3JVTB

Calcium-bound scallop myosin regulatory domain (lever arm) with reconstituted complete light chains
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
156
structure length
156
Chain Sequence
b'ADKAASGVLTKLPQKQIQEMKEAFSMIDVDRDGFVSKEDIKAISEQLGRAPDDKELTAMLKEAPGPLNFTMFLSIFSDKLSGTDSEETIRNAFAMFDEQETKKLNIEYIKDLLENMGDNFNKDEMRMTFKEAPVEGGKFDYVKFTAMIKGSGEEEA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Myosin heavy chain, striated adductor muscle
publication title The on-off switch in regulated myosins: different triggers but related mechanisms.
pubmed doi rcsb
molecule tags Contractile protein
total genus 45
structure length 156
sequence length 156
ec nomenclature
pdb deposition date 2009-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13405 EF-hand_6 EF-hand domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3jvtB01
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3jvtB02
3CR4X 3EK7A 2PMYA 3WNXB 1YVLA 1PVAA 1WDCC 4GAOA 3NSKA 1E8AA 2SASA 1CLBA 2AAOA 2E30A 2KAXA 1IGVA 5I2OA 2NZ0A 3FWBA 1JC2A 1J1DA 2I18A 4ORCB 2O60A 1JWDA 1G4YR 4ORBB 2MLFC 1W7JB 1TNPA 1S1EA 3IQQA 4XYNA 1KFUS 2LUXA 3A8RA 1SY9A 1KFXL 4OKHA 1XO5A 1JUOA 1CM1A 1K94A 1SL7A 4NQGA 1BMOA 1ZUZA 4XJKA 5BPJA 3BQ3A 4AQJA 3HX4A 1NX0A 5D7FA 1CKKA 1J1EA 1M63B 3SG3A 3PN7B 2LHIA 5I2LA 1OMVA 1A4PA 1DJHA 1TNXA 1BF5A 4FTGA 4UPGA 1Q80A 1TN4A 1SK6D 1NSHA 1CDLA 1TIZA 2LVVA 2QACA 1ZFSA 1BLQA 3CTNA 3DVKA 2KI4C 1DGUA 2GV5A 3BXKA 1NCXA 2WCBA 5AANA 2HPSA 2LVJA 3SG2A 4ETOA 1V1GA 2FCDA 1KK8B 1CDPA 2L50A 1NX3A 2LLTA 3RM1A 1DGVA 1K93D 2NCOA 3BOWA 2MBXA 1F8HA 2L4HA 1YVHA 1A75B 2LP2A 3EKHA 4N5XA 1B7TY 1ALVA 1LXFC 3EVRA 1EG4A 2BCXA 1UHNA 2CCMA 1QX2A 2M0RA 3CS1A 2K7OA 3PFVA 3PN7C 1KWOB 4HREE 4WQ2A 4C0JA 3MSEB 1B1GA 1XFXO 2Q91A 4MEWA 5I8NA 2LNKA 2M97A 2JULA 1ZACA 2BBMA 1SBJA 2JT0A 1LKJA 3LK1A 3LCPC 1EJ3A 2MJWB 1DT7B 2A4JA 2WNDA 4DUQA 1CMFA 3I5FB 1TRFA 3SG6A 4MSPA 3D10A 3WXAA 2M9GA 1KK8C 1D1OA 1Y1AA 1DJWA 1SKTA 1NIWA 1KQMB 3A4UB 4OVNF 3ZWHA 3EVVA 3PSRA 3EK8A 2KFFA 1XVJA 1RFJA 5HLVA 1SNLA 4ORAB 4M2QA 1K9KA 2JZIA 2L5XB 4MRYA 3KHEA 1F4QA 3CZTX 3BUOB 3TUYB 1QX5B 1AJ4A 1DJZA 2I94A 2KAYA 1RJVA 2ZNEA 2KNEA 1AJ5A 3I5FC 2KGRA 1ODBA 4C0KA 4CFQA 2FJUB 1K9UA 2JWWA 4MZJA 4PALA 1YUSA 5HKWA 1BG1A 1IJ5A 1EG3A 1UP5A 2LLUA 1CMGA 1FI5A 4M2PA 4MRXA 3EK4A 1IJ6A 2NLNA 3OB2B 4HSZA 3SIAA 1F4OA 2M8UA 1KQMC 1Y1XA 2BE6A 2KFGA 4TNCA 1KCYA 2IS9A 2MHHA 3IQOA 1K96A 2M29A 2P6BB 1SPYA 3AAKA 3O2PA 5ER4X 3WHUB 1QATA 5CSNA 1QVIZ 2BL0B 4A4BA 2HF5A 1NYAA 3TUYC 1A29A 3JVTC 5AEQA 1U5IA 4XJKB 2L98A 2BCAA 1TTXA 1SL9A 2AUCA 3HCMA 1RECA 1YUUA 3NXAA 1BJFA 1EXRA 1K9PA 2F33A 2JPTA 2LMVA 4I5LB 1KSOA 4E68A 4YI8A 3PALA 1S6JA 3TDIA 1IKUA 1HQVA 1RROA 3I5IC 4YGAA 2JXCA 2JTTA 1YTZC 1ALWA 1PULA 3SJSA 1SCMC 1RK9A 2PALA 4PE0A 5HKYA 2LVIA 2PVBA 4CLNA 1R6PA 1K8UA 2JRFA 1PSRA 4MN0A 3JTDB 2PRUA 1J55A 2CBLA 3CWGA 3BOWB 2OS8B 1CFCA 1OOJA 5CSJA 1SCVA 1NCYA 1QASA 2KYCA 1NX1A 1JF0A 1Y1UA 5DKQA 5HKZA 4DS7A 1BR4B 1IWQA 4NDDA 1B9AA 3FS7A 2F3ZA 4PHNA 3M0WA 3DVEA 1CFDA 4WQ3A 1LA0A 2AMIA 2KQYA 5G08A 1F71A 4A4CA 1PK0D 4FQOA 1JSAA 3I5GB 1CLLA 4ICBA 1W7IB 3WHTB 3BYAA 4YGBB 2MLEC 3AKBA 1YR5A 3TS5B 2CTNA 1WY9A 4ZCUA 4PHJA 3OHMB 1CM4A 1S5GZ 5JOLA 5IBWA 3AKAA 5KU1A 2JTZA 2OS8C 3GK2A 4JPZB 4CIDA 2HQWA 3CLNA 5DKNA 5HLOA 3DF0B 5KSZA 3QRXA 2HQ8A 2LAPA 2LLSA 2H61C 1KFXS 4L9MA 2JNXA 4BY4A 1YX7A 2F2OA 1DJIA 2ZN8A 1CDMA 3VRRA 3CR2A 2K2FA 1GGZA 3OX6A 1RWYA 1QTXA 1FBVA 1BOCA 4HRHA 1SL8A 2ZN9A 1MF8B 1FI6A 5K89A 2LVKA 4YI9A 4YRUA 1Y0VH 1S6CA 1QLSA 1LINA 2K61A 2V53A 4I5JA 1YRTB 1B8CA 3OB1B 1H4BA 4OR9B 1L2OB 1B47A 3BUMB 3IF7A 2WORA 4YGEB 1S36A 3AAJA 3KEVA 4CFRA 1TNWA 1AUIB 1M31A 1UWOA 3D0YB 2OTGB 3GOFA 4P2YB 2I7AA 2MAZA 3EKJA 1NUBA 1DF0A 1U5IB 3KPXA 4GBAA 1N65A 1KWOC 3CR5X 2MA2A 1QV1A 2NXQA 3VROA 4DCKA 1YUTA 1QLKA 4CPVA 3I5HB 1GQMA 4U8DA 1DJYA 4DIRA 1F55A 1N2DA 4QJ5B 5AERA 1G8IA 1OQPA 1QIWA 2D8NA 1XFVO 1S6IA 2LP3A 1CLMA 1K90D 4M2OA 1OZOA 4MZKA 1L2OC 4Q04A 3O78A 4BY5A 1OMDA 1DJXA 1JBAA 2L51A 2JQ6A 1UUSA 1CB1A 1K2HA 1M45A 1XA5A 1PALA 2K0JA 5FYXA 4GUKA 5ER5A 4HRGA 2PSRA 1L7ZA 1G33A 2RGIA 3I5HC 1H8BA 1SMGA 1UHIA 2DOQA 3O4YA 3RLZA 3C1VA 1B4CA 5TNCA 2F2PA 5CSFA 1FPWA 3TDZA 1WDCB 1UHJA 3PM8A 2B1UA 2ZRSA 5KTYA 1QS7A 1IRJA 1KK7Y 1F70A 1MHOA 1SR6B 2E6WA 2Y4QA 4PE4A 1C07A 2FCEA 1S3PA 3FWCA 2O5GA 1Y6WA 4PHKA 3VGOA 2BE4A 2K7BA 2BBNA 2TN4A 3EVUA 3VRNA 4P5OE 1QVIY 2ZRTA 1YURA 3DVJA 4I5NB 5CPVA 5AFPA 2KDHA 3OP0A 4PHMA 2R2IA 1N0YA 1BU3A 3TDUA 5GQQC 2BL0C 2K7DA 2LC5A 5F6TA 1WRZA 1JFKA 3SG5A 1IH0A 1X02A 5AXIA 1MQ1A 1NCZA 1YRUB 4MBEA 5D69A 3GK4X 1TOPA 1RTP1 4N1FA 1CFPA 2WOSA 5JJGA 1A03A 3K21A 1C7VA 1MUXA 2H2KA 1BR1B 3ICBA 4N1GA 1SR6C 1XFYO 3CGAA 4R1EA 2JT3A 3BUNB 3KO0A 1B8RA 1CDNA 1BODA 1A2XA 1XYDA 2KBIA 2EHBA 2HETA 2FOTA 1LA3A 2JC2A 3OX5A 1OSAA 1AK8A 4NDCA 1IQ5A 1QV0A 2JXLA 2KHNA 2KI4B 1ZMZA 1TCFA 2VRGA 4WRIA 1MXLC 2LE9B 2WC8A 3JTDC 2K7CA 1QX7A 1WLZA 2KYFA 3NSIA 2KAVA 2ISDA 1DTLA 1DF0B 2I2RE 1FW4A 1F54A 4DRWA 3TZ1A 4GPLB 1B7TZ 2PASA 2EGDA 3SG7A 1UURA 1XFZO 4OCIA 3VRPA 1DMOA 3SIBA 1MR8A 4IL1A 3I5GC 4USLA 2JNFA 4YGCB 3NSOA 5CSIA 5J3XA 5PALA 4QJ4B 1S5GY 2GGMA 1OMRA 2ZFDA 2BCBA 4D1EA 4QJ3B 2KFHA 1NPQA 2NCPA 3F45A 2M3WA 4PCWA 3TS5C 1FF1A 2M49B 1K95A 2WCEA 2SCPA 4GGNA 2LM5A 2WCFA 1QIVA 4GGFC 1QJTA 4AOMA 1NP8A 2BECA 1UHHA 2L4IA 2BKHB 2M1KB 3BUWB 2JT8A 4JQ0D 1M39A 2M7NA 1UHKA 1C7WA 2H61A 4MLWA 2EC6B 1GJYA 2Q4UA 2M1UA 1AVSA 1VRKA 1V1FA 2JU0A 3LL8B 4YGDB 4GFTA 