3LL8B

Crystal structure of calcineurin in complex with akap79 peptide
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
155
structure length
155
Chain Sequence
DADEIKRLGKRFKKLDLDNSGSLSVEEFMSLPELQQNPLVQRVIDIFDTDGNGEVDFKEFIEGVSQFSVKGDKEQKLRFAFRIYDMDKDGYISNGELFQVLKMMVGNNLKDTQLQQIVDKTIINADKDGDGRISFEEFCAVVGGLDIHKKMVVDV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords AKAP79 peptide
publication title Balanced interactions of calcineurin with AKAP79 regulate Ca(2+)-calcineurin-NFAT signaling.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/calcium binding protein
total genus 55
structure length 155
sequence length 155
chains with identical sequence D
ec nomenclature
pdb deposition date 2010-01-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00036 EF-hand_1 EF hand
B PF13202 EF-hand_5 EF hand
B PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3ll8B00
1DF0B 3DF0B 1J55A 4CLNA 1M45A 4FTGA 4HRGA 3GK4X 5BPJA 1K9UA 4PE1A 4ETOA 1PALA 1RROA 1XVJA 2BCAA 2B1UA 1CFDA 5HLOA 1S6IA 1YR5A 2JZIA 2LUXA 2M0RA 1LA0A 2KAVA 3BUXB 1J7OA 1SK6D 1UHKA 2MLFC 3TZ1A 3EVUA 1PULA 1QVIY 5K89A 2LVKA 1QJTA 1S36A 1B7TZ 1BU3A 1Y1XA 4YGBB 1H8BA 2LMUA 5ER4X 4YRUA 2I94A 5I8NA 1B7TY 1YVHA 1DGUA 3EK7A 4PALA 2LMVA 2LLSA 4A4BA 1CM4A 3JVTC 4AOMA 3H4SE 1X02A 1J7PA 1ZUZA 1XA5A 2H61C 1SR6B 4QJ3B 2SCPA 2HQWA 1B8LA 3BQ3A 1MQ1A 1TNWA 1J7RA 1QATA 4CIDA 2GGZA 3WNXB 4OV2A 4PHNA 4MLWA 3OHMB 2CTNA 1J1EA 4CFRA 3VGOA 3SG4A 1BT6A 5PALA 5DKRA 3OB2B 1DT7B 5KTYA 3KEVA 1CFCA 1FW4A 4GAOA 3PN7C 4R1EA 1WY9A 1NSHA 1QIWA 1QV1A 1PVAA 3FWBA 1NP8A 2PVBA 4AQIA 3VRPA 1AP4A 1C7VA 1K2HA 1QLSA 1AHRA 1RTP1 2L0PA 2ZKMX 1SL7A 2G2BA 1B8RA 1JF2A 2KAYA 2ZNEA 4MRYA 2TN4A 3ZNIA 2KI4B 1BODA 3EKHA 1DF0A 3DF0A 2HPSA 1NUBA 1S5GZ 2DOQA 4PHKA 2BECA 5HKWA 1F55A 1WDCB 1EG4A 2P6BB 1LVCD 1B47A 1S5GY 2L98A 4YGAA 1CDPA 2F33A 3I5GB 2NLNA 1F4OA 2QPTA 2L50A 3PALA 1JC2A 2WORA 1GGWA 2E30A 4HREE 4WQ2A 2EC6C 1K9KA 2HETA 1DVIA 1KSOA 2ZN9A 4NDDA 1BMOA 2JNXA 1WLMA 3I5FB 2KI4C 3O2PA 1QV0A 3JTDB 1UURA 1HT9A 1E8AA 1MR8A 1C7WA 5CSFA 2LVIA 1Y1UA 2L4IA 1WDCC 1DGVA 4YI8A 2I18A 2LMTA 3VRQA 3BUWB 2ZRSA 2GGMA 1S26D 5KSZA 2Q4UA 1YTZC 1CFPA 3AKAA 3TS5B 4P5OE 1SPYA 3NSLA 4GNKB 2LP2A 1YURA 1OZSA 5CSNA 3TDUA 5JOLA 4PE0A 2KOTA 1TNXA 3QRXA 2MJWB 4M2OA 4WRIA 2M1UA 5I2OA 4GGFC 1OOJA 4QJ4B 3GK1A 1K93D 1R2UA 4OCIA 4HRHA 1IGVA 4MZKA 1J7QA 3BUMB 4UPGA 2ZN8A 3CZTX 2L51A 4ORAB 1R6PA 3M0WA 1SY9A 4OKHA 1M46A 1WRZA 1H4BA 1KCYA 4ICBA 3SG5A 2K8MB 1SKTA 2KI6D 2M7NA 5HKYA 1S6CA 1U5IB 3EK4A 2V53A 3SJSA 4M2PA 3D0YB 2JTTA 1EXRA 3NSIA 4OR9B 4A4CA 1GJYA 1UHHA 3EK8A 1J1DA 1QX2A 3VRNA 1KK7Z 3WHUB 3A8RA 1DJHA 1NWDA 4OVNF 2ZFDA 1BF5A 2VRGA 2L5XB 2COLB 2LVVA 3JVTB 1KK7Y 1QX5B 2LP3A 