3JVTB

Calcium-bound scallop myosin regulatory domain (lever arm) with reconstituted complete light chains
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
156
structure length
156
Chain Sequence
ADKAASGVLTKLPQKQIQEMKEAFSMIDVDRDGFVSKEDIKAISEQLGRAPDDKELTAMLKEAPGPLNFTMFLSIFSDKLSGTDSEETIRNAFAMFDEQETKKLNIEYIKDLLENMGDNFNKDEMRMTFKEAPVEGGKFDYVKFTAMIKGSGEEEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The on-off switch in regulated myosins: different triggers but related mechanisms.
pubmed doi rcsb
molecule keywords Myosin heavy chain, striated adductor muscle
molecule tags Contractile protein
total genus 45
structure length 156
sequence length 156
ec nomenclature
pdb deposition date 2009-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13405 EF-hand_6 EF-hand domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3jvtB01
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3jvtB02
1CLBA 1CMFA 1KWOB 1J55A 2ZNDA 3WNXB 1CTRA 1DJIA 2WNDA 3IQQA 1DF0B 5CPVA 1S3PA 3SG2A 4OCIA 1BMOA 2L50A 1BLQA 1F71A 1AVSA 1RWYA 1NPQA 2E30A 1N65A 1IQ3A 1WY9A 2COLB 2JTTA 2I94A 1UHJA 2JWWA 1B7TY 4GFTA 5BPJA 5D7FA 4MVFA 3BYAA 3OB1B 1FW4A 3GOFA 5DKNA 2L4HA 2MLEC 1SL7A 1SR6C 1J7RA 4ZCUA 2ZRSA 3I5FB 5HLOA 1JWDA 1LINA 1IGVA 1CDNA 1D1OA 2LP2A 1PRWA 3CTNA 4MZKA 4M2QA 4XJKA 1UHNA 4MN0A 3D10A 1KFUS 2BCAA 2KI6C 2O5GA 4CIDA 4HRGA 3SG4A 4PDZA 1DJYA 3GK4X 3I5HB 1OZSA 3KEVA 5KSZA 5HYDA 2G2BA 2QACA 3BOWB 1NX0A 1JSAA 2JOJA 3EVUA 1K96A 2KNEA 2WORA 3JVTB 1KWOC 3BUNB 3CWGA 4GGFC 1NYAA 4MSPA 1TNQA 4ORCB 2ZNEA 3CR2A 2KDHA 4AQJA 1NX2A 2CCMA 4PE4A 5B8IB 5I2OA 1OZOA 4PHKA 4OKHA 1JC2A 1YVHA 3EKHA 2DOQA 5DKQA 1B9AA 2JQ6A 2BKHB 1IG5A 2FJUB 2K2AA 4DUQA 2CT9A 1VRKA 1JFKA 1QV0A 1F55A 3O4YA 4HSZA 2LNKA 1RJVA 1UHIA 1AK8A 2LHLA 2PMYA 4ORBB 3A4UB 2JXLA 1NCZA 3DF0A 1CLMA 1SMGA 3OB2B 3I5FC 3VROA 1DMOA 1QIVA 3EK7A 2LHIA 5AFPA 1B1GA 1NCYA 3DD4A 1EXRA 3PM8A 1AUIB 2OS8B 2BKIB 3KPXA 2KAYA 3SG7A 1TCFA 1A2XA 2LMVA 2M0RA 2FCDA 3HX4A 1K9KA 1BJFA 1YURA 2JC2A 1B7TZ 1V1FA 3NSLA 4C0LA 3O78A 1K8UA 3I5HC 4YGBB 4CFRA 1Q80A 1DJZA 2JULA 2K7BA 1AJ4A 3IQOA 1SY9A 4MZJA 5DKRA 4ICBA 2JT0A 1XYDA 2F3YA 3VGOA 3JVTC 5AERA 1KK7Y 1SL9A 1XFWO 1XK4A 2P6BB 1S6CA 2ZKMX 3RLZA 4N1FA 1IH0A 2MAZA 1BG1A 3PFVA 1KCYA 1KSOA 1NP8A 1AJ5A 3MSEB 2LLUA 1F54A 2KAXA 3KHEA 1DTLA 1Y0VH 1BT6A 3I5IB 1IJ6A 4R1EA 1SL8A 1NSHA 3EK4A 5GQQC 1NX1A 1N2DA 2M1KB 2VRGA 4GNKB 2K7CA 1F4QA 1XFXO 3DVEA 2LLTA 3QRXA 4L9MA 1U5IA 3FWCA 4AOMA 3ICBA 1TOPA 3BUOB 1MHOA 1BR1B 2GV5A 2K61A 4NDBA 1MXEA 4YI8A 1DT7B 3ZWHA 2OS8C 1QASA 3PALA 2NXQA 1M31A 2L5XB 1ODBA 1B8RA 1TNWA 3DF0B 2M8UA 1DGUA 2Y1MA 1FBVA 1G4YR 2OPOA 4ORAB 3BXKA 1QS7A 3TUYB 1A75A 2RGIA 3SG6A 3AAJA 1YUSA 4YGEB 1OMVA 1J1DA 4QJ3B 3KO0A 1K9PA 2KFGA 1RTP1 1KQMB 1RECA 2M7NA 3AKAA 2GGZA 1YX8A 1K94A 2LV7A 2Q4UA 1C07A 4JWQA 1QTXA 2F3ZA 3TZ1A 5I2QA 3RM1A 1B8LA 1XVJA 1C7VA 2JU0A 4C0JA 1CFDA 2PVBA 2WC8A 3SG5A 1F4OA 2M1UA 3SIAA 1DGVA 4C0KA 3I5IC 4WRIA 2BL0B 1LXFC 2K2FA 3OX6A 2EGDA 1LA3A 1UURA 2LAPA 2Y4QA 3JTDB 3VRPA 1V1GA 5JJGA 2F2PA 2HPSA 2LCPA 4Q04A 1JUOA 1QJTA 1KK7Z 2G9BA 2K8MB 1NWDA 1DJWA 2ZRTA 2M7LA 2D8NA 1QX2A 3EK8A 1NX3A 2PALA 4I5KA 1AHRA 1W7IB 2F2OA 2LVIA 2LUXA 4AQIA 1HT9A 1U5IB 1DJHA 2GGMA 2HQWA 3BUXB 1PVBA 1KSMA 1MXLC 1S6JA 5F6TA 1Y1AA 1J7OA 3TUYC 3IF7A 1IRJA 2LP3A 1EL4A 1CMGA 2PASA 4P5OE 1TIZA 1OE9B 1SCVA 2KI6D 1KQMC 2MLFC 1TRFA 4I5JA 4YGAA 2WCEA 3LK1A 3D0YA 4ETOA 1PULA 4E68A 2NZ0A 1MUXA 1YX7A 1KK8B 1NUBA 1PK0D 2BE6A 3AKBA 1DJXA 1KQVA 5PALA 1H8BA 1OMRA 3K21A 1JF0A 3WHTB 4MRYA 2H61C 2JTZA 1EJ3A 1BODA 1PVAA 4DCKA 2BL0C 5D69A 3TDZA 4OV2A 4XYNA 3KF9A 1S1EA 1Y1UA 2K7OA 3GK1A 1WRLA 2EHBA 1CM4A 2SASA 4MLWA 3JTDC 4ZCVA 3SIBA 1LVCD 1M39A 5AEQA 5FYXA 2HF5A 1H4BA 1SRAA 2PRUA 4I5LB 2L51A 5HKWA 1R6PA 5CSFA 3BQ3A 2KI4B 4MZLA 1PSBA 1L2OB 2I2RE 3M0WA 5TNCA 3TS5B 2HQ8A 1S26D 3NSKA 2AAOA 4XJKB 5ER4X 1N0YA 1L7ZA 5G08A 1F70A 2LM5A 2MHHA 1MR8A 3NSIA 1LA0A 1XFUO 5HLVA 4YGCB 1CLLA 1UP5A 4NDDA 3NSOA 2WCBA 2KHNA 1CNPA 2L98A 3NXAA 4USLA 3WHUB 4UPGA 5AANA 3I5GB 2LE9B 1R2UA 2ZN9A 3EVVA 1GGWA 4NQGA 2B1UA 1RROA 5CSIA 4YRUA 1CB1A 1YUUA 2CBLA 1BF5A 2KYFA 1GJYA 1CFCA 1M45A 1TNXA 4M2OA 1OQPA 3E3RA 3PLFB 1QX5B 5HKZA 2ISDA 1S6IA 5KU1A 1SPYA 1QLKA 2KI4C 2KSPA 4DIRA 2NCPA 1QIWA 2AUCA 1L2OC 3TDUA 4QJ4B 2KBMA 3TS5C 2WOSA 3DVJA 2L2EA 5IBWA 2KGBC 3FS7A 5CSNA 1CDMA 2BE4A 4MRXA 1QATA 4JQ0D 4D1EA 3O6BA 2L0PA 5HKYA 3CR5X 2LLSA 1SBJA 3OP0A 3CZTX 4U8DA 4WQ3A 1FF1A 3SJSA 2JXCA 4F0ZB 1IWQA 4I5NB 5KTYA 2K7DA 1K90D 4PE0A 1GQMA 4CPVA 1XO5A 4GUKA 3HCMA 4PHMA 1G8IA 2HETA 1SYMA 1B47A 4CFQA 4DS7A 2MA2A 1HQVA 3I5GC 4BY5A 2M97A 1WRZA 3LL8B 2JT8A 1E8AA 2BCXA 2O60A 1QXPA 3BUWB 1YRUB 1ZACA 1SW8A 2I18A 1OSAA 3VRRA 1NIWA 2KBIA 4QJ5B 4N1GA 3DVKA 4YGDB 4FQOA 1SNLA 1Y1XA 2KGRA 4GBAA 2ZFDA 4NDCA 4A4BA 2F8PA 2H2KA 1TCOB 1UUSA 1KFXL 2ZN8A 1IQ5A 2JT3A 2PSRA 1Y6WA 2LMUA 2FOTA 2KFFA 3BUMB 1CM1A 1XFZO 3O2PA 1C7WA 4YBHB 1DVIA 1ZUZA 4WQ2A 2LUCA 5AXIA 2BBNA 5JOLA 2CTNA 4PHNA 1J7QA 1MF8B 1JFJA 1EG3A 1QVIY 1FI5A 1CDPA 1G33A 2I7AA 1JF2A 3LCPC 3LLEA 2MRDA 4DRWA 1BU3A 1A75B 4PHJA 4JPZB 1M63B 3OX5A 1S5GY 1SKTA 4MEWA 3CLNA 2WCFA 1CFPA 1SCMB 2JNXA 2CXJA 4OVNF 1B4CA 1XK4C 2JRFA 1UHKA 1MQ1A 2LANA 4PE1A 1RK9A 4GGNA 4HRHA 1TTXA 2Y5IA 4BY4A 1YVLA 2EC6B 1QV1A 2FCEA 2MBXA 1J7PA 4M2PA 4GPLB 2TN4A 4A4CA 3CS1A 4N5XA 1W7JB 3A8RA 3WXAA 1PSRA 5I8NA 1AP4A 1EH2A 3SG3A 1UWOA 2LVVA 1J1EA 1JBAA 2KQYA 2KAVA 2OTGB 4CLNA 1DJGA 1QLSA 2CNPA 1BR4B 1YR5A 4P2YB 1F8HA 