3JVTB

Calcium-bound scallop myosin regulatory domain (lever arm) with reconstituted complete light chains
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
156
structure length
156
Chain Sequence
ADKAASGVLTKLPQKQIQEMKEAFSMIDVDRDGFVSKEDIKAISEQLGRAPDDKELTAMLKEAPGPLNFTMFLSIFSDKLSGTDSEETIRNAFAMFDEQETKKLNIEYIKDLLENMGDNFNKDEMRMTFKEAPVEGGKFDYVKFTAMIKGSGEEEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Myosin heavy chain, striated adductor muscle
publication title The on-off switch in regulated myosins: different triggers but related mechanisms.
pubmed doi rcsb
molecule tags Contractile protein
total genus 45
structure length 156
sequence length 156
ec nomenclature
pdb deposition date 2009-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13405 EF-hand_6 EF-hand domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3jvtB01
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3jvtB02
5PALA 4DUQA 1SRAA 2KDHA 1EG3A 2O5GA 2LVKA 2PALA 1NCZA 4ORCB 1WDCC 3H4SE 2HPSA 1TNWA 2LVIA 2ZNEA 4YGEB 1B4CA 1PALA 4QJ3B 1DJIA 1V1FA 1NX0A 1SCMB 1BF5A 4WRIA 3CLNA 1KSOA 4ZCVA 1VRKA 5F6TA 4OV2A 5KTYA 4AQJA 1S1EA 2O60A 2LUCA 2M7LA 3GK4X 2KYFA 1RK9A 3NSKA 1MXEA 4GGNA 3OP0A 4IL1A 1SL7A 1WRKA 3M0WA 1IJ6A 1TTXA 4XYNA 1OMVA 2JQ6A 3KF9A 1YVHA 3DVEA 3PALA 2WCEA 1V1GA 1WLMA 3I5GB 1WY9A 1J7QA 5GQQC 1S5GY 1S26D 1KQMC 4BY4A 2M97A 4MZKA 1UP5A 3F45A 4JQ0D 2KI4B 1BMOA 4PE4A 2P6BB 1JWDA 2H61A 1NX3A 1C07A 4TNCA 1MWNA 1CTRA 1CDNA 1ZOTB 1UHIA 4YGBB 4HRGA 3EK4A 1TOPA 2M0RA 4OKHA 4GGFC 4CFRA 1OMDA 2BKIB 3LCPC 1N2DA 3CR4X 2Y4QA 2SCPA 1CFDA 4QJ5B 1F55A 1IKUA 5I2LA 1AJ4A 4YRUA 1BR1B 5IBWA 2LMTA 1QX7A 2L0PA 2F2PA 3KEVA 2OS8C 1DGVA 1TCFA 2BCXA 2WCFA 4JWQA 3HCMA 1AP4A 2ZFDA 2LUXA 3IQOA 1UHHA 2KHNA 3CR5X 1DF0B 3AAKA 4NQGA 1KCYA 1A75B 2TN4A 2K7DA 3SG3A 1J7RA 1C7WA 1J1EA 1DJXA 1TCOB 1NX2A 2KFGA 5CSJA 1PRWA 3I5IB 4MSPA 4ORAB 1CKKA 3RLZA 1MXLC 1KK8B 2LP2A 2JWWA 2QACA 3SIAA 4PE1A 2K2FA 2JRFA 3DVKA 3EK7A 1UHNA 4YI9A 3D0YA 4MEWA 4CLNA 2KQYA 1WDCB 4F0ZB 1WRLA 1SCVA 4DS7A 5I8NA 2KI6C 1KFUL 1G4YR 2KAVA 1QXPA 4PCWA 2ZNDA 2COLB 3TDIA 1QASA 1MUXA 1ALVA 2I7AA 1YX7A 2KGBC 2CTNA 4GFTA 1PVBA 4MVFA 1YR5A 2I2RE 1UUSA 5D7FA 1F71A 2F2OA 4GBAA 3DVJA 2JC2A 5KSZA 2I94A 3TZ1A 4OCIA 1MR8A 2E30A 2E6WA 4QJ4B 2VRGA 2LLUA 1KQMB 4GGFA 2KFHA 1S36A 1TN4A 4DIRA 1NSHA 1N65A 2JNFA 3BXKA 1NCXA 1IRJA 1SL8A 2JXCA 3DVMA 1XVJA 1F70A 2PVBA 3MSEB 1QS7A 2NCOA 1CB1A 1DTLA 2F33A 2NZ0A 2D8NA 4PDZA 1NP8A 2KBMA 2Y1NA 2ZKMX 5HYDA 1M31A 1K9PA 3SG2A 1OSAA 1PK0D 3DF0A 5K89A 1F8HA 1OMRA 2KQ6A 2HETA 4XJKB 2M29A 3KO0A 4YGCB 1LVCD 1MF8B 3BOWB 2LCPA 5D69A 2L98A 4D1EA 1QV1A 3O2PA 1FF1A 3BUWB 1G33A 4OR9B 2FCEA 1Y0VH 2JTTA 2WORA 1XFXO 4PHNA 4CIDA 4C0JA 1D1OA 2QPTA 2MHHA 1DGUA 1YVLA 1AHRA 3O78A 2LM5A 1XK4C 1UWOA 5DKRA 1YRUB 5JJGA 3O4YA 1U5IA 1CDMA 3OX6A 2NXQA 1A29A 1BT6A 3PN7C 1DMOA 4ETOA 5AEQA 1S6IA 2BECA 2BKHB 2HF5A 5HKYA 1S3PA 1SK6D 2JU0A 1U5IB 2MLEC 3NSLA 5AANA 2L4HA 4YGAA 1PULA 4Q04A 1QIVA 2RGIA 3NSIA 1L7ZA 3TUYB 1JF2A 2LP3A 1A4PA 3LL8B 1Y1AA 1J7PA 4AQIA 1RROA 2GGZA 1BODA 4PE7A 1KFUS 1DJYA 3NXAA 2KYCA 4YGDB 3KHEA 4C0LA 1CFFA 1Y1UA 1CFCA 1RJVA 2GV5A 2LNKA 1SBJA 1M46A 2BCBA 5ER4X 2DOQA 1XA5A 1WRZA 3I5FC 2MBXA 2F8PA 2KBIA 1QLSA 1SR6C 2CT9A 2I18A 5JOLA 3BYAA 4E68A 2LVVA 3GK2A 1H4BA 1DF0A 5J3XA 3ZWHA 1H8BA 1A75A 4FQOA 4GNKB 3OB2B 3HX4A 1GGZA 1YURA 1MQ1A 2WOSA 4MBEA 1SYMA 1EL4A 3CGAA 2PMYA 1YUUA 1B9AA 3CZTX 4R1EA 4NDBA 4MRYA 1B47A 1S6CA 5CPVA 1FI5A 1FPWA 3WXAA 1OZSA 3SG5A 3VRNA 1B8LA 4ZCUA 3A4UB 1B8CA 3EVRA 2JPTA 1K9UA 1RECA 1TNQA 1QX2A 1CMGA 1B7TY 1DJHA 2FCDA 1EH2A 1AK8A 2LE9B 2Y1MA 4PHJA 3PFVA 1IWQA 2NLNA 3WHTB 2LMUA 2M3WA 3OX5A 1JFKA 5B8IB 3FIAA 1YUTA 1KFXL 3IF7A 1F54A 1SL9A 4P5OE 1BOCA 4GPLB 4USLA 1E8AA 1SPYA 2V53A 4MZJA 1JSAA 2JOJA 1UHJA 2JTZA 2M9GA 1K96A 1YX8A 1BR4B 5HKZA 3BUMB 2K7BA 3TUYC 1B1GA 3PN7B 1NCYA 1PVAA 1TRFA 4M2PA 1NPQA 1W7IB 2Q4UA 1FI6A 3SIBA 1ODBA 2WCBA 3SG4A 4NDDA 4P2YB 1NIWA 1RWYA 1Y1XA 3LLEA 5CSIA 2L4IA 2PASA 3CWGA 2BE6A 2CCMA 4HREE 1XFZO 2K8MB 5HLOA 1NWDA 1SKTA 2LC5A 3PM8A 3PSRA 1YTZC 3A8RA 1R2UA 3FS7A 3QRXA 2WNDA 1B7TZ 1CMFA 2SASA 2MJWB 3I5FB 1LA3A 1UURA 4ICBA 1GQMA 4XJKA 1SR6B 2EC6C 2HQWA 2LHLA 1W7JB 1ZMZA 3BOWA 1SNLA 1BJFA 2JT3A 3GOFA 4A4CA 3SG6A 2AMIA 1AUIB 1XFYO 2H61C 4UPGA 1M45A 1OQPA 1BLQA 2OTGC 1CDPA 4PHKA 1JF0A 5I2OA 1ALWA 3FWBA 3AKBA 3I5HC 1QLKA 3SJSA 2BCAA 3OHMB 1XFVO 1IQ3A 3TS5C 3NSOA 4N1GA 1CM4A 1IGVA 2M8UA 1Y6WA 2MA2A 2M1KB 1DJWA 2KAYA 1S6JA 1FBVA 1HQVA 2LAPA 2LV7A 2L2EA 2G9BA 4PE0A 1JBAA 1TIZA 1EJ3A 1JC2A 1K9KA 1LA0A 2LANA 1TNXA 1LXFC 1TNPA 1KQVA 1C7VA 3VROA 2PSRA 3IQQA 1KK7Y 3AKAA 2LLTA 1KSMA 2GGMA 2IS9A 2OPOA 1GJYA 1AJ5A 5CSFA 1QJTA 4DCKA 5G08A 1DVIA 1RTP1 4M2QA 4MN0A 1XFUO 1IG5A 2WC8A 2CBLA 2MAZA 4C0KA 1J1DA 4A4BA 2K0JA 3LK0A 2AAOA 3ZNIA 1IH0A 1KFXS 1QIWA 1QVIY 2ZN8A 3AAJA 4CFQA 1J7OA 1PSRA 4OVNF 1OOJA 1IJ5A 2H2KA 3DD4A 3VRPA 1X02A 3D10A 1KWOC 4PHMA 4NDCA 2KSPA 4YI8A 3CS1A 1OZOA 2K61A 3SG7A 4PALA 3FWCA 3PLFB 3C1VA 2JZIA 1L2OC 3EVVA 3WHUB 2BBNA 4JPZB 1CFPA 3JTDC 2F3ZA 1QV0A 1ZUZA 1CLBA 1CDLA 2EC6B 2M49B 4MRXA 5FYXA 1KK7Z 3BUNB 1PSBA 2PRUA 2L5XB 1CM1A 3CR2A 1NX1A 3ICBA 1EXRA 1QX5B 1DJGA 4I5JA 2KFFA 1NYAA 2LVJA 5KU1A 1CLMA 1SY9A 2NCPA 4HRHA 2OTGB 5HLVA 4MLWA 1XK4A 3I5HB 1QVIZ 2LHIA 5BPJA 1LKJA 1ZFSA 1XO5A 3TS5B 1OE9B 2Y5IA 5AFPA 1FW4A 2BL0C 1DJZA 1K2HA 1RFJA 2LMVA 1QTXA 3JVTC 4I5LB 2G2BA 1CNPA 1UHKA 1WLZA 1DT7B 1SW8A 2JT8A 2M1UA 1M63B 2JULA 2KI6D 2ZRTA 4GUKA 