1EH2A 3DD4A 1MXEA 4AQIA 1LVCD 1SW8A 5DKRA 5I2QA 1J7RA 1WRKA 2CT9A 2KGBC 1PVBA 3VRQA 3LLEA 4NDBA 1J7OA 1XK4C 2CXJA 4GNKB 1CNPA 3PLFB 4I5KA 3SG4A 2KOTA 1J7QA 1CFFA 4PE1A 3BUXB 2LV7A 2LUCA 3LK0A 1B8LA 5HYDA 4C0LA 4GGFA 2G2BA 2LMTA 1MWNA 4JWQA 3DF0A 4MZLA 1IQ3A 1DVIA 1NWDA 4F0ZB 4PE7A 3PATA 1AP4A 1A75A 2F3YA 2EC6C 1IG5A 1QXPA 2OTGC 4PDZA 1SRAA 2L0PA 1BT6A 1OE9B 1PRWA 1WRLA 2LCPA 1HT9A 3H4SE 3JVTB 2K2AA 1GGWA 1S26D 2Y5IA 1M46A 2LHLA 1R2UA 2CNPA 3NSLA 2GGZA 5B8IB 1J7PA 2K8MB 3GK1A 2KI6D 2OPOA 3KF9A 2KQ6A 2L2EA 1XK4A 1NX2A 1OZSA 1DJGA 1XFWO 2G9BA 2LANA 1ZOTB 1WLMA 1KSMA 2Y1NA 4MVFA 2MRDA 2KSPA 3I5IB 1KK7Z 3E3RA 3FIAA 2QPTA 2COLB 2KBMA 2F8PA 1PSBA 2LMUA 1SCMB 3DVMA 3ZNIA 1TCOB 2ZKMX 1TNQA 2Y1MA 4OV2A 2M7LA 3D0YA 2KI6C 2BKIB 4ZCVA 1YX8A 1SYMA 1KFUL 1XFUO 2ZNDA 1AHRA 1EL4A 1JF2A 3O6BA 4YBHB 1KQVA 2JOJA 1JFJA 1CTRA
chains in the Genus database with same CATH superfamily
3CR4X 3EK7A 2PMYA 3WNXB 1YVLA 1PVAA 1WDCC 2KLEA 4GAOA 1OOHA 5DICA 3NSKA 1E8AA 2SASA 1CLBA 2AAOA 3DYEA 2E30A 2KAXA 4JKTA 1IGVA 1OW4A 5I2OA 2NZ0A 3FWBA 1JC2A 1J1DA 4F7FA 2I18A 4ORCB 2O60A 1JWDA 1G4YR 4ORBB 2MLFC 1W7JB 1TNPA 1S1EA 3IQQA 4XYNA 1KFUS 2LUXA 3A8RA 1SY9A 1KFXL 4OKHA 1XO5A 1JUOA 1CM1A 1K94A 1SL7A 3BFAA 4NQGA 1BMOA 1ZUZA 2KLDA 4XJKA 5BPJA 3BQ3A 4AQJA 3HX4A 1NX0A 5D7FA 1CKKA 1J1EA 1M63B 3R1VA 3PN7B 3SG3A 3UNWA 1TUZA 2LHIA 2QDIA 4FQTA 5I2LA 1OMVA 1A4PA 1DJHA 1TNXA 1BF5A 4FTGA 4UPGA 1Q80A 1TN4A 1SK6D 1NSHA 1CDLA 1TIZA 2LVVA 2QACA 1ZFSA 1BLQA 3CTNA 3DVKA 2KI4C 1DGUA 2GV5A 3BXKA 1NCXA 2WCBA 5AANA 2HPSA 2LVJA 3SG2A 4ETOA 1V1GA 2FCDA 1KK8B 1CDPA 2L50A 1NX3A 2LLTA 3D74A 3RM1A 1DGVA 1K93D 2NCOA 3BOWA 2MBXA 3BJHA 1F8HA 2L4HA 1YVHA 1A75B 2LP2A 3EKHA 4N5XA 2QEVA 5FI6A 3SS3A 1B7TY 1ALVA 1LXFC 3EVRA 1EG4A 2BCXA 1UHNA 2CCMA 1QX2A 2M0RA 3CS1A 2K7OA 3PFVA 3PN7C 1KWOB 4HREE 4WQ2A 4C0JA 3MSEB 1B1GA 1XFXO 2Q91A 4MEWA 5I8NA 2LNKA 2M97A 2JULA 1XFRA 1ZACA 2BBMA 1SBJA 2JT0A 1LKJA 3LK1A 3LCPC 1EJ3A 3D76A 2MJWB 1DT7B 2A4JA 2WNDA 4DUQA 1CMFA 3I5FB 1TRFA 3S0AA 3SG6A 3NHIA 3S0FA 4MSPA 2L5YA 3D10A 3WXAA 2M9GA 1KK8C 1TWOA 1D1OA 1Y1AA 1DJWA 1SKTA 1NIWA 1KQMB 3A4UB 3FE8A 4OVNF 3ZWHA 1IIOA 3EVVA 3PSRA 5I94A 3CZ1A 3EK8A 1LS8A 2KFFA 1XVJA 1RFJA 3R72A 1SNLA 1Z2CB 3CABA 5HLVA 4ORAB 4M2QA 1K9KA 2JZIA 2L5XB 4MRYA 3KHEA 3B6XA 1F4QA 3CZTX 3BUOB 3TUYB 1QX5B 3RZSA 1AJ4A 1DJZA 2I94A 2KAYA 1RJVA 2ZNEA 2KNEA 1AJ5A 3I5FC 2KGRA 1ODBA 4C0KA 4CFQA 2FJUB 1K9UA 2JWWA 1T14A 4MZJA 1YUSA 4PALA 5HKWA 1BG1A 1IJ5A 1EG3A 1UP5A 2LLUA 1CMGA 5HL1A 1FI5A 2WCKA 4M2PA 3EK4A 1IJ6A 2QEHA 2NLNA 3OB2B 4MRXA 4HSZA 3SIAA 1F4OA 2M8UA 1KQMC 1Y1XA 2BE6A 2KFGA 4TNCA 1KCYA 2IS9A 2MHHA 3IQOA 1K96A 2M29A 2P6BB 2H8VA 1SPYA 3AAKA 3O2PA 5ER4X 3WHUB 1QATA 5CSNA 1QVIZ 2BL0B 2K60A 4A4BA 2HF5A 1NYAA 3TUYC 5D3OA 1A29A 3JVTC 5AEQA 1U5IA 4XJKB 2L98A 2BCAA 4OZDA 1TTXA 1SL9A 2AUCA 3HCMA 1RECA 1YUUA 3NXAA 3NHTA 1BJFA 1EXRA 1K9PA 2F33A 2JPTA 2LMVA 4I5LB 2WC5A 1KSOA 4E68A 4YI8A 3PALA 1S6JA 3TDIA 1IKUA 1HQVA 1RROA 2WCHA 3I5IC 3R1OA 4YGAA 2JXCA 2JTTA 1YTZC 3NGVA 1ALWA 1DELA 1PULA 3SJSA 4INWA 1SCMC 1RK9A 2PALA 4PE0A 3CDNA 2GTEA 5HKYA 2LVIA 2PVBA 4CLNA 1R6PA 1K8UA 2JRFA 1PSRA 2P70A 4MN0A 2WCMA 3JTDB 2PRUA 1J55A 2CBLA 3CWGA 3BOWB 2OS8B 1CFCA 1OOJA 5CSJA 1SCVA 1NCYA 1QASA 2KYCA 1NX1A 1JF0A 1P28A 1Y1UA 5DKQA 5HKZA 3S0BA 4DS7A 1C3ZA 1BR4B 1IWQA 4NDDA 1B9AA 3FS7A 2F3ZA 4PHNA 3M0WA 4KYNA 3DVEA 1CFDA 4WQ3A 1LA0A 3B88A 1DQEA 2AMIA 2KQYA 5G08A 1F71A 4A4CA 1PK0D 4FQOA 1JSAA 3I5GB 1CLLA 4ICBA 1W7IB 2BAPA 2QEBA 3WHTB 3BYAA 4YGBB 2MLEC 3AKBA 1YR5A 3TS5B 3BFBA 2CTNA 1WY9A 4ZCUA 4PHJA 3OHMB 1CM4A 1S5GZ 5JOLA 5IBWA 3AKAA 5KU1A 2JTZA 2OS8C 3GK2A 4JPZB 4CIDA 2HQWA 3CLNA 5DKNA 2PQLA 5HLOA 3DF0B 5KSZA 3QRXA 2HQ8A 3Q8IA 2LAPA 2LLSA 3IVTA 2H61C 1KFXS 4L9MA 2JNXA 5FI7A 4BY4A 1YX7A 2F2OA 1DJIA 2ZN8A 1CDMA 3VRRA 3CR2A 2K2FA 1GGZA 2QEOA 3OX6A 4IJ7A 2WC6A 1RWYA 1ORGA 1QTXA 1FBVA 3DZTA 1BOCA 3S0DA 4HRHA 5FI2A 1SL8A 2ZN9A 1MF8B 1FI6A 3S0GA 5K89A 2LVKA 2KPHA 4YI9A 1Y0VH 3S0EA 1S6CA 1QLSA 4YRUA 1LINA 2K61A 2YGUA 2V53A 4I5JA 2ERBA 1YRTB 1B8CA 3OB1B 3SS4A 1H4BA 4OR9B 1L2OB 3D73A 1B47A 3BUMB 3IF7A 2WORA 4YGEB 1S36A 3AAJA 3KEVA 4CFRA 1TNWA 1AUIB 1M31A 1UWOA 3D0YB 2OTGB 3GOFA 4P2YB 2I7AA 2MAZA 3EKJA 1NUBA 1DF0A 1U5IB 1W9ZA 3KPXA 4GBAA 1N65A 4PT1A 1KWOC 4JD9A 3CR5X 2MA2A 1QV1A 2NXQA 3VROA 4DCKA 1YUTA 1QLKA 4CPVA 3I5HB 1GQMA 4U8DA 1DJYA 4DIRA 1F55A 1N2DA 4QJ5B 3PJIA 5AERA 1G8IA 1OQPA 1QIWA 2D8NA 1XFVO 3CZ0A 1S6IA 3B7AA 5EL2A 2LP3A 1CLMA 1C3YA 1K90D 3OGNA 4M2OA 1OZOA 4MZKA 1L2OC 4Q04A 3O78A 4BY5A 1OMDA 3O4XA 3VB1A 1DJXA 1OOGA 1JBAA 2L51A 2JQ6A 1UUSA 3BFHA 1CB1A 1K2HA 1M45A 1XA5A 1PALA 2K0JA 3D77A 5FYXA 4GUKA 5ER5A 4HRGA 2PSRA 1L7ZA 1G33A 2RGIA 3I5HC 1H8BA 1SMGA 1UHIA 2DOQA 3O4YA 3RLZA 3C1VA 1B4CA 5TNCA 2F2PA 5CSFA 1FPWA 3TDZA 1WDCB 1UHJA 3PM8A 2B1UA 2ZRSA 5KTYA 3QMEA 1QS7A 1IRJA 1KK7Y 1F70A 1MHOA 1SR6B 2E6WA 2Y4QA 4PE4A 1C07A 3DXLA 2FCEA 1S3PA 3FWCA 2O5GA 1Y6WA 4INXA 4PHKA 3VGOA 2BE4A 2K7BA 2BBNA 2TN4A 3EVUA 3VRNA 4P5OE 1QVIY 2ZRTA 1YURA 3DVJA 4I5NB 5CPVA 5AFPA 2KDHA 1Z4HA 2L2CA 2R2IA 1N0YA 3OP0A 4PHMA 1BU3A 2P71A 3TDUA 5GQQC 2BL0C 2K7DA 2LC5A 5F6TA 1WRZA 1JFKA 3SG5A 1IH0A 1X02A 5AXIA 3N7HA 1MQ1A 1NCZA 1YRUB 4MBEA 5D69A 3GK4X 1TOPA 1RTP1 4N1FA 1CFPA 2WOSA 1OOIX 5JJGA 1A03A 3K21A 1C7VA 1MUXA 2H2KA 1BR1B 2BNXA 3ICBA 1SR6C 1XFYO 3CGAA 3B86A 3D78A 4N1GA 4R1EA 2JPOA 2JT3A 3BUNB 3KO0A 1B8RA 1CDNA 1BODA 1A2XA 1XYDA 2KBIA 2FJYA 2EHBA 2HETA 2WCLA 2FOTA 1LA3A 2JC2A 3OX5A 