1WLMA 1FPWA 2LC5A 3EVRA 2LVKA 2NCOA 1PALA 3OHMB 5I2LA 1CFFA 1K2HA 1ZMZA 2LMTA 1WDCB 2JPTA 4GGFA 3VRNA 1FI6A 3H4SE 1EG4A 2IS9A 1YUTA 1ALWA 2QPTA 4PE7A 1DF0A 3DVMA 2A4JA 3PN7B 1KFUL 1K9UA 2BBMA 1KK8C 1TN4A 1NCXA 1ALVA 1XFVO 2V53A 4PALA 4OR9B 4YI9A 1BOCA 3TDIA 2R2IA 1OOJA 5K89A 1MWNA 1SCMC 2L4IA 2MJWB 3D0YB 3PSRA 1KFXS 4MBEA 1S36A 2JZIA 1RFJA 1XFYO 3CGAA 2H61A 2M9GA 1K95A 2BCBA 1WLZA 4GAOA 1IKUA 2EC6C 1QVIZ 3FIAA 3C1VA 5J3XA 1LKJA 3VRQA 2M3WA 1B8CA 1TNPA 1X02A 2K0JA 2NLNA 5CSJA 4TNCA 2BECA 2KQ6A 1A29A 2M29A 1IJ5A 1XA5A 1UHHA 2JNFA 3PATA 1K93D 1S5GZ 4PCWA 3ZNIA 1SR6B 2M49B 3EKJA 3FWBA 5ER5A 3AAKA 1SK6D 3F45A 2OTGC 4HREE 1GGZA 4FTGA 3LK0A 1CKKA 1YRTB 1OMDA 3BOWA 1ZOTB 1YTZC 2LVJA 4IL1A 2E6WA 2Q91A 1A4PA 1M46A 1A03A 3GK2A 1WDCC 2AMIA 2Y1NA 2KFHA 1QX7A 1CDLA 2SCPA 2KOTA 2F33A 1ZFSA 2KYCA 1WRKA 3CR4X 3PN7C
chains in the Genus database with same CATH superfamily
2ERBA 1CLBA 1CMFA 1KWOB 1J55A 2ZNDA 3WNXB 1CTRA 1DJIA 2WNDA 3IQQA 1DF0B 5CPVA 1S3PA 2QEVA 3SG2A 4OCIA 1BMOA 2L50A 1BLQA 1F71A 1AVSA 1RWYA 1NPQA 2E30A 1N65A 3S0GA 2WCLA 3BFBA 3D77A 1IQ3A 1WY9A 2COLB 2JTTA 2I94A 1UHJA 2JWWA 1B7TY 4GFTA 5BPJA 5D7FA 3K1EA 4MVFA 1DEKA 3BYAA 3OB1B 1FW4A 3GOFA 5DKNA 2L4HA 2MLEC 3R1OA 1SL7A 1SR6C 1J7RA 4ZCUA 1SSEB 2ZRSA 3I5FB 5HLOA 1JWDA 1LINA 1IGVA 1CDNA 1D1OA 2LP2A 1PRWA 3CTNA 4MZKA 4M2QA 4XJKA 5FI2A 1UHNA 2WC5A 4MN0A 3D10A 1KFUS 3L4AA 2BCAA 2KI6C 3CZ1A 2O5GA 4CIDA 4HRGA 3SG4A 4PDZA 1DJYA 3GK4X 3I5HB 1OZSA 3KEVA 3NGVA 5KSZA 5HYDA 3DYEA 2G2BA 2QACA 3BOWB 1NX0A 3VB1A 1JSAA 2JOJA 3EVUA 1K96A 2KNEA 2WORA 3JVTB 1KWOC 3BUNB 3CWGA 4GGFC 1NYAA 4MSPA 1TNQA 4ORCB 2ZNEA 3CR2A 2KDHA 4AQJA 1NX2A 2CCMA 4PE4A 5B8IB 3SS5A 1OZOA 4PHKA 4OKHA 5I2OA 1JC2A 1YVHA 3EKHA 2DOQA 5DKQA 1B9AA 2JQ6A 2BKHB 1IG5A 2FJUB 2K2AA 3R1PA 4JKTA 4DUQA 2CT9A 1VRKA 1JFKA 1QV0A 1F55A 3O4YA 3IVTA 4HSZA 2LNKA 3B88A 1RJVA 1UHIA 1AK8A 2LHLA 1OOHA 2PMYA 4ORBB 3A4UB 2JXLA 1NCZA 3DF0A 1CLMA 1SMGA 3OB2B 3I5FC 3SS4A 3VROA 1DMOA 1QIVA 3EK7A 2LHIA 3NHIA 5AFPA 1B1GA 1NCYA 3DD4A 1EXRA 1OW4A 1AUIB 3PM8A 2BAPA 2OS8B 2BKIB 3KPXA 2KAYA 3SG7A 1TCFA 1C3YA 1A2XA 2LMVA 2M0RA 2FCDA 3PJIA 3HX4A 1K9KA 1BJFA 1YURA 2JC2A 1B7TZ 1V1FA 3NSLA 4C0LA 3O78A 1K8UA 3I5HC 4YGBB 4CFRA 1Q80A 1DJZA 2JULA 2K7BA 1AJ4A 3DXLA 3IQOA 1SY9A 4MZJA 5DKRA 4ICBA 2JT0A 1XYDA 2PYQA 3BFHA 2WC6A 2F3YA 3VGOA 3JVTC 5AERA 1KK7Y 1SL9A 1XFWO 1XK4A 2JPOA 1S6CA 2P6BB 2ZKMX 3CZ2A 3RLZA 4N1FA 1IH0A 2MAZA 1BG1A 3PFVA 1KCYA 1KSOA 1NP8A 1AJ5A 3MSEB 2LLUA 1F54A 2KAXA 3KHEA 1DTLA 3L4LA 1Y0VH 1BT6A 2WCMA 3I5IB 1IJ6A 4R1EA 1SL8A 1NSHA 3EK4A 5GQQC 1NX1A 1N2DA 2M1KB 2VRGA 4GNKB 1DC1A 2K7CA 1F4QA 1XFXO 3DVEA 1DQEA 2LLTA 3QRXA 4L9MA 1U5IA 2KLEA 3FWCA 4AOMA 3ICBA 1TOPA 3BUOB 1MHOA 1BR1B 2GV5A 2K61A 4NDBA 3FE9A 1MXEA 4YI8A 1DT7B 3ZWHA 2OS8C 1QASA 3PALA 2NXQA 1M31A 2L5XB 1ODBA 1B8RA 1TNWA 3CDNA 3D78A 2M8UA 3DF0B 1DGUA 2Y1MA 1FBVA 1G4YR 2OPOA 1Z4HA 3BXKA 4ORAB 1QS7A 3TUYB 1A75A 2RGIA 3OGNA 3AAJA 3SG6A 1YUSA 4YGEB 1OMVA 1J1DA 4QJ3B 3KO0A 1K9PA 2KFGA 1P28A 1RTP1 1KQMB 1RECA 2M7NA 3AKAA 2GGZA 1YX8A 1K94A 2LV7A 2Q4UA 3S0EA 1C07A 4JWQA 1QTXA 2F3ZA 3TZ1A 5I2QA 3RM1A 2YGUA 1B8LA 1XVJA 3D73A 2JU0A 1C7VA 4C0JA 5I94A 1CFDA 2PVBA 2WC8A 3SG5A 1F4OA 2M1UA 3SIAA 1DGVA 4C0KA 3I5IC 4WRIA 2BL0B 1LXFC 2K2FA 3OX6A 2EGDA 3UNWA 1LA3A 1UURA 2LAPA 2Y4QA 3JTDB 3VRPA 1V1GA 5JJGA 2F2PA 2HPSA 2LCPA 2BNXA 4Q04A 1JUOA 1QJTA 1QWVA 1KK7Z 2G9BA 2K8MB 1NWDA 1DJWA 2QEHA 2ZRTA 2M7LA 2WCHA 2D8NA 1QX2A 3EK8A 1NX3A 2PALA 4I5KA 1AHRA 1W7IB 2F2OA 2LVIA 2LUXA 4AQIA 1HT9A 1U5IB 1DJHA 2GGMA 2HQWA 3BUXB 1W9ZA 1PVBA 2WCJA 1KSMA 1MXLC 1S6JA 5HL1A 3PM2A 5F6TA 1Y1AA 1J7OA 3TUYC 3IF7A 1IRJA 2LP3A 1EL4A 1CMGA 3Q8IA 2PASA 3FE6A 4P5OE 1TIZA 1OE9B 1SCVA 2KI6D 1KQMC 2MLFC 1TRFA 4I5JA 4YGAA 2WCEA 3LK1A 3D0YA 5D3OA 1OOGA 3EG5B 4ETOA 1PULA 4E68A 2NZ0A 1MUXA 1YX7A 1KK8B 2QEOA 1NUBA 1PK0D 2L2CA 2BE6A 3AKBA 1DJXA 1KQVA 5PALA 1H8BA 3O4XA 1OMRA 3K21A 4PT1A 1JF0A 1OOIX 3WHTB 4MRYA 2H61C 2JTZA 1EJ3A 1BODA 1PVAA 4DCKA 2BL0C 5D69A 3TDZA 4OV2A 4XYNA 3KF9A 1S1EA 1Y1UA 2K7OA 3DZTA 2GTEA 3GK1A 1WRLA 2EHBA 1CM4A 2SASA 4KYNA 1DELA 3JTDC 4MLWA 4ZCVA 3SIBA 1LVCD 1M39A 5AEQA 5FYXA 2HF5A 3S0BA 1SRAA 1H4BA 2PRUA 4I5LB 2L51A 5HKWA 1R6PA 5CSFA 3BQ3A 2KI4B 4MZLA 2FJYA 1PSBA 1L2OB 2I2RE 3M0WA 5TNCA 3TS5B 2HQ8A 1S26D 3NSKA 2AAOA 4XJKB 5ER4X 1N0YA 1L7ZA 5G08A 3QMEA 3CABA 3S0AA 1F70A 2LM5A 2MHHA 1MR8A 3NSIA 1LA0A 1XFUO 5HLVA 4YGCB 3DY9A 1CLLA 1UP5A 3BFAA 4NDDA 3NSOA 3B7AA 2WCBA 2KHNA 1CNPA 2L98A 3NXAA 4USLA 3WHUB 4UPGA 5AANA 3I5GB 2LE9B 1R2UA 2ZN9A 3EVVA 1GGWA 4NQGA 2B1UA 1RROA 5CSIA 4YRUA 1CB1A 1YUUA 2CBLA 1BF5A 3R1VA 2KYFA 1GJYA 1CFCA 2QDIA 1M45A 1TNXA 4M2OA 1OQPA 3E3RA 3PLFB 1QX5B 5HKZA 1XFRA 2ISDA 1T14A 1S6IA 5KU1A 4JD9A 1SPYA 1QLKA 2KI4C 2KSPA 4DIRA 2NCPA 1QIWA 2AUCA 2WCKA 5EL2A 1L2OC 2K60A 5FI6A 2KBMA 3TDUA 3TS5C 4QJ4B 2WOSA 3DVJA 2L2EA 3S0DA 2KGBC 3FS7A 4FQTA 5CSNA 5IBWA 1CDMA 2BE4A 4MRXA 1QATA 4JQ0D 4D1EA 3O6BA 2L0PA 5HKYA 3CR5X 2LLSA 1SBJA 3D76A 3CZTX 3OP0A 4U8DA 4WQ3A 3SJSA 2JXCA 4F0ZB 1IWQA 4I5NB 1FF1A 1TWOA 5KTYA 2K7DA 1K90D 4PE0A 1GQMA 4CPVA 1XO5A 4GUKA 3HCMA 4PHMA 3D74A 1G8IA 2HETA 3R72A 1SYMA 1IIOA 1B47A 2KPHA 4CFQA 4DS7A 2MA2A 1HQVA 3I5GC 4BY5A 2M97A 1WRZA 3LL8B 2JT8A 1E8AA 2BCXA 2O60A 1QXPA 3BUWB 1YRUB 1ZACA 1SW8A 2I18A 1OSAA 3VRRA 1NIWA 2KBIA 4QJ5B 4N1GA 3DVKA 4YGDB 4FQOA 1SNLA 1Y1XA 2KGRA 4GBAA 3RZSA 2ZFDA 4NDCA 4A4BA 2F8PA 3D75A 2H2KA 1TCOB 1UUSA 1KFXL 2ZN8A 1IQ5A 2JT3A 2PSRA 1Y6WA 2LMUA 2FOTA 