4ORBB 5TNCA 1JUOA 1N0YA 4WQ2A 5DKQA 1YRTB 2A4JA 3O6BA 1IQ5A 1S5GZ 1SCMC 2M7NA 2ZRSA 2L50A 5CSNA 1YUSA 3CTNA 1JFJA 4M2OA 1HT9A 3E3RA 3TDUA 2K2AA 3EVUA 3JVTB 2KAXA 2JT0A 1B8RA 4YBHB 2CNPA 3BUOB 3VRRA 1K94A 3KPXA 1F4OA 1A03A 1K93D 1AVSA 3VRQA 2AUCA 3D0YB 4U8DA 4DRWA 2JXLA 5AXIA 3GK1A 2L51A 3BUXB 3I5GC 1QATA 1CLLA 3EKJA 2B1UA 4FTGA 2ZN9A 1KWOB 1LINA 2MRDA 4N1FA 2BE4A 1K95A 2JNXA 2KOTA 2R2IA 3BQ3A 2KI4C 2EHBA 1A2XA 2HQ8A 1MHOA 1BU3A 2CXJA 3EKHA 4HSZA 1M39A 1L2OB 4GAOA 1SMGA 4L9MA 1R6PA 4I5KA 2K7OA 3JTDB 2EGDA 2MLFC 5DKNA 3VGOA 1BG1A 2Q91A 2FOTA 3EK8A 1J55A 4WQ3A 3WNXB 1GGWA 1ZACA 3LK1A 5AERA 2LLSA 1NUBA 4AOMA 4I5NB 3RM1A 1XYDA 1K90D 2K7CA 3PATA 2BBMA 4MZLA 1EG4A 2F3YA 5HKWA 1G8IA 5ER5A 3OB1B 3TDZA 1XFWO 5I2QA 2FJUB 2KGRA 2OS8B 3I5IC 2ISDA 4BY5A 3K21A 1Q80A 1KK8C 4N5XA 2BL0B 4CPVA 1F4QA 2KNEA 1K8UA 3DF0B
chains in the Genus database with same CATH superfamily
5PALA 4DUQA 1SRAA 2KDHA 2KLDA 1EG3A 2O5GA 2LVKA 2PALA 1DELA 1NCZA 4ORCB 1WDCC 3H4SE 2HPSA 1TNWA 2LVIA 2ZNEA 4YGEB 1B4CA 1PALA 4QJ3B 1DJIA 1V1FA 1NX0A 1SCMB 2K60A 3L4LA 3OGNA 2FJYA 1BF5A 4WRIA 3CLNA 1KSOA 4ZCVA 1TUZA 1VRKA 5F6TA 4OV2A 5KTYA 4AQJA 1S1EA 2O60A 2LUCA 3CDNA 2M7LA 3GK4X 2KYFA 1RK9A 3NSKA 1MXEA 4GGNA 4INWA 3OP0A 4IL1A 1SL7A 1WRKA 3M0WA 1IJ6A 1TTXA 4XYNA 3S0FA 2BNXA 1OMVA 2JQ6A 3QMEA 3KF9A 1YVHA 3CZ0A 3DVEA 3PALA 3R1VA 2WCEA 1V1GA 1WLMA 3I5GB 1WY9A 1J7QA 5GQQC 1S5GY 1S26D 1KQMC 4BY4A 2M97A 4MZKA 1UP5A 3F45A 4JQ0D 2KI4B 1BMOA 4PE4A 2P6BB 1JWDA 2H61A 1NX3A 1C07A 1TWOA 1MWNA 1CTRA 4TNCA 1CDNA 1ZOTB 1UHIA 4YGBB 4HRGA 3EK4A 1TOPA 2P70A 2M0RA 4OKHA 4GGFC 4CFRA 1OMDA 1Z2CB 2BKIB 1N2DA 3LCPC 3CR4X 2Y4QA 2SCPA 1CFDA 4QJ5B 4JKTA 5FI7A 1IKUA 1F55A 5I2LA 1AJ4A 4YRUA 1BR1B 5IBWA 2LMTA 1QX7A 2L0PA 3O4XA 2F2PA 3KEVA 2OS8C 1DGVA 1TCFA 2BCXA 2WCFA 3CABA 4JWQA 3HCMA 1AP4A 2ZFDA 2LUXA 3IQOA 1UHHA 2KHNA 3CR5X 1DF0B 3AAKA 4NQGA 1KCYA 1A75B 1DQEA 2TN4A 2K7DA 3SG3A 1J7RA 1C7WA 1J1EA 1DJXA 1TCOB 3NHIA 1NX2A 2KFGA 5CSJA 1PRWA 3I5IB 4MSPA 4ORAB 1CKKA 3RLZA 1MXLC 1KK8B 2LP2A 2JWWA 2QACA 3SIAA 4PE1A 2K2FA 2JRFA 3DVKA 3EK7A 1UHNA 4YI9A 3D0YA 3B86A 4MEWA 4CLNA 2KQYA 1WDCB 4F0ZB 3S0GA 1WRLA 1SCVA 4DS7A 5I8NA 2KI6C 1KFUL 1G4YR 2KAVA 1QXPA 4PCWA 2ZNDA 2COLB 1OOFA 3TDIA 1QASA 3SS5A 1MUXA 2QEOA 1ALVA 2I7AA 1YX7A 2KGBC 3CZ1A 2CTNA 4GFTA 1PVBA 4MVFA 1YR5A 2I2RE 1UUSA 2QEVA 5D7FA 2F2OA 4GBAA 1F71A 3DVJA 2JC2A 5KSZA 2I94A 3TZ1A 4OCIA 1MR8A 2E30A 2E6WA 4QJ4B 2VRGA 3CYZA 2LLUA 1KQMB 1DEKA 4GGFA 3FE8A 2KFHA 1S36A 3CZ2A 1TN4A 4DIRA 1NSHA 1N65A 2JNFA 3BXKA 1NCXA 1IRJA 1SL8A 2JXCA 3DVMA 1XVJA 1F70A 2PVBA 3MSEB 1QS7A 2NCOA 3DYEA 1CB1A 1DTLA 2F33A 2NZ0A 2D8NA 4PDZA 3VB1A 1NP8A 2KBMA 3UNWA 2Y1NA 2ZKMX 5HYDA 1M31A 1K9PA 3SG2A 1OSAA 1PK0D 3DF0A 5K89A 1F8HA 2WCLA 3NHTA 1OMRA 2KQ6A 2HETA 4XJKB 3PM2A 2M29A 3KO0A 2WCJA 1LVCD 1MF8B 3BOWB 2LCPA 4YGCB 2L98A 5D69A 1QV1A 4D1EA 3O2PA 1FF1A 3BUWB 1G33A 3IVTA 3B88A 4OR9B 3EG5B 2FCEA 1Y0VH 2JTTA 2WORA 1XFXO 4PHNA 4CIDA 4C0JA 1D1OA 2KLEA 2QPTA 2MHHA 1W9ZA 1DGUA 1YVLA 1AHRA 3O78A 2LM5A 1XK4C 1UWOA 5DKRA 1YRUB 5JJGA 1TUJA 3O4YA 1U5IA 1CDMA 2H8VA 3OX6A 2NXQA 1A29A 1BT6A 3PN7C 1DMOA 4ETOA 5AEQA 1S6IA 2BECA 2BKHB 2HF5A 5HKYA 1S3PA 1SK6D 2JU0A 1U5IB 2MLEC 3NSLA 5AANA 2L4HA 4YGAA 2WC6A 1PULA 4Q04A 1QIVA 2RGIA 3NSIA 1L7ZA 3TUYB 1JF2A 2LP3A 1A4PA 3LL8B 1Y1AA 1J7PA 3B87A 4AQIA 1RROA 2GGZA 1BODA 4PE7A 1KFUS 1DJYA 3NXAA 2KYCA 4YGDB 3KHEA 4C0LA 1CFFA 1Y1UA 2QDIA 1RJVA 2GV5A 2JPOA 1CFCA 2LNKA 1SBJA 1M46A 3BFAA 2BCBA 5ER4X 2DOQA 4F7FA 1XA5A 1WRZA 3I5FC 2MBXA 2F8PA 2KBIA 1QLSA 1SR6C 2CT9A 2I18A 5JOLA 2KPHA 3BYAA 4E68A 2LVVA 3GK2A 3UO9A 1H4BA 1DF0A 5J3XA 3ZWHA 1H8BA 1A75A 4FQOA 4GNKB 3OB2B 3HX4A 1GGZA 1YURA 3K1EA 2L2CA 1MQ1A 2WOSA 4MBEA 1SYMA 1OOHA 1EL4A 3CGAA 2PMYA 1YUUA 1B9AA 3CZTX 4R1EA 4NDBA 4JD9A 3S0AA 4MRYA 5DICA 1B47A 1S6CA 5CPVA 1FI5A 1FPWA 3WXAA 1OZSA 3SG5A 3VRNA 1B8LA 4ZCUA 3A4UB 1B8CA 3EVRA 2JPTA 1K9UA 1RECA 1TNQA 1QX2A 1CMGA 1B7TY 1DJHA 2FCDA 1EH2A 1AK8A 2LE9B 2L5YA 2Y1MA 4PHJA 3PFVA 1IWQA 2NLNA 3WHTB 2LMUA 2M3WA 3OX5A 1JFKA 1OOGA 2QEHA 4IJ7A 5B8IB 3FIAA 1YUTA 1KFXL 3BJHA 3FE9A 3IF7A 1SL9A 1F54A 4P5OE 1BOCA 4GPLB 4USLA 1E8AA 1SPYA 2V53A 4MZJA 1C3ZA 1JSAA 2JOJA 1UHJA 2JTZA 2M9GA 1K96A 1YX8A 1BR4B 5HKZA 3BUMB 2K7BA 3TUYC 1B1GA 3PN7B 1NCYA 1PVAA 1TRFA 4M2PA 1NPQA 1W7IB 2Q4UA 1FI6A 3SIBA 1ODBA 2WCBA 3SG4A 4NDDA 4P2YB 1NIWA 1RWYA 1Y1XA 3LLEA 5CSIA 2L4IA 2PASA 3CWGA 2BE6A 2CCMA 3D75A 4HREE 1XFZO 2K8MB 5HLOA 1NWDA 1SKTA 1LS8A 2LC5A 3PM8A 3PSRA 3SS4A 1YTZC 3A8RA 1R2UA 3FS7A 5HL1A 3QRXA 2P71A 2WNDA 3L4AA 1B7TZ 3R72A 1CMFA 2SASA 2MJWB 3I5FB 1LA3A 1UURA 4ICBA 1GQMA 4INXA 1SR6B 4XJKA 2EC6C 2HQWA 2LHLA 1W7JB 1ZMZA 3BOWA 1SNLA 1BJFA 2JT3A 3GOFA 3DY9A 3SG6A 4A4CA 2AMIA 1AUIB 1XFYO 3RZSA 3R1PA 2H61C 4UPGA 1M45A 3N7HA 1OQPA 1BLQA 2OTGC 1CDPA 4PHKA 1JF0A 5I2OA 1ALWA 3FWBA 3AKBA 3Q8IA 3I5HC 1QLKA 3SJSA 2BCAA 2QEBA 3OHMB 1XFVO 1IQ3A 3TS5C 3NSOA 4N1GA 1CM4A 1IGVA 5FI2A 2M8UA 1Y6WA 2MA2A 2M1KB 1DJWA 2KAYA 1S6JA 1FBVA 1HQVA 2LAPA 2LV7A 2L2EA 2G9BA 4PE0A 1JBAA 1TIZA 1EJ3A 1JC2A 2GTEA 1K9KA 1LA0A 2LANA 1TNXA 1LXFC 1TNPA 1KQVA 3SS3A 1C7VA 3VROA 2PSRA 3IQQA 1KK7Y 3AKAA 2LLTA 1KSMA 3DXLA 2GGMA 2IS9A 2OPOA 1AJ5A 1GJYA 5CSFA 3L47A 1QJTA 1T14A 4DCKA 5G08A 1DVIA 1RTP1 4M2QA 4MN0A 1XFUO 1IG5A 2WC8A 2CBLA 2MAZA 4C0KA 1J1DA 2WCKA 4A4BA 2K0JA 3LK0A 2AAOA 3ZNIA 1IH0A 1KFXS 1QIWA 1P28A 1QVIY 2ZN8A 3AAJA 3BFHA 3V2LA 4CFQA 1PSRA 1J7OA 4OVNF 1OOJA 1IJ5A 2H2KA 2ERBA 3DD4A 3VRPA 1X02A 3D10A 