1UHNA 1QIVA 3O4YA 1QXPA 1QVIZ 1NX1A 1Q80A 2SASA 2LLTA 2NCOA 3WXAA 1UHJA 2OPOA 4GUKA 1OMVA 5D7FA 4MSPA 5JJGA 1XFVO 1TIZA 2F3ZA 1B8CA 2K7OA 1FBVA 1YUSA 1G33A 2CT9A 2D8NA 1SNLA 3ICBA 4PE7A 2MLEC 4N1GA 1LXFC 3OB1B 1YUUA 3PFVA 3FIAA 1B9AA 1JFKA 3PSRA 5G08A 2JU0A 4PHJA 1CMGA 3PN7B 4MZLA 4NDBA 1N2DA 1FF1A 1A2XA 1LKJA 2AAOA 3MSEB 1CNPA 2I7AA 2AUCA 3NXAA 4JQ0D 1K94A 2M29A 4DS7A 1S3PA 2HF5A 2LLUA 5AEQA 2HQ8A 5CPVA 2KBMA 5TNCA 1N0YA 2L2EA 1K96A 1L7ZA 1UWOA 2MA2A 4HSZA 1ALWA 1NCXA 3I5HC 2JXLA 3GOFA 1OZOA 2KGBC 1RWYA 2LCPA 1N65A 1RFJA 3IQOA 5I2QA 2JQ6A 1CLMA 1WRLA 1IRJA 2KFHA 3VRRA 1AUIB 2O60A 1PSRA 3AAJA 5DKQA 4CFQA 2CCMA 2EC6B 2I2RE 2BE6A 1F54A 1U5IA 2A4JA 2KI6C 1SRAA 1RK9A 3D0YA 1M31A 4P2YB 3IQQA 2JWWA 2KHNA 3PLFB 4I5LB 4E68A 3RM1A 1XFWO 1SL8A 1PSBA 1A75B 2Y5IA 1BR1B 1V1FA 1FI6A 1CTRA 1S1EA 1YX8A 1SYMA 2JT3A 1QLKA 4BY5A 1MXLC 2K7CA 2MAZA 4YGDB 1XYDA 2LUCA 2PMYA 1XFYO 4C0JA 2IS9A 5B8IB 1ODBA 2H61A 4USLA 4I5JA 1PRWA 1KFXS 1OE9B 3CR5X 5DKNA 4F0ZB 1JFJA 1KQMC 2BKIB 3PM8A 1RECA 4C0KA 1B4CA 2LE9B 3KO0A 1NPQA 3RLZA 1NIWA 3D10A 3LLEA 1QASA 5HKZA 1LINA 3NSKA 1SW8A 1KSMA 2PSRA 1XK4C 2E6WA 2WC8A 3C1VA 3SG2A 2F8PA 3E3RA 1ZMZA 1MHOA 3LL8B 4L9MA 5FYXA 1IG5A 2WCEA 2F3YA 1IWQA 1W7JB 2LM5A 3DVMA 1TOPA 4XJKB 4BY4A 1DTLA 1SMGA 4JWQA 1F8HA 1EG3A 2M97A 1FPWA 3LK0A 2FJUB 1LA3A 3BYAA 1GQMA 3LK1A 1TCFA 1L2OC 2LVJA 1TN4A 2CNPA 4MEWA 1YRUB 2K7DA 3BXKA 2M49B 2FOTA 1YUTA 5KU1A 3TDIA 4MVFA 3F45A 4ORBB 4NQGA 1CDLA 3WHTB 1K9PA 1XFXO 1PK0D 2PASA 1KQVA 5I2LA 4PDZA 3AKBA 3KF9A 2MHHA 4QJ5B 1KK8B 2K7BA 4GGNA 4U8DA 1Y0VH 4JPZB 3DVKA 1OMDA 2K2FA 1YX7A 3IF7A 1TRFA 2KYCA 1CM1A 2JT0A 4MRXA 5AANA 1CMFA 3A4UB 1SBJA 1OQPA 4GPLB 1BR4B 2MRDA 2JXCA 3O6BA 4DUQA 1BLQA 3HX4A 1A4PA 2G9BA 1IJ6A 2KAXA 3DVEA 4YI9A 2M3WA 1NCYA 1WRKA 2O5GA 5J3XA 1UP5A 1A75A 3I5IC 1IH0A 1XFZO 2JULA 1C07A 1EL4A 2KNEA 2JC2A 2BL0C 1CLBA 1SCMC 1KK8C 2K61A 1KFXL 1TCOB 2K0JA 1W7IB 1A29A 1IKUA 2EHBA 2BKHB 1XFUO 4YBHB 4YGCB 2JNFA 2KFGA 3I5HB 3SG7A 3EVRA 4GBAA 1RJVA 3CR2A 2PALA 1KFUL 4PE4A 1CDNA 4NDCA 1NYAA 3EKJA 4GGFA 3TUYC 2OS8C 5F6TA 5AFPA 1F71A 1K95A 4IL1A 3DVJA 2LNKA 2WCBA 2LV7A 2KBIA 2KFFA 2RGIA 1OMRA 1MUXA 2CXJA 1EJ3A 1M39A 3CLNA 3LCPC 1ZFSA 1TTXA 2BBNA 2Q91A 4N5XA 5ER5A 4DCKA 2KGRA 4C0LA 2LANA 4FQOA 1IQ5A 4XJKA 1F70A 2KSPA 1GGZA 1TNPA 2WNDA 2LHIA 1FI5A 4GFTA 2LC5A 4TNCA 3O78A 2KQYA 2LHLA 2F2OA 1CB1A 2KYFA 1G8IA 1A03A 4DIRA 1IQ3A 1DMOA 1S6JA 4I5KA 3FWCA 4MN0A 1QS7A 5D69A 2ZNDA 1JF0A 1QX7A 1YRTB 2JT8A 1AJ4A 1F4QA 3BUNB 3ZWHA 2M1KB 2AMIA 3BOWB 1KQMB 1V1GA 1XO5A 2M9GA 1NCZA 3OX5A 4MBEA 1NX0A 3AAKA 1DJYA 2BE4A 5AERA 3NSOA 4WQ3A 1CDMA 1UHIA 2LAPA 4ZCUA 3KHEA 1JSAA 2JOJA 1SR6C 3EVVA 3GK2A 1DJIA 2M7LA 2KDHA 2F2PA 2Y4QA 2JRFA 2L4HA 3KPXA 5CSJA 1DJZA 