2KFFA 3BUMB 1CM1A 1XFZO 3O2PA 1C7WA 4YBHB 1DVIA 1LS8A 1ZUZA 4WQ2A 1GM0A 2LUCA 5AXIA 2BBNA 5JOLA 2CTNA 4PHNA 1ORGA 1J7QA 1MF8B 1JFJA 3B86A 1EG3A 1QVIY 1FI5A 1CDPA 1G33A 2I7AA 1JF2A 3LCPC 3LLEA 2MRDA 4DRWA 3B87A 1BU3A 1A75B 4PHJA 3CZ0A 4JPZB 1M63B 3OX5A 2QEBA 1S5GY 1SKTA 4MEWA 3CLNA 2WCFA 1CFPA 1SCMB 2JNXA 2CXJA 4INWA 4OVNF 1B4CA 4OZDA 1XK4C 2JRFA 1UHKA 1MQ1A 2LANA 3CYZA 4PE1A 1RK9A 4GGNA 4HRHA 1TTXA 2Y5IA 4BY4A 1YVLA 2EC6B 1QV1A 2FCEA 5FI7A 2MBXA 1J7PA 4M2PA 4GPLB 2TN4A 4A4CA 3CS1A 4IJ7A 4N5XA 1W7JB 3A8RA 3WXAA 1PSRA 5I8NA 1AP4A 3V2LA 1EH2A 3SG3A 1UWOA 2LVVA 1J1EA 1JBAA 2KQYA 2KLDA 2KAVA 2OTGB 3NHTA 4CLNA 1DJGA 2P71A 1QLSA 2CNPA 1BR4B 1YR5A 4P2YB 1F8HA 1WLMA 2P70A 2LC5A 3EVRA 1FPWA 2LVKA 4F7FA 2NCOA 1PALA 1TUJA 3OHMB 5I2LA 3FE8A 1ZMZA 2LMTA 3L47A 1CFFA 1K2HA 1WDCB 2JPTA 4GGFA 3VRNA 1FI6A 3H4SE 1EG4A 2IS9A 1YUTA 1ALWA 2QPTA 4PE7A 1TUZA 1DF0A 3DVMA 2A4JA 3UO9A 3PN7B 1KFUL 1K9UA 2BBMA 1TN4A 1KK8C 1NCXA 1ALVA 1XFVO 2V53A 2H8VA 3BJHA 4OR9B 4PALA 4YI9A 2R2IA 3TDIA 1BOCA 1OOJA 5K89A 1MWNA 1SCMC 2L4IA 2MJWB 3D0YB 5DICA 3PSRA 1KFXS 4MBEA 1S36A 2JZIA 1RFJA 1XFYO 3CGAA 2H61A 3B6XA 2M9GA 1K95A 2BCBA 1WLZA 4GAOA 1IKUA 2EC6C 1QVIZ 4INXA 3FIAA 3C1VA 5J3XA 1LKJA 3VRQA 2M3WA 1B8CA 1TNPA 1X02A 1C3ZA 2K0JA 2NLNA 5CSJA 3SS3A 4TNCA 3S0FA 2BECA 2KQ6A 1A29A 3OBVA 2M29A 1IJ5A 1XA5A 1UHHA 2JNFA 2L5YA 1K93D 1S5GZ 3PATA 4PCWA 3ZNIA 3N7HA 1SR6B 2M49B 3EKJA 3FWBA 5ER5A 3AAKA 1SK6D 3F45A 2OTGC 4HREE 1GGZA 4FTGA 3LK0A 1CKKA 1YRTB 1OMDA 3BOWA 1ZOTB 1YTZC 2LVJA 4IL1A 2E6WA 2Q91A 1A4PA 1M46A 1A03A 3GK2A 1WDCC 2AMIA 1Z2CB 2KFHA 2Y1NA 1OOFA 1CDLA 1QX7A 2SCPA 2KOTA 2F33A 2PQLA 1ZFSA 2KYCA 1WRKA 3CR4X 3PN7C
chains in the Genus database with same CATH topology
1CLBA 1CMFA 1KWOB 1J55A 2ZNDA 3WNXB 1CTRA 1DJIA 2WNDA 3IQQA 1DF0B 5CPVA 1S3PA 3SG2A 4OCIA 1BMOA 2L50A 1BLQA 1F71A 1AVSA 1RWYA 1NPQA 2E30A 1N65A 1IQ3A 1WY9A 2COLB 2JTTA 2I94A 1UHJA 2JWWA 1B7TY 4GFTA 5BPJA 5D7FA 4MVFA 3BYAA 3OB1B 1FW4A 3GOFA 5DKNA 2L4HA 2MLEC 1SL7A 1SR6C 1J7RA 4ZCUA 2ZRSA 3I5FB 5HLOA 1JWDA 1LINA 1IGVA 1CDNA 1D1OA 2LP2A 1PRWA 3CTNA 4MZKA 4M2QA 4XJKA 1UHNA 4MN0A 3D10A 1KFUS 2BCAA 2KI6C 2O5GA 4CIDA 4HRGA 3SG4A 4PDZA 1DJYA 3GK4X 3I5HB 1OZSA 3KEVA 5KSZA 5HYDA 2G2BA 2QACA 3BOWB 1NX0A 1JSAA 2JOJA 3EVUA 1K96A 2KNEA 2WORA 3JVTB 1KWOC 3BUNB 3CWGA 4GGFC 1NYAA 4MSPA 1TNQA 4ORCB 2ZNEA 3CR2A 2KDHA 4AQJA 1NX2A 2CCMA 4PE4A 5B8IB 5I2OA 1OZOA 4PHKA 4OKHA 1JC2A 1YVHA 3EKHA 2DOQA 5DKQA 1B9AA 2JQ6A 2BKHB 1IG5A 2FJUB 2K2AA 4DUQA 2CT9A 1VRKA 1JFKA 1QV0A 1F55A 3O4YA 4HSZA 2LNKA 1RJVA 1UHIA 1AK8A 2LHLA 2PMYA 4ORBB 3A4UB 2JXLA 1NCZA 3DF0A 1CLMA 1SMGA 3OB2B 3I5FC 3VROA 1DMOA 1QIVA 3EK7A 2LHIA 5AFPA 1B1GA 1NCYA 3DD4A 1EXRA 3PM8A 1AUIB 2OS8B 2BKIB 3KPXA 2KAYA 3SG7A 1TCFA 1A2XA 2LMVA 2M0RA 2FCDA 3HX4A 1K9KA 1BJFA 1YURA 2JC2A 1B7TZ 1V1FA 3NSLA 4C0LA 3O78A 1K8UA 3I5HC 4YGBB 4CFRA 1Q80A 1DJZA 2JULA 2K7BA 1AJ4A 3IQOA 1SY9A 4MZJA 5DKRA 4ICBA 2JT0A 1XYDA 2F3YA 3VGOA 3JVTC 5AERA 1KK7Y 1SL9A 1XFWO 1XK4A 2P6BB 1S6CA 2ZKMX 3RLZA 4N1FA 1IH0A 2MAZA 1BG1A 3PFVA 1KCYA 1KSOA 1NP8A 1AJ5A 3MSEB 2LLUA 1F54A 2KAXA 3KHEA 1DTLA 1Y0VH 1BT6A 3I5IB 1IJ6A 4R1EA 1SL8A 1NSHA 3EK4A 5GQQC 1NX1A 1N2DA 2M1KB 2VRGA 4GNKB 2K7CA 1F4QA 1XFXO 3DVEA 2LLTA 3QRXA 4L9MA 1U5IA 3FWCA 4AOMA 3ICBA 1TOPA 3BUOB 1MHOA 1BR1B 2GV5A 2K61A 4NDBA 1MXEA 4YI8A 1DT7B 3ZWHA 2OS8C 1QASA 3PALA 2NXQA 1M31A 2L5XB 1ODBA 1B8RA 1TNWA 3DF0B 2M8UA 1DGUA 2Y1MA 1FBVA 1G4YR 2OPOA 4ORAB 3BXKA 1QS7A 3TUYB 1A75A 2RGIA 3SG6A 3AAJA 1YUSA 4YGEB 1OMVA 1J1DA 4QJ3B 3KO0A 1K9PA 2KFGA 1RTP1 1KQMB 1RECA 2M7NA 3AKAA 2GGZA 1YX8A 1K94A 2LV7A 2Q4UA 1C07A 4JWQA 1QTXA 2F3ZA 3TZ1A 5I2QA 3RM1A 1B8LA 1XVJA 1C7VA 2JU0A 4C0JA 1CFDA 2PVBA 2WC8A 3SG5A 1F4OA 2M1UA 3SIAA 1DGVA 4C0KA 3I5IC 4WRIA 2BL0B 1LXFC 2K2FA 3OX6A 2EGDA 1LA3A 1UURA 2LAPA 2Y4QA 3JTDB 3VRPA 1V1GA 5JJGA 2F2PA 2HPSA 2LCPA 4Q04A 1JUOA 1QJTA 1KK7Z 2G9BA 2K8MB 1NWDA 1DJWA 2ZRTA 2M7LA 2D8NA 1QX2A 3EK8A 1NX3A 2PALA 4I5KA 1AHRA 1W7IB 2F2OA 2LVIA 2LUXA 4AQIA 1HT9A 1U5IB 1DJHA 2GGMA 2HQWA 3BUXB 1PVBA 1KSMA 1MXLC 1S6JA 5F6TA 1Y1AA 1J7OA 3TUYC 3IF7A 1IRJA 2LP3A 1EL4A 1CMGA 2PASA 4P5OE 1TIZA 1OE9B 1SCVA 2KI6D 1KQMC 2MLFC 1TRFA 4I5JA 4YGAA 2WCEA 3LK1A 3D0YA 4ETOA 1PULA 4E68A 2NZ0A 1MUXA 1YX7A 1KK8B 1NUBA 1PK0D 2BE6A 3AKBA 1DJXA 1KQVA 5PALA 1H8BA 1OMRA 3K21A 1JF0A 3WHTB 4MRYA 2H61C 2JTZA 1EJ3A 1BODA 1PVAA 4DCKA 2BL0C 5D69A 3TDZA 4OV2A 4XYNA 3KF9A 1S1EA 1Y1UA 2K7OA 3GK1A 1WRLA 2EHBA 1CM4A 2SASA 4MLWA 3JTDC 4ZCVA 3SIBA 1LVCD 1M39A 5AEQA 5FYXA 2HF5A 1H4BA 1SRAA 2PRUA 4I5LB 2L51A 5HKWA 1R6PA 5CSFA 3BQ3A 2KI4B 4MZLA 1PSBA 1L2OB 2I2RE 3M0WA 5TNCA 3TS5B 2HQ8A 1S26D 3NSKA 2AAOA 4XJKB 5ER4X 1N0YA 1L7ZA 5G08A 1F70A 2LM5A 2MHHA 1MR8A 3NSIA 1LA0A 1XFUO 5HLVA 4YGCB 1CLLA 1UP5A 4NDDA 3NSOA 2WCBA 2KHNA 1CNPA 2L98A 3NXAA 4USLA 3WHUB 4UPGA 5AANA 3I5GB 2LE9B 1R2UA 2ZN9A 3EVVA 1GGWA 4NQGA 2B1UA 1RROA 5CSIA 4YRUA 1CB1A 1YUUA 2CBLA 1BF5A 2KYFA 1GJYA 1CFCA 1M45A 1TNXA 4M2OA 1OQPA 3E3RA 3PLFB 1QX5B 5HKZA 2ISDA 1S6IA 5KU1A 1SPYA 1QLKA 2KI4C 2KSPA 4DIRA 2NCPA 1QIWA 2AUCA 1L2OC 3TDUA 4QJ4B 2KBMA 3TS5C 2WOSA 3DVJA 2L2EA 5IBWA 2KGBC 3FS7A 5CSNA 1CDMA 2BE4A 4MRXA 1QATA 4JQ0D 4D1EA 3O6BA 2L0PA 5HKYA 3CR5X 2LLSA 1SBJA 3OP0A 3CZTX 4U8DA 4WQ3A 1FF1A 3SJSA 2JXCA 4F0ZB 1IWQA 4I5NB 5KTYA 2K7DA 1K90D 4PE0A 1GQMA 4CPVA 1XO5A 4GUKA 3HCMA 4PHMA 1G8IA 2HETA 1SYMA 1B47A 4CFQA 4DS7A 2MA2A 1HQVA 3I5GC 4BY5A 2M97A 1WRZA 3LL8B 2JT8A 1E8AA 2BCXA 2O60A 1QXPA 3BUWB 1YRUB 