1KWOC 4PHMA 4NDCA 3B6XA 2KSPA 4YI8A 3S0BA 3CS1A 1OZOA 2K61A 3SG7A 4PALA 3FE6A 1C3YA 3FWCA 3PLFB 3C1VA 2JZIA 1L2OC 3EVVA 3WHUB 2BBNA 1QWVA 4JPZB 1CFPA 3JTDC 2F3ZA 1QV0A 1ZUZA 1CLBA 1CDLA 2EC6B 2M49B 3D74A 4MRXA 5FYXA 1KK7Z 3BUNB 2WCMA 1PSBA 2PRUA 2L5XB 1CM1A 3CR2A 1XFRA 1NX1A 3ICBA 1EXRA 1QX5B 1DJGA 4I5JA 2KFFA 1NYAA 2LVJA 3D78A 5KU1A 1CLMA 1DC1A 1SY9A 2NCPA 5EL2A 4HRHA 2OTGB 3PJIA 4MLWA 5HLVA 1XK4A 3I5HB 1QVIZ 2LHIA 5BPJA 1LKJA 1ZFSA 1XO5A 3TS5B 1OE9B 2Y5IA 5AFPA 3D76A 1FW4A 2BL0C 1DJZA 3BFBA 1K2HA 1RFJA 2LMVA 1QTXA 3JVTC 4FQTA 2G2BA 4I5LB 1CNPA 1UHKA 1WLZA 1DT7B 1SW8A 2JT8A 2M1UA 1M63B 3NGVA 2JULA 2KI6D 2ZRTA 4GUKA 4ORBB 1ORGA 4PT1A 5TNCA 1JUOA 1N0YA 4WQ2A 5DKQA 1YRTB 2A4JA 3D73A 3DZTA 3O6BA 1IQ5A 1S5GZ 1SCMC 2M7NA 2ZRSA 2L50A 5CSNA 1YUSA 3CTNA 1JFJA 4M2OA 1HT9A 3E3RA 3TDUA 2K2AA 3EVUA 3JVTB 1Z4HA 3R1OA 2KAXA 4KYNA 2JT0A 1B8RA 4YBHB 2WC5A 2CNPA 3BUOB 3VRRA 3B7AA 3OBVA 1K94A 3KPXA 5FI6A 1F4OA 1A03A 1K93D 3D77A 1AVSA 3VRQA 2AUCA 3D0YB 5I94A 4U8DA 4DRWA 2JXLA 5AXIA 3GK1A 2L51A 3BUXB 3I5GC 1QATA 1CLLA 3EKJA 2B1UA 1GM0A 4FTGA 2ZN9A 1KWOB 1LINA 2MRDA 4N1FA 2BE4A 1K95A 2JNXA 2KOTA 2R2IA 3BQ3A 5D3OA 2KI4C 1OW4A 2EHBA 2PYQA 1A2XA 2HQ8A 1MHOA 1BU3A 1OOIX 2CXJA 3EKHA 2YGUA 4HSZA 1M39A 1L2OB 4GAOA 1SMGA 4L9MA 1R6PA 4I5KA 2K7OA 3JTDB 2EGDA 1IIOA 2MLFC 5DKNA 3VGOA 1BG1A 2Q91A 4OZDA 2FOTA 3EK8A 1J55A 4WQ3A 3WNXB 1GGWA 1ZACA 3LK1A 5AERA 2PQLA 2LLSA 3S0DA 1NUBA 4AOMA 4I5NB 3RM1A 1XYDA 1SSEB 1K90D 2K7CA 3PATA 2BBMA 4MZLA 1EG4A 2F3YA 5HKWA 1G8IA 5ER5A 2BAPA 3OB1B 3TDZA 1XFWO 5I2QA 2FJUB 2KGRA 2OS8B 3S0EA 3I5IC 2ISDA 4BY5A 2WCHA 1Q80A 3K21A 1KK8C 4N5XA 2BL0B 4CPVA 1F4QA 2KNEA 1K8UA 3DF0B
chains in the Genus database with same CATH topology
5PALA 4DUQA 1SRAA 2KDHA 1EG3A 2O5GA 2LVKA 2PALA 1NCZA 4ORCB 1WDCC 3H4SE 2HPSA 1TNWA 2LVIA 2ZNEA 4YGEB 1B4CA 1PALA 4QJ3B 1DJIA 1V1FA 1NX0A 1SCMB 1BF5A 4WRIA 3CLNA 1KSOA 4ZCVA 1VRKA 5F6TA 4OV2A 5KTYA 4AQJA 1S1EA 2O60A 2LUCA 2M7LA 3GK4X 2KYFA 1RK9A 3NSKA 1MXEA 4GGNA 3OP0A 4IL1A 1SL7A 1WRKA 3M0WA 1IJ6A 1TTXA 4XYNA 1OMVA 2JQ6A 3KF9A 1YVHA 3DVEA 3PALA 2WCEA 1V1GA 1WLMA 3I5GB 1WY9A 1J7QA 5GQQC 1S5GY 1S26D 1KQMC 4BY4A 2M97A 4MZKA 1UP5A 3F45A 4JQ0D 2KI4B 1BMOA 4PE4A 2P6BB 1JWDA 2H61A 1NX3A 1C07A 4TNCA 1MWNA 1CTRA 1CDNA 1ZOTB 1UHIA 4YGBB 4HRGA 3EK4A 1TOPA 2M0RA 4OKHA 4GGFC 4CFRA 1OMDA 2BKIB 3LCPC 1N2DA 3CR4X 2Y4QA 2SCPA 1CFDA 4QJ5B 1F55A 1IKUA 5I2LA 1AJ4A 4YRUA 1BR1B 5IBWA 2LMTA 1QX7A 2L0PA 2F2PA 3KEVA 2OS8C 1DGVA 1TCFA 2BCXA 2WCFA 4JWQA 3HCMA 1AP4A 2ZFDA 2LUXA 3IQOA 1UHHA 2KHNA 3CR5X 1DF0B 3AAKA 4NQGA 1KCYA 1A75B 2TN4A 2K7DA 3SG3A 1J7RA 1C7WA 1J1EA 1DJXA 1TCOB 1NX2A 2KFGA 5CSJA 1PRWA 3I5IB 4MSPA 4ORAB 1CKKA 3RLZA 1MXLC 1KK8B 2LP2A 2JWWA 2QACA 3SIAA 4PE1A 2K2FA 2JRFA 3DVKA 3EK7A 1UHNA 4YI9A 3D0YA 4MEWA 4CLNA 2KQYA 1WDCB 4F0ZB 1WRLA 1SCVA 4DS7A 5I8NA 2KI6C 1KFUL 1G4YR 2KAVA 1QXPA 4PCWA 2ZNDA 2COLB 3TDIA 1QASA 1MUXA 1ALVA 2I7AA 1YX7A 2KGBC 2CTNA 4GFTA 1PVBA 4MVFA 1YR5A 2I2RE 1UUSA 5D7FA 1F71A 2F2OA 4GBAA 3DVJA 2JC2A 5KSZA 2I94A 3TZ1A 4OCIA 1MR8A 2E30A 2E6WA 4QJ4B 2VRGA 2LLUA 1KQMB 4GGFA 2KFHA 1S36A 1TN4A 4DIRA 1NSHA 1N65A 2JNFA 3BXKA 1NCXA 1IRJA 1SL8A 2JXCA 3DVMA 1XVJA 1F70A 2PVBA 3MSEB 1QS7A 2NCOA 1CB1A 1DTLA 2F33A 2NZ0A 2D8NA 4PDZA 1NP8A 2KBMA 2Y1NA 2ZKMX 5HYDA 1M31A 1K9PA 3SG2A 1OSAA 1PK0D 3DF0A 5K89A 1F8HA 1OMRA 2KQ6A 2HETA 4XJKB 2M29A 3KO0A 4YGCB 1LVCD 1MF8B 3BOWB 2LCPA 5D69A 2L98A 4D1EA 1QV1A 3O2PA 1FF1A 3BUWB 1G33A 4OR9B 2FCEA 1Y0VH 2JTTA 2WORA 1XFXO 4PHNA 4CIDA 4C0JA 1D1OA 2QPTA 2MHHA 1DGUA 1YVLA 1AHRA 3O78A 2LM5A 1XK4C 1UWOA 5DKRA 1YRUB 5JJGA 3O4YA 1U5IA 1CDMA 3OX6A 2NXQA 1A29A 1BT6A 3PN7C 1DMOA 4ETOA 5AEQA 1S6IA 2BECA 2BKHB 2HF5A 5HKYA 1S3PA 1SK6D 2JU0A 1U5IB 2MLEC 3NSLA 5AANA 2L4HA 4YGAA 1PULA 4Q04A 1QIVA 2RGIA 3NSIA 1L7ZA 3TUYB 1JF2A 2LP3A 1A4PA 3LL8B 1Y1AA 1J7PA 4AQIA 1RROA 2GGZA 1BODA 4PE7A 1KFUS 1DJYA 3NXAA 2KYCA 4YGDB 3KHEA 4C0LA 1CFFA 1Y1UA 1CFCA 1RJVA 2GV5A 2LNKA 1SBJA 1M46A 2BCBA 5ER4X 2DOQA 1XA5A 1WRZA 3I5FC 2MBXA 2F8PA 2KBIA 1QLSA 1SR6C 2CT9A 2I18A 5JOLA 3BYAA 4E68A 2LVVA 3GK2A 1H4BA 1DF0A 5J3XA 3ZWHA 1H8BA 1A75A 4FQOA 4GNKB 3OB2B 3HX4A 1GGZA 1YURA 1MQ1A 2WOSA 4MBEA 1SYMA 1EL4A 3CGAA 2PMYA 1YUUA 1B9AA 3CZTX 4R1EA 4NDBA 4MRYA 1B47A 1S6CA 5CPVA 1FI5A 1FPWA 3WXAA 1OZSA 3SG5A 3VRNA 1B8LA 4ZCUA 3A4UB 1B8CA 3EVRA 2JPTA 1K9UA 1RECA 1TNQA 1QX2A 1CMGA 1B7TY 1DJHA 2FCDA 1EH2A 1AK8A 2LE9B 2Y1MA 4PHJA 3PFVA 1IWQA 2NLNA 3WHTB 2LMUA 2M3WA 3OX5A 1JFKA 5B8IB 3FIAA 1YUTA 1KFXL 3IF7A 1F54A 1SL9A 4P5OE 1BOCA 4GPLB 4USLA 1E8AA 1SPYA 2V53A 4MZJA 1JSAA 2JOJA 1UHJA 2JTZA 2M9GA 1K96A 1YX8A 1BR4B 5HKZA 3BUMB 2K7BA 3TUYC 1B1GA 3PN7B 1NCYA 1PVAA 1TRFA 4M2PA 1NPQA 1W7IB 2Q4UA 1FI6A 3SIBA 1ODBA 2WCBA 3SG4A 4NDDA 4P2YB 1NIWA 1RWYA 1Y1XA 3LLEA 5CSIA 2L4IA 2PASA 3CWGA 2BE6A 2CCMA 4HREE 1XFZO 2K8MB 5HLOA 1NWDA 1SKTA 2LC5A 3PM8A 3PSRA 1YTZC 3A8RA 1R2UA 3FS7A 3QRXA 2WNDA 1B7TZ 1CMFA 2SASA 2MJWB 3I5FB 1LA3A 1UURA 4ICBA 1GQMA 4XJKA 1SR6B 2EC6C 2HQWA 2LHLA 1W7JB 1ZMZA 3BOWA 1SNLA 1BJFA 2JT3A 3GOFA 4A4CA 3SG6A 2AMIA 1AUIB 1XFYO 2H61C 4UPGA 1M45A 1OQPA 1BLQA 2OTGC 1CDPA 4PHKA 1JF0A 5I2OA 1ALWA 3FWBA 3AKBA 3I5HC 1QLKA 3SJSA 2BCAA 3OHMB 1XFVO 1IQ3A 3TS5C 3NSOA 4N1GA 1CM4A 1IGVA 2M8UA 1Y6WA 2MA2A 2M1KB 1DJWA 2KAYA 1S6JA 1FBVA 1HQVA 2LAPA 2LV7A 2L2EA 2G9BA 4PE0A 1JBAA 1TIZA 1EJ3A 1JC2A 1K9KA 1LA0A 2LANA 1TNXA 1LXFC 1TNPA 1KQVA 1C7VA 3VROA 2PSRA 3IQQA 1KK7Y 3AKAA 2LLTA 1KSMA 2GGMA 2IS9A 2OPOA 1GJYA 1AJ5A 