1AVSA 1BOCA 1ALVA 4ORCB 1ZOTB 1L2OB 1D1OA 1KFUS 2Y1MA 3SG6A 4DRWA 2WOSA 1PVBA 1SCVA 1JWDA 1YVLA 2R2IA 1WLZA 3K21A 5HYDA 1OSAA 1DJWA 1CLLA 1Y6WA 2EGDA 5GQQC 1TNQA 4Q04A 4YGEB 1UUSA 2FCDA 4PCWA 4D1EA 3VROA 1DJGA 1ZACA 4I5NB 3SIAA 3SIBA 1QTXA 3CWGA 1MWNA 3CR4X 2ZRTA 4ZCVA 1BJFA 1DJXA 1VRKA 4PHMA 2CBLA 2OTGB 2FCEA 2JTZA 2WCFA 4N1FA 1B1GA 5IBWA 2KQ6A 1MXEA 2M8UA 1K90D 1AJ5A 3I5GC 1K8UA 2JPTA 3CTNA 1KWOB 1NX2A 1G4YR 1BG1A 2BCBA 2H2KA 3I5IB 4M2QA 5HLVA 1CFFA 2BL0B 1AK8A 1CKKA 1SCMB 2NXQA 1M63B 1JBAA 3DD4A 1MF8B 3I5FC 3OP0A 5AXIA 3PATA 2BBMA 3CGAA 3JTDC 2BCXA 2NCPA 3BOWA 4MZJA 2OTGC 3BUOB 3FS7A 2K2AA 5CSIA 3OX6A 2MBXA 1EH2A 1HQVA 1Y1AA 2QACA 2Y1NA 2OS8B 3HCMA 1KWOC 3TDZA 3TUYB 4AQJA 1JUOA 3CS1A 4CPVA 4XYNA 1XK4A 2GV5A 3TS5C 1SL9A 2NZ0A 2PRUA 1NX3A 2ISDA 3SG3A 1IJ5A
chains in the Genus database with same CATH superfamily
1DF0B 3DF0B 1J55A 2WCMA 4CLNA 1M45A 4FTGA 4HRGA 3GK4X 5BPJA 1K9UA 4PE1A 4ETOA 1PALA 1RROA 1XVJA 2BCAA 2B1UA 1CFDA 1C3ZA 5HLOA 1S6IA 1YR5A 4OZDA 2JZIA 2LUXA 2M0RA 1LA0A 2KAVA 3BUXB 1J7OA 1SK6D 1P28A 1UHKA 2MLFC 3D78A 3TZ1A 3EVUA 1PULA 3FE9A 1QVIY 5K89A 2LVKA 1QJTA 1S36A 1B7TZ 1BU3A 1Y1XA 4YGBB 1H8BA 2LMUA 5ER4X 4YRUA 2I94A 5I8NA 1B7TY 1GM0A 1YVHA 1DGUA 2YGUA 3EK7A 2LMVA 4INWA 4PALA 2LLSA 4A4BA 1CM4A 3JVTC 4AOMA 3H4SE 1X02A 1J7PA 1ZUZA 1XA5A 2H61C 1SR6B 4QJ3B 2SCPA 2HQWA 1B8LA 1OW4A 3BQ3A 1MQ1A 2L2CA 1DC1A 1TNWA 1J7RA 1QATA 5D3OA 2QEBA 2GGZA 4CIDA 2ERBA 3WNXB 4OV2A 4PHNA 4MLWA 1Z2CB 3OHMB 2CTNA 3VB1A 1J1EA 4CFRA 3CZ1A 3VGOA 3SG4A 1BT6A 5PALA 5DKRA 2WC5A 3OB2B 3NHTA 1DT7B 5KTYA 3KEVA 1CFCA 1FW4A 4GAOA 3PN7C 4R1EA 1WY9A 3UO9A 1NSHA 1QIWA 1QV1A 1PVAA 3FWBA 1NP8A 2PVBA 4AQIA 3PJIA 3VRPA 1AP4A 1C7VA 1K2HA 1QLSA 1AHRA 1RTP1 2P70A 2L0PA 2ZKMX 1SL7A 2G2BA 1B8RA 1JF2A 3B86A 2KAYA 2ZNEA 4MRYA 2TN4A 3ZNIA 3CDNA 2KI4B 1BODA 3B7AA 3EKHA 1DF0A 3DF0A 2QEHA 2HPSA 1NUBA 1S5GZ 2DOQA 4PHKA 1IIOA 2BECA 5HKWA 5HL1A 1TUZA 3OGNA 1F55A 1WDCB 1EG4A 2P6BB 1LVCD 1B47A 1S5GY 2L98A 4YGAA 1CDPA 2F33A 3I5GB 3V2LA 2NLNA 1F4OA 2QPTA 2L50A 3PALA 1JC2A 2WORA 3BFBA 1GGWA 2E30A 4HREE 4WQ2A 2EC6C 1K9KA 2HETA 1DVIA 1KSOA 2ZN9A 4NDDA 1BMOA 2JNXA 2BAPA 1WLMA 3I5FB 2KI4C 3O2PA 1QV0A 3JTDB 1UURA 1HT9A 1E8AA 1MR8A 1C7WA 5CSFA 2LVIA 1Y1UA 2L4IA 1WDCC 2QEVA 1DGVA 4YI8A 3DXLA 2I18A 2LMTA 3D75A 3BUWB 3VRQA 2ZRSA 2GGMA 1S26D 3EG5B 5KSZA 2Q4UA 1YTZC 1CFPA 3AKAA 3TS5B 4P5OE 1SPYA 2BNXA 3NSLA 4GNKB 2LP2A 1YURA 1OZSA 5CSNA 3TDUA 5JOLA 4PE0A 2KOTA 1TNXA 3QRXA 2MJWB 4M2OA 4WRIA 2M1UA 5I2OA 4GGFC 1OOJA 4QJ4B 3GK1A 1K93D 1R2UA 2GTEA 4OCIA 4HRHA 1IGVA 4MZKA 1J7QA 3BUMB 4UPGA 2ZN8A 3CZTX 2L51A 4ORAB 1R6PA 3M0WA 1SY9A 4OKHA 1M46A 1WRZA 1H4BA 3B6XA 1KCYA 4ICBA 3SG5A 2K8MB 1SKTA 2KLDA 2KI6D 2M7NA 1S6CA 1U5IB 3EK4A 