3CZ2A 1OSAA 1AK8A 4NDCA 1IQ5A 1QV0A 2JXLA 2KHNA 2KI4B 1ZMZA 1TCFA 2VRGA 4WRIA 1MXLC 3B87A 3L4AA 2LE9B 2WC8A 3UO9A 3JTDC 2K7CA 1QX7A 1WLZA 2KYFA 3NSIA 2KAVA 3D75A 2WCJA 2ISDA 1DTLA 1DF0B 2I2RE 1FW4A 3OBVA 1F54A 4DRWA 3TZ1A 4GPLB 1B7TZ 2PASA 2EGDA 3SG7A 1UURA 1XFZO 3CYZA 4OCIA 3VRPA 1DMOA 3PM2A 3SIBA 1MR8A 4IL1A 3I5GC 4USLA 2JNFA 4YGCB 3EG5B 3NSOA 5CSIA 5J3XA 5PALA 4QJ4B 3L4LA 1S5GY 2GGMA 1OMRA 2ZFDA 2BCBA 4D1EA 4QJ3B 2KFHA 1NPQA 2NCPA 3F45A 2M3WA 4PCWA 3TS5C 1FF1A 2M49B 1K95A 3V2LA 2WCEA 2SCPA 4GGNA 2LM5A 2WCFA 1QIVA 4GGFC 1QJTA 4AOMA 1NP8A 2BECA 1UHHA 2L4IA 2BKHB 2M1KB 3BUWB 2JT8A 4JQ0D 1M39A 2M7NA 1UHKA 1C7WA 2H61A 4MLWA 2EC6B 1GJYA 2Q4UA 2M1UA 1AVSA 1VRKA 1V1FA 2JU0A 3LL8B 4YGDB 4GFTA 1EH2A 3DD4A 1MXEA 4AQIA 1LVCD 1SW8A 5DKRA 5I2QA 1J7RA 1WRKA 2CT9A 2KGBC 1PVBA 3VRQA 3LLEA 3DY9A 4NDBA 1J7OA 1XK4C 2CXJA 4GNKB 1CNPA 3PLFB 1OOFA 1DEKA 4I5KA 3SG4A 2KOTA 1J7QA 3SS5A 1CFFA 4PE1A 3BUXB 2LV7A 3FE9A 3L47A 2LUCA 3LK0A 1B8LA 5HYDA 4C0LA 4GGFA 2G2BA 1TUJA 2LMTA 1MWNA 4JWQA 3DF0A 4MZLA 1IQ3A 2PYQA 1DVIA 1NWDA 4F0ZB 4PE7A 3PATA 1AP4A 1A75A 2F3YA 2EC6C 1IG5A 1QXPA 2OTGC 4PDZA 1SRAA 1QWVA 2L0PA 1BT6A 1OE9B 1PRWA 1WRLA 2LCPA 1HT9A 3H4SE 3JVTB 2K2AA 1GGWA 1S26D 2Y5IA 1M46A 2LHLA 1R2UA 2CNPA 3NSLA 2GGZA 5B8IB 1J7PA 2K8MB 3GK1A 2KI6D 2OPOA 3KF9A 2KQ6A 2L2EA 1XK4A 1NX2A 1OZSA 1DJGA 1XFWO 2G9BA 2LANA 1DC1A 1ZOTB 3FE6A 1WLMA 1KSMA 2Y1NA 3R1PA 2MRDA 4MVFA 2KSPA 3I5IB 1KK7Z 3E3RA 3FIAA 2QPTA 2COLB 2KBMA 2F8PA 1PSBA 2LMUA 1SCMB 3DVMA 3ZNIA 1TCOB 2ZKMX 1TNQA 2Y1MA 4OV2A 2M7LA 3D0YA 2KI6C 1GM0A 2BKIB 4ZCVA 1YX8A 1SYMA 1KFUL 1XFUO 2ZNDA 1AHRA 1EL4A 1JF2A 1SSEB 3K1EA 3O6BA 4YBHB 1KQVA 2JOJA 1JFJA 1CTRA
chains in the Genus database with same CATH topology
3CR4X 3EK7A 2PMYA 3WNXB 1YVLA 1PVAA 1WDCC 4GAOA 3NSKA 1E8AA 2SASA 1CLBA 2AAOA 2E30A 2KAXA 1IGVA 5I2OA 2NZ0A 3FWBA 1JC2A 1J1DA 2I18A 4ORCB 2O60A 1JWDA 1G4YR 4ORBB 2MLFC 1W7JB 1TNPA 1S1EA 3IQQA 4XYNA 1KFUS 2LUXA 3A8RA 1SY9A 1KFXL 4OKHA 1XO5A 1JUOA 1CM1A 1K94A 1SL7A 4NQGA 1BMOA 1ZUZA 4XJKA 5BPJA 3BQ3A 4AQJA 3HX4A 1NX0A 5D7FA 1CKKA 1J1EA 1M63B 3SG3A 3PN7B 2LHIA 5I2LA 1OMVA 1A4PA 1DJHA 1TNXA 1BF5A 4FTGA 4UPGA 1Q80A 1TN4A 1SK6D 1NSHA 1CDLA 1TIZA 2LVVA 2QACA 1ZFSA 1BLQA 3CTNA 3DVKA 2KI4C 1DGUA 2GV5A 3BXKA 1NCXA 2WCBA 5AANA 2HPSA 2LVJA 3SG2A 4ETOA 1V1GA 2FCDA 1KK8B 1CDPA 2L50A 1NX3A 2LLTA 3RM1A 1DGVA 1K93D 2NCOA 3BOWA 2MBXA 1F8HA 2L4HA 1YVHA 1A75B 2LP2A 3EKHA 4N5XA 1B7TY 1ALVA 1LXFC 3EVRA 1EG4A 2BCXA 1UHNA 2CCMA 1QX2A 2M0RA 3CS1A 2K7OA 3PFVA 3PN7C 1KWOB 4HREE 4WQ2A 4C0JA 3MSEB 1B1GA 1XFXO 2Q91A 4MEWA 5I8NA 2LNKA 2M97A 2JULA 1ZACA 2BBMA 1SBJA 2JT0A 1LKJA 3LK1A 3LCPC 1EJ3A 2MJWB 1DT7B 2A4JA 2WNDA 4DUQA 1CMFA 3I5FB 1TRFA 3SG6A 4MSPA 3D10A 3WXAA 2M9GA 1KK8C 1D1OA 1Y1AA 1DJWA 1SKTA 1NIWA 1KQMB 3A4UB 4OVNF 3ZWHA 3EVVA 3PSRA 3EK8A 2KFFA 1XVJA 1RFJA 5HLVA 1SNLA 4ORAB 4M2QA 1K9KA 2JZIA 2L5XB 4MRYA 3KHEA 1F4QA 3CZTX 3BUOB 3TUYB 1QX5B 1AJ4A 1DJZA 2I94A 2KAYA 1RJVA 2ZNEA 2KNEA 1AJ5A 3I5FC 2KGRA 1ODBA 4C0KA 4CFQA 2FJUB 1K9UA 2JWWA 4MZJA 4PALA 1YUSA 5HKWA 1BG1A 1IJ5A 1EG3A 1UP5A 2LLUA 1CMGA 1FI5A 4M2PA 4MRXA 3EK4A 1IJ6A 2NLNA 3OB2B 4HSZA 3SIAA 1F4OA 2M8UA 1KQMC 1Y1XA 2BE6A 2KFGA 4TNCA 1KCYA 2IS9A 2MHHA 3IQOA 1K96A 2M29A 2P6BB 1SPYA 3AAKA 3O2PA 5ER4X 3WHUB 1QATA 5CSNA 1QVIZ 2BL0B 4A4BA 2HF5A 1NYAA 3TUYC 1A29A 3JVTC 5AEQA 1U5IA 4XJKB 2L98A 2BCAA 1TTXA 1SL9A 2AUCA 3HCMA 1RECA 1YUUA 3NXAA 1BJFA 1EXRA 1K9PA 2F33A 2JPTA 2LMVA 4I5LB 1KSOA 4E68A 4YI8A 3PALA 1S6JA 3TDIA 1IKUA 1HQVA 1RROA 3I5IC 4YGAA 2JXCA 2JTTA 1YTZC 1ALWA 1PULA 3SJSA 1SCMC 1RK9A 2PALA 4PE0A 5HKYA 2LVIA 2PVBA 4CLNA 1R6PA 1K8UA 2JRFA 1PSRA 4MN0A 3JTDB 2PRUA 1J55A 2CBLA 3CWGA 3BOWB 2OS8B 1CFCA 1OOJA 5CSJA 1SCVA 1NCYA 1QASA 2KYCA 1NX1A 1JF0A 1Y1UA 5DKQA 5HKZA 4DS7A 1BR4B 1IWQA 4NDDA 1B9AA 3FS7A 2F3ZA 4PHNA 3M0WA 3DVEA 1CFDA 4WQ3A 1LA0A 2AMIA 2KQYA 5G08A 1F71A 4A4CA 1PK0D 4FQOA 1JSAA 3I5GB 1CLLA 4ICBA 1W7IB 3WHTB 3BYAA 4YGBB 2MLEC 3AKBA 1YR5A 3TS5B 2CTNA 1WY9A 4ZCUA 4PHJA 3OHMB 1CM4A 1S5GZ 5JOLA 5IBWA 3AKAA 5KU1A 2JTZA 2OS8C 3GK2A 4JPZB 4CIDA 2HQWA 3CLNA 5DKNA 5HLOA 3DF0B 5KSZA 3QRXA 2HQ8A 2LAPA 2LLSA 2H61C 1KFXS 4L9MA 2JNXA 4BY4A 1YX7A 2F2OA 1DJIA 2ZN8A 1CDMA 3VRRA 3CR2A 2K2FA 1GGZA 3OX6A 1RWYA 1QTXA 1FBVA 1BOCA 4HRHA 1SL8A 2ZN9A 1MF8B 1FI6A 5K89A 2LVKA 4YI9A 4YRUA 1Y0VH 1S6CA 1QLSA 1LINA 2K61A 2V53A 4I5JA 1YRTB 1B8CA 3OB1B 1H4BA 4OR9B 1L2OB 1B47A 3BUMB 3IF7A 2WORA 4YGEB 1S36A 3AAJA 3KEVA 4CFRA 1TNWA 1AUIB 1M31A 1UWOA 3D0YB 2OTGB 3GOFA 4P2YB 2I7AA 2MAZA 3EKJA 1NUBA 1DF0A 1U5IB 3KPXA 4GBAA 1N65A 1KWOC 3CR5X 2MA2A 1QV1A 2NXQA 3VROA 4DCKA 1YUTA 1QLKA 4CPVA 3I5HB 1GQMA 4U8DA 1DJYA 4DIRA 1F55A 1N2DA 4QJ5B 5AERA 1G8IA 1OQPA 1QIWA 2D8NA 1XFVO 1S6IA 2LP3A 1CLMA 1K90D 4M2OA 1OZOA 4MZKA 1L2OC 4Q04A 3O78A 4BY5A 1OMDA 1DJXA 1JBAA 2L51A 2JQ6A 1UUSA 1CB1A 1K2HA 1M45A 1XA5A 1PALA 2K0JA 5FYXA 4GUKA 5ER5A 4HRGA 2PSRA 1L7ZA 1G33A 2RGIA 3I5HC 1H8BA 1SMGA 1UHIA 2DOQA 3O4YA 3RLZA 3C1VA 1B4CA 5TNCA 2F2PA 5CSFA 1FPWA 3TDZA 1WDCB 1UHJA 3PM8A 2B1UA 2ZRSA 5KTYA 1QS7A 1IRJA 1KK7Y 1F70A 1MHOA 1SR6B 2E6WA 2Y4QA 4PE4A 1C07A 2FCEA 1S3PA 3FWCA 2O5GA 1Y6WA 4PHKA 3VGOA 2BE4A 2K7BA 2BBNA 2TN4A 3EVUA 3VRNA 4P5OE 1QVIY 2ZRTA 1YURA 3DVJA 4I5NB 5CPVA 5AFPA 2KDHA 3OP0A 4PHMA 2R2IA 1N0YA 1BU3A 3TDUA 5GQQC 2BL0C 2K7DA 2LC5A 5F6TA 1WRZA 1JFKA 3SG5A 1IH0A 1X02A 5AXIA 1MQ1A 1NCZA 1YRUB 4MBEA 5D69A 3GK4X 1TOPA 1RTP1 4N1FA 1CFPA 2WOSA 5JJGA 1A03A 3K21A 1C7VA 1MUXA 2H2KA 1BR1B 3ICBA 