5CSFA 1QJTA 4DCKA 5G08A 1DVIA 1RTP1 4M2QA 4MN0A 1XFUO 1IG5A 2WC8A 2CBLA 2MAZA 4C0KA 1J1DA 4A4BA 2K0JA 3LK0A 2AAOA 3ZNIA 1IH0A 1KFXS 1QIWA 1QVIY 2ZN8A 3AAJA 4CFQA 1J7OA 1PSRA 4OVNF 1OOJA 1IJ5A 2H2KA 3DD4A 3VRPA 1X02A 3D10A 1KWOC 4PHMA 4NDCA 2KSPA 4YI8A 3CS1A 1OZOA 2K61A 3SG7A 4PALA 3FWCA 3PLFB 3C1VA 2JZIA 1L2OC 3EVVA 3WHUB 2BBNA 4JPZB 1CFPA 3JTDC 2F3ZA 1QV0A 1ZUZA 1CLBA 1CDLA 2EC6B 2M49B 4MRXA 5FYXA 1KK7Z 3BUNB 1PSBA 2PRUA 2L5XB 1CM1A 3CR2A 1NX1A 3ICBA 1EXRA 1QX5B 1DJGA 4I5JA 2KFFA 1NYAA 2LVJA 5KU1A 1CLMA 1SY9A 2NCPA 4HRHA 2OTGB 5HLVA 4MLWA 1XK4A 3I5HB 1QVIZ 2LHIA 5BPJA 1LKJA 1ZFSA 1XO5A 3TS5B 1OE9B 2Y5IA 5AFPA 1FW4A 2BL0C 1DJZA 1K2HA 1RFJA 2LMVA 1QTXA 3JVTC 4I5LB 2G2BA 1CNPA 1UHKA 1WLZA 1DT7B 1SW8A 2JT8A 2M1UA 1M63B 2JULA 2KI6D 2ZRTA 4GUKA 4ORBB 5TNCA 1JUOA 1N0YA 4WQ2A 5DKQA 1YRTB 2A4JA 3O6BA 1IQ5A 1S5GZ 1SCMC 2M7NA 2ZRSA 2L50A 5CSNA 1YUSA 3CTNA 1JFJA 4M2OA 1HT9A 3E3RA 3TDUA 2K2AA 3EVUA 3JVTB 2KAXA 2JT0A 1B8RA 4YBHB 2CNPA 3BUOB 3VRRA 1K94A 3KPXA 1F4OA 1A03A 1K93D 1AVSA 3VRQA 2AUCA 3D0YB 4U8DA 4DRWA 2JXLA 5AXIA 3GK1A 2L51A 3BUXB 3I5GC 1QATA 1CLLA 3EKJA 2B1UA 4FTGA 2ZN9A 1KWOB 1LINA 2MRDA 4N1FA 2BE4A 1K95A 2JNXA 2KOTA 2R2IA 3BQ3A 2KI4C 2EHBA 1A2XA 2HQ8A 1MHOA 1BU3A 2CXJA 3EKHA 4HSZA 1M39A 1L2OB 4GAOA 1SMGA 4L9MA 1R6PA 4I5KA 2K7OA 3JTDB 2EGDA 2MLFC 5DKNA 3VGOA 1BG1A 2Q91A 2FOTA 3EK8A 1J55A 4WQ3A 3WNXB 1GGWA 1ZACA 3LK1A 5AERA 2LLSA 1NUBA 4AOMA 4I5NB 3RM1A 1XYDA 1K90D 2K7CA 3PATA 2BBMA 4MZLA 1EG4A 2F3YA 5HKWA 1G8IA 5ER5A 3OB1B 3TDZA 1XFWO 5I2QA 2FJUB 2KGRA 2OS8B 3I5IC 2ISDA 4BY5A 3K21A 1Q80A 1KK8C 4N5XA 2BL0B 4CPVA 1F4QA 2KNEA 1K8UA 3DF0B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5PAL A;  4DUQ A;  1SRA A;  2KDH A;  1EG3 A;  2O5G A;  2LVK A;  2PAL A;  1NCZ A;  4ORC B;  1WDC C;  3H4S E;  2HPS A;  1TNW A;  2LVI A;  2ZNE A;  4YGE B;  1B4C A;  1PAL A;  4QJ3 B;  1DJI A;  1V1F A;  1NX0 A;  1SCM B;  1BF5 A;  4WRI A;  3CLN A;  1KSO A;  4ZCV A;  1VRK A;  5F6T A;  4OV2 A;  5KTY A;  4AQJ A;  1S1E A;  2O60 A;  2LUC A;  2M7L A;  3GK4 X;  2KYF A;  1RK9 A;  3NSK A;  1MXE A;  4GGN A;  3OP0 A;  4IL1 A;  1SL7 A;  1WRK A;  3M0W A;  1IJ6 A;  1TTX A;  4XYN A;  1OMV A;  2JQ6 A;  3KF9 A;  1YVH A;  3DVE A;  3PAL A;  2WCE A;  1V1G A;  1WLM A;  3I5G B;  1WY9 A;  1J7Q A;  5GQQ C;  1S5G Y;  1S26 D;  1KQM C;  4BY4 A;  2M97 A;  4MZK A;  1UP5 A;  3F45 A;  4JQ0 D;  2KI4 B;  1BMO A;  4PE4 A;  2P6B B;  1JWD A;  2H61 A;  1NX3 A;  1C07 A;  4TNC A;  1MWN A;  1CTR A;  1CDN A;  1ZOT B;  1UHI A;  4YGB B;  4HRG A;  3EK4 A;  1TOP A;  2M0R A;  4OKH A;  4GGF C;  4CFR A;  1OMD A;  2BKI B;  3LCP C;  1N2D A;  3CR4 X;  2Y4Q A;  2SCP A;  1CFD A;  4QJ5 B;  1F55 A;  1IKU A;  5I2L A;  1AJ4 A;  4YRU A;  1BR1 B;  5IBW A;  2LMT A;  1QX7 A;  2L0P A;  2F2P A;  3KEV A;  2OS8 C;  1DGV A;  1TCF A;  2BCX A;  2WCF A;  4JWQ A;  3HCM A;  1AP4 A;  2ZFD A;  2LUX A;  3IQO A;  1UHH A;  2KHN A;  3CR5 X;  1DF0 B;  3AAK A;  4NQG A;  1KCY A;  1A75 B;  2TN4 A;  2K7D A;  3SG3 A;  1J7R A;  1C7W A;  1J1E A;  1DJX A;  1TCO B;  1NX2 A;  2KFG A;  5CSJ A;  1PRW A;  3I5I B;  4MSP A;  4ORA B;  1CKK A;  3RLZ A;  1MXL C;  1KK8 B;  2LP2 A;  2JWW A;  2QAC A;  3SIA A;  4PE1 A;  2K2F A;  2JRF A;  3DVK A;  3EK7 A;  1UHN A;  4YI9 A;  3D0Y A;  4MEW A;  4CLN A;  2KQY A;  1WDC B;  4F0Z B;  1WRL A;  1SCV A;  4DS7 A;  5I8N A;  2KI6 C;  1KFU L;  1G4Y R;  2KAV A;  1QXP A;  4PCW A;  2ZND A;  2COL B;  3TDI A;  1QAS A;  1MUX A;  1ALV A;  2I7A A;  1YX7 A;  2KGB C;  2CTN A;  4GFT A;  1PVB A;  4MVF A;  1YR5 A;  2I2R E;  1UUS A;  5D7F A;  1F71 A;  2F2O A;  4GBA A;  3DVJ A;  2JC2 A;  5KSZ A;  2I94 A;  3TZ1 A;  4OCI A;  1MR8 A;  2E30 A;  2E6W A;  4QJ4 B;  2VRG A;  2LLU A;  1KQM B;  4GGF A;  2KFH A;  1S36 A;  1TN4 A;  4DIR A;  1NSH A;  1N65 A;  2JNF A;  3BXK A;  1NCX A;  1IRJ A;  1SL8 A;  2JXC A;  3DVM A;  1XVJ A;  1F70 A;  2PVB A;  3MSE B;  1QS7 A;  2NCO A;  1CB1 A;  1DTL A;  2F33 A;  2NZ0 A;  2D8N A;  4PDZ A;  1NP8 A;  2KBM A;  2Y1N A;  2ZKM X;  5HYD A;  1M31 A;  1K9P A;  3SG2 A;  1OSA A;  1PK0 D;  3DF0 A;  5K89 A;  1F8H A;  1OMR A;  2KQ6 A;  2HET A;  4XJK B;  2M29 A;  3KO0 A;  4YGC B;  1LVC D;  1MF8 B;  3BOW B;  2LCP A;  5D69 A;  2L98 A;  4D1E A;  1QV1 A;  3O2P A;  1FF1 A;  3BUW B;  1G33 A;  4OR9 B;  2FCE A;  1Y0V H;  2JTT A;  2WOR A;  1XFX O;  4PHN A;  4CID A;  4C0J A;  1D1O A;  2QPT A;  2MHH A;  1DGU A;  1YVL A;  1AHR A;  3O78 A;  2LM5 A;  1XK4 C;  1UWO A;  5DKR A;  1YRU B;  5JJG A;  3O4Y A;  1U5I A;  1CDM A;  3OX6 A;  2NXQ A;  1A29 A;  1BT6 A;  3PN7 C;  1DMO A;  4ETO A;  5AEQ A;  1S6I A;  2BEC A;  2BKH B;  2HF5 A;  5HKY A;  1S3P A;  1SK6 D;  2JU0 A;  1U5I B;  2MLE C;  3NSL A;  5AAN A;  2L4H A;  4YGA A;  1PUL A;  4Q04 A;  1QIV A;  2RGI A;  3NSI A;  1L7Z A;  3TUY B;  1JF2 A;  2LP3 A;  1A4P A;  3LL8 B;  1Y1A A;  1J7P A;  4AQI A;  1RRO A;  2GGZ A;  1BOD A;  4PE7 A;  1KFU S;  1DJY A;  3NXA A;  2KYC A;  4YGD B;  3KHE A;  4C0L A;  1CFF A;  1Y1U A;  1CFC A;  1RJV A;  2GV5 A;  2LNK A;  1SBJ A;  1M46 A;  2BCB A;  5ER4 X;  2DOQ A;  1XA5 A;  1WRZ A;  3I5F C;  2MBX A;  2F8P A;  2KBI A;  1QLS A;  1SR6 C;  2CT9 A;  2I18 A;  5JOL A;  3BYA A;  4E68 A;  2LVV A;  3GK2 A;  1H4B A;  1DF0 A;  5J3X A;  3ZWH A;  1H8B A;  1A75 A;  4FQO A;  4GNK B;  3OB2 B;  3HX4 A;  1GGZ A;  1YUR A;  1MQ1 A;  2WOS A;  4MBE A;  1SYM A;  1EL4 A;  3CGA A;  2PMY A;  1YUU A;  1B9A A;  3CZT X;  4R1E A;  4NDB A;  4MRY A;  1B47 A;  