5HKYA 2V53A 3SJSA 3R72A 3D0YB 4M2PA 2JTTA 1EXRA 3NSIA 4OR9B 4A4CA 1GJYA 1UHHA 3EK8A 1J1DA 1QX2A 3VRNA 1KK7Z 3WHUB 3A8RA 1DJHA 1NWDA 4OVNF 2ZFDA 1BF5A 2VRGA 2L5XB 2COLB 2LVVA 3JVTB 1SSEB 1KK7Y 1QX5B 2LP3A 1UHNA 1QIVA 3O4YA 1QXPA 2WCJA 3O4XA 1Z4HA 1QVIZ 1NX1A 1Q80A 2SASA 2LLTA 2NCOA 3OBVA 3WXAA 1UHJA 2OPOA 3S0AA 4GUKA 2K60A 1OMVA 5D7FA 4MSPA 5JJGA 1XFVO 1TIZA 2F3ZA 1B8CA 3S0DA 2K7OA 1FBVA 1YUSA 1G33A 2CT9A 2D8NA 1SNLA 3ICBA 4PE7A 2MLEC 4N1GA 1LXFC 3OB1B 1YUUA 3D77A 3PFVA 3FIAA 1B9AA 1JFKA 3PSRA 5G08A 2JU0A 4PHJA 1T14A 1CMGA 3PN7B 4MZLA 4NDBA 3S0FA 1N2DA 1FF1A 1A2XA 1LKJA 2AAOA 3MSEB 1CNPA 2I7AA 3R1PA 2AUCA 3NXAA 4JQ0D 3S0BA 1K94A 2M29A 4DS7A 1S3PA 2HF5A 2LLUA 5AEQA 2HQ8A 5CPVA 2KBMA 5TNCA 1N0YA 2L2EA 1K96A 1L7ZA 1UWOA 2MA2A 4HSZA 1ALWA 1NCXA 1OOHA 2JXLA 3GOFA 3I5HC 1OZOA 1DQEA 2KGBC 1RWYA 2LCPA 1N65A 1RFJA 3IQOA 5I2QA 2JQ6A 1CLMA 1C3YA 5EL2A 1WRLA 1IRJA 2KFHA 3VRRA 1AUIB 3BFHA 2O60A 1PSRA 3AAJA 5DKQA 4CFQA 2CCMA 2EC6B 2I2RE 2BE6A 2L5YA 1F54A 1U5IA 3L4LA 2A4JA 2KI6C 1SRAA 1RK9A 3D0YA 1M31A 4P2YB 3IQQA 2JWWA 2KHNA 1XFRA 3PLFB 4I5LB 4E68A 3BFAA 3RM1A 1XFWO 1SL8A 1PSBA 1A75B 2Y5IA 1BR1B 1V1FA 1FI6A 1CTRA 1S1EA 1YX8A 1SYMA 2JT3A 1QLKA 4BY5A 1TUJA 1MXLC 2K7CA 2MAZA 4YGDB 1XYDA 2LUCA 3D74A 2PMYA 1XFYO 4C0JA 2IS9A 5B8IB 1ODBA 2WCKA 2H61A 4USLA 4I5JA 1PRWA 1KFXS 1OE9B 3CR5X 5DKNA 4F0ZB 1JFJA 1KQMC 2BKIB 3PM8A 1RECA 4C0KA 1B4CA 2LE9B 3KO0A 1NPQA 5FI2A 3RLZA 1NIWA 3D10A 3LLEA 1QASA 5HKZA 1LINA 3NSKA 1SW8A 1KSMA 2PSRA 2WC6A 1XK4C 1DELA 2E6WA 2WC8A 3C1VA 3SG2A 2F8PA 3E3RA 1ZMZA 1MHOA 3LL8B 4L9MA 5FYXA 1IG5A 2WCEA 2F3YA 1IWQA 1W7JB 2KPHA 2LM5A 3DVMA 3K1EA 1TOPA 3SS3A 1ORGA 3UNWA 4XJKB 4BY4A 1DTLA 1SMGA 4JWQA 1F8HA 1EG3A 2M97A 1FPWA 4KYNA 3LK0A 2FJUB 1LA3A 3BYAA 1GQMA 3LK1A 1TCFA 1L2OC 2LVJA 1TN4A 2CNPA 4MEWA 1YRUB 2K7DA 3B87A 3BXKA 5FI7A 2M49B 2FOTA 1YUTA 5KU1A 3TDIA 4MVFA 3F45A 4ORBB 4NQGA 1CDLA 3WHTB 3NHIA 1K9PA 1XFXO 1PK0D 2PASA 1KQVA 4AQJA 2WCLA 5I2LA 4PDZA 1OOIX 3AKBA 3KF9A 2MHHA 4QJ5B 1KK8B 2K7BA 4GGNA 4U8DA 1Y0VH 4JPZB 3DVKA 1OMDA 3S0EA 3S0GA 2K2FA 4PT1A 1YX7A 3IF7A 1TRFA 2KYCA 1CM1A 2JT0A 3R1VA 4MRXA 5AANA 1CMFA 3A4UB 1SBJA 1W9ZA 1OQPA 4GPLB 1BR4B 2MRDA 2JXCA 3O6BA 4DUQA 1BLQA 3HX4A 1A4PA 2G9BA 1IJ6A 2KAXA 3DVEA 4YI9A 2M3WA 1NCYA 1WRKA 2O5GA 5J3XA 5I94A 2PQLA 1UP5A 1A75A 3I5IC 1IH0A 1XFZO 2JULA 1C07A 1EL4A 2KNEA 2JC2A 2BL0C 3PM2A 1CLBA 1SCMC 1OOFA 1KK8C 2K61A 1KFXL 1TCOB 2K0JA 1W7IB 1A29A 1IKUA 2EHBA 2BKHB 1XFUO 4YBHB 4YGCB 2JNFA 2KFGA 2P71A 3I5HB 3SG7A 3EVRA 4GBAA 1RJVA 3CR2A 2PALA 1KFUL 3N7HA 4PE4A 1CDNA 4NDCA 2FJYA 1NYAA 3EKJA 4GGFA 3IVTA 2OS8C 5F6TA 5AFPA 3TUYC 1F71A 1K95A 4IL1A 3DVJA 2LNKA 2KLEA 2LV7A 2WCBA 2KBIA 2KFFA 2RGIA 1OMRA 2WCHA 2QDIA 1MUXA 2QEOA 2CXJA 