4N1GA 1SR6C 1XFYO 3CGAA 4R1EA 2JT3A 3BUNB 3KO0A 1B8RA 1CDNA 1BODA 1A2XA 1XYDA 2KBIA 2EHBA 2HETA 2FOTA 1LA3A 2JC2A 3OX5A 1OSAA 1AK8A 4NDCA 1IQ5A 1QV0A 2JXLA 2KHNA 2KI4B 1ZMZA 1TCFA 2VRGA 4WRIA 1MXLC 2LE9B 2WC8A 3JTDC 2K7CA 1QX7A 1WLZA 2KYFA 3NSIA 2KAVA 2ISDA 1DTLA 1DF0B 2I2RE 1FW4A 1F54A 4DRWA 3TZ1A 4GPLB 1B7TZ 2PASA 2EGDA 3SG7A 1UURA 1XFZO 4OCIA 3VRPA 1DMOA 3SIBA 1MR8A 4IL1A 3I5GC 4USLA 2JNFA 4YGCB 3NSOA 5CSIA 5J3XA 5PALA 4QJ4B 1S5GY 2GGMA 1OMRA 2ZFDA 2BCBA 4D1EA 4QJ3B 2KFHA 1NPQA 2NCPA 3F45A 2M3WA 4PCWA 3TS5C 1FF1A 2M49B 1K95A 2WCEA 2SCPA 4GGNA 2LM5A 2WCFA 1QIVA 4GGFC 1QJTA 4AOMA 1NP8A 2BECA 1UHHA 2L4IA 2BKHB 2M1KB 3BUWB 2JT8A 4JQ0D 1M39A 2M7NA 1UHKA 1C7WA 2H61A 4MLWA 2EC6B 1GJYA 2Q4UA 2M1UA 1AVSA 1VRKA 1V1FA 2JU0A 3LL8B 4YGDB 4GFTA 1EH2A 3DD4A 1MXEA 4AQIA 1LVCD 1SW8A 5DKRA 5I2QA 1J7RA 1WRKA 2CT9A 2KGBC 1PVBA 3VRQA 3LLEA 4NDBA 1J7OA 1XK4C 2CXJA 4GNKB 1CNPA 3PLFB 4I5KA 3SG4A 2KOTA 1J7QA 1CFFA 4PE1A 3BUXB 2LV7A 2LUCA 3LK0A 1B8LA 5HYDA 4C0LA 4GGFA 2G2BA 2LMTA 1MWNA 4JWQA 3DF0A 4MZLA 1IQ3A 1DVIA 1NWDA 4F0ZB 4PE7A 3PATA 1AP4A 1A75A 2F3YA 2EC6C 1IG5A 1QXPA 2OTGC 4PDZA 1SRAA 2L0PA 1BT6A 1OE9B 1PRWA 1WRLA 2LCPA 1HT9A 3H4SE 3JVTB 2K2AA 1GGWA 1S26D 2Y5IA 1M46A 2LHLA 1R2UA 2CNPA 3NSLA 2GGZA 5B8IB 1J7PA 2K8MB 3GK1A 2KI6D 2OPOA 3KF9A 2KQ6A 2L2EA 1XK4A 1NX2A 1OZSA 1DJGA 1XFWO 2G9BA 2LANA 1ZOTB 1WLMA 1KSMA 2Y1NA 4MVFA 2MRDA 2KSPA 3I5IB 1KK7Z 3E3RA 3FIAA 2QPTA 2COLB 2KBMA 2F8PA 1PSBA 2LMUA 1SCMB 3DVMA 3ZNIA 1TCOB 2ZKMX 1TNQA 2Y1MA 4OV2A 2M7LA 3D0YA 2KI6C 2BKIB 4ZCVA 1YX8A 1SYMA 1KFUL 1XFUO 2ZNDA 1AHRA 1EL4A 1JF2A 3O6BA 4YBHB 1KQVA 2JOJA 1JFJA 1CTRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CR4 X;  3EK7 A;  2PMY A;  3WNX B;  1YVL A;  1PVA A;  1WDC C;  4GAO A;  3NSK A;  1E8A A;  2SAS A;  1CLB A;  2AAO A;  2E30 A;  2KAX A;  1IGV A;  5I2O A;  2NZ0 A;  3FWB A;  1JC2 A;  1J1D A;  2I18 A;  4ORC B;  2O60 A;  1JWD A;  1G4Y R;  4ORB B;  2MLF C;  1W7J B;  1TNP A;  1S1E A;  3IQQ A;  4XYN A;  1KFU S;  2LUX A;  3A8R A;  1SY9 A;  1KFX L;  4OKH A;  1XO5 A;  1JUO A;  1CM1 A;  1K94 A;  1SL7 A;  4NQG A;  1BMO A;  1ZUZ A;  4XJK A;  5BPJ A;  3BQ3 A;  4AQJ A;  3HX4 A;  1NX0 A;  5D7F A;  1CKK A;  1J1E A;  1M63 B;  3SG3 A;  3PN7 B;  2LHI A;  5I2L A;  1OMV A;  1A4P A;  1DJH A;  1TNX A;  1BF5 A;  4FTG A;  4UPG A;  1Q80 A;  1TN4 A;  1SK6 D;  1NSH A;  1CDL A;  1TIZ A;  2LVV A;  2QAC A;  1ZFS A;  1BLQ A;  3CTN A;  3DVK A;  2KI4 C;  1DGU A;  2GV5 A;  3BXK A;  1NCX A;  2WCB A;  5AAN A;  2HPS A;  2LVJ A;  3SG2 A;  4ETO A;  1V1G A;  2FCD A;  1KK8 B;  1CDP A;  2L50 A;  1NX3 A;  2LLT A;  3RM1 A;  1DGV A;  1K93 D;  2NCO A;  3BOW A;  2MBX A;  1F8H A;  2L4H A;  1YVH A;  1A75 B;  2LP2 A;  3EKH A;  4N5X A;  1B7T Y;  1ALV A;  1LXF C;  3EVR A;  1EG4 A;  2BCX A;  1UHN A;  2CCM A;  1QX2 A;  2M0R A;  3CS1 A;  2K7O A;  3PFV A;  3PN7 C;  1KWO B;  4HRE E;  4WQ2 A;  4C0J A;  3MSE B;  1B1G A;  1XFX O;  2Q91 A;  4MEW A;  5I8N A;  2LNK A;  2M97 A;  2JUL A;  1ZAC A;  2BBM A;  1SBJ A;  2JT0 A;  1LKJ A;  3LK1 A;  3LCP C;  1EJ3 A;  2MJW B;  1DT7 B;  2A4J A;  2WND A;  4DUQ A;  1CMF A;  3I5F B;  1TRF A;  3SG6 A;  4MSP A;  3D10 A;  3WXA A;  2M9G A;  1KK8 C;  1D1O A;  1Y1A A;  1DJW A;  1SKT A;  1NIW A;  1KQM B;  3A4U B;  4OVN F;  3ZWH A;  3EVV A;  3PSR A;  3EK8 A;  2KFF A;  1XVJ A;  1RFJ A;  5HLV A;  1SNL A;  4ORA B;  4M2Q A;  1K9K A;  2JZI A;  2L5X B;  4MRY A;  3KHE A;  1F4Q A;  3CZT X;  3BUO B;  3TUY B;  1QX5 B;  1AJ4 A;  1DJZ A;  2I94 A;  2KAY A;  1RJV A;  2ZNE A;  2KNE A;  1AJ5 A;  3I5F C;  2KGR A;  1ODB A;  4C0K A;  4CFQ A;  2FJU B;  1K9U A;  2JWW A;  4MZJ A;  4PAL A;  1YUS A;  5HKW A;  1BG1 A;  1IJ5 A;  1EG3 A;  1UP5 A;  2LLU A;  1CMG A;  1FI5 A;  4M2P A;  4MRX A;  3EK4 A;  1IJ6 A;  2NLN A;  3OB2 B;  4HSZ A;  3SIA A;  1F4O A;  2M8U A;  1KQM C;  1Y1X A;  2BE6 A;  2KFG A;  4TNC A;  1KCY A;  2IS9 A;  2MHH A;  3IQO A;  1K96 A;  2M29 A;  2P6B B;  1SPY A;  3AAK A;  3O2P A;  5ER4 X;  3WHU B;  1QAT A;  5CSN A;  1QVI Z;  2BL0 B;  4A4B A;  2HF5 A;  1NYA A;  3TUY C;  1A29 A;  3JVT C;  5AEQ A;  1U5I A;  4XJK B;  2L98 A;  2BCA A;  1TTX A;  1SL9 A;  2AUC A;  3HCM A;  1REC A;  1YUU A;  3NXA A;  1BJF A;  1EXR A;  1K9P A;  2F33 A;  2JPT A;  2LMV A;  4I5L B;  1KSO A;  4E68 A;  4YI8 A;  3PAL A;  1S6J A;  3TDI A;  1IKU A;  1HQV A;  1RRO A;  3I5I C;  4YGA A;  2JXC A;  2JTT A;  1YTZ C;  1ALW A;  1PUL A;  3SJS A;  1SCM C;  1RK9 A;  2PAL A;  4PE0 A;  5HKY A;  2LVI A;  2PVB A;  4CLN A;  1R6P A;  1K8U A;  2JRF A;  1PSR A;  4MN0 A;  3JTD B;  2PRU A;  1J55 A;  2CBL A;  3CWG A;  3BOW B;  2OS8 B;  1CFC A;  1OOJ A;  5CSJ A;  1SCV A;  1NCY A;  1QAS A;  2KYC A;  1NX1 A;  1JF0 A;  1Y1U A;  5DKQ A;  5HKZ A;  4DS7 A;  1BR4 B;  1IWQ A;  4NDD A;  1B9A A;  3FS7 A;  2F3Z A;  4PHN A;  3M0W A;  3DVE A;  1CFD A;  4WQ3 A;  1LA0 A;  2AMI A;  2KQY A;  5G08 A;  1F71 A;  4A4C A;  1PK0 D;  4FQO A;  1JSA A;  3I5G B;  1CLL A;  4ICB A;  1W7I B;  3WHT B;  3BYA A;  4YGB B;  2MLE C;  3AKB A;  1YR5 A;  3TS5 B;  2CTN A;  1WY9 A;  4ZCU A;  4PHJ A;  3OHM B;  1CM4 A;  1S5G Z;  5JOL A;  5IBW A;  3AKA A;  5KU1 A;  2JTZ A;  2OS8 C;  3GK2 A;  4JPZ B;  4CID A;  2HQW A;  3CLN A;  5DKN A;  5HLO A;  3DF0 B;  5KSZ A;  3QRX A;  2HQ8 A;  2LAP A;  2LLS A;  2H61 C;  1KFX S;  4L9M A;  2JNX A;  4BY4 A;  1YX7 A;  2F2O A;  1DJI A;  2ZN8 A;  1CDM A;  3VRR A;  3CR2 A;  2K2F A;  1GGZ A;  3OX6 A;  1RWY A;  1QTX A;  1FBV A;  