1ZACA 1SW8A 2I18A 1OSAA 3VRRA 1NIWA 2KBIA 4QJ5B 4N1GA 3DVKA 4YGDB 4FQOA 1SNLA 1Y1XA 2KGRA 4GBAA 2ZFDA 4NDCA 4A4BA 2F8PA 2H2KA 1TCOB 1UUSA 1KFXL 2ZN8A 1IQ5A 2JT3A 2PSRA 1Y6WA 2LMUA 2FOTA 2KFFA 3BUMB 1CM1A 1XFZO 3O2PA 1C7WA 4YBHB 1DVIA 1ZUZA 4WQ2A 2LUCA 5AXIA 2BBNA 5JOLA 2CTNA 4PHNA 1J7QA 1MF8B 1JFJA 1EG3A 1QVIY 1FI5A 1CDPA 1G33A 2I7AA 1JF2A 3LCPC 3LLEA 2MRDA 4DRWA 1BU3A 1A75B 4PHJA 4JPZB 1M63B 3OX5A 1S5GY 1SKTA 4MEWA 3CLNA 2WCFA 1CFPA 1SCMB 2JNXA 2CXJA 4OVNF 1B4CA 1XK4C 2JRFA 1UHKA 1MQ1A 2LANA 4PE1A 1RK9A 4GGNA 4HRHA 1TTXA 2Y5IA 4BY4A 1YVLA 2EC6B 1QV1A 2FCEA 2MBXA 1J7PA 4M2PA 4GPLB 2TN4A 4A4CA 3CS1A 4N5XA 1W7JB 3A8RA 3WXAA 1PSRA 5I8NA 1AP4A 1EH2A 3SG3A 1UWOA 2LVVA 1J1EA 1JBAA 2KQYA 2KAVA 2OTGB 4CLNA 1DJGA 1QLSA 2CNPA 1BR4B 1YR5A 4P2YB 1F8HA 1WLMA 1FPWA 2LC5A 3EVRA 2LVKA 2NCOA 1PALA 3OHMB 5I2LA 1CFFA 1K2HA 1ZMZA 2LMTA 1WDCB 2JPTA 4GGFA 3VRNA 1FI6A 3H4SE 1EG4A 2IS9A 1YUTA 1ALWA 2QPTA 4PE7A 1DF0A 3DVMA 2A4JA 3PN7B 1KFUL 1K9UA 2BBMA 1KK8C 1TN4A 1NCXA 1ALVA 1XFVO 2V53A 4PALA 4OR9B 4YI9A 1BOCA 3TDIA 2R2IA 1OOJA 5K89A 1MWNA 1SCMC 2L4IA 2MJWB 3D0YB 3PSRA 1KFXS 4MBEA 1S36A 2JZIA 1RFJA 1XFYO 3CGAA 2H61A 2M9GA 1K95A 2BCBA 1WLZA 4GAOA 1IKUA 2EC6C 1QVIZ 3FIAA 3C1VA 5J3XA 1LKJA 3VRQA 2M3WA 1B8CA 1TNPA 1X02A 2K0JA 2NLNA 5CSJA 4TNCA 2BECA 2KQ6A 1A29A 2M29A 1IJ5A 1XA5A 1UHHA 2JNFA 3PATA 1K93D 1S5GZ 4PCWA 3ZNIA 1SR6B 2M49B 3EKJA 3FWBA 5ER5A 3AAKA 1SK6D 3F45A 2OTGC 4HREE 1GGZA 4FTGA 3LK0A 1CKKA 1YRTB 1OMDA 3BOWA 1ZOTB 1YTZC 2LVJA 4IL1A 2E6WA 2Q91A 1A4PA 1M46A 1A03A 3GK2A 1WDCC 2AMIA 2Y1NA 2KFHA 1QX7A 1CDLA 2SCPA 2KOTA 2F33A 1ZFSA 2KYCA 1WRKA 3CR4X 3PN7C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CLB A;  1CMF A;  1KWO B;  1J55 A;  2ZND A;  3WNX B;  1CTR A;  1DJI A;  2WND A;  3IQQ A;  1DF0 B;  5CPV A;  1S3P A;  3SG2 A;  4OCI A;  1BMO A;  2L50 A;  1BLQ A;  1F71 A;  1AVS A;  1RWY A;  1NPQ A;  2E30 A;  1N65 A;  1IQ3 A;  1WY9 A;  2COL B;  2JTT A;  2I94 A;  1UHJ A;  2JWW A;  1B7T Y;  4GFT A;  5BPJ A;  5D7F A;  4MVF A;  3BYA A;  3OB1 B;  1FW4 A;  3GOF A;  5DKN A;  2L4H A;  2MLE C;  1SL7 A;  1SR6 C;  1J7R A;  4ZCU A;  2ZRS A;  3I5F B;  5HLO A;  1JWD A;  1LIN A;  1IGV A;  1CDN A;  1D1O A;  2LP2 A;  1PRW A;  3CTN A;  4MZK A;  4M2Q A;  4XJK A;  1UHN A;  4MN0 A;  3D10 A;  1KFU S;  2BCA A;  2KI6 C;  2O5G A;  4CID A;  4HRG A;  3SG4 A;  4PDZ A;  1DJY A;  3GK4 X;  3I5H B;  1OZS A;  3KEV A;  5KSZ A;  5HYD A;  2G2B A;  2QAC A;  3BOW B;  1NX0 A;  1JSA A;  2JOJ A;  3EVU A;  1K96 A;  2KNE A;  2WOR A;  3JVT B;  1KWO C;  3BUN B;  3CWG A;  4GGF C;  1NYA A;  4MSP A;  1TNQ A;  4ORC B;  2ZNE A;  3CR2 A;  2KDH A;  4AQJ A;  1NX2 A;  2CCM A;  4PE4 A;  5B8I B;  5I2O A;  1OZO A;  4PHK A;  4OKH A;  1JC2 A;  1YVH A;  3EKH A;  2DOQ A;  5DKQ A;  1B9A A;  2JQ6 A;  2BKH B;  1IG5 A;  2FJU B;  2K2A A;  4DUQ A;  2CT9 A;  1VRK A;  1JFK A;  1QV0 A;  1F55 A;  3O4Y A;  4HSZ A;  2LNK A;  1RJV A;  1UHI A;  1AK8 A;  2LHL A;  2PMY A;  4ORB B;  3A4U B;  2JXL A;  1NCZ A;  3DF0 A;  1CLM A;  1SMG A;  3OB2 B;  3I5F C;  3VRO A;  1DMO A;  1QIV A;  3EK7 A;  2LHI A;  5AFP A;  1B1G A;  1NCY A;  3DD4 A;  1EXR A;  3PM8 A;  1AUI B;  2OS8 B;  2BKI B;  3KPX A;  2KAY A;  3SG7 A;  1TCF A;  1A2X A;  2LMV A;  2M0R A;  2FCD A;  3HX4 A;  1K9K A;  1BJF A;  1YUR A;  2JC2 A;  1B7T Z;  1V1F A;  3NSL A;  4C0L A;  3O78 A;  1K8U A;  3I5H C;  4YGB B;  4CFR A;  1Q80 A;  1DJZ A;  2JUL A;  2K7B A;  1AJ4 A;  3IQO A;  1SY9 A;  4MZJ A;  5DKR A;  4ICB A;  2JT0 A;  1XYD A;  2F3Y A;  3VGO A;  3JVT C;  5AER A;  1KK7 Y;  1SL9 A;  1XFW O;  1XK4 A;  2P6B B;  1S6C A;  2ZKM X;  3RLZ A;  4N1F A;  1IH0 A;  2MAZ A;  1BG1 A;  3PFV A;  1KCY A;  1KSO A;  1NP8 A;  1AJ5 A;  3MSE B;  2LLU A;  1F54 A;  2KAX A;  3KHE A;  1DTL A;  1Y0V H;  1BT6 A;  3I5I B;  1IJ6 A;  4R1E A;  1SL8 A;  1NSH A;  3EK4 A;  5GQQ C;  1NX1 A;  1N2D A;  2M1K B;  2VRG A;  4GNK B;  2K7C A;  1F4Q A;  1XFX O;  3DVE A;  2LLT A;  3QRX A;  4L9M A;  1U5I A;  3FWC A;  4AOM A;  3ICB A;  1TOP A;  3BUO B;  1MHO A;  1BR1 B;  2GV5 A;  2K61 A;  4NDB A;  1MXE A;  4YI8 A;  1DT7 B;  3ZWH A;  2OS8 C;  1QAS A;  3PAL A;  2NXQ A;  1M31 A;  2L5X B;  1ODB A;  1B8R A;  1TNW A;  3DF0 B;  2M8U A;  1DGU A;  2Y1M A;  1FBV A;  1G4Y R;  2OPO A;  4ORA B;  3BXK A;  1QS7 A;  3TUY B;  1A75 A;  2RGI A;  3SG6 A;  3AAJ A;  1YUS A;  4YGE B;  1OMV A;  1J1D A;  4QJ3 B;  3KO0 A;  1K9P A;  2KFG A;  1RTP 1;  1KQM B;  1REC A;  2M7N A;  3AKA A;  2GGZ A;  1YX8 A;  1K94 A;  2LV7 A;  2Q4U A;  1C07 A;  4JWQ A;  1QTX A;  2F3Z A;  3TZ1 A;  5I2Q A;  3RM1 A;  1B8L A;  1XVJ A;  1C7V A;  2JU0 A;  4C0J A;  1CFD A;  2PVB A;  2WC8 A;  3SG5 A;  1F4O A;  2M1U A;  3SIA A;  1DGV A;  4C0K A;  3I5I C;  4WRI A;  2BL0 B;  1LXF C;  2K2F A;  3OX6 A;  2EGD A;  1LA3 A;  1UUR A;  2LAP A;  2Y4Q A;  3JTD B;  3VRP A;  1V1G A;  5JJG A;  2F2P A;  2HPS A;  2LCP A;  4Q04 A;  1JUO A;  1QJT A;  1KK7 Z;  2G9B A;  2K8M B;  1NWD A;  1DJW A;  2ZRT A;  2M7L A;  2D8N A;  1QX2 A;  3EK8 A;  1NX3 A;  2PAL A;  4I5K A;  1AHR A;  1W7I B;  2F2O A;  2LVI A;  2LUX A;  4AQI A;  1HT9 A;  1U5I B;  1DJH A;  2GGM A;  2HQW A;  3BUX B;  1PVB A;  1KSM A;  1MXL C;  1S6J A;  5F6T A;  1Y1A A;  1J7O A;  3TUY C;  3IF7 A;  1IRJ A;  2LP3 A;  1EL4 A;  1CMG A;  2PAS A;  4P5O E;  1TIZ A;  1OE9 B;  1SCV A;  2KI6 D;  1KQM C;  2MLF C;  1TRF A;  4I5J A;  4YGA A;  2WCE A;  3LK1 A;  3D0Y A;  4ETO A;  1PUL A;  4E68 A;  2NZ0 A;  1MUX A;  1YX7 A;  