1EJ3A 1M39A 3BJHA 3CLNA 1TWOA 3LCPC 1ZFSA 1TTXA 2BBNA 2Q91A 4N5XA 5ER5A 4DCKA 2KGRA 4C0LA 2LANA 4FQOA 1IQ5A 4XJKA 1F70A 2KSPA 1GGZA 1TNPA 2WNDA 2LHIA 3B88A 1FI5A 4GFTA 3CZ0A 2LC5A 4TNCA 3O78A 2KQYA 2LHLA 2F2OA 1CB1A 2KYFA 3QMEA 1G8IA 1A03A 2H8VA 2JPOA 4DIRA 1IQ3A 1DMOA 1S6JA 3RZSA 4I5KA 3FWCA 4MN0A 1QS7A 5D69A 2ZNDA 1JF0A 1QX7A 1YRTB 2JT8A 1AJ4A 1F4QA 3BUNB 3ZWHA 2M1KB 2AMIA 3BOWB 1KQMB 1V1GA 1XO5A 2M9GA 1NCZA 3OX5A 4FQTA 4MBEA 1NX0A 3AAKA 1LS8A 1DJYA 2BE4A 5AERA 3NSOA 4WQ3A 1CDMA 1UHIA 2LAPA 4ZCUA 3KHEA 1JSAA 3DYEA 2JOJA 1SR6C 3EVVA 3D73A 1DEKA 3GK2A 3CZ2A 1DJIA 3D76A 2M7LA 2KDHA 5DICA 2F2PA 2Y4QA 2JRFA 2L4HA 3KPXA 5CSJA 1DJZA 1AVSA 4IJ7A 1BOCA 1ALVA 3FE6A 4ORCB 1ZOTB 1L2OB 1D1OA 1KFUS 2Y1MA 3SG6A 4DRWA 2WOSA 1PVBA 1SCVA 1JWDA 1YVLA 2R2IA 1WLZA 3K21A 2PYQA 5HYDA 1OSAA 1DJWA 1CLLA 1Y6WA 2EGDA 5GQQC 1TNQA 4Q04A 4YGEB 1UUSA 2FCDA 4PCWA 4D1EA 3VROA 1DJGA 3Q8IA 1ZACA 3DZTA 4I5NB 3SIAA 3SIBA 1QTXA 3CABA 3CWGA 1MWNA 3CR4X 2ZRTA 4ZCVA 3FE8A 1BJFA 1DJXA 1VRKA 4INXA 1OOGA 4PHMA 5FI6A 2CBLA 2OTGB 2FCEA 2JTZA 2WCFA 4N1FA 3SS4A 5IBWA 1B1GA 2KQ6A 1MXEA 2M8UA 4F7FA 1K90D 1AJ5A 3I5GC 1K8UA 2JPTA 3CTNA 1KWOB 3CYZA 1NX2A 3NGVA 1G4YR 4JD9A 3DY9A 3L47A 1BG1A 2BCBA 2H2KA 3I5IB 4M2QA 5HLVA 1CFFA 2BL0B 1AK8A 1CKKA 1SCMB 2NXQA 1M63B 1JBAA 3DD4A 1MF8B 3I5FC 3OP0A 5AXIA 3PATA 4JKTA 2BBMA 3CGAA 3JTDC 2BCXA 2NCPA 3BOWA 3L4AA 4MZJA 2OTGC 3BUOB 3FS7A 2K2AA 5CSIA 3OX6A 2MBXA 1EH2A 1HQVA 1Y1AA 2QACA 2Y1NA 2OS8B 3HCMA 1KWOC 3SS5A 3TDZA 3TUYB 1JUOA 3CS1A 4CPVA 4XYNA 1XK4A 2GV5A 1QWVA 3TS5C 1SL9A 2NZ0A 2PRUA 3R1OA 1NX3A 2ISDA 3SG3A 1IJ5A
chains in the Genus database with same CATH topology
1DF0B 3DF0B 1J55A 4CLNA 1M45A 4FTGA 4HRGA 3GK4X 5BPJA 1K9UA 4PE1A 4ETOA 1PALA 1RROA 1XVJA 2BCAA 2B1UA 1CFDA 5HLOA 1S6IA 1YR5A 2JZIA 2LUXA 2M0RA 1LA0A 2KAVA 3BUXB 1J7OA 1SK6D 1UHKA 2MLFC 3TZ1A 3EVUA 1PULA 1QVIY 5K89A 2LVKA 1QJTA 1S36A 1B7TZ 1BU3A 1Y1XA 4YGBB 1H8BA 2LMUA 5ER4X 4YRUA 2I94A 5I8NA 1B7TY 1YVHA 1DGUA 3EK7A 4PALA 2LMVA 2LLSA 4A4BA 1CM4A 3JVTC 4AOMA 3H4SE 1X02A 1J7PA 1ZUZA 1XA5A 2H61C 1SR6B 4QJ3B 2SCPA 2HQWA 1B8LA 3BQ3A 1MQ1A 1TNWA 1J7RA 1QATA 4CIDA 2GGZA 3WNXB 4OV2A 4PHNA 4MLWA 3OHMB 2CTNA 1J1EA 4CFRA 3VGOA 3SG4A 1BT6A 5PALA 5DKRA 3OB2B 1DT7B 5KTYA 3KEVA 1CFCA 1FW4A 4GAOA 3PN7C 4R1EA 1WY9A 1NSHA 1QIWA 1QV1A 1PVAA 3FWBA 1NP8A 2PVBA 4AQIA 3VRPA 1AP4A 1C7VA 1K2HA 1QLSA 1AHRA 1RTP1 2L0PA 2ZKMX 1SL7A 2G2BA 1B8RA 1JF2A 2KAYA 2ZNEA 4MRYA 2TN4A 3ZNIA 2KI4B 1BODA 3EKHA 1DF0A 3DF0A 2HPSA 1NUBA 1S5GZ 2DOQA 4PHKA 2BECA 5HKWA 1F55A 1WDCB 1EG4A 2P6BB 1LVCD 1B47A 1S5GY 2L98A 4YGAA 1CDPA 2F33A 3I5GB 2NLNA 1F4OA 2QPTA 2L50A 3PALA 1JC2A 2WORA 1GGWA 2E30A 4HREE 4WQ2A 2EC6C 1K9KA 2HETA 1DVIA 1KSOA 2ZN9A 4NDDA 1BMOA 