1S6C A;  5CPV A;  1FI5 A;  1FPW A;  3WXA A;  1OZS A;  3SG5 A;  3VRN A;  1B8L A;  4ZCU A;  3A4U B;  1B8C A;  3EVR A;  2JPT A;  1K9U A;  1REC A;  1TNQ A;  1QX2 A;  1CMG A;  1B7T Y;  1DJH A;  2FCD A;  1EH2 A;  1AK8 A;  2LE9 B;  2Y1M A;  4PHJ A;  3PFV A;  1IWQ A;  2NLN A;  3WHT B;  2LMU A;  2M3W A;  3OX5 A;  1JFK A;  5B8I B;  3FIA A;  1YUT A;  1KFX L;  3IF7 A;  1F54 A;  1SL9 A;  4P5O E;  1BOC A;  4GPL B;  4USL A;  1E8A A;  1SPY A;  2V53 A;  4MZJ A;  1JSA A;  2JOJ A;  1UHJ A;  2JTZ A;  2M9G A;  1K96 A;  1YX8 A;  1BR4 B;  5HKZ A;  3BUM B;  2K7B A;  3TUY C;  1B1G A;  3PN7 B;  1NCY A;  1PVA A;  1TRF A;  4M2P A;  1NPQ A;  1W7I B;  2Q4U A;  1FI6 A;  3SIB A;  1ODB A;  2WCB A;  3SG4 A;  4NDD A;  4P2Y B;  1NIW A;  1RWY A;  1Y1X A;  3LLE A;  5CSI A;  2L4I A;  2PAS A;  3CWG A;  2BE6 A;  2CCM A;  4HRE E;  1XFZ O;  2K8M B;  5HLO A;  1NWD A;  1SKT A;  2LC5 A;  3PM8 A;  3PSR A;  1YTZ C;  3A8R A;  1R2U A;  3FS7 A;  3QRX A;  2WND A;  1B7T Z;  1CMF A;  2SAS A;  2MJW B;  3I5F B;  1LA3 A;  1UUR A;  4ICB A;  1GQM A;  4XJK A;  1SR6 B;  2EC6 C;  2HQW A;  2LHL A;  1W7J B;  1ZMZ A;  3BOW A;  1SNL A;  1BJF A;  2JT3 A;  3GOF A;  4A4C A;  3SG6 A;  2AMI A;  1AUI B;  1XFY O;  2H61 C;  4UPG A;  1M45 A;  1OQP A;  1BLQ A;  2OTG C;  1CDP A;  4PHK A;  1JF0 A;  5I2O A;  1ALW A;  3FWB A;  3AKB A;  3I5H C;  1QLK A;  3SJS A;  2BCA A;  3OHM B;  1XFV O;  1IQ3 A;  3TS5 C;  3NSO A;  4N1G A;  1CM4 A;  1IGV A;  2M8U A;  1Y6W A;  2MA2 A;  2M1K B;  1DJW A;  2KAY A;  1S6J A;  1FBV A;  1HQV A;  2LAP A;  2LV7 A;  2L2E A;  2G9B A;  4PE0 A;  1JBA A;  1TIZ A;  1EJ3 A;  1JC2 A;  1K9K A;  1LA0 A;  2LAN A;  1TNX A;  1LXF C;  1TNP A;  1KQV A;  1C7V A;  3VRO A;  2PSR A;  3IQQ A;  1KK7 Y;  3AKA A;  2LLT A;  1KSM A;  2GGM A;  2IS9 A;  2OPO A;  1GJY A;  1AJ5 A;  5CSF A;  1QJT A;  4DCK A;  5G08 A;  1DVI A;  1RTP 1;  4M2Q A;  4MN0 A;  1XFU O;  1IG5 A;  2WC8 A;  2CBL A;  2MAZ A;  4C0K A;  1J1D A;  4A4B A;  2K0J A;  3LK0 A;  2AAO A;  3ZNI A;  1IH0 A;  1KFX S;  1QIW A;  1QVI Y;  2ZN8 A;  3AAJ A;  4CFQ A;  1J7O A;  1PSR A;  4OVN F;  1OOJ A;  1IJ5 A;  2H2K A;  3DD4 A;  3VRP A;  1X02 A;  3D10 A;  1KWO C;  4PHM A;  4NDC A;  2KSP A;  4YI8 A;  3CS1 A;  1OZO A;  2K61 A;  3SG7 A;  4PAL A;  3FWC A;  3PLF B;  3C1V A;  2JZI A;  1L2O C;  3EVV A;  3WHU B;  2BBN A;  4JPZ B;  1CFP A;  3JTD C;  2F3Z A;  1QV0 A;  1ZUZ A;  1CLB A;  1CDL A;  2EC6 B;  2M49 B;  4MRX A;  5FYX A;  1KK7 Z;  3BUN B;  1PSB A;  2PRU A;  2L5X B;  1CM1 A;  3CR2 A;  1NX1 A;  3ICB A;  1EXR A;  1QX5 B;  1DJG A;  4I5J A;  2KFF A;  1NYA A;  2LVJ A;  5KU1 A;  1CLM A;  1SY9 A;  2NCP A;  4HRH A;  2OTG B;  5HLV A;  4MLW A;  1XK4 A;  3I5H B;  1QVI Z;  2LHI A;  5BPJ A;  1LKJ A;  1ZFS A;  1XO5 A;  3TS5 B;  1OE9 B;  2Y5I A;  5AFP A;  1FW4 A;  2BL0 C;  1DJZ A;  1K2H A;  1RFJ A;  2LMV A;  1QTX A;  3JVT C;  4I5L B;  2G2B A;  1CNP A;  1UHK A;  1WLZ A;  1DT7 B;  1SW8 A;  2JT8 A;  2M1U A;  1M63 B;  2JUL A;  2KI6 D;  2ZRT A;  4GUK A;  4ORB B;  5TNC A;  1JUO A;  1N0Y A;  4WQ2 A;  5DKQ A;  1YRT B;  2A4J A;  3O6B A;  1IQ5 A;  1S5G Z;  1SCM C;  2M7N A;  2ZRS A;  2L50 A;  5CSN A;  1YUS A;  3CTN A;  1JFJ A;  4M2O A;  1HT9 A;  3E3R A;  3TDU A;  2K2A A;  3EVU A;  3JVT B;  2KAX A;  2JT0 A;  1B8R A;  4YBH B;  2CNP A;  3BUO B;  3VRR A;  1K94 A;  3KPX A;  1F4O A;  1A03 A;  1K93 D;  1AVS A;  3VRQ A;  2AUC A;  3D0Y B;  4U8D A;  4DRW A;  2JXL A;  5AXI A;  3GK1 A;  2L51 A;  3BUX B;  3I5G C;  1QAT A;  1CLL A;  3EKJ A;  2B1U A;  4FTG A;  2ZN9 A;  1KWO B;  1LIN A;  2MRD A;  4N1F A;  2BE4 A;  1K95 A;  2JNX A;  2KOT A;  2R2I A;  3BQ3 A;  2KI4 C;  2EHB A;  1A2X A;  2HQ8 A;  1MHO A;  1BU3 A;  2CXJ A;  3EKH A;  4HSZ A;  1M39 A;  1L2O B;  4GAO A;  1SMG A;  4L9M A;  1R6P A;  4I5K A;  2K7O A;  3JTD B;  2EGD A;  2MLF C;  5DKN A;  3VGO A;  1BG1 A;  2Q91 A;  2FOT A;  3EK8 A;  1J55 A;  4WQ3 A;  3WNX B;  1GGW A;  1ZAC A;  3LK1 A;  5AER A;  2LLS A;  1NUB A;  4AOM A;  4I5N B;  3RM1 A;  1XYD A;  1K90 D;  2K7C A;  3PAT A;  2BBM A;  4MZL A;  1EG4 A;  2F3Y A;  5HKW A;  1G8I A;  5ER5 A;  3OB1 B;  3TDZ A;  1XFW O;  5I2Q A;  2FJU B;  2KGR A;  2OS8 B;  3I5I C;  2ISD A;  4BY5 A;  3K21 A;  1Q80 A;  1KK8 C;  4N5X A;  2BL0 B;  4CPV A;  1F4Q A;  2KNE A;  1K8U A;  3DF0 B; 
#chains in the Genus database with same CATH topology
 5PAL A;  4DUQ A;  1SRA A;  2KDH A;  2KLD A;  1EG3 A;  2O5G A;  2LVK A;  2PAL A;  1DEL A;  1NCZ A;  4ORC B;  1WDC C;  3H4S E;  2HPS A;  1TNW A;  2LVI A;  2ZNE A;  4YGE B;  1B4C A;  1PAL A;  4QJ3 B;  1DJI A;  1V1F A;  1NX0 A;  1SCM B;  2K60 A;  3L4L A;  3OGN A;  2FJY A;  1BF5 A;  4WRI A;  3CLN A;  1KSO A;  4ZCV A;  1TUZ A;  1VRK A;  5F6T A;  4OV2 A;  5KTY A;  4AQJ A;  1S1E A;  2O60 A;  2LUC A;  3CDN A;  2M7L A;  3GK4 X;  2KYF A;  1RK9 A;  3NSK A;  1MXE A;  4GGN A;  4INW A;  3OP0 A;  4IL1 A;  1SL7 A;  1WRK A;  3M0W A;  1IJ6 A;  1TTX A;  4XYN A;  3S0F A;  2BNX A;  1OMV A;  2JQ6 A;  3QME A;  3KF9 A;  1YVH A;  3CZ0 A;  3DVE A;  3PAL A;  3R1V A;  2WCE A;  1V1G A;  1WLM A;  3I5G B;  1WY9 A;  1J7Q A;  5GQQ C;  1S5G Y;  1S26 D;  1KQM C;  4BY4 A;  2M97 A;  4MZK A;  1UP5 A;  3F45 A;  4JQ0 D;  2KI4 B;  1BMO A;  4PE4 A;  2P6B B;  1JWD A;  2H61 A;  1NX3 A;  1C07 A;  1TWO A;  1MWN A;  1CTR A;  4TNC A;  1CDN A;  1ZOT B;  1UHI A;  4YGB B;  4HRG A;  3EK4 A;  1TOP A;  2P70 A;  2M0R A;  4OKH A;  4GGF C;  4CFR A;  1OMD A;  1Z2C B;  2BKI B;  1N2D A;  3LCP C;  3CR4 X;  