1KK8 B;  1NUB A;  1PK0 D;  2BE6 A;  3AKB A;  1DJX A;  1KQV A;  5PAL A;  1H8B A;  1OMR A;  3K21 A;  1JF0 A;  3WHT B;  4MRY A;  2H61 C;  2JTZ A;  1EJ3 A;  1BOD A;  1PVA A;  4DCK A;  2BL0 C;  5D69 A;  3TDZ A;  4OV2 A;  4XYN A;  3KF9 A;  1S1E A;  1Y1U A;  2K7O A;  3GK1 A;  1WRL A;  2EHB A;  1CM4 A;  2SAS A;  4MLW A;  3JTD C;  4ZCV A;  3SIB A;  1LVC D;  1M39 A;  5AEQ A;  5FYX A;  2HF5 A;  1H4B A;  1SRA A;  2PRU A;  4I5L B;  2L51 A;  5HKW A;  1R6P A;  5CSF A;  3BQ3 A;  2KI4 B;  4MZL A;  1PSB A;  1L2O B;  2I2R E;  3M0W A;  5TNC A;  3TS5 B;  2HQ8 A;  1S26 D;  3NSK A;  2AAO A;  4XJK B;  5ER4 X;  1N0Y A;  1L7Z A;  5G08 A;  1F70 A;  2LM5 A;  2MHH A;  1MR8 A;  3NSI A;  1LA0 A;  1XFU O;  5HLV A;  4YGC B;  1CLL A;  1UP5 A;  4NDD A;  3NSO A;  2WCB A;  2KHN A;  1CNP A;  2L98 A;  3NXA A;  4USL A;  3WHU B;  4UPG A;  5AAN A;  3I5G B;  2LE9 B;  1R2U A;  2ZN9 A;  3EVV A;  1GGW A;  4NQG A;  2B1U A;  1RRO A;  5CSI A;  4YRU A;  1CB1 A;  1YUU A;  2CBL A;  1BF5 A;  2KYF A;  1GJY A;  1CFC A;  1M45 A;  1TNX A;  4M2O A;  1OQP A;  3E3R A;  3PLF B;  1QX5 B;  5HKZ A;  2ISD A;  1S6I A;  5KU1 A;  1SPY A;  1QLK A;  2KI4 C;  2KSP A;  4DIR A;  2NCP A;  1QIW A;  2AUC A;  1L2O C;  3TDU A;  4QJ4 B;  2KBM A;  3TS5 C;  2WOS A;  3DVJ A;  2L2E A;  5IBW A;  2KGB C;  3FS7 A;  5CSN A;  1CDM A;  2BE4 A;  4MRX A;  1QAT A;  4JQ0 D;  4D1E A;  3O6B A;  2L0P A;  5HKY A;  3CR5 X;  2LLS A;  1SBJ A;  3OP0 A;  3CZT X;  4U8D A;  4WQ3 A;  1FF1 A;  3SJS A;  2JXC A;  4F0Z B;  1IWQ A;  4I5N B;  5KTY A;  2K7D A;  1K90 D;  4PE0 A;  1GQM A;  4CPV A;  1XO5 A;  4GUK A;  3HCM A;  4PHM A;  1G8I A;  2HET A;  1SYM A;  1B47 A;  4CFQ A;  4DS7 A;  2MA2 A;  1HQV A;  3I5G C;  4BY5 A;  2M97 A;  1WRZ A;  3LL8 B;  2JT8 A;  1E8A A;  2BCX A;  2O60 A;  1QXP A;  3BUW B;  1YRU B;  1ZAC A;  1SW8 A;  2I18 A;  1OSA A;  3VRR A;  1NIW A;  2KBI A;  4QJ5 B;  4N1G A;  3DVK A;  4YGD B;  4FQO A;  1SNL A;  1Y1X A;  2KGR A;  4GBA A;  2ZFD A;  4NDC A;  4A4B A;  2F8P A;  2H2K A;  1TCO B;  1UUS A;  1KFX L;  2ZN8 A;  1IQ5 A;  2JT3 A;  2PSR A;  1Y6W A;  2LMU A;  2FOT A;  2KFF A;  3BUM B;  1CM1 A;  1XFZ O;  3O2P A;  1C7W A;  4YBH B;  1DVI A;  1ZUZ A;  4WQ2 A;  2LUC A;  5AXI A;  2BBN A;  5JOL A;  2CTN A;  4PHN A;  1J7Q A;  1MF8 B;  1JFJ A;  1EG3 A;  1QVI Y;  1FI5 A;  1CDP A;  1G33 A;  2I7A A;  1JF2 A;  3LCP C;  3LLE A;  2MRD A;  4DRW A;  1BU3 A;  1A75 B;  4PHJ A;  4JPZ B;  1M63 B;  3OX5 A;  1S5G Y;  1SKT A;  4MEW A;  3CLN A;  2WCF A;  1CFP A;  1SCM B;  2JNX A;  2CXJ A;  4OVN F;  1B4C A;  1XK4 C;  2JRF A;  1UHK A;  1MQ1 A;  2LAN A;  4PE1 A;  1RK9 A;  4GGN A;  4HRH A;  1TTX A;  2Y5I A;  4BY4 A;  1YVL A;  2EC6 B;  1QV1 A;  2FCE A;  2MBX A;  1J7P A;  4M2P A;  4GPL B;  2TN4 A;  4A4C A;  3CS1 A;  4N5X A;  1W7J B;  3A8R A;  3WXA A;  1PSR A;  5I8N A;  1AP4 A;  1EH2 A;  3SG3 A;  1UWO A;  2LVV A;  1J1E A;  1JBA A;  2KQY A;  2KAV A;  2OTG B;  4CLN A;  1DJG A;  1QLS A;  2CNP A;  1BR4 B;  1YR5 A;  4P2Y B;  1F8H A;  1WLM A;  1FPW A;  2LC5 A;  3EVR A;  2LVK A;  2NCO A;  1PAL A;  3OHM B;  5I2L A;  1CFF A;  1K2H A;  1ZMZ A;  2LMT A;  1WDC B;  2JPT A;  4GGF A;  3VRN A;  1FI6 A;  3H4S E;  1EG4 A;  2IS9 A;  1YUT A;  1ALW A;  2QPT A;  4PE7 A;  1DF0 A;  3DVM A;  2A4J A;  3PN7 B;  1KFU L;  1K9U A;  2BBM A;  1KK8 C;  1TN4 A;  1NCX A;  1ALV A;  1XFV O;  2V53 A;  4PAL A;  4OR9 B;  4YI9 A;  1BOC A;  3TDI A;  2R2I A;  1OOJ A;  5K89 A;  1MWN A;  1SCM C;  2L4I A;  2MJW B;  3D0Y B;  3PSR A;  1KFX S;  4MBE A;  1S36 A;  2JZI A;  1RFJ A;  1XFY O;  3CGA A;  2H61 A;  2M9G A;  1K95 A;  2BCB A;  1WLZ A;  4GAO A;  1IKU A;  2EC6 C;  1QVI Z;  3FIA A;  3C1V A;  5J3X A;  1LKJ A;  3VRQ A;  2M3W A;  1B8C A;  1TNP A;  1X02 A;  2K0J A;  2NLN A;  5CSJ A;  4TNC A;  2BEC A;  2KQ6 A;  1A29 A;  2M29 A;  1IJ5 A;  1XA5 A;  1UHH A;  2JNF A;  3PAT A;  1K93 D;  1S5G Z;  4PCW A;  3ZNI A;  1SR6 B;  2M49 B;  3EKJ A;  3FWB A;  5ER5 A;  3AAK A;  1SK6 D;  3F45 A;  2OTG C;  4HRE E;  1GGZ A;  4FTG A;  3LK0 A;  1CKK A;  1YRT B;  1OMD A;  3BOW A;  1ZOT B;  1YTZ C;  2LVJ A;  4IL1 A;  2E6W A;  2Q91 A;  1A4P A;  1M46 A;  1A03 A;  3GK2 A;  1WDC C;  2AMI A;  2Y1N A;  2KFH A;  1QX7 A;  1CDL A;  2SCP A;  2KOT A;  2F33 A;  1ZFS A;  2KYC A;  1WRK A;  3CR4 X;  3PN7 C; 
#chains in the Genus database with same CATH topology
 2ERB A;  1CLB A;  1CMF A;  1KWO B;  1J55 A;  2ZND A;  3WNX B;  1CTR A;  1DJI A;  2WND A;  3IQQ A;  1DF0 B;  5CPV A;  1S3P A;  2QEV A;  3SG2 A;  4OCI A;  1BMO A;  2L50 A;  1BLQ A;  1F71 A;  1AVS A;  1RWY A;  1NPQ A;  2E30 A;  1N65 A;  3S0G A;  2WCL A;  3BFB A;  3D77 A;  1IQ3 A;  1WY9 A;  2COL B;  2JTT A;  2I94 A;  1UHJ A;  2JWW A;  1B7T Y;  4GFT A;  5BPJ A;  5D7F A;  3K1E A;  4MVF A;  1DEK A;  3BYA A;  3OB1 B;  1FW4 A;  3GOF A;  5DKN A;  2L4H A;  2MLE C;  3R1O A;  1SL7 A;  1SR6 C;  1J7R A;  4ZCU A;  1SSE B;  2ZRS A;  3I5F B;  5HLO A;  1JWD A;  1LIN A;  1IGV A;  1CDN A;  1D1O A;  2LP2 A;  1PRW A;  3CTN A;  4MZK A;  4M2Q A;  4XJK A;  5FI2 A;  1UHN A;  2WC5 A;  4MN0 A;  3D10 A;  1KFU S;  3L4A A;  2BCA A;  2KI6 C;  3CZ1 A;  2O5G A;  4CID A;  4HRG A;  3SG4 A;  4PDZ A;  1DJY A;  3GK4 X;  3I5H B;  1OZS A;  3KEV A;  3NGV A;  5KSZ A;  5HYD A;  3DYE A;  2G2B A;  2QAC A;  3BOW B;  1NX0 A;  3VB1 A;  1JSA A;  2JOJ A;  3EVU A;  1K96 A;  2KNE A;  2WOR A;  3JVT B;  1KWO C;  3BUN B;  3CWG A;  4GGF C;  1NYA A;  4MSP A;  1TNQ A;  4ORC B;  2ZNE A;  3CR2 A;  2KDH A;  4AQJ A;  1NX2 A;  2CCM A;  4PE4 A;  5B8I B;  3SS5 A;  1OZO A;  4PHK A;  4OKH A;  5I2O A;  1JC2 A;  1YVH A;  3EKH A;  2DOQ A;  5DKQ A;  1B9A A;  2JQ6 A;  2BKH B;  1IG5 A;  2FJU B;  2K2A A;  3R1P A;  4JKT A;  4DUQ A;  2CT9 A;  1VRK A;  1JFK A;  1QV0 A;  1F55 A;  3O4Y A;  3IVT A;  4HSZ A;  2LNK A;  3B88 A;  1RJV A;  1UHI A;  1AK8 A;  2LHL A;  1OOH A;  2PMY A;  4ORB B;  3A4U B;  2JXL A;  1NCZ A;  3DF0 A;  1CLM A;  1SMG A;  3OB2 B;  3I5F C;  3SS4 A;  3VRO A;  1DMO A;  1QIV A;  3EK7 A;  2LHI A;  3NHI A;  5AFP A;  1B1G A;  1NCY A;  3DD4 A;  1EXR A;  1OW4 A;  1AUI B;  3PM8 A;  2BAP A;  2OS8 B;  2BKI B;  3KPX A;  2KAY A;  3SG7 A;  1TCF A;  1C3Y A;  1A2X A;  2LMV A;  2M0R A;  2FCD A;  3PJI A;  3HX4 A;  1K9K A;  1BJF A;  1YUR A;  2JC2 A;  1B7T Z;  1V1F A;  3NSL A;  4C0L A;  3O78 A;  1K8U A;  3I5H C;  4YGB B;  4CFR A;  1Q80 A;  1DJZ A;  2JUL A;  2K7B A;  1AJ4 A;  3DXL A;  3IQO A;  1SY9 A;  4MZJ A;  5DKR A;  4ICB A;  2JT0 A;  1XYD A;  2PYQ A;  3BFH A;  2WC6 A;  2F3Y A;  3VGO A;  3JVT C;  5AER A;  1KK7 Y;  1SL9 A;  1XFW O;  1XK4 A;  2JPO A;  1S6C A;  2P6B B;  2ZKM X;  3CZ2 A;  3RLZ A;  4N1F A;  1IH0 A;  2MAZ A;  1BG1 A;  3PFV A;  1KCY A;  1KSO A;  1NP8 A;  1AJ5 A;  3MSE B;  2LLU A;  1F54 A;  2KAX A;  3KHE A;  1DTL A;  3L4L A;  1Y0V H;  1BT6 A;  2WCM A;  3I5I B;  1IJ6 A;  4R1E A;  1SL8 A;  1NSH A;  3EK4 A;  5GQQ C;  1NX1 A;  1N2D A;  2M1K B;  2VRG A;  4GNK B;  1DC1 A;  2K7C A;  1F4Q A;  1XFX O;  3DVE A;  1DQE A;  2LLT A;  3QRX A;  4L9M A;  1U5I A;  2KLE A;  3FWC A;  4AOM A;  3ICB A;  1TOP A;  3BUO B;  1MHO A;  1BR1 B;  2GV5 A;  2K61 A;  4NDB A;  3FE9 A;  1MXE A;  4YI8 A;  1DT7 B;  3ZWH A;  2OS8 C;  1QAS A;  3PAL A;  2NXQ A;  1M31 A;  2L5X B;  1ODB A;  1B8R A;  1TNW A;  3CDN A;  3D78 A;  2M8U A;  3DF0 B;  1DGU A;  2Y1M A;  1FBV A;  1G4Y R;  2OPO A;  1Z4H A;  3BXK A;  4ORA B;  1QS7 A;  3TUY B;  1A75 A;  2RGI A;  3OGN A;  3AAJ A;  3SG6 A;  1YUS A;  4YGE B;  1OMV A;  1J1D A;  4QJ3 B;  3KO0 A;  1K9P A;  2KFG A;  1P28 A;  1RTP 1;  1KQM B;  1REC A;  2M7N A;  3AKA A;  2GGZ A;  1YX8 A;  1K94 A;  2LV7 A;  2Q4U A;  3S0E A;  1C07 A;  4JWQ A;  1QTX A;  2F3Z A;  3TZ1 A;  5I2Q A;  3RM1 A;  2YGU A;  1B8L A;  1XVJ A;  3D73 A;  2JU0 A;  1C7V A;  4C0J A;  5I94 A;  1CFD A;  2PVB A;  2WC8 A;  3SG5 A;  1F4O A;  2M1U A;  3SIA A;  1DGV A;  4C0K A;  3I5I C;  4WRI A;  2BL0 B;  1LXF C;  2K2F A;  3OX6 A;  2EGD A;  3UNW A;  1LA3 A;  1UUR A;  2LAP A;  2Y4Q A;  3JTD B;  3VRP A;  1V1G A;  5JJG A;  2F2P A;  2HPS A;  2LCP A;  2BNX A;  4Q04 A;  1JUO A;  1QJT A;  1QWV A;  1KK7 Z;  2G9B A;  2K8M B;  1NWD A;  1DJW A;  2QEH A;  2ZRT A;  2M7L A;  2WCH A;  2D8N A;  1QX2 A;  3EK8 A;  1NX3 A;  2PAL A;  4I5K A;  1AHR A;  1W7I B;  2F2O A;  2LVI A;  2LUX A;  4AQI A;  1HT9 A;  1U5I B;  1DJH A;  2GGM A;  2HQW A;  3BUX B;  1W9Z A;  1PVB A;  2WCJ A;  1KSM A;  1MXL C;  1S6J A;  5HL1 A;  3PM2 A;  5F6T A;  1Y1A A;  1J7O A;  3TUY C;  3IF7 A;  1IRJ A;  2LP3 A;  1EL4 A;  1CMG A;  3Q8I A;  2PAS A;  3FE6 A;  4P5O E;  1TIZ A;  1OE9 B;  1SCV A;  2KI6 D;  1KQM C;  2MLF C;  1TRF A;  4I5J A;  4YGA A;  2WCE A;  3LK1 A;  3D0Y A;  5D3O A;  1OOG A;  3EG5 B;  4ETO A;  1PUL A;  4E68 A;  2NZ0 A;  1MUX A;  1YX7 A;  1KK8 B;  2QEO A;  1NUB A;  1PK0 D;  2L2C A;  2BE6 A;  3AKB A;  1DJX A;  1KQV A;  5PAL A;  1H8B A;  3O4X A;  1OMR A;  3K21 A;  4PT1 A;  1JF0 A;  1OOI X;  3WHT B;  4MRY A;  2H61 C;  2JTZ A;  1EJ3 A;  1BOD A;  1PVA A;  4DCK A;  2BL0 C;  5D69 A;  3TDZ A;  4OV2 A;  4XYN A;  3KF9 A;  1S1E A;  1Y1U A;  2K7O A;  3DZT A;  2GTE A;  3GK1 A;  1WRL A;  2EHB A;  1CM4 A;  2SAS A;  4KYN A;  1DEL A;  3JTD C;  4MLW A;  4ZCV A;  3SIB A;  1LVC D;  1M39 A;  5AEQ A;  5FYX A;  2HF5 A;  3S0B A;  1SRA A;  1H4B A;  2PRU A;  4I5L B;  2L51 A;  5HKW A;  1R6P A;  5CSF A;  3BQ3 A;  2KI4 B;  4MZL A;  2FJY A;  1PSB A;  1L2O B;  2I2R E;  3M0W A;  5TNC A;  3TS5 B;  2HQ8 A;  1S26 D;  3NSK A;  2AAO A;  4XJK B;  5ER4 X;  1N0Y A;  1L7Z A;  5G08 A;  3QME A;  3CAB A;  3S0A A;  1F70 A;  2LM5 A;  2MHH A;  1MR8 A;  3NSI A;  1LA0 A;  1XFU O;  5HLV A;  4YGC B;  3DY9 A;  1CLL A;  1UP5 A;  3BFA A;  4NDD A;  3NSO A;  3B7A A;  2WCB A;  2KHN A;  1CNP A;  2L98 A;  3NXA A;  4USL A;  3WHU B;  4UPG A;  5AAN A;  3I5G B;  2LE9 B;  1R2U A;  2ZN9 A;  3EVV A;  1GGW A;  4NQG A;  2B1U A;  1RRO A;  5CSI A;  4YRU A;  1CB1 A;  1YUU A;  2CBL A;  1BF5 A;  3R1V A;  2KYF A;  1GJY A;  1CFC A;  2QDI A;  1M45 A;  1TNX A;  4M2O A;  1OQP A;  3E3R A;  3PLF B;  1QX5 B;  5HKZ A;  1XFR A;  2ISD A;  1T14 A;  1S6I A;  5KU1 A;  4JD9 A;  1SPY A;  1QLK A;  2KI4 C;  2KSP A;  4DIR A;  2NCP A;  1QIW A;  2AUC A;  2WCK A;  5EL2 A;  1L2O C;  2K60 A;  5FI6 A;  2KBM A;  3TDU A;  3TS5 C;  4QJ4 B;  2WOS A;  3DVJ A;  2L2E A;  3S0D A;  2KGB C;  3FS7 A;  4FQT A;  5CSN A;  5IBW A;  1CDM A;  2BE4 A;  4MRX A;  1QAT A;  4JQ0 D;  4D1E A;  3O6B A;  2L0P A;  5HKY A;  3CR5 X;  2LLS A;  1SBJ A;  3D76 A;  3CZT X;  3OP0 A;  4U8D A;  4WQ3 A;  3SJS A;  2JXC A;  4F0Z B;  1IWQ A;  4I5N B;  1FF1 A;  1TWO A;  5KTY A;  2K7D A;  1K90 D;  4PE0 A;  1GQM A;  4CPV A;  1XO5 A;  4GUK A;  3HCM A;  4PHM A;  3D74 A;  1G8I A;  2HET A;  3R72 A;  1SYM A;  1IIO A;  1B47 A;  2KPH A;  4CFQ A;  4DS7 A;  2MA2 A;  1HQV A;  3I5G C;  4BY5 A;  2M97 A;  1WRZ A;  3LL8 B;  2JT8 A;  1E8A A;  2BCX A;  2O60 A;  1QXP A;  3BUW B;  1YRU B;  1ZAC A;  1SW8 A;  2I18 A;  1OSA A;  3VRR A;  1NIW A;  2KBI A;  4QJ5 