2JNXA 1WLMA 3I5FB 2KI4C 3O2PA 1QV0A 3JTDB 1UURA 1HT9A 1E8AA 1MR8A 1C7WA 5CSFA 2LVIA 1Y1UA 2L4IA 1WDCC 1DGVA 4YI8A 2I18A 2LMTA 3VRQA 3BUWB 2ZRSA 2GGMA 1S26D 5KSZA 2Q4UA 1YTZC 1CFPA 3AKAA 3TS5B 4P5OE 1SPYA 3NSLA 4GNKB 2LP2A 1YURA 1OZSA 5CSNA 3TDUA 5JOLA 4PE0A 2KOTA 1TNXA 3QRXA 2MJWB 4M2OA 4WRIA 2M1UA 5I2OA 4GGFC 1OOJA 4QJ4B 3GK1A 1K93D 1R2UA 4OCIA 4HRHA 1IGVA 4MZKA 1J7QA 3BUMB 4UPGA 2ZN8A 3CZTX 2L51A 4ORAB 1R6PA 3M0WA 1SY9A 4OKHA 1M46A 1WRZA 1H4BA 1KCYA 4ICBA 3SG5A 2K8MB 1SKTA 2KI6D 2M7NA 5HKYA 1S6CA 1U5IB 3EK4A 2V53A 3SJSA 4M2PA 3D0YB 2JTTA 1EXRA 3NSIA 4OR9B 4A4CA 1GJYA 1UHHA 3EK8A 1J1DA 1QX2A 3VRNA 1KK7Z 3WHUB 3A8RA 1DJHA 1NWDA 4OVNF 2ZFDA 1BF5A 2VRGA 2L5XB 2COLB 2LVVA 3JVTB 1KK7Y 1QX5B 2LP3A 1UHNA 1QIVA 3O4YA 1QXPA 1QVIZ 1NX1A 1Q80A 2SASA 2LLTA 2NCOA 3WXAA 1UHJA 2OPOA 4GUKA 1OMVA 5D7FA 4MSPA 5JJGA 1XFVO 1TIZA 2F3ZA 1B8CA 2K7OA 1FBVA 1YUSA 1G33A 2CT9A 2D8NA 1SNLA 3ICBA 4PE7A 2MLEC 4N1GA 1LXFC 3OB1B 1YUUA 3PFVA 3FIAA 1B9AA 1JFKA 3PSRA 5G08A 2JU0A 4PHJA 1CMGA 3PN7B 4MZLA 4NDBA 1N2DA 1FF1A 1A2XA 1LKJA 2AAOA 3MSEB 1CNPA 2I7AA 2AUCA 3NXAA 4JQ0D 1K94A 2M29A 4DS7A 1S3PA 2HF5A 2LLUA 5AEQA 2HQ8A 5CPVA 2KBMA 5TNCA 1N0YA 2L2EA 1K96A 1L7ZA 1UWOA 2MA2A 4HSZA 1ALWA 1NCXA 3I5HC 2JXLA 3GOFA 1OZOA 2KGBC 1RWYA 2LCPA 1N65A 1RFJA 3IQOA 5I2QA 2JQ6A 1CLMA 1WRLA 1IRJA 2KFHA 3VRRA 1AUIB 2O60A 1PSRA 3AAJA 5DKQA 4CFQA 2CCMA 2EC6B 2I2RE 2BE6A 1F54A 1U5IA 2A4JA 2KI6C 1SRAA 1RK9A 3D0YA 1M31A 4P2YB 3IQQA 2JWWA 2KHNA 3PLFB 4I5LB 4E68A 3RM1A 1XFWO 1SL8A 1PSBA 1A75B 2Y5IA 1BR1B 1V1FA 1FI6A 1CTRA 1S1EA 1YX8A 1SYMA 2JT3A 1QLKA 4BY5A 1MXLC 2K7CA 2MAZA 4YGDB 1XYDA 2LUCA 2PMYA 1XFYO 4C0JA 2IS9A 5B8IB 1ODBA 2H61A 4USLA 4I5JA 1PRWA 1KFXS 1OE9B 3CR5X 5DKNA 4F0ZB 1JFJA 1KQMC 2BKIB 3PM8A 1RECA 4C0KA 1B4CA 2LE9B 3KO0A 1NPQA 3RLZA 1NIWA 3D10A 3LLEA 1QASA 5HKZA 1LINA 3NSKA 1SW8A 1KSMA 2PSRA 1XK4C 2E6WA 2WC8A 3C1VA 3SG2A 2F8PA 3E3RA 1ZMZA 1MHOA 3LL8B 4L9MA 5FYXA 1IG5A 2WCEA 2F3YA 1IWQA 1W7JB 2LM5A 3DVMA 1TOPA 4XJKB 4BY4A 1DTLA 1SMGA 4JWQA 1F8HA 1EG3A 2M97A 1FPWA 3LK0A 2FJUB 1LA3A 3BYAA 1GQMA 3LK1A 1TCFA 1L2OC 2LVJA 1TN4A 2CNPA 4MEWA 1YRUB 2K7DA 3BXKA 2M49B 2FOTA 1YUTA 5KU1A 3TDIA 4MVFA 3F45A 4ORBB 4NQGA 1CDLA 3WHTB 1K9PA 1XFXO 1PK0D 2PASA 1KQVA 5I2LA 4PDZA 3AKBA 3KF9A 2MHHA 4QJ5B 1KK8B 2K7BA 4GGNA 4U8DA 1Y0VH 4JPZB 3DVKA 1OMDA 2K2FA 1YX7A 3IF7A 1TRFA 2KYCA 1CM1A 2JT0A 4MRXA 5AANA 1CMFA 3A4UB 1SBJA 1OQPA 4GPLB 1BR4B 2MRDA 2JXCA 3O6BA 4DUQA 1BLQA 3HX4A 1A4PA 2G9BA 1IJ6A 2KAXA 3DVEA 4YI9A 2M3WA 1NCYA 1WRKA 2O5GA 5J3XA 1UP5A 1A75A 3I5IC 1IH0A 1XFZO 2JULA 1C07A 1EL4A 2KNEA 2JC2A 2BL0C 1CLBA 1SCMC 1KK8C 2K61A 1KFXL 1TCOB 2K0JA 1W7IB 1A29A 1IKUA 2EHBA 2BKHB 1XFUO 4YBHB 4YGCB 2JNFA 2KFGA 3I5HB 3SG7A 3EVRA 4GBAA 