1BOC A;  4HRH A;  1SL8 A;  2ZN9 A;  1MF8 B;  1FI6 A;  5K89 A;  2LVK A;  4YI9 A;  4YRU A;  1Y0V H;  1S6C A;  1QLS A;  1LIN A;  2K61 A;  2V53 A;  4I5J A;  1YRT B;  1B8C A;  3OB1 B;  1H4B A;  4OR9 B;  1L2O B;  1B47 A;  3BUM B;  3IF7 A;  2WOR A;  4YGE B;  1S36 A;  3AAJ A;  3KEV A;  4CFR A;  1TNW A;  1AUI B;  1M31 A;  1UWO A;  3D0Y B;  2OTG B;  3GOF A;  4P2Y B;  2I7A A;  2MAZ A;  3EKJ A;  1NUB A;  1DF0 A;  1U5I B;  3KPX A;  4GBA A;  1N65 A;  1KWO C;  3CR5 X;  2MA2 A;  1QV1 A;  2NXQ A;  3VRO A;  4DCK A;  1YUT A;  1QLK A;  4CPV A;  3I5H B;  1GQM A;  4U8D A;  1DJY A;  4DIR A;  1F55 A;  1N2D A;  4QJ5 B;  5AER A;  1G8I A;  1OQP A;  1QIW A;  2D8N A;  1XFV O;  1S6I A;  2LP3 A;  1CLM A;  1K90 D;  4M2O A;  1OZO A;  4MZK A;  1L2O C;  4Q04 A;  3O78 A;  4BY5 A;  1OMD A;  1DJX A;  1JBA A;  2L51 A;  2JQ6 A;  1UUS A;  1CB1 A;  1K2H A;  1M45 A;  1XA5 A;  1PAL A;  2K0J A;  5FYX A;  4GUK A;  5ER5 A;  4HRG A;  2PSR A;  1L7Z A;  1G33 A;  2RGI A;  3I5H C;  1H8B A;  1SMG A;  1UHI A;  2DOQ A;  3O4Y A;  3RLZ A;  3C1V A;  1B4C A;  5TNC A;  2F2P A;  5CSF A;  1FPW A;  3TDZ A;  1WDC B;  1UHJ A;  3PM8 A;  2B1U A;  2ZRS A;  5KTY A;  1QS7 A;  1IRJ A;  1KK7 Y;  1F70 A;  1MHO A;  1SR6 B;  2E6W A;  2Y4Q A;  4PE4 A;  1C07 A;  2FCE A;  1S3P A;  3FWC A;  2O5G A;  1Y6W A;  4PHK A;  3VGO A;  2BE4 A;  2K7B A;  2BBN A;  2TN4 A;  3EVU A;  3VRN A;  4P5O E;  1QVI Y;  2ZRT A;  1YUR A;  3DVJ A;  4I5N B;  5CPV A;  5AFP A;  2KDH A;  3OP0 A;  4PHM A;  2R2I A;  1N0Y A;  1BU3 A;  3TDU A;  5GQQ C;  2BL0 C;  2K7D A;  2LC5 A;  5F6T A;  1WRZ A;  1JFK A;  3SG5 A;  1IH0 A;  1X02 A;  5AXI A;  1MQ1 A;  1NCZ A;  1YRU B;  4MBE A;  5D69 A;  3GK4 X;  1TOP A;  1RTP 1;  4N1F A;  1CFP A;  2WOS A;  5JJG A;  1A03 A;  3K21 A;  1C7V A;  1MUX A;  2H2K A;  1BR1 B;  3ICB A;  4N1G A;  1SR6 C;  1XFY O;  3CGA A;  4R1E A;  2JT3 A;  3BUN B;  3KO0 A;  1B8R A;  1CDN A;  1BOD A;  1A2X A;  1XYD A;  2KBI A;  2EHB A;  2HET A;  2FOT A;  1LA3 A;  2JC2 A;  3OX5 A;  1OSA A;  1AK8 A;  4NDC A;  1IQ5 A;  1QV0 A;  2JXL A;  2KHN A;  2KI4 B;  1ZMZ A;  1TCF A;  2VRG A;  4WRI A;  1MXL C;  2LE9 B;  2WC8 A;  3JTD C;  2K7C A;  1QX7 A;  1WLZ A;  2KYF A;  3NSI A;  2KAV A;  2ISD A;  1DTL A;  1DF0 B;  2I2R E;  1FW4 A;  1F54 A;  4DRW A;  3TZ1 A;  4GPL B;  1B7T Z;  2PAS A;  2EGD A;  3SG7 A;  1UUR A;  1XFZ O;  4OCI A;  3VRP A;  1DMO A;  3SIB A;  1MR8 A;  4IL1 A;  3I5G C;  4USL A;  2JNF A;  4YGC B;  3NSO A;  5CSI A;  5J3X A;  5PAL A;  4QJ4 B;  1S5G Y;  2GGM A;  1OMR A;  2ZFD A;  2BCB A;  4D1E A;  4QJ3 B;  2KFH A;  1NPQ A;  2NCP A;  3F45 A;  2M3W A;  4PCW A;  3TS5 C;  1FF1 A;  2M49 B;  1K95 A;  2WCE A;  2SCP A;  4GGN A;  2LM5 A;  2WCF A;  1QIV A;  4GGF C;  1QJT A;  4AOM A;  1NP8 A;  2BEC A;  1UHH A;  2L4I A;  2BKH B;  2M1K B;  3BUW B;  2JT8 A;  4JQ0 D;  1M39 A;  2M7N A;  1UHK A;  1C7W A;  2H61 A;  4MLW A;  2EC6 B;  1GJY A;  2Q4U A;  2M1U A;  1AVS A;  1VRK A;  1V1F A;  2JU0 A;  3LL8 B;  4YGD B;  4GFT A;  1EH2 A;  3DD4 A;  1MXE A;  4AQI A;  1LVC D;  1SW8 A;  5DKR A;  5I2Q A;  1J7R A;  1WRK A;  2CT9 A;  2KGB C;  1PVB A;  3VRQ A;  3LLE A;  4NDB A;  1J7O A;  1XK4 C;  2CXJ A;  4GNK B;  1CNP A;  3PLF B;  4I5K A;  3SG4 A;  2KOT A;  1J7Q A;  1CFF A;  4PE1 A;  3BUX B;  2LV7 A;  2LUC A;  3LK0 A;  1B8L A;  5HYD A;  4C0L A;  4GGF A;  2G2B A;  2LMT A;  1MWN A;  4JWQ A;  3DF0 A;  4MZL A;  1IQ3 A;  1DVI A;  1NWD A;  4F0Z B;  4PE7 A;  3PAT A;  1AP4 A;  1A75 A;  2F3Y A;  2EC6 C;  1IG5 A;  1QXP A;  2OTG C;  4PDZ A;  1SRA A;  2L0P A;  1BT6 A;  1OE9 B;  1PRW A;  1WRL A;  2LCP A;  1HT9 A;  3H4S E;  3JVT B;  2K2A A;  1GGW A;  1S26 D;  2Y5I A;  1M46 A;  2LHL A;  1R2U A;  2CNP A;  3NSL A;  2GGZ A;  5B8I B;  1J7P A;  2K8M B;  3GK1 A;  2KI6 D;  2OPO A;  3KF9 A;  2KQ6 A;  2L2E A;  1XK4 A;  1NX2 A;  1OZS A;  1DJG A;  1XFW O;  2G9B A;  2LAN A;  1ZOT B;  1WLM A;  1KSM A;  2Y1N A;  4MVF A;  2MRD A;  2KSP A;  3I5I B;  1KK7 Z;  3E3R A;  3FIA A;  2QPT A;  2COL B;  2KBM A;  2F8P A;  1PSB A;  2LMU A;  1SCM B;  3DVM A;  3ZNI A;  1TCO B;  2ZKM X;  1TNQ A;  2Y1M A;  4OV2 A;  2M7L A;  3D0Y A;  2KI6 C;  2BKI B;  4ZCV A;  1YX8 A;  1SYM A;  1KFU L;  1XFU O;  2ZND A;  1AHR A;  1EL4 A;  1JF2 A;  3O6B A;  4YBH B;  1KQV A;  2JOJ A;  1JFJ A;  1CTR A; 
#chains in the Genus database with same CATH topology
 3CR4 X;  3EK7 A;  2PMY A;  3WNX B;  1YVL A;  1PVA A;  1WDC C;  2KLE A;  4GAO A;  1OOH A;  5DIC A;  3NSK A;  1E8A A;  2SAS A;  1CLB A;  2AAO A;  3DYE A;  2E30 A;  2KAX A;  4JKT A;  1IGV A;  1OW4 A;  5I2O A;  2NZ0 A;  3FWB A;  1JC2 A;  1J1D A;  4F7F A;  2I18 A;  4ORC B;  2O60 A;  1JWD A;  1G4Y R;  4ORB B;  2MLF C;  1W7J B;  1TNP A;  1S1E A;  3IQQ A;  4XYN A;  1KFU S;  2LUX A;  3A8R A;  1SY9 A;  1KFX L;  4OKH A;  1XO5 A;  1JUO A;  1CM1 A;  1K94 A;  1SL7 A;  3BFA A;  4NQG A;  1BMO A;  1ZUZ A;  2KLD A;  4XJK A;  5BPJ A;  3BQ3 A;  4AQJ A;  3HX4 A;  1NX0 A;  5D7F A;  1CKK A;  1J1E A;  1M63 B;  3R1V A;  3PN7 B;  3SG3 A;  3UNW A;  1TUZ A;  2LHI A;  2QDI A;  4FQT A;  5I2L A;  1OMV A;  1A4P A;  1DJH A;  1TNX A;  1BF5 A;  4FTG A;  4UPG A;  1Q80 A;  1TN4 A;  1SK6 D;  1NSH A;  1CDL A;  1TIZ A;  2LVV A;  2QAC A;  1ZFS A;  1BLQ A;  3CTN A;  3DVK A;  2KI4 C;  1DGU A;  2GV5 A;  3BXK A;  1NCX A;  2WCB A;  5AAN A;  2HPS A;  2LVJ A;  3SG2 A;  4ETO A;  1V1G A;  2FCD A;  1KK8 B;  1CDP A;  2L50 A;  1NX3 A;  2LLT A;  3D74 A;  3RM1 A;  1DGV A;  1K93 D;  2NCO A;  3BOW A;  2MBX A;  3BJH A;  1F8H A;  2L4H A;  1YVH A;  1A75 B;  2LP2 A;  3EKH A;  4N5X A;  2QEV A;  5FI6 A;  3SS3 A;  1B7T Y;  1ALV A;  1LXF C;  3EVR A;  1EG4 A;  2BCX A;  1UHN A;  2CCM A;  1QX2 A;  2M0R A;  3CS1 A;  2K7O A;  3PFV A;  3PN7 C;  1KWO B;  4HRE E;  4WQ2 A;  4C0J A;  3MSE B;  1B1G A;  1XFX O;  2Q91 A;  4MEW A;  5I8N A;  2LNK A;  2M97 A;  2JUL A;  1XFR A;  1ZAC A;  2BBM A;  1SBJ A;  2JT0 A;  1LKJ A;  3LK1 A;  3LCP C;  1EJ3 A;  3D76 A;  2MJW B;  1DT7 B;  2A4J A;  2WND A;  4DUQ A;  1CMF A;  3I5F B;  1TRF A;  3S0A A;  3SG6 A;  3NHI A;  3S0F A;  4MSP A;  2L5Y A;  3D10 A;  3WXA A;  2M9G A;  1KK8 C;  1TWO A;  1D1O A;  1Y1A A;  1DJW A;  1SKT A;  1NIW A;  1KQM B;  3A4U B;  3FE8 A;  4OVN F;  3ZWH A;  1IIO A;  3EVV A;  3PSR A;  5I94 A;  3CZ1 A;  3EK8 A;  1LS8 A;  2KFF A;  1XVJ A;  1RFJ A;  3R72 A;  1SNL A;  1Z2C B;  3CAB A;  5HLV A;  4ORA B;  4M2Q A;  1K9K A;  2JZI A;  2L5X B;  4MRY A;  3KHE A;  3B6X A;  1F4Q A;  3CZT X;  3BUO B;  3TUY B;  1QX5 B;  3RZS A;  1AJ4 A;  1DJZ A;  2I94 A;  2KAY A;  1RJV A;  2ZNE A;  2KNE A;  1AJ5 A;  3I5F C;  2KGR A;  1ODB A;  4C0K A;  4CFQ A;  2FJU B;  1K9U A;  2JWW A;  1T14 A;  4MZJ A;  1YUS A;  4PAL A;  5HKW A;  1BG1 A;  1IJ5 A;  1EG3 A;  1UP5 A;  2LLU A;  1CMG A;  5HL1 A;  1FI5 A;  2WCK A;  4M2P A;  3EK4 A;  1IJ6 A;  2QEH A;  2NLN A;  3OB2 B;  4MRX A;  4HSZ A;  3SIA A;  1F4O A;  2M8U A;  1KQM C;  1Y1X A;  2BE6 A;  2KFG A;  4TNC A;  1KCY A;  2IS9 A;  2MHH A;  3IQO A;  1K96 A;  2M29 A;  2P6B B;  2H8V A;  1SPY A;  3AAK A;  3O2P A;  5ER4 X;  3WHU B;  1QAT A;  5CSN A;  1QVI Z;  2BL0 B;  2K60 A;  4A4B A;  2HF5 A;  1NYA A;  3TUY C;  5D3O A;  1A29 A;  3JVT C;  5AEQ A;  1U5I A;  4XJK B;  2L98 A;  2BCA A;  4OZD A;  1TTX A;  1SL9 A;  2AUC A;  3HCM A;  1REC A;  1YUU A;  3NXA A;  3NHT A;  1BJF A;  1EXR A;  1K9P A;  2F33 A;  2JPT A;  2LMV A;  4I5L B;  2WC5 A;  1KSO A;  4E68 A;  4YI8 A;  3PAL A;  1S6J A;  3TDI A;  1IKU A;  1HQV A;  1RRO A;  2WCH A;  3I5I C;  3R1O A;  4YGA A;  2JXC A;  2JTT A;  1YTZ C;  3NGV A;  1ALW A;  1DEL A;  1PUL A;  3SJS A;  4INW A;  1SCM C;  1RK9 A;  2PAL A;  4PE0 A;  3CDN A;  2GTE A;  5HKY A;  2LVI A;  2PVB A;  4CLN A;  1R6P A;  1K8U A;  2JRF A;  1PSR A;  2P70 A;  4MN0 A;  2WCM A;  3JTD B;  2PRU A;  1J55 A;  2CBL A;  3CWG A;  3BOW B;  2OS8 B;  1CFC A;  1OOJ A;  5CSJ A;  1SCV A;  1NCY A;  1QAS A;  2KYC A;  1NX1 A;  1JF0 A;  1P28 A;  1Y1U A;  5DKQ A;  5HKZ A;  3S0B A;  4DS7 A;  1C3Z A;  1BR4 B;  1IWQ A;  4NDD A;  1B9A A;  3FS7 A;  2F3Z A;  4PHN A;  3M0W A;  4KYN A;  3DVE A;  1CFD A;  4WQ3 A;  1LA0 A;  3B88 A;  1DQE A;  2AMI A;  2KQY A;  5G08 A;  1F71 A;  4A4C A;  1PK0 D;  4FQO A;  1JSA A;  3I5G B;  1CLL A;  4ICB A;  1W7I B;  2BAP A;  2QEB A;  3WHT B;  3BYA A;  4YGB B;  2MLE C;  3AKB A;  1YR5 A;  3TS5 B;  3BFB A;  2CTN A;  1WY9 A;  4ZCU A;  4PHJ A;  3OHM B;  1CM4 A;  1S5G Z;  5JOL A;  5IBW A;  3AKA A;  5KU1 A;  2JTZ A;  2OS8 C;  3GK2 A;  4JPZ B;  4CID A;  2HQW A;  3CLN A;  5DKN A;  2PQL A;  5HLO A;  3DF0 B;  5KSZ A;  3QRX A;  2HQ8 A;  3Q8I A;  2LAP A;  2LLS A;  3IVT A;  2H61 C;  1KFX S;  4L9M A;  2JNX A;  5FI7 A;  4BY4 A;  1YX7 A;  2F2O A;  1DJI A;  2ZN8 A;  1CDM A;  3VRR A;  3CR2 A;  2K2F A;  1GGZ A;  2QEO A;  3OX6 A;  4IJ7 A;  2WC6 A;  1RWY A;  1ORG A;  1QTX A;  1FBV A;  3DZT A;  1BOC A;  3S0D A;  4HRH A;  5FI2 A;  1SL8 A;  2ZN9 A;  1MF8 B;  1FI6 A;  3S0G A;  5K89 A;  2LVK A;  2KPH A;  4YI9 A;  1Y0V H;  3S0E A;  1S6C A;  1QLS A;  4YRU A;  1LIN A;  2K61 A;  2YGU A;  2V53 A;  4I5J A;  2ERB A;  1YRT B;  1B8C A;  3OB1 B;  3SS4 A;  1H4B A;  4OR9 B;  1L2O B;  3D73 A;  1B47 A;  3BUM B;  3IF7 A;  2WOR A;  4YGE B;  1S36 A;  3AAJ A;  3KEV A;  4CFR A;  1TNW A;  1AUI B;  1M31 A;  1UWO A;  3D0Y B;  2OTG B;  3GOF A;  4P2Y B;  2I7A A;  2MAZ A;  3EKJ A;  1NUB A;  1DF0 A;  1U5I B;  1W9Z A;  3KPX A;  4GBA A;  1N65 A;  4PT1 A;  1KWO C;  4JD9 A;  3CR5 X;  2MA2 A;  1QV1 A;  2NXQ A;  3VRO A;  4DCK A;  1YUT A;  1QLK A;  4CPV A;  3I5H B;  1GQM A;  4U8D A;  1DJY A;  4DIR A;  1F55 A;  1N2D A;  4QJ5 B;  3PJI A;  5AER A;  1G8I A;  1OQP A;  1QIW A;  2D8N A;  1XFV O;  3CZ0 A;  1S6I A;  3B7A A;  5EL2 A;  2LP3 A;  1CLM A;  1C3Y A;  1K90 D;  3OGN A;  4M2O A;  1OZO A;  4MZK A;  1L2O C;  4Q04 A;  3O78 A;  4BY5 A;  1OMD A;  3O4X A;  3VB1 A;  1DJX A;  1OOG A;  1JBA A;  2L51 A;  2JQ6 A;  1UUS A;  3BFH A;  1CB1 A;  1K2H A;  1M45 A;  1XA5 A;  1PAL A;  2K0J A;  3D77 A;  5FYX A;  4GUK A;  5ER5 A;  4HRG A;  2PSR A;  1L7Z A;  1G33 A;  2RGI A;  3I5H C;  1H8B A;  1SMG A;  1UHI A;  2DOQ A;  3O4Y A;  3RLZ A;  3C1V A;  1B4C A;  5TNC A;  2F2P A;  5CSF A;  1FPW A;  3TDZ A;  1WDC B;  1UHJ A;  3PM8 A;  2B1U A;  2ZRS A;  5KTY A;  3QME A;  1QS7 A;  1IRJ A;  1KK7 Y;  1F70 A;  1MHO A;  1SR6 B;  2E6W A;  2Y4Q A;  4PE4 A;  1C07 A;  3DXL A;  2FCE A;  1S3P A;  3FWC A;  2O5G A;  1Y6W A;  4INX A;  4PHK A;  3VGO A;  2BE4 A;  2K7B A;  2BBN A;  2TN4 A;  3EVU A;  3VRN A;  4P5O E;  1QVI Y;  2ZRT A;  1YUR A;  3DVJ A;  4I5N B;  5CPV A;  5AFP A;  2KDH A;  1Z4H A;  2L2C A;  2R2I A;  1N0Y A;  3OP0 A;  4PHM A;  1BU3 A;  2P71 A;  3TDU A;  5GQQ C;  2BL0 C;  2K7D A;  2LC5 A;  5F6T A;  1WRZ A;  1JFK A;  3SG5 A;  1IH0 A;  1X02 A;  5AXI A;  3N7H A;  1MQ1 A;  1NCZ A;  1YRU B;  4MBE A;  5D69 A;  3GK4 X;  1TOP A;  1RTP 1;  4N1F A;  1CFP A;  2WOS A;  1OOI X;  5JJG A;  1A03 A;  3K21 A;  1C7V A;  1MUX A;  2H2K A;  1BR1 B;  2BNX A;  3ICB A;  1SR6 C;  1XFY O;  3CGA A;  3B86 A;  3D78 A;  4N1G A;  4R1E A;  2JPO A;  2JT3 A;  3BUN B;  3KO0 A;  1B8R A;  1CDN A;  1BOD A;  1A2X A;  1XYD A;  2KBI A;  2FJY A;  2EHB A;  2HET A;  2WCL A;  2FOT A;  1LA3 A;  2JC2 A;  3OX5 A;  3CZ2 A;  1OSA A;  1AK8 A;  4NDC A;  1IQ5 A;  1QV0 A;  2JXL A;  2KHN A;  2KI4 B;  1ZMZ A;  1TCF A;  2VRG A;  4WRI A;  1MXL C;  3B87 A;  3L4A A;  2LE9 B;  2WC8 A;  3UO9 A;  3JTD C;  2K7C A;  1QX7 A;  1WLZ A;  2KYF A;  3NSI A;  2KAV A;  3D75 A;  2WCJ A;  2ISD A;  1DTL A;  1DF0 B;  2I2R E;  1FW4 A;  3OBV A;  1F54 A;  4DRW A;  3TZ1 A;  4GPL B;  1B7T Z;  2PAS A;  2EGD A;  3SG7 A;  1UUR A;  1XFZ O;  3CYZ A;  4OCI A;  3VRP A;  1DMO A;  3PM2 A;  3SIB A;  1MR8 A;  4IL1 A;  3I5G C;  4USL A;  2JNF A;  4YGC B;  3EG5 B;  3NSO A;  5CSI A;  5J3X A;  5PAL A;  4QJ4 B;  3L4L A;  1S5G Y;  2GGM A;  1OMR A;  2ZFD A;  2BCB A;  4D1E A;  4QJ3 B;  2KFH A;  1NPQ A;  2NCP A;  3F45 A;  2M3W A;  4PCW A;  3TS5 C;  1FF1 A;  2M49 B;  1K95 A;  3V2L A;  2WCE A;  2SCP A;  4GGN A;  2LM5 A;  2WCF A;  1QIV A;  4GGF C;  1QJT A;  4AOM A;  1NP8 A;  2BEC A;  1UHH A;  2L4I A;  2BKH B;  2M1K B;  3BUW B;  2JT8 A;  4JQ0 D;  1M39 A;  2M7N A;  1UHK A;  1C7W A;  2H61 A;  4MLW A;  2EC6 B;  1GJY A;  2Q4U A;  2M1U A;  1AVS A;  1VRK A;  1V1F A;  2JU0 A;  3LL8 B;  4YGD B;  4GFT A;  1EH2 A;  3DD4 A;  1MXE A;  4AQI A;  1LVC D;  1SW8 A;  5DKR A;  5I2Q A;  1J7R A;  1WRK A;  2CT9 A;  2KGB C;  1PVB A;  3VRQ A;  3LLE A;  3DY9 A;  4NDB A;  1J7O A;  1XK4 C;  2CXJ A;  4GNK B;  1CNP A;  3PLF B;  1OOF A;  1DEK A;  4I5K A;  3SG4 A;  2KOT A;  1J7Q A;  3SS5 A;  1CFF A;  4PE1 A;  3BUX B;  2LV7 A;  3FE9 A;  3L47 A;  2LUC A;  3LK0 A;  1B8L A;  5HYD A;  4C0L A;  4GGF A;  2G2B A;  1TUJ A;  2LMT A;  1MWN A;  4JWQ A;  3DF0 A;  4MZL A;  1IQ3 A;  2PYQ A;  1DVI A;  1NWD A;  4F0Z B;  4PE7 A;  3PAT A;  1AP4 A;  1A75 A;  2F3Y A;  2EC6 C;  1IG5 A;  1QXP A;  2OTG C;  4PDZ A;  1SRA A;  1QWV A;  2L0P A;  1BT6 A;  1OE9 B;  1PRW A;  1WRL A;  2LCP A;  1HT9 A;  3H4S E;  3JVT B;  2K2A A;  1GGW A;  1S26 D;  2Y5I A;  1M46 A;  2LHL A;  1R2U A;  2CNP A;  3NSL A;  2GGZ A;  5B8I B;  1J7P A;  2K8M B;  3GK1 A;  2KI6 D;  2OPO A;  3KF9 A;  2KQ6 A;  2L2E A;  1XK4 A;  1NX2 A;  1OZS A;  1DJG A;  1XFW O;  2G9B A;  2LAN A;  1DC1 A;  1ZOT B;  3FE6 A;  1WLM A;  1KSM A;  2Y1N A;  3R1P A;  2MRD A;  4MVF A;  2KSP A;  3I5I B;  1KK7 Z;  3E3R A;  3FIA A;  2QPT A;  2COL B;  2KBM A;  2F8P A;  1PSB A;  2LMU A;  1SCM B;  3DVM A;  3ZNI A;  1TCO B;  2ZKM X;  1TNQ A;  2Y1M A;  4OV2 A;  2M7L A;  3D0Y A;  2KI6 C;  1GM0 A;  2BKI B;  4ZCV A;  1YX8 A;  1SYM A;  1KFU L;  1XFU O;  2ZND A;  1AHR A;  1EL4 A;  1JF2 A;  1SSE B;  3K1E A;  3O6B A;  4YBH B;  1KQV A;  2JOJ A;  1JFJ A;  1CTR A; 
#chains in the Genus database with same CATH homology
 3CR4 X;  3EK7 A;  2PMY A;  3WNX B;  1YVL A;  1PVA A;  1WDC C;  4GAO A;  3NSK A;  1E8A A;  2SAS A;  1CLB A;  2AAO A;  2E30 A;  2KAX A;  1IGV A;  5I2O A;  2NZ0 A;  3FWB A;  1JC2 A;  1J1D A;  2I18 A;  4ORC B;  2O60 A;  1JWD A;  1G4Y R;  4ORB B;  2MLF C;  1W7J B;  1TNP A;  1S1E A;  3IQQ A;  4XYN A;  1KFU S;  2LUX A;  3A8R A;  1SY9 A;  1KFX L;  4OKH A;  1XO5 A;  1JUO A;  1CM1 A;  1K94 A;  1SL7 A;  4NQG A;  1BMO A;  1ZUZ A;  4XJK A;  5BPJ A;  3BQ3 A;  4AQJ A;  3HX4 A;  1NX0 A;  5D7F A;  1CKK A;  1J1E A;  1M63 B;  3SG3 A;  3PN7 B;  2LHI A;  5I2L A;  1OMV A;  1A4P A;  1DJH A;  1TNX A;  1BF5 A;  4FTG A;  4UPG A;  1Q80 A;  1TN4 A;  1SK6 D;  1NSH A;  1CDL A;  1TIZ A;  2LVV A;  2QAC A;  1ZFS A;  1BLQ A;  3CTN A;  3DVK A;  2KI4 C;  1DGU A;  2GV5 A;  3BXK A;  1NCX A;  2WCB A;  5AAN A;  2HPS A;  2LVJ A;  3SG2 A;  4ETO A;  1V1G A;  2FCD A;  1KK8 B;  1CDP A;  2L50 A;  1NX3 A;  2LLT A;  3RM1 A;  1DGV A;  1K93 D;  2NCO A;  3BOW A;  2MBX A;  1F8H A;  2L4H A;  1YVH A;  1A75 B;  2LP2 A;  3EKH A;  4N5X A;  1B7T Y;  1ALV A;  1LXF C;  3EVR A;  1EG4 A;  2BCX A;  1UHN A;  2CCM A;  1QX2 A;  2M0R A;  3CS1 A;  2K7O A;  3PFV A;  3PN7 C;  1KWO B;  4HRE E;  4WQ2 A;  4C0J A;  3MSE B;  1B1G A;  1XFX O;  2Q91 A;  4MEW A;  5I8N A;  2LNK A;  2M97 A;  2JUL A;  1ZAC A;  2BBM A;  1SBJ A;  2JT0 A;  1LKJ A;  3LK1 A;  3LCP C;  1EJ3 A;  2MJW B;  1DT7 B;  2A4J A;  2WND A;  4DUQ A;  1CMF A;  3I5F B;  1TRF A;  3SG6 A;  4MSP A;  3D10 A;  3WXA A;  2M9G A;  1KK8 C;  1D1O A;  1Y1A A;  1DJW A;  1SKT A;  1NIW A;  1KQM B;  3A4U B;  4OVN F;  3ZWH A;  3EVV A;  3PSR A;  3EK8 A;  2KFF A;  1XVJ A;  1RFJ A;  5HLV A;  1SNL A;  4ORA B;  4M2Q A;  1K9K A;  2JZI A;  2L5X B;  4MRY A;  3KHE A;  1F4Q A;  3CZT X;  3BUO B;  3TUY B;  1QX5 B;  1AJ4 A;  1DJZ A;  2I94 A;  2KAY A;  1RJV A;  2ZNE A;  2KNE A;  1AJ5 A;  3I5F C;  2KGR A;  1ODB A;  4C0K A;  4CFQ A;  2FJU B;  1K9U A;  2JWW A;  4MZJ A;  4PAL A;  1YUS A;  5HKW A;  1BG1 A;  1IJ5 A;  1EG3 A;  1UP5 A;  2LLU A;  1CMG A;  1FI5 A;  4M2P A;  4MRX A;  3EK4 A;  1IJ6 A;  2NLN A;  3OB2 B;  4HSZ A;  3SIA A;  1F4O A;  2M8U A;  1KQM C;  1Y1X A;  2BE6 A;  2KFG A;  4TNC A;  1KCY A;  2IS9 A;  2MHH A;  3IQO A;  1K96 A;  2M29 A;  2P6B B;  1SPY A;  3AAK A;  3O2P A;  5ER4 X;  3WHU B;  1QAT A;  5CSN A;  1QVI Z;  2BL0 B;  4A4B A;  2HF5 A;  1NYA A;  3TUY C;  1A29 A;  3JVT C;  5AEQ A;  1U5I A;  4XJK B;  2L98 A;  2BCA A;  1TTX A;  1SL9 A;  2AUC A;  3HCM A;  1REC A;  1YUU A;  3NXA A;  1BJF A;  1EXR A;  1K9P A;  2F33 A;  2JPT A;  2LMV A;  4I5L B;  1KSO A;  4E68 A;  4YI8 A;  3PAL A;  1S6J A;  3TDI A;  1IKU