2Y4Q A;  2SCP A;  1CFD A;  4QJ5 B;  4JKT A;  5FI7 A;  1IKU A;  1F55 A;  5I2L A;  1AJ4 A;  4YRU A;  1BR1 B;  5IBW A;  2LMT A;  1QX7 A;  2L0P A;  3O4X A;  2F2P A;  3KEV A;  2OS8 C;  1DGV A;  1TCF A;  2BCX A;  2WCF A;  3CAB A;  4JWQ A;  3HCM A;  1AP4 A;  2ZFD A;  2LUX A;  3IQO A;  1UHH A;  2KHN A;  3CR5 X;  1DF0 B;  3AAK A;  4NQG A;  1KCY A;  1A75 B;  1DQE A;  2TN4 A;  2K7D A;  3SG3 A;  1J7R A;  1C7W A;  1J1E A;  1DJX A;  1TCO B;  3NHI A;  1NX2 A;  2KFG A;  5CSJ A;  1PRW A;  3I5I B;  4MSP A;  4ORA B;  1CKK A;  3RLZ A;  1MXL C;  1KK8 B;  2LP2 A;  2JWW A;  2QAC A;  3SIA A;  4PE1 A;  2K2F A;  2JRF A;  3DVK A;  3EK7 A;  1UHN A;  4YI9 A;  3D0Y A;  3B86 A;  4MEW A;  4CLN A;  2KQY A;  1WDC B;  4F0Z B;  3S0G A;  1WRL A;  1SCV A;  4DS7 A;  5I8N A;  2KI6 C;  1KFU L;  1G4Y R;  2KAV A;  1QXP A;  4PCW A;  2ZND A;  2COL B;  1OOF A;  3TDI A;  1QAS A;  3SS5 A;  1MUX A;  2QEO A;  1ALV A;  2I7A A;  1YX7 A;  2KGB C;  3CZ1 A;  2CTN A;  4GFT A;  1PVB A;  4MVF A;  1YR5 A;  2I2R E;  1UUS A;  2QEV A;  5D7F A;  2F2O A;  4GBA A;  1F71 A;  3DVJ A;  2JC2 A;  5KSZ A;  2I94 A;  3TZ1 A;  4OCI A;  1MR8 A;  2E30 A;  2E6W A;  4QJ4 B;  2VRG A;  3CYZ A;  2LLU A;  1KQM B;  1DEK A;  4GGF A;  3FE8 A;  2KFH A;  1S36 A;  3CZ2 A;  1TN4 A;  4DIR A;  1NSH A;  1N65 A;  2JNF A;  3BXK A;  1NCX A;  1IRJ A;  1SL8 A;  2JXC A;  3DVM A;  1XVJ A;  1F70 A;  2PVB A;  3MSE B;  1QS7 A;  2NCO A;  3DYE A;  1CB1 A;  1DTL A;  2F33 A;  2NZ0 A;  2D8N A;  4PDZ A;  3VB1 A;  1NP8 A;  2KBM A;  3UNW A;  2Y1N A;  2ZKM X;  5HYD A;  1M31 A;  1K9P A;  3SG2 A;  1OSA A;  1PK0 D;  3DF0 A;  5K89 A;  1F8H A;  2WCL A;  3NHT A;  1OMR A;  2KQ6 A;  2HET A;  4XJK B;  3PM2 A;  2M29 A;  3KO0 A;  2WCJ A;  1LVC D;  1MF8 B;  3BOW B;  2LCP A;  4YGC B;  2L98 A;  5D69 A;  1QV1 A;  4D1E A;  3O2P A;  1FF1 A;  3BUW B;  1G33 A;  3IVT A;  3B88 A;  4OR9 B;  3EG5 B;  2FCE A;  1Y0V H;  2JTT A;  2WOR A;  1XFX O;  4PHN A;  4CID A;  4C0J A;  1D1O A;  2KLE A;  2QPT A;  2MHH A;  1W9Z A;  1DGU A;  1YVL A;  1AHR A;  3O78 A;  2LM5 A;  1XK4 C;  1UWO A;  5DKR A;  1YRU B;  5JJG A;  1TUJ A;  3O4Y A;  1U5I A;  1CDM A;  2H8V A;  3OX6 A;  2NXQ A;  1A29 A;  1BT6 A;  3PN7 C;  1DMO A;  4ETO A;  5AEQ A;  1S6I A;  2BEC A;  2BKH B;  2HF5 A;  5HKY A;  1S3P A;  1SK6 D;  2JU0 A;  1U5I B;  2MLE C;  3NSL A;  5AAN A;  2L4H A;  4YGA A;  2WC6 A;  1PUL A;  4Q04 A;  1QIV A;  2RGI A;  3NSI A;  1L7Z A;  3TUY B;  1JF2 A;  2LP3 A;  1A4P A;  3LL8 B;  1Y1A A;  1J7P A;  3B87 A;  4AQI A;  1RRO A;  2GGZ A;  1BOD A;  4PE7 A;  1KFU S;  1DJY A;  3NXA A;  2KYC A;  4YGD B;  3KHE A;  4C0L A;  1CFF A;  1Y1U A;  2QDI A;  1RJV A;  2GV5 A;  2JPO A;  1CFC A;  2LNK A;  1SBJ A;  1M46 A;  3BFA A;  2BCB A;  5ER4 X;  2DOQ A;  4F7F A;  1XA5 A;  1WRZ A;  3I5F C;  2MBX A;  2F8P A;  2KBI A;  1QLS A;  1SR6 C;  2CT9 A;  2I18 A;  5JOL A;  2KPH A;  3BYA A;  4E68 A;  2LVV A;  3GK2 A;  3UO9 A;  1H4B A;  1DF0 A;  5J3X A;  3ZWH A;  1H8B A;  1A75 A;  4FQO A;  4GNK B;  3OB2 B;  3HX4 A;  1GGZ A;  1YUR A;  3K1E A;  2L2C A;  1MQ1 A;  2WOS A;  4MBE A;  1SYM A;  1OOH A;  1EL4 A;  3CGA A;  2PMY A;  1YUU A;  1B9A A;  3CZT X;  4R1E A;  4NDB A;  4JD9 A;  3S0A A;  4MRY A;  5DIC A;  1B47 A;  1S6C A;  5CPV A;  1FI5 A;  1FPW A;  3WXA A;  1OZS A;  3SG5 A;  3VRN A;  1B8L A;  4ZCU A;  3A4U B;  1B8C A;  3EVR A;  2JPT A;  1K9U A;  1REC A;  1TNQ A;  1QX2 A;  1CMG A;  1B7T Y;  1DJH A;  2FCD A;  1EH2 A;  1AK8 A;  2LE9 B;  2L5Y A;  2Y1M A;  4PHJ A;  3PFV A;  1IWQ A;  2NLN A;  3WHT B;  2LMU A;  2M3W A;  3OX5 A;  1JFK A;  1OOG A;  2QEH A;  4IJ7 A;  5B8I B;  3FIA A;  1YUT A;  1KFX L;  3BJH A;  3FE9 A;  3IF7 A;  1SL9 A;  1F54 A;  4P5O E;  1BOC A;  4GPL B;  4USL A;  1E8A A;  1SPY A;  2V53 A;  4MZJ A;  1C3Z A;  1JSA A;  2JOJ A;  1UHJ A;  2JTZ A;  2M9G A;  1K96 A;  1YX8 A;  1BR4 B;  5HKZ A;  3BUM B;  2K7B A;  3TUY C;  1B1G A;  3PN7 B;  1NCY A;  1PVA A;  1TRF A;  4M2P A;  1NPQ A;  1W7I B;  2Q4U A;  1FI6 A;  3SIB A;  1ODB A;  2WCB A;  3SG4 A;  4NDD A;  4P2Y B;  1NIW A;  1RWY A;  1Y1X A;  3LLE A;  5CSI A;  2L4I A;  2PAS A;  3CWG A;  2BE6 A;  2CCM A;  3D75 A;  4HRE E;  1XFZ O;  2K8M B;  5HLO A;  1NWD A;  1SKT A;  1LS8 A;  2LC5 A;  3PM8 A;  3PSR A;  3SS4 A;  1YTZ C;  3A8R A;  1R2U A;  3FS7 A;  5HL1 A;  3QRX A;  2P71 A;  2WND A;  3L4A A;  1B7T Z;  3R72 A;  1CMF A;  2SAS A;  2MJW B;  3I5F B;  1LA3 A;  1UUR A;  4ICB A;  1GQM A;  4INX A;  1SR6 B;  4XJK A;  2EC6 C;  2HQW A;  2LHL A;  1W7J B;  1ZMZ A;  3BOW A;  1SNL A;  1BJF A;  2JT3 A;  3GOF A;  3DY9 A;  3SG6 A;  4A4C A;  2AMI A;  1AUI B;  1XFY O;  3RZS A;  3R1P A;  2H61 C;  4UPG A;  1M45 A;  3N7H A;  1OQP A;  1BLQ A;  2OTG C;  1CDP A;  4PHK A;  1JF0 A;  5I2O A;  1ALW A;  3FWB A;  3AKB A;  3Q8I A;  3I5H C;  1QLK A;  3SJS A;  2BCA A;  2QEB A;  3OHM B;  1XFV O;  1IQ3 A;  3TS5 C;  3NSO A;  4N1G A;  1CM4 A;  1IGV A;  5FI2 A;  2M8U A;  1Y6W A;  2MA2 A;  2M1K B;  1DJW A;  2KAY A;  1S6J A;  1FBV A;  1HQV A;  2LAP A;  2LV7 A;  2L2E A;  2G9B A;  4PE0 A;  1JBA A;  1TIZ A;  1EJ3 A;  1JC2 A;  2GTE A;  1K9K A;  1LA0 A;  2LAN A;  1TNX A;  1LXF C;  1TNP A;  1KQV A;  3SS3 A;  1C7V A;  3VRO A;  2PSR A;  3IQQ A;  1KK7 Y;  3AKA A;  2LLT A;  1KSM A;  3DXL A;  2GGM A;  2IS9 A;  2OPO A;  1AJ5 A;  1GJY A;  5CSF A;  3L47 A;  1QJT A;  1T14 A;  4DCK A;  5G08 A;  1DVI A;  1RTP 1;  4M2Q A;  4MN0 A;  1XFU O;  1IG5 A;  2WC8 A;  2CBL A;  2MAZ A;  4C0K A;  1J1D A;  2WCK A;  4A4B