1RJVA 3CR2A 2PALA 1KFUL 4PE4A 1CDNA 4NDCA 1NYAA 3EKJA 4GGFA 3TUYC 2OS8C 5F6TA 5AFPA 1F71A 1K95A 4IL1A 3DVJA 2LNKA 2WCBA 2LV7A 2KBIA 2KFFA 2RGIA 1OMRA 1MUXA 2CXJA 1EJ3A 1M39A 3CLNA 3LCPC 1ZFSA 1TTXA 2BBNA 2Q91A 4N5XA 5ER5A 4DCKA 2KGRA 4C0LA 2LANA 4FQOA 1IQ5A 4XJKA 1F70A 2KSPA 1GGZA 1TNPA 2WNDA 2LHIA 1FI5A 4GFTA 2LC5A 4TNCA 3O78A 2KQYA 2LHLA 2F2OA 1CB1A 2KYFA 1G8IA 1A03A 4DIRA 1IQ3A 1DMOA 1S6JA 4I5KA 3FWCA 4MN0A 1QS7A 5D69A 2ZNDA 1JF0A 1QX7A 1YRTB 2JT8A 1AJ4A 1F4QA 3BUNB 3ZWHA 2M1KB 2AMIA 3BOWB 1KQMB 1V1GA 1XO5A 2M9GA 1NCZA 3OX5A 4MBEA 1NX0A 3AAKA 1DJYA 2BE4A 5AERA 3NSOA 4WQ3A 1CDMA 1UHIA 2LAPA 4ZCUA 3KHEA 1JSAA 2JOJA 1SR6C 3EVVA 3GK2A 1DJIA 2M7LA 2KDHA 2F2PA 2Y4QA 2JRFA 2L4HA 3KPXA 5CSJA 1DJZA 1AVSA 1BOCA 1ALVA 4ORCB 1ZOTB 1L2OB 1D1OA 1KFUS 2Y1MA 3SG6A 4DRWA 2WOSA 1PVBA 1SCVA 1JWDA 1YVLA 2R2IA 1WLZA 3K21A 5HYDA 1OSAA 1DJWA 1CLLA 1Y6WA 2EGDA 5GQQC 1TNQA 4Q04A 4YGEB 1UUSA 2FCDA 4PCWA 4D1EA 3VROA 1DJGA 1ZACA 4I5NB 3SIAA 3SIBA 1QTXA 3CWGA 1MWNA 3CR4X 2ZRTA 4ZCVA 1BJFA 1DJXA 1VRKA 4PHMA 2CBLA 2OTGB 2FCEA 2JTZA 2WCFA 4N1FA 1B1GA 5IBWA 2KQ6A 1MXEA 2M8UA 1K90D 1AJ5A 3I5GC 1K8UA 2JPTA 3CTNA 1KWOB 1NX2A 1G4YR 1BG1A 2BCBA 2H2KA 3I5IB 4M2QA 5HLVA 1CFFA 2BL0B 1AK8A 1CKKA 1SCMB 2NXQA 1M63B 1JBAA 3DD4A 1MF8B 3I5FC 3OP0A 5AXIA 3PATA 2BBMA 3CGAA 3JTDC 2BCXA 2NCPA 3BOWA 4MZJA 2OTGC 3BUOB 3FS7A 2K2AA 5CSIA 3OX6A 2MBXA 1EH2A 1HQVA 1Y1AA 2QACA 2Y1NA 2OS8B 3HCMA 1KWOC 3TDZA 3TUYB 4AQJA 1JUOA 3CS1A 4CPVA 4XYNA 1XK4A 2GV5A 3TS5C 1SL9A 2NZ0A 2PRUA 1NX3A 2ISDA 3SG3A 1IJ5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DF0 B;  3DF0 B;  1J55 A;  4CLN A;  1M45 A;  4FTG A;  4HRG A;  3GK4 X;  5BPJ A;  1K9U A;  4PE1 A;  4ETO A;  1PAL A;  1RRO A;  1XVJ A;  2BCA A;  2B1U A;  1CFD A;  5HLO A;  1S6I A;  1YR5 A;  2JZI A;  2LUX A;  2M0R A;  1LA0 A;  2KAV A;  3BUX B;  1J7O A;  1SK6 D;  1UHK A;  2MLF C;  3TZ1 A;  3EVU A;  1PUL A;  1QVI Y;  5K89 A;  2LVK A;  1QJT A;  1S36 A;  1B7T Z;  1BU3 A;  1Y1X A;  4YGB B;  1H8B A;  2LMU A;  5ER4 X;  4YRU A;  2I94 A;  5I8N A;  1B7T Y;  1YVH A;  1DGU A;  3EK7 A;  4PAL A;  2LMV A;  2LLS A;  4A4B A;  1CM4 A;  3JVT C;  4AOM A;  3H4S E;  1X02 A;  1J7P A;  1ZUZ A;  1XA5 A;  2H61 C;  1SR6 B;  4QJ3 B;  2SCP A;  2HQW A;  1B8L A;  3BQ3 A;  1MQ1 A;  1TNW A;  1J7R A;  1QAT A;  4CID A;  2GGZ A;  3WNX B;  4OV2 A;  4PHN A;  4MLW A;  3OHM B;  2CTN A;  1J1E A;  4CFR A;  3VGO A;  3SG4 A;  1BT6 A;  5PAL A;  5DKR A;  3OB2 B;  1DT7 B;  5KTY A;  3KEV A;  1CFC A;  1FW4 A;  4GAO A;  3PN7 C;  4R1E A;  1WY9 A;  1NSH A;  1QIW A;  1QV1 A;  1PVA A;  3FWB A;  1NP8 A;  2PVB A;  4AQI A;  3VRP A;  1AP4 A;  1C7V A;  1K2H A;  1QLS A;  1AHR A;  1RTP 1;  2L0P A;  2ZKM X;  1SL7 A;  2G2B A;  1B8R