IQ3 A;  2E30 A;  4MRX A;  4PDZ A;  3OGN A;  1KK8 C;  1FW4 A;  1UP5 A;  2WND A;  2V53 A;  3CS1 A;  3R1V A;  1R6P A;  4I5K A;  4WQ3 A;  3SG3 A;  5KU1 A;  3EVR A;  2VRG A;  2ISD A;  2LUX A;  2KHN A;  1A03 A;  2KAX A;  1KQM C;  5F6T A;  2WC5 A;  2PQL A;  3SG7 A;  3PSR A;  4PE0 A;  3HCM A;  3R1O A;  1K90 D;  1ZAC A;  2WOR A;  2QEO A;  2Y1N A;  1SCM C;  2ZND A;  1LXF C;  1KFU S;  3O2P A;  3SS5 A;  1CFP A;  1IWQ A;  5HL1 A;  1N65 A;  1MHO A;  2L51 A;  1LA3 A;  1QWV A;  4XYN A;  5HKW A;  2WOS A;  4JD9 A;  4PT1 A;  1FPW A;  3FE6 A;  2JC2 A;  1PSR A;  2BNX A;  2KI4 B;  4FQO A;  1V1F A;  2LC5 A;  1XO5 A;  1JUO A;  2FCD A;  2L4I A;  2H61 A;  2BAP A;  1CNP A;  2NCO A;  4MBE A;  4A4B A;  1J7O A;  1F54 A;  3B86 A;  5EL2 A;  3S0F A;  4F7F A;  1TIZ A;  2BEC A;  1EL4 A;  3AKA A;  2PAS A;  2TN4 A;  1NX3 A;  1DJG A;  1QV1 A;  3I5H B;  1M46 A;  3CGA A;  1SMG A;  2BCA A;  2OTG C;  1B7T Z;  3DVK A;  1ALV A;  4NDC A;  1G8I A;  1IJ6 A;  4ORA B;  1DF0 A;  1PSB A;  3D0Y A;  1TOP A;  4N1F A;  4OKH A;  1EG3 A;  1YRT B;  2MLF C;  3QRX A;  1C07 A;  1F71 A;  1DJX A;  3KPX A;  3C1V A;  1DF0 B;  1GGW A;  1M39 A;  1LVC D;  3SG6 A;  3O78 A;  3PJI A;  4N5X A;  5FYX A;  1CB1 A;  1A75 A;  1YUT A;  2LMV A;  4AOM A;  4YBH B;  3OHM B;  2ZN8 A;  2CNP A;  4ORC B;  2OPO A;  1SPY A;  5DIC A;  5I2Q A;  1AK8 A;  2LP2 A;  1A75 B;  1K94 A;  1LA0 A;  2F8P A;  3Q8I A;  2AMI A;  1CTR A;  4FQT A;  1AHR A;  4CFQ A;  3BFH A;  1B8C A;  2QEB A;  3TDU A;  1DTL A;  1K95 A;  1TNW A;  2DOQ A;  2K60 A;  2LVK A;  1IRJ A;  3D10 A;  4PCW A;  3K21 A;  1V1G A;  1XVJ A;  3L4L A;  2OS8 C;  4QJ4 B;  1F70 A;  1OZO A;  1NIW A;  2BL0 B;  2COL B;  3UNW A;  4DRW A;  1QVI Y;  1DVI A;  1SYM A;  3EVV A;  2JWW A;  3I5I C;  3VRO A;  2WCB A;  5CSN A;  4ORB B;  3D74 A;  1EH2 A;  1S6J A;  2JZI A;  2Y5I A;  3SG2 A;  1S36 A;  2WC8 A;  4HRG A;  2ZFD A;  3N7H A;  4I5N B;  2JXL A;  3CZ0 A;  2JTT A;  2M8U A;  2MRD A;  4HSZ A;  3OB2 B;  4MLW A;  1DJY A;  4OV2 A;  4R1E A;  2G2B A;  2KNE A;  4YGB B;  1EG4 A;  4GGF C;  2B1U A;  1UWO A;  1AP4 A;  1SR6 B;  2KAY A;  