A;  2K0J A;  3LK0 A;  2AAO A;  3ZNI A;  1IH0 A;  1KFX S;  1QIW A;  1P28 A;  1QVI Y;  2ZN8 A;  3AAJ A;  3BFH A;  3V2L A;  4CFQ A;  1PSR A;  1J7O A;  4OVN F;  1OOJ A;  1IJ5 A;  2H2K A;  2ERB A;  3DD4 A;  3VRP A;  1X02 A;  3D10 A;  1KWO C;  4PHM A;  4NDC A;  3B6X A;  2KSP A;  4YI8 A;  3S0B A;  3CS1 A;  1OZO A;  2K61 A;  3SG7 A;  4PAL A;  3FE6 A;  1C3Y A;  3FWC A;  3PLF B;  3C1V A;  2JZI A;  1L2O C;  3EVV A;  3WHU B;  2BBN A;  1QWV A;  4JPZ B;  1CFP A;  3JTD C;  2F3Z A;  1QV0 A;  1ZUZ A;  1CLB A;  1CDL A;  2EC6 B;  2M49 B;  3D74 A;  4MRX A;  5FYX A;  1KK7 Z;  3BUN B;  2WCM A;  1PSB A;  2PRU A;  2L5X B;  1CM1 A;  3CR2 A;  1XFR A;  1NX1 A;  3ICB A;  1EXR A;  1QX5 B;  1DJG A;  4I5J A;  2KFF A;  1NYA A;  2LVJ A;  3D78 A;  5KU1 A;  1CLM A;  1DC1 A;  1SY9 A;  2NCP A;  5EL2 A;  4HRH A;  2OTG B;  3PJI A;  4MLW A;  5HLV A;  1XK4 A;  3I5H B;  1QVI Z;  2LHI A;  5BPJ A;  1LKJ A;  1ZFS A;  1XO5 A;  3TS5 B;  1OE9 B;  2Y5I A;  5AFP A;  3D76 A;  1FW4 A;  2BL0 C;  1DJZ A;  3BFB A;  1K2H A;  1RFJ A;  2LMV A;  1QTX A;  3JVT C;  4FQT A;  2G2B A;  4I5L B;  1CNP A;  1UHK A;  1WLZ A;  1DT7 B;  1SW8 A;  2JT8 A;  2M1U A;  1M63 B;  3NGV A;  2JUL A;  2KI6 D;  2ZRT A;  4GUK A;  4ORB B;  1ORG A;  4PT1 A;  5TNC A;  1JUO A;  1N0Y A;  4WQ2 A;  5DKQ A;  1YRT B;  2A4J A;  3D73 A;  3DZT A;  3O6B A;  1IQ5 A;  1S5G Z;  1SCM C;  2M7N A;  2ZRS A;  2L50 A;  5CSN A;  1YUS A;  3CTN A;  1JFJ A;  4M2O A;  1HT9 A;  3E3R A;  3TDU A;  2K2A A;  3EVU A;  3JVT B;  1Z4H A;  3R1O A;  2KAX A;  4KYN A;  2JT0 A;  1B8R A;  4YBH B;  2WC5 A;  2CNP A;  3BUO B;  3VRR A;  3B7A A;  3OBV A;  1K94 A;  3KPX A;  5FI6 A;  1F4O A;  1A03 A;  1K93 D;  3D77 A;  1AVS A;  3VRQ A;  2AUC A;  3D0Y B;  5I94 A;  4U8D A;  4DRW A;  2JXL A;  5AXI A;  3GK1 A;  2L51 A;  3BUX B;  3I5G C;  1QAT A;  1CLL A;  3EKJ A;  2B1U A;  1GM0 A;  4FTG A;  2ZN9 A;  1KWO B;  1LIN A;  2MRD A;  4N1F A;  2BE4 A;  1K95 A;  2JNX A;  2KOT A;  2R2I A;  3BQ3 A;  5D3O A;  2KI4 C;  1OW4 A;  2EHB A;  2PYQ A;  1A2X A;  2HQ8 A;  1MHO A;  1BU3 A;  1OOI X;  2CXJ A;  3EKH A;  2YGU A;  4HSZ A;  1M39 A;  1L2O B;  4GAO A;  1SMG A;  4L9M A;  1R6P A;  4I5K A;  2K7O A;  3JTD B;  2EGD A;  1IIO A;  2MLF C;  5DKN A;  3VGO A;  1BG1 A;  2Q91 A;  4OZD A;  2FOT A;  3EK8 A;  1J55 A;  4WQ3 A;  3WNX B;  1GGW A;  1ZAC A;  3LK1 A;  5AER A;  2PQL A;  2LLS A;  3S0D A;  1NUB A;  4AOM A;  4I5N B;  3RM1 A;  1XYD A;  1SSE B;  1K90 D;  2K7C A;  3PAT A;  2BBM A;  4MZL A;  1EG4 A;  2F3Y A;  5HKW A;  1G8I A;  5ER5 A;  2BAP A;  3OB1 B;  3TDZ A;  1XFW O;  5I2Q A;  2FJU B;  2KGR A;  2OS8 B;  3S0E A;  3I5I C;  2ISD A;  4BY5 A;  2WCH A;  1Q80 A;  3K21 A;  1KK8 C;  4N5X A;  2BL0 B;  4CPV A;  1F4Q A;  2KNE A;  1K8U A;  3DF0 B; 
#chains in the Genus database with same CATH homology
 5PAL A;  4DUQ A;  1SRA A;  2KDH A;  1EG3 A;  2O5G A;  2LVK A;  2PAL A;  1NCZ A;  4ORC B;  1WDC C;  3H4S E;  2HPS A;  1TNW A;  2LVI A;  2ZNE A;  4YGE B;  1B4C A;  1PAL A;  4QJ3 B;  1DJI A;  1V1F A;  1NX0 A;  1SCM B;  1BF5 A;  4WRI A;  3CLN A;  1KSO A;  4ZCV A;  1VRK A;  5F6T A;  4OV2 A;  5KTY A;  4AQJ A;  1S1E A;  2O60 A;  2LUC A;  2M7L A;  3GK4 X;  2KYF A;  1RK9 A;  3NSK A;  1MXE A;  4GGN A;  3OP0 A;  4IL1 A;  1SL7 A;  1WRK A;  3M0W A;  1IJ6 A;  1TTX A;  4XYN A;  1OMV A;  2JQ6 A;  3KF9 A;  1YVH A;  3DVE A;  3PAL A;  2WCE A;  1V1G A;  1WLM A;  3I5G B;  1WY9 A;  1J7Q A;  5GQQ C;  1S5G Y;  1S26 D;  1KQM C;  4BY4 A;  2M97 A;  4MZK A;  1UP5 A;  3F45 A;  4JQ0 D;  2KI4 B;  1BMO A;  4PE4 A;  2P6B B;  1JWD A;  2H61 A;  1NX3 A;  1C07 A;  4TNC A;  1MWN A;  1CTR A;  1CDN A;  1ZOT B;  1UHI A;  4YGB B;  4HRG A;  3EK4 A;  1TOP A;  2M0R A;  4OKH A;  4GGF C;  4CFR A;  1OMD A;  2BKI B;  3LCP C;  1N2D A;  3CR4 X;  2Y4Q A;  2SCP A;  1CFD A;  4QJ5 B;  1F55 A;  1IKU A;  5I2L A;  1AJ4 A;  4YRU A;  1BR1 B;  5IBW A;  2LMT A;  1QX7 A;  2L0P A;  2F2P A;  3KEV A;  2OS8 C;  1DGV A;  1TCF A;  2BCX A;  2WCF A;  4JWQ A;  3HCM A;  1AP4 A;  2ZFD A;  2LUX A;  3IQO A;  1UHH A;  2KHN A;  3CR5 X;  1DF0 B;  3AAK A;  4NQG A;  1KCY A;  1A75 B;  2TN4 A;  2K7D A;  3SG3 A;  1J7R A;  1C7W A;  1J1E A;  1DJX A;  1TCO B;  1NX2 A;  2KFG A;  5CSJ A;  1PRW A;  3I5I B;  4MSP A;  4ORA B;  1CKK A;  3RLZ A;  1MXL C;  1KK8 B;  2LP2 A;  2JWW A;  2QAC A;  3SIA A;  4PE1 A;  2K2F A;  2JRF A;  3DVK A;  3EK7 A;  1UHN A;  4YI9 A;  3D0Y A;  4MEW A;  4CLN A;  2KQY A;  1WDC B;  4F0Z B;  1WRL A;  1SCV A;  4DS7 A;  5I8N A;  2KI6 C;  1KFU L;  1G4Y R;  2KAV A;  1QXP A;  4PCW A;  2ZND A;  2COL B;  3TDI A;  1QAS A;  1MUX A;  1ALV A;  2I7A A;  1YX7 A;  2KGB C;  2CTN A;  4GFT A;  1PVB A;  4MVF A;  1YR5 A;  2I2R E;  1UUS A;  5D7F A;  1F71 A;  2F2O A;  4GBA A;  3DVJ A;  2JC2 A;  5KSZ A;  2I94 A;  3TZ1 A;  4OCI A;  1MR8 A;  2E30 A;  2E6W A;  4QJ4 B;  2VRG A;  2LLU A;  1KQM B;  4GGF A;  2KFH A;  1S36 A;  1TN4 A;  4DIR A;  1NSH A;  1N65 A;  2JNF A;  3BXK A;  1NCX A;  1IRJ A;  1SL8 A;  2JXC A;  3DVM A;  1XVJ A;  1F70 A;  2PVB A;  3MSE B;  1QS7 A;  2NCO A;  1CB1 A;  1DTL A;  2F33 A;  2NZ0 A;  2D8N A;  4PDZ A;  1NP8 A;  2KBM A;  2Y1N A;  2ZKM X;  5HYD A;  1M31 A;  1K9P A;  3SG2 A;  1OSA A;  1PK0 D;  3DF0 A;  5K89 A;  1F8H A;  1OMR A;  2KQ6 A;  2HET A;  4XJK B;  2M29 A;  3KO0 A;  4YGC B;  1LVC D;  1MF8 B;  3BOW B;  2LCP A;  5D69 A;  2L98 A;  4D1E A;  1QV1 A;  3O2P A;  1FF1 A;  3BUW B;  1G33 A;  4OR9 B;  2FCE A;  1Y0V H;  2JTT A;  2WOR A;  1XFX