B;  4N1G A;  3DVK A;  4YGD B;  4FQO A;  1SNL A;  1Y1X A;  2KGR A;  4GBA A;  3RZS A;  2ZFD A;  4NDC A;  4A4B A;  2F8P A;  3D75 A;  2H2K A;  1TCO B;  1UUS A;  1KFX L;  2ZN8 A;  1IQ5 A;  2JT3 A;  2PSR A;  1Y6W A;  2LMU A;  2FOT A;  2KFF A;  3BUM B;  1CM1 A;  1XFZ O;  3O2P A;  1C7W A;  4YBH B;  1DVI A;  1LS8 A;  1ZUZ A;  4WQ2 A;  1GM0 A;  2LUC A;  5AXI A;  2BBN A;  5JOL A;  2CTN A;  4PHN A;  1ORG A;  1J7Q A;  1MF8 B;  1JFJ A;  3B86 A;  1EG3 A;  1QVI Y;  1FI5 A;  1CDP A;  1G33 A;  2I7A A;  1JF2 A;  3LCP C;  3LLE A;  2MRD A;  4DRW A;  3B87 A;  1BU3 A;  1A75 B;  4PHJ A;  3CZ0 A;  4JPZ B;  1M63 B;  3OX5 A;  2QEB A;  1S5G Y;  1SKT A;  4MEW A;  3CLN A;  2WCF A;  1CFP A;  1SCM B;  2JNX A;  2CXJ A;  4INW A;  4OVN F;  1B4C A;  4OZD A;  1XK4 C;  2JRF A;  1UHK A;  1MQ1 A;  2LAN A;  3CYZ A;  4PE1 A;  1RK9 A;  4GGN A;  4HRH A;  1TTX A;  2Y5I A;  4BY4 A;  1YVL A;  2EC6 B;  1QV1 A;  2FCE A;  5FI7 A;  2MBX A;  1J7P A;  4M2P A;  4GPL B;  2TN4 A;  4A4C A;  3CS1 A;  4IJ7 A;  4N5X A;  1W7J B;  3A8R A;  3WXA A;  1PSR A;  5I8N A;  1AP4 A;  3V2L A;  1EH2 A;  3SG3 A;  1UWO A;  2LVV A;  1J1E A;  1JBA A;  2KQY A;  2KLD A;  2KAV A;  2OTG B;  3NHT A;  4CLN A;  1DJG A;  2P71 A;  1QLS A;  2CNP A;  1BR4 B;  1YR5 A;  4P2Y B;  1F8H A;  1WLM A;  2P70 A;  2LC5 A;  3EVR A;  1FPW A;  2LVK A;  4F7F A;  2NCO A;  1PAL A;  1TUJ A;  3OHM B;  5I2L A;  3FE8 A;  1ZMZ A;  2LMT A;  3L47 A;  1CFF A;  1K2H A;  1WDC B;  2JPT A;  4GGF A;  3VRN A;  1FI6 A;  3H4S E;  1EG4 A;  2IS9 A;  1YUT A;  1ALW A;  2QPT A;  4PE7 A;  1TUZ A;  1DF0 A;  3DVM A;  2A4J A;  3UO9 A;  3PN7 B;  1KFU L;  1K9U A;  2BBM A;  1TN4 A;  1KK8 C;  1NCX A;  1ALV A;  1XFV O;  2V53 A;  2H8V A;  3BJH A;  4OR9 B;  4PAL A;  4YI9 A;  2R2I A;  3TDI A;  1BOC A;  1OOJ A;  5K89 A;  1MWN A;  1SCM C;  2L4I A;  2MJW B;  3D0Y B;  5DIC A;  3PSR A;  1KFX S;  4MBE A;  1S36 A;  2JZI A;  1RFJ A;  1XFY O;  3CGA A;  2H61 A;  3B6X A;  2M9G A;  1K95 A;  2BCB A;  1WLZ A;  4GAO A;  1IKU A;  2EC6 C;  1QVI Z;  4INX A;  3FIA A;  3C1V A;  5J3X A;  1LKJ A;  3VRQ A;  2M3W A;  1B8C A;  1TNP A;  1X02 A;  1C3Z A;  2K0J A;  2NLN A;  5CSJ A;  3SS3 A;  4TNC A;  3S0F A;  2BEC A;  2KQ6 A;  1A29 A;  3OBV A;  2M29 A;  1IJ5 A;  1XA5 A;  1UHH A;  2JNF A;  2L5Y A;  1K93 D;  1S5G Z;  3PAT A;  4PCW A;  3ZNI A;  3N7H A;  1SR6 B;  2M49 B;  3EKJ A;  3FWB A;  5ER5 A;  3AAK A;  1SK6 D;  3F45 A;  2OTG C;  4HRE E;  1GGZ A;  4FTG A;  3LK0 A;  1CKK A;  1YRT B;  1OMD A;  3BOW A;  1ZOT B;  1YTZ C;  2LVJ A;  4IL1 A;  2E6W A;  2Q91 A;  1A4P A;  1M46 A;  1A03 A;  3GK2 A;  1WDC C;  2AMI A;  1Z2C B;  2KFH A;  2Y1N A;  1OOF A;  1CDL A;  1QX7 A;  2SCP A;  2KOT A;  2F33 A;  2PQL A;  1ZFS A;  2KYC A;  1WRK A;  3CR4 X;  3PN7 C; 
#chains in the Genus database with same CATH homology
 1CLB A;  1CMF A;  1KWO B;  1J55 A;  2ZND A;  3WNX B;  1CTR A;  1DJI A;  2WND A;  3IQQ A;  1DF0 B;  5CPV A;  1S3P A;  3SG2 A;  4OCI A;  1BMO A;  2L50 A;  1BLQ A;  1F71 A;  1AVS A;  1RWY A;  1NPQ A;  2E30 A;  1N65 A;  1IQ3 A;  1WY9 A;  2COL B;  2JTT A;  2I94 A;  1UHJ A;  2JWW A;  1B7T Y;  4GFT A;  5BPJ A;  5D7F A;  4MVF A;  3BYA A;  3OB1 B;  1FW4 A;  3GOF A;  5DKN A;  2L4H A;  2MLE C;  1SL7 A;  1SR6 C;  1J7R A;  4ZCU A;  2ZRS A;  3I5F B;  5HLO A;  1JWD A;  1LIN A;  1IGV A;  1CDN A;  1D1O A;  2LP2 A;  1PRW A;  3CTN A;  4MZK A;  4M2Q A;  4XJK A;  1UHN A;  4MN0 A;  3D10 A;  1KFU S;  2BCA A;  2KI6 C;  2O5G A;  4CID A;  4HRG A;  3SG4 A;  4PDZ A;  1DJY A;  3GK4 X;  3I5H B;  1OZS A;  3KEV A;  5KSZ A;  5HYD A;  2G2B A;  2QAC A;  3BOW B;  1NX0 A;  1JSA A;  2JOJ A;  3EVU A;  1K96 A;  2KNE A;  2WOR A;  3JVT B;  1KWO C;  3BUN B;  3CWG A;  4GGF C;  1NYA A;  4MSP A;  1TNQ A;  4ORC B;  2ZNE A;  3CR2 A;  2KDH A;  4AQJ A;  1NX2 A;  2CCM A;  4PE4 A;  5B8I B;  5I2O A;  1OZO A;  4PHK A;  4OKH A;  1JC2 A;  1YVH A;  3EKH A;  2DOQ A;  5DKQ A;  1B9A A;  2JQ6 A;  2BKH B;  1IG5 A;  2FJU B;  2K2A A;  4DUQ A;  2CT9 A;  1VRK A;  1JFK A;  1QV0 A;  1F55 A;  3O4Y A;  4HSZ A;  2LNK A;  1RJV A;  1UHI A;  1AK8 A;  2LHL A;  2PMY A;  4ORB B;  3A4U B;  2JXL A;  1NCZ A;  3DF0 A;  1CLM A;  1SMG A;  3OB2 B;  3I5F C;  3VRO A;  1DMO A;  1QIV A;  3EK7 A;  2LHI A;  5AFP A;  1B1G A;  1NCY A;  3DD4 A;  1EXR A;  3PM8 A;  1AUI B;  2OS8 B;  2BKI B;  3KPX A;  2KAY A;  3SG7 A;  1TCF A;  1A2X A;  2LMV A;  2M0R A;  2FCD A;  3HX4 A;  1K9K A;  1BJF A;  1YUR A;  2JC2 A;  1B7T Z;  1V1F A;  3NSL A;  4C0L A;  3O78 A;  1K8U A;  3I5H C;  4YGB B;  4CFR A;  1Q80 A;  1DJZ A;  2JUL A;  2K7B A;  1AJ4 A;  3IQO A;  1SY9 A;  4MZJ A;  5DKR A;  4ICB A;  2JT0 A;  1XYD A;  2F3Y A;  3VGO A;  3JVT C;  5AER A;  1KK7 Y;  1SL9 A;  1XFW O;  1XK4 A;  2P6B B;  1S6C A;  2ZKM X;  3RLZ A;  4N1F A;  1IH0 A;  2MAZ A;  1BG1 A;  3PFV A;  1KCY A;  1KSO A;  1NP8 A;  1AJ5 A;  3MSE B;  2LLU A;  1F54 A;  2KAX A;  3KHE A;  1DTL A;  1Y0V H;  1BT6 A;  3I5I B;  1IJ6 A;  4R1E A;  1SL8 A;  1NSH A;  3EK4 A;  5GQQ C;  1NX1 A;  1N2D A;  2M1K B;  2VRG A;  4GNK B;  2K7C A;  1F4Q A;  1XFX O;  3DVE A;  2LLT A;  3QRX A;  4L9M A;  1U5I A;  3FWC A;  4AOM A;  3ICB A;  1TOP A;  3BUO B;  1MHO A;  1BR1 B;  2GV5 A;  2K61 A;  4NDB A;  1MXE A;  4YI8 A;  1DT7 B;  3ZWH A;  2OS8 C;  1QAS A;  3PAL A;  2NXQ A;  1M31 A;  2L5X B;  1ODB A;  1B8R A;  1TNW A;  3DF0 B;  2M8U A;  1DGU A;  2Y1M A;  1FBV A;  1G4Y R;  2OPO A;  4ORA B;  3BXK A;  1QS7 A;  3TUY B;  1A75 A;  2RGI A;  3SG6 A;  3AAJ A;  1YUS A;  4YGE B;  1OMV A;  1J1D A;  4QJ3 B;  3KO0 A;  1K9P A;  2KFG A;  1RTP 1;  1KQM B;  1REC A;  2M7N A;  3AKA A;  2GGZ A;  1YX8 A;  1K94 A;  2LV7 A;  2Q4U A;  1C07 A;  4JWQ A;  1QTX A;  2F3Z A;  3TZ1 A;  5I2Q A;  3RM1 A;  1B8L A;  1XVJ A;  1C7V A;  2JU0 A;  4C0J A;  1CFD A;  2PVB A;  2WC8 A;  3SG5 A;  1F4O A;  2M1U A;  3SIA A;  1DGV A;  4C0K A;  3I5I C;  4WRI A;  2BL0 B;  1LXF C;  2K2F A;  3OX6 A;  2EGD A;  1LA3 A;  1UUR A;  2LAP A;  2Y4Q A;  3JTD B;  3VRP A;  1V1G A;  5JJG A;  2F2P A;  2HPS A;  2LCP A;  4Q04 A;  1JUO A;  1QJT A;  1KK7 Z;  2G9B A;  2K8M B;  1NWD A;  1DJW A;  2ZRT A;  2M7L A;  2D8N A;  1QX2 A;  3EK8 A;  1NX3 A;  2PAL A;  4I5K A;  1AHR A;  1W7I B;  2F2O A;  2LVI A;  2LUX A;  4AQI A;  1HT9 A;  1U5I B;  1DJH A;  2GGM A;  2HQW A;  3BUX B;  1PVB A;  1KSM A;  1MXL C;  1S6J A;  5F6T A;  1Y1A A;  1J7O A;  3TUY C;  3IF7 A;  1IRJ A;  2LP3 A;  1EL4 A;  1CMG A;  2PAS A;  4P5O E;  1TIZ A;  1OE9 B;  1SCV A;  2KI6 D;  1KQM C;  2MLF C;  1TRF A;  4I5J A;  4YGA A;  2WCE A;  3LK1 A;  3D0Y A;  4ETO A;  1PUL A;  4E68 A;  2NZ0 A;  1MUX A;  1YX7 A;  1KK8 B;  1NUB A;  1PK0 D;  2BE6 A;  3AKB A;  1DJX A;  1KQV A;  5PAL A;  1H8B A;  1OMR A;  3K21 A;  1JF0 A;  3WHT B;  4MRY A;  2H61 C;  2JTZ A;  1EJ3 A;  1BOD A;  1PVA A;  4DCK A;  2BL0 C;  5D69 A;  3TDZ A;  4OV2 A;  4XYN A;  3KF9 A;  1S1E A;  1Y1U A;  2K7O A;  3GK1 A;  1WRL A;  2EHB A;  1CM4 A;  2SAS A;  4MLW A;  3JTD C;  4ZCV A;  3SIB A;  1LVC D;  1M39 A;  5AEQ A;  5FYX A;  2HF5 A;  1H4B A;  1SRA A;  2PRU A;  4I5L B;  2L51 A;  5HKW A;  1R6P A;  5CSF A;  3BQ3 A;  2KI4 B;  4MZL A;  1PSB A;  1L2O B;  2I2R E;  3M0W A;  5TNC A;  3TS5 B;  2HQ8 A;  1S26 D;  3NSK A;  2AAO A;  4XJK B;  5ER4 X;  1N0Y A;  1L7Z A;  5G08 A;  1F70 A;  2LM5 A;  2MHH A;  1MR8 A;  3NSI A;  1LA0 A;  1XFU O;  5HLV A;  4YGC B;  1CLL A;  1UP5 A;  4NDD A;  3NSO A;  2WCB A;  2KHN A;  1CNP A;  2L98 A;  3NXA A;  4USL A;  3WHU B;  4UPG A;  5AAN A;  3I5G B;  2LE9 B;  1R2U A;  2ZN9 A;  3EVV A;  1GGW A;  4NQG A;  2B1U A;  1RRO A;  5CSI A;  4YRU A;  1CB1 A;  1YUU A;  2CBL A;  1BF5 A;  2KYF A;  1GJY A;  1CFC A;  1M45 A;  1TNX A;  4M2O A;  1OQP A;  3E3R A;  3PLF B;  1QX5 B;  5HKZ A;  2ISD A;  1S6I A;  5KU1 A;  1SPY A;  1QLK A;  2KI4 C;  2KSP A;  4DIR A;  2NCP A;  1QIW A;  2AUC A;  1L2O C;  3TDU A;  4QJ4 B;  2KBM A;  3TS5 C;  2WOS A;  3DVJ A;  2L2E A;  5IBW A;  2KGB C;  3FS7 A;  5CSN A;  1CDM A;  2BE4 A;  4MRX A;  1QAT A;  4JQ0 D;  4D1E A;  3O6B A;  2L0P A;  5HKY A;  3CR5 X;  2LLS A;  1SBJ A;  3OP0 A;  3CZT X;  4U8D A;  4WQ3 A;  1FF1 A;  3SJS A;  2JXC A;  4F0Z B;  1IWQ A;  4I5N B;  5KTY A;  2K7D A;  1K90 D;  4PE0 A;  1GQM A;  4CPV A;  1XO5 A;  4GUK A;  3HCM A;  4PHM A;  1G8I A;  2HET A;  1SYM A;  1B47 A;  4CFQ A;  4DS7 A;  2MA2 A;  1HQV A;  3I5G C;  4BY5 A;  2M97 A;  1WRZ A;  3LL8 B;  2JT8 A;  1E8A A;  2BCX A;  2O60 A;  1QXP A;  3BUW B;  1YRU B;  1ZAC A;  1SW8 A;  2I18 A;  1OSA A;  3VRR A;  1NIW A;  2KBI A;  4QJ5 B;  4N1G A;  3DVK A;  4YGD B;  4FQO A;  1SNL A;  1Y1X A;  2KGR A;  4GBA A;  2ZFD A;  4NDC A;  4A4B A;  2F8P A;  2H2K A;  1TCO B;  1UUS A;  1KFX L;  2ZN8 A;  1IQ5 A;  2JT3 A;  2PSR A;  1Y6W A;  2LMU A;  2FOT A;  2KFF A;  3BUM B;  1CM1 A;  1XFZ O;  3O2P A;  1C7W A;  4YBH B;  1DVI A;  1ZUZ A;  4WQ2 A;  2LUC A;  5AXI A;  2BBN A;  5JOL A;  2CTN A;  4PHN A;  1J7Q A;  1MF8 B;  1JFJ A;  1EG3 A;  1QVI Y;  1FI5 A;  1CDP A;  1G33 A;  2I7A A;  1JF2 A;  3LCP C;  3LLE A;  2MRD A;  4DRW A;  1BU3 A;  1A75 B;  4PHJ A;  4JPZ B;  1M63 B;  3OX5 A;  1S5G Y;  1SKT A;  4MEW A;  3CLN A;  2WCF A;  1CFP A;  1SCM B;  2JNX A;  2CXJ A;  4OVN F;  1B4C A;  1XK4 C;  2JRF A;  1UHK A;  1MQ1 A;  2LAN A;  4PE1 A;  1RK9 A;  4GGN A;  4HRH A;  1TTX A;  2Y5I A;  4BY4 A;  1YVL A;  2EC6 B;  1QV1 A;  2FCE A;  2MBX A;  1J7P A;  4M2P A;  4GPL B;  2TN4 A;  4A4C A;  3CS1 A;  4N5X A;  1W7J B;  3A8R A;  3WXA A;  1PSR A;  5I8N A;  1AP4 A;  1EH2 A;  3SG3 A;  1UWO A;  2LVV A;  1J1E A;  1JBA A;  2KQY A;  2KAV A;  2OTG B;  4CLN A;  1DJG A;  1QLS A;  2CNP A;  1BR4 B;  1YR5 A;  4P2Y B;  1F8H A;  1WLM A;  1FPW A;  2LC5 A;  3EVR A;  2LVK A;  2NCO A;  1PAL A;  3OHM B;  5I2L A;  1CFF A;  1K2H A;  1ZMZ A;  2LMT A;  1WDC B;  2JPT A;  4GGF A;  3VRN A;  1FI6 A;  3H4S E;  1EG4 A;  2IS9 A;  1YUT A;  1ALW A;  2QPT A;  4PE7 A;  1DF0 A;  3DVM A;  2A4J A;  3PN7 B;  1KFU L;  1K9U A;  2BBM A;  1KK8 C;  1TN4 A;  1NCX A;  1ALV A;  1XFV O;  2V53 A;  4PAL A;  4OR9 B;  4YI9 A;  1BOC A;  3TDI A;  2R2I A;  1OOJ A;  5K89 A;  1MWN A;  1SCM C;  2L4I A;  2MJW B;  3D0Y B;  3PSR A;  1KFX S;  4MBE A;  1S36 A;  2JZI A;  1RFJ A;  1XFY O;  3CGA A;  2H61 A;  2M9G A;  1K95 A;  2BCB A;  1WLZ A;  4GAO A;  1IKU A;  2EC6 C;  1QVI Z;  3FIA A;  3C1V A;  5J3X A;  1LKJ A;  3VRQ A;  2M3W A;  1B8C A;  1TNP A;  1X02 A;  2K0J A;  2NLN A;  5CSJ A;  4TNC A;  2BEC A;  2KQ6 A;  1A29 A;  2M29 A;  1IJ5 A;  1XA5 A;  1UHH A;  2JNF A;  3PAT A;  1K93 D;  1S5G Z;  4PCW A;  3ZNI A;  1SR6 B;  2M49 B;  3EKJ A;  3FWB A;  5ER5 A;  3AAK A;  1SK6 D;  3F45 A;  2OTG C;  4HRE E;  1GGZ A;  4FTG A;  3LK0 A;  1CKK A;  1YRT B;  1OMD A;  3BOW A;  1ZOT B;  1YTZ C;  2LVJ A;  4IL1 A;  2E6W A;  2Q91 A;  1A4P A;  1M46 A;  1A03 A;  3GK2 A;  1WDC C;  2AMI A;  2Y1N A;  2KFH A;  1QX7 A;  1CDL A;  2SCP A;  2KOT A;  2F33 A;  1ZFS A;  2KYC A;  1WRK A;  3CR4 X;  3PN7 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...