1NX1 A;  4HRH A;  4PHJ A;  1B1G A;  1CMG A;  1L7Z A;  1S1E A;  4MVF A;  1SKT A;  3SG4 A;  1BT6 A;  2HQW A;  1WDC C;  4ZCV A;  2ZNE A;  5HLV A;  2IS9 A;  4TNC A;  3DYE A;  1C7V A;  1B4C A;  2F33 A;  2GGM A;  1JC2 A;  2P71 A;  2O60 A;  1QX2 A;  1JSA A;  2MA2 A;  4JKT A;  2JTZ A;  2LLT A;  4U8D A;  1CKK A;  1SL8 A;  3SG5 A;  4DUQ A;  2BKI B;  2M7L A;  2BKH B;  1SY9 A;  3CAB A;  5D7F A;  2R2I A;  2PAL A;  1CDL A;  1XYD A;  1CDM A;  2KGR A;  4FTG A;  2CCM A;  1CDP A;  3KF9 A;  5ER5 A;  4BY5 A;  1OOJ A;  3BJH A;  3FWB A;  2E6W A;  1L2O B;  2KQ6 A;  1CLL A;  1HQV A;  3I5G B;  1MXL C;  4I5J A;  2JNX A;  3VB1 A;  2LHI A;  1S5G Z;  2NXQ A;  4NDD A;  1UHN A;  3GK1 A;  2L5Y A;  1YVH A;  5FI7 A;  4GAO A;  2PSR A;  5KTY A;  1QAT A;  1F8H A;  2LMU A;  4MZJ A;  2H2K A;  1Y0V H;  3FIA A;  2SCP A;  5TNC A;  2P70 A;  4YI8 A;  4IJ7 A;  2LAP A;  1ALW A;  1YRU B;  2QDI A;  1TNQ A;  2KFF A;  4PE1 A;  3TS5 B;  2QEH A;  2BBN A;  4MN0 A;  5PAL A;  3EK7 A;  3NHI A;  3FE8 A;  1TCO B;  5K89 A;  2M1K B; 
#chains in the Genus database with same CATH homology
 3D78 A;  1OOG A;  3CZ1 A;  2WCJ A;  1ORG A;  1XFR A;  2WCM A;  1DQE A;  3DXL A;  1OOF A;  1TWO A;  3PJI A;  1OOI X;  1LS8 A;  3B7A A;  4INX A;  2WCK A;  5DIC A;  3BFB A;  3Q8I A;  3R72 A;  4FQT A;  3DZT A;  3B87 A;  3L47 A;  3BFH A;  2QEB A;  3QME A;  3V2L A;  2ERB A;  2FJY A;  3L4L A;  3D77 A;  3B6X A;  3FE9 A;  4OZD A;  3L4A A;  2QEV A;  3S0G A;  1P28 A;  3CDN A;  3D74 A;  3CYZ A;  3D75 A;  3S0A A;  1C3Y A;  3B88 A;  3N7H A;  3CZ2 A;  3CZ0 A;  2JPO A;  1C3Z A;  3BFA A;  3D73 A;  1GM0 A;  2L2C A;  3R1P A;  1T14 A;  3RZS A;  3NHT A;  1TUJ A;  3DYE A;  3OGN A;  3R1V A;  2P71 A;  2KPH A;  2WC6 A;  3K1E A;  4INW A;  2WC5 A;  2PQL A;  3CAB A;  3NGV A;  3R1O A;  3D76 A;  2QEO A;  2GTE A;  3BJH A;  2WCL A;  1OW4 A;  2WCH A;  3VB1 A;  1QWV A;  4JD9 A;  4PT1 A;  3FE6 A;  1OOH A;  3DY9 A;  3S0B A;  3B86 A;  5EL2 A;  2P70 A;  4F7F A;  3S0F A;  2H8V A;  3S0E A;  3S0D A;  2QDI A;  2QEH A;  3NHI A;  3FE8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...