O;  4PHN A;  4CID A;  4C0J A;  1D1O A;  2QPT A;  2MHH A;  1DGU A;  1YVL A;  1AHR A;  3O78 A;  2LM5 A;  1XK4 C;  1UWO A;  5DKR A;  1YRU B;  5JJG A;  3O4Y A;  1U5I A;  1CDM A;  3OX6 A;  2NXQ A;  1A29 A;  1BT6 A;  3PN7 C;  1DMO A;  4ETO A;  5AEQ A;  1S6I A;  2BEC A;  2BKH B;  2HF5 A;  5HKY A;  1S3P A;  1SK6 D;  2JU0 A;  1U5I B;  2MLE C;  3NSL A;  5AAN A;  2L4H A;  4YGA A;  1PUL A;  4Q04 A;  1QIV A;  2RGI A;  3NSI A;  1L7Z A;  3TUY B;  1JF2 A;  2LP3 A;  1A4P A;  3LL8 B;  1Y1A A;  1J7P A;  4AQI A;  1RRO A;  2GGZ A;  1BOD A;  4PE7 A;  1KFU S;  1DJY A;  3NXA A;  2KYC A;  4YGD B;  3KHE A;  4C0L A;  1CFF A;  1Y1U A;  1CFC A;  1RJV A;  2GV5 A;  2LNK A;  1SBJ A;  1M46 A;  2BCB A;  5ER4 X;  2DOQ A;  1XA5 A;  1WRZ A;  3I5F C;  2MBX A;  2F8P A;  2KBI A;  1QLS A;  1SR6 C;  2CT9 A;  2I18 A;  5JOL A;  3BYA A;  4E68 A;  2LVV A;  3GK2 A;  1H4B A;  1DF0 A;  5J3X A;  3ZWH A;  1H8B A;  1A75 A;  4FQO A;  4GNK B;  3OB2 B;  3HX4 A;  1GGZ A;  1YUR A;  1MQ1 A;  2WOS A;  4MBE A;  1SYM A;  1EL4 A;  3CGA A;  2PMY A;  1YUU A;  1B9A A;  3CZT X;  4R1E A;  4NDB A;  4MRY A;  1B47 A;  1S6C A;  5CPV A;  1FI5 A;  1FPW A;  3WXA A;  1OZS A;  3SG5 A;  3VRN A;  1B8L A;  4ZCU A;  3A4U B;  1B8C A;  3EVR A;  2JPT A;  1K9U A;  1REC A;  1TNQ A;  1QX2 A;  1CMG A;  1B7T Y;  1DJH A;  2FCD A;  1EH2 A;  1AK8 A;  2LE9 B;  2Y1M A;  4PHJ A;  3PFV A;  1IWQ A;  2NLN A;  3WHT B;  2LMU A;  2M3W A;  3OX5 A;  1JFK A;  5B8I B;  3FIA A;  1YUT A;  1KFX L;  3IF7 A;  1F54 A;  1SL9 A;  4P5O E;  1BOC A;  4GPL B;  4USL A;  1E8A A;  1SPY A;  2V53 A;  4MZJ A;  1JSA A;  2JOJ A;  1UHJ A;  2JTZ A;  2M9G A;  1K96 A;  1YX8 A;  1BR4 B;  5HKZ A;  3BUM B;  2K7B A;  3TUY C;  1B1G A;  3PN7 B;  1NCY A;  1PVA A;  1TRF A;  4M2P A;  1NPQ A;  1W7I B;  2Q4U A;  1FI6 A;  3SIB A;  1ODB A;  2WCB A;  3SG4 A;  4NDD A;  4P2Y B;  1NIW A;  1RWY A;  1Y1X A;  3LLE A;  5CSI A;  2L4I A;  2PAS A;  3CWG A;  2BE6 A;  2CCM A;  4HRE E;  1XFZ O;  2K8M B;  5HLO A;  1NWD A;  1SKT A;  2LC5 A;  3PM8 A;  3PSR A;  1YTZ C;  3A8R A;  1R2U A;  3FS7 A;  3QRX A;  2WND A;  1B7T Z;  1CMF A;  2SAS A;  2MJW B;  3I5F B;  1LA3 A;  1UUR A;  4ICB A;  1GQM A;  4XJK A;  1SR6 B;  2EC6 C;  2HQW A;  2LHL A;  1W7J B;  1ZMZ A;  3BOW A;  1SNL A;  1BJF A;  2JT3 A;  3GOF A;  4A4C A;  3SG6 A;  2AMI A;  1AUI B;  1XFY O;  2H61 C;  4UPG A;  1M45 A;  1OQP A;  1BLQ A;  2OTG C;  1CDP A;  4PHK A;  1JF0 A;  5I2O A;  1ALW A;  3FWB A;  3AKB A;  3I5H C;  1QLK A;  3SJS A;  2BCA A;  3OHM B;  1XFV O;  1IQ3 A;  3TS5 C;  3NSO A;  4N1G A;  1CM4 A;  1IGV A;  2M8U A;  1Y6W A;  2MA2 A;  2M1K B;  1DJW A;  2KAY A;  1S6J A;  1FBV A;  1HQV A;  2LAP A;  2LV7 A;  2L2E A;  2G9B A;  4PE0 A;  1JBA A;  1TIZ A;  1EJ3 A;  1JC2 A;  1K9K A;  1LA0 A;  2LAN A;  1TNX A;  1LXF C;  1TNP A;  1KQV A;  1C7V A;  3VRO A;  2PSR A;  3IQQ A;  1KK7 Y;  3AKA A;  2LLT A;  1KSM A;  2GGM A;  2IS9 A;  2OPO A;  1GJY A;  1AJ5 A;  5CSF A;  1QJT A;  4DCK A;  5G08 A;  1DVI A;  1RTP 1;  4M2Q A;  4MN0 A;  1XFU O;  1IG5 A;  2WC8 A;  2CBL A;  2MAZ A;  4C0K A;  1J1D A;  4A4B A;  2K0J A;  3LK0 A;  2AAO A;  3ZNI A;  1IH0 A;  1KFX S;  1QIW A;  1QVI Y;  2ZN8 A;  3AAJ A;  4CFQ A;  1J7O A;  1PSR A;  4OVN F;  1OOJ A;  1IJ5 A;  2H2K A;  3DD4 A;  3VRP A;  1X02 A;  3D10 A;  1KWO C;  4PHM A;  4NDC A;  2KSP A;  4YI8 A;  3CS1 A;  1OZO A;  2K61 A;  3SG7 A;  4PAL A;  3FWC A;  3PLF B;  3C1V A;  2JZI A;  1L2O C;  3EVV A;  3WHU B;  2BBN A;  4JPZ B;  1CFP A;  3JTD C;  2F3Z A;  1QV0 A;  1ZUZ A;  1CLB A;  1CDL A;  2EC6 B;  2M49 B;  4MRX A;  5FYX A;  1KK7 Z;  3BUN B;  1PSB A;  2PRU A;  2L5X B;  1CM1 A;  3CR2 A;  1NX1 A;  3ICB A;  1EXR A;  1QX5 B;  1DJG A;  4I5J A;  2KFF A;  1NYA A;  2LVJ A;  5KU1 A;  1CLM A;  1SY9 A;  2NCP A;  4HRH A;  2OTG B;  5HLV A;  4MLW A;  1XK4 A;  3I5H B;  1QVI Z;  2LHI A;  5BPJ A;  1LKJ A;  1ZFS A;  1XO5 A;  3TS5 B;  1OE9 B;  2Y5I A;  5AFP A;  1FW4 A;  2BL0 C;  1DJZ A;  1K2H A;  1RFJ A;  2LMV A;  1QTX A;  3JVT C;  4I5L B;  2G2B A;  1CNP A;  1UHK A;  1WLZ A;  1DT7 B;  1SW8 A;  2JT8 A;  2M1U A;  1M63 B;  2JUL A;  2KI6 D;  2ZRT A;  4GUK A;  4ORB B;  5TNC A;  1JUO A;  1N0Y A;  4WQ2 A;  5DKQ A;  1YRT B;  2A4J A;  3O6B A;  1IQ5 A;  1S5G Z;  1SCM C;  2M7N A;  2ZRS A;  2L50 A;  5CSN A;  1YUS A;  3CTN A;  1JFJ A;  4M2O A;  1HT9 A;  3E3R A;  3TDU A;  2K2A A;  3EVU A;  3JVT B;  2KAX A;  2JT0 A;  1B8R A;  4YBH B;  2CNP A;  3BUO B;  3VRR A;  1K94 A;  3KPX A;  1F4O A;  1A03 A;  1K93 D;  1AVS A;  3VRQ A;  2AUC A;  3D0Y B;  4U8D A;  4DRW A;  2JXL A;  5AXI A;  3GK1 A;  2L51 A;  3BUX B;  3I5G C;  1QAT A;  1CLL A;  3EKJ A;  2B1U A;  4FTG A;  2ZN9 A;  1KWO B;  1LIN A;  2MRD A;  4N1F A;  2BE4 A;  1K95 A;  2JNX A;  2KOT A;  2R2I A;  3BQ3 A;  2KI4 C;  2EHB A;  1A2X A;  2HQ8 A;  1MHO A;  1BU3 A;  2CXJ A;  3EKH A;  4HSZ A;  1M39 A;  1L2O B;  4GAO A;  1SMG A;  4L9M A;  1R6P A;  4I5K A;  2K7O A;  3JTD B;  2EGD A;  2MLF C;  5DKN A;  3VGO A;  1BG1 A;  2Q91 A;  2FOT A;  3EK8 A;  1J55 A;  4WQ3 A;  3WNX B;  1GGW A;  1ZAC A;  3LK1 A;  5AER A;  2LLS A;  1NUB A;  4AOM A;  4I5N B;  3RM1 A;  1XYD A;  1K90 D;  2K7C A;  3PAT A;  2BBM A;  4MZL A;  1EG4 A;  2F3Y A;  5HKW A;  1G8I A;  5ER5 A;  3OB1 B;  3TDZ A;  1XFW O;  5I2Q A;  2FJU B;  2KGR A;  2OS8 B;  3I5I C;  2ISD A;  4BY5 A;  3K21 A;  1Q80 A;  1KK8 C;  4N5X A;  2BL0 B;  4CPV A;  1F4Q A;  2KNE A;  1K8U A;  3DF0 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...