A;  1HQV A;  1RRO A;  3I5I C;  4YGA A;  2JXC A;  2JTT A;  1YTZ C;  1ALW A;  1PUL A;  3SJS A;  1SCM C;  1RK9 A;  2PAL A;  4PE0 A;  5HKY A;  2LVI A;  2PVB A;  4CLN A;  1R6P A;  1K8U A;  2JRF A;  1PSR A;  4MN0 A;  3JTD B;  2PRU A;  1J55 A;  2CBL A;  3CWG A;  3BOW B;  2OS8 B;  1CFC A;  1OOJ A;  5CSJ A;  1SCV A;  1NCY A;  1QAS A;  2KYC A;  1NX1 A;  1JF0 A;  1Y1U A;  5DKQ A;  5HKZ A;  4DS7 A;  1BR4 B;  1IWQ A;  4NDD A;  1B9A A;  3FS7 A;  2F3Z A;  4PHN A;  3M0W A;  3DVE A;  1CFD A;  4WQ3 A;  1LA0 A;  2AMI A;  2KQY A;  5G08 A;  1F71 A;  4A4C A;  1PK0 D;  4FQO A;  1JSA A;  3I5G B;  1CLL A;  4ICB A;  1W7I B;  3WHT B;  3BYA A;  4YGB B;  2MLE C;  3AKB A;  1YR5 A;  3TS5 B;  2CTN A;  1WY9 A;  4ZCU A;  4PHJ A;  3OHM B;  1CM4 A;  1S5G Z;  5JOL A;  5IBW A;  3AKA A;  5KU1 A;  2JTZ A;  2OS8 C;  3GK2 A;  4JPZ B;  4CID A;  2HQW A;  3CLN A;  5DKN A;  5HLO A;  3DF0 B;  5KSZ A;  3QRX A;  2HQ8 A;  2LAP A;  2LLS A;  2H61 C;  1KFX S;  4L9M A;  2JNX A;  4BY4 A;  1YX7 A;  2F2O A;  1DJI A;  2ZN8 A;  1CDM A;  3VRR A;  3CR2 A;  2K2F A;  1GGZ A;  3OX6 A;  1RWY A;  1QTX A;  1FBV A;  1BOC A;  4HRH A;  1SL8 A;  2ZN9 A;  1MF8 B;  1FI6 A;  5K89 A;  2LVK A;  4YI9 A;  4YRU A;  1Y0V H;  1S6C A;  1QLS A;  1LIN A;  2K61 A;  2V53 A;  4I5J A;  1YRT B;  1B8C A;  3OB1 B;  1H4B A;  4OR9 B;  1L2O B;  1B47 A;  3BUM B;  3IF7 A;  2WOR A;  4YGE B;  1S36 A;  3AAJ A;  3KEV A;  4CFR A;  1TNW A;  1AUI B;  1M31 A;  1UWO A;  3D0Y B;  2OTG B;  3GOF A;  4P2Y B;  2I7A A;  2MAZ A;  3EKJ A;  1NUB A;  1DF0 A;  1U5I B;  3KPX A;  4GBA A;  1N65 A;  1KWO C;  3CR5 X;  2MA2 A;  1QV1 A;  2NXQ A;  3VRO A;  4DCK A;  1YUT A;  1QLK A;  4CPV A;  3I5H B;  1GQM A;  4U8D A;  1DJY A;  4DIR A;  1F55 A;  1N2D A;  4QJ5 B;  5AER A;  1G8I A;  1OQP A;  1QIW A;  2D8N A;  1XFV O;  1S6I A;  2LP3 A;  1CLM A;  1K90 D;  4M2O A;  1OZO A;  4MZK A;  1L2O C;  4Q04 A;  3O78 A;  4BY5 A;  1OMD A;  1DJX A;  1JBA A;  2L51 A;  2JQ6 A;  1UUS A;  1CB1 A;  1K2H A;  1M45 A;  1XA5 A;  1PAL A;  2K0J A;  5FYX A;  4GUK A;  5ER5 A;  4HRG A;  2PSR A;  1L7Z A;  1G33 A;  2RGI A;  3I5H C;  1H8B A;  1SMG A;  1UHI A;  2DOQ A;  3O4Y A;  3RLZ A;  3C1V A;  1B4C A;  5TNC A;  2F2P A;  5CSF A;  1FPW A;  3TDZ A;  1WDC B;  1UHJ A;  3PM8 A;  2B1U A;  2ZRS A;  5KTY A;  1QS7 A;  1IRJ A;  1KK7 Y;  1F70 A;  1MHO A;  1SR6 B;  2E6W A;  2Y4Q A;  4PE4 A;  1C07 A;  2FCE A;  1S3P A;  3FWC A;  2O5G A;  1Y6W A;  4PHK A;  3VGO A;  2BE4 A;  2K7B A;  2BBN A;  2TN4 A;  3EVU A;  3VRN A;  4P5O E;  1QVI Y;  2ZRT A;  1YUR A;  3DVJ A;  4I5N B;  5CPV A;  5AFP A;  2KDH A;  3OP0 A;  4PHM A;  2R2I A;  1N0Y A;  1BU3 A;  3TDU A;  5GQQ C;  2BL0 C;  2K7D A;  2LC5 A;  5F6T A;  1WRZ A;  1JFK A;  3SG5 A;  1IH0 A;  1X02 A;  5AXI A;  1MQ1 A;  1NCZ A;  1YRU B;  4MBE A;  5D69 A;  3GK4 X;  1TOP A;  1RTP 1;  4N1F A;  1CFP A;  2WOS A;  5JJG A;  1A03 A;  3K21 A;  1C7V A;  1MUX A;  2H2K A;  1BR1 B;  3ICB A;  4N1G A;  1SR6 C;  1XFY O;  3CGA A;  4R1E A;  2JT3 A;  3BUN B;  3KO0 A;  1B8R A;  1CDN A;  1BOD A;  1A2X A;  1XYD A;  2KBI A;  2EHB A;  2HET A;  2FOT A;  1LA3 A;  2JC2 A;  3OX5 A;  1OSA A;  1AK8 A;  4NDC A;  1IQ5 A;  1QV0 A;  2JXL A;  2KHN A;  2KI4 B;  1ZMZ A;  1TCF A;  2VRG A;  4WRI A;  1MXL C;  2LE9 B;  2WC8 A;  3JTD C;  2K7C A;  1QX7 A;  1WLZ A;  2KYF A;  3NSI A;  2KAV A;  2ISD A;  1DTL A;  1DF0 B;  2I2R E;  1FW4 A;  1F54 A;  4DRW A;  3TZ1 A;  4GPL B;  1B7T Z;  2PAS A;  2EGD A;  3SG7 A;  1UUR A;  1XFZ O;  4OCI A;  3VRP A;  1DMO A;  3SIB A;  1MR8 A;  4IL1 A;  3I5G C;  4USL A;  2JNF A;  4YGC B;  3NSO A;  5CSI A;  5J3X A;  5PAL A;  4QJ4 B;  1S5G Y;  2GGM A;  1OMR A;  2ZFD A;  2BCB A;  4D1E A;  4QJ3 B;  2KFH A;  1NPQ A;  2NCP A;  3F45 A;  2M3W A;  4PCW A;  3TS5 C;  1FF1 A;  2M49 B;  1K95 A;  2WCE A;  2SCP A;  4GGN A;  2LM5 A;  2WCF A;  1QIV A;  4GGF C;  1QJT A;  4AOM A;  1NP8 A;  2BEC A;  1UHH A;  2L4I A;  2BKH B;  2M1K B;  3BUW B;  2JT8 A;  4JQ0 D;  1M39 A;  2M7N A;  1UHK A;  1C7W A;  2H61 A;  4MLW A;  2EC6 B;  1GJY A;  2Q4U A;  2M1U A;  1AVS A;  1VRK A;  1V1F A;  2JU0 A;  3LL8 B;  4YGD B;  4GFT A;  1EH2 A;  3DD4 A;  1MXE A;  4AQI A;  1LVC D;  1SW8 A;  5DKR A;  5I2Q A;  1J7R A;  1WRK A;  2CT9 A;  2KGB C;  1PVB A;  3VRQ A;  3LLE A;  4NDB A;  1J7O A;  1XK4 C;  2CXJ A;  4GNK B;  1CNP A;  3PLF B;  4I5K A;  3SG4 A;  2KOT A;  1J7Q A;  1CFF A;  4PE1 A;  3BUX B;  2LV7 A;  2LUC A;  3LK0 A;  1B8L A;  5HYD A;  4C0L A;  4GGF A;  2G2B A;  2LMT A;  1MWN A;  4JWQ A;  3DF0 A;  4MZL A;  1IQ3 A;  1DVI A;  1NWD A;  4F0Z B;  4PE7 A;  3PAT A;  1AP4 A;  1A75 A;  2F3Y A;  2EC6 C;  1IG5 A;  1QXP A;  2OTG C;  4PDZ A;  1SRA A;  2L0P A;  1BT6 A;  1OE9 B;  1PRW A;  1WRL A;  2LCP A;  1HT9 A;  3H4S E;  3JVT B;  2K2A A;  1GGW A;  1S26 D;  2Y5I A;  1M46 A;  2LHL A;  1R2U A;  2CNP A;  3NSL A;  2GGZ A;  5B8I B;  1J7P A;  2K8M B;  3GK1 A;  2KI6 D;  2OPO A;  3KF9 A;  2KQ6 A;  2L2E A;  1XK4 A;  1NX2 A;  1OZS A;  1DJG A;  1XFW O;  2G9B A;  2LAN A;  1ZOT B;  1WLM A;  1KSM A;  2Y1N A;  4MVF A;  2MRD A;  2KSP A;  3I5I B;  1KK7 Z;  3E3R A;  3FIA A;  2QPT A;  2COL B;  2KBM A;  2F8P A;  1PSB A;  2LMU A;  1SCM B;  3DVM A;  3ZNI A;  1TCO B;  2ZKM X;  1TNQ A;  2Y1M A;  4OV2 A;  2M7L A;  3D0Y A;  2KI6 C;  2BKI B;  4ZCV A;  1YX8 A;  1SYM A;  1KFU L;  1XFU O;  2ZND A;  1AHR A;  1EL4 A;  1JF2 A;  3O6B A;  4YBH B;  1KQV A;  2JOJ A;  1JFJ A;  1CTR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...