A;  1JF2 A;  2KAY A;  2ZNE A;  4MRY A;  2TN4 A;  3ZNI A;  2KI4 B;  1BOD A;  3EKH A;  1DF0 A;  3DF0 A;  2HPS A;  1NUB A;  1S5G Z;  2DOQ A;  4PHK A;  2BEC A;  5HKW A;  1F55 A;  1WDC B;  1EG4 A;  2P6B B;  1LVC D;  1B47 A;  1S5G Y;  2L98 A;  4YGA A;  1CDP A;  2F33 A;  3I5G B;  2NLN A;  1F4O A;  2QPT A;  2L50 A;  3PAL A;  1JC2 A;  2WOR A;  1GGW A;  2E30 A;  4HRE E;  4WQ2 A;  2EC6 C;  1K9K A;  2HET A;  1DVI A;  1KSO A;  2ZN9 A;  4NDD A;  1BMO A;  2JNX A;  1WLM A;  3I5F B;  2KI4 C;  3O2P A;  1QV0 A;  3JTD B;  1UUR A;  1HT9 A;  1E8A A;  1MR8 A;  1C7W A;  5CSF A;  2LVI A;  1Y1U A;  2L4I A;  1WDC C;  1DGV A;  4YI8 A;  2I18 A;  2LMT A;  3VRQ A;  3BUW B;  2ZRS A;  2GGM A;  1S26 D;  5KSZ A;  2Q4U A;  1YTZ C;  1CFP A;  3AKA A;  3TS5 B;  4P5O E;  1SPY A;  3NSL A;  4GNK B;  2LP2 A;  1YUR A;  1OZS A;  5CSN A;  3TDU A;  5JOL A;  4PE0 A;  2KOT A;  1TNX A;  3QRX A;  2MJW B;  4M2O A;  4WRI A;  2M1U A;  5I2O A;  4GGF C;  1OOJ A;  4QJ4 B;  3GK1 A;  1K93 D;  1R2U A;  4OCI A;  4HRH A;  1IGV A;  4MZK A;  1J7Q A;  3BUM B;  4UPG A;  2ZN8 A;  3CZT X;  2L51 A;  4ORA B;  1R6P A;  3M0W A;  1SY9 A;  4OKH A;  1M46 A;  1WRZ A;  1H4B A;  1KCY A;  4ICB A;  3SG5 A;  2K8M B;  1SKT A;  2KI6 D;  2M7N A;  5HKY A;  1S6C A;  1U5I B;  3EK4 A;  2V53 A;  3SJS A;  4M2P A;  3D0Y B;  2JTT A;  1EXR A;  3NSI A;  4OR9 B;  4A4C A;  1GJY A;  1UHH A;  3EK8 A;  1J1D A;  1QX2 A;  3VRN A;  1KK7 Z;  3WHU B;  3A8R A;  1DJH A;  1NWD A;  4OVN F;  2ZFD A;  1BF5 A;  2VRG A;  2L5X B;  2COL B;  2LVV A;  3JVT B;  1KK7 Y;  1QX5 B;  2LP3 A;  1UHN A;  1QIV A;  3O4Y A;  1QXP A;  1QVI Z;  1NX1 A;  1Q80 A;  2SAS A;  2LLT A;  2NCO A;  3WXA A;  1UHJ A;  2OPO A;  4GUK A;  1OMV A;  5D7F A;  4MSP A;  5JJG A;  1XFV O;  1TIZ A;  2F3Z A;  1B8C A;  2K7O A;  1FBV A;  1YUS A;  1G33 A;  2CT9 A;  2D8N A;  1SNL A;  3ICB A;  4PE7 A;  2MLE C;  4N1G A;  1LXF C;  3OB1 B;  1YUU A;  3PFV A;  3FIA A;  1B9A A;  1JFK A;  3PSR A;  5G08 A;  2JU0 A;  4PHJ A;  1CMG A;  3PN7 B;  4MZL A;  4NDB A;  1N2D A;  1FF1 A;  1A2X A;  1LKJ A;  2AAO A;  3MSE B;  1CNP A;  2I7A A;  2AUC A;  3NXA A;  4JQ0 D;  1K94 A;  2M29 A;  4DS7 A;  1S3P A;  2HF5 A;  2LLU A;  5AEQ A;  2HQ8 A;  5CPV A;  2KBM A;  5TNC A;  1N0Y A;  2L2E A;  1K96 A;  1L7Z A;  1UWO A;  2MA2 A;  4HSZ A;  1ALW A;  1NCX A;  3I5H C;  2JXL A;  3GOF A;  1OZO A;  2KGB C;  1RWY A;  2LCP A;  1N65 A;  1RFJ A;  3IQO A;  5I2Q A;  2JQ6 A;  1CLM A;  1WRL A;  1IRJ A;  2KFH A;  3VRR A;  1AUI B;  2O60 A;  1PSR A;  3AAJ A;  5DKQ A;  4CFQ A;  2CCM A;  2EC6 B;  2I2R E;  2BE6 A;  1F54 A;  1U5I A;  2A4J A;  2KI6 C;  1SRA A;  1RK9 A;  3D0Y A;  1M31 A;  4P2Y B;  3IQQ A;  2JWW A;  2KHN A;  3PLF B;  4I5L B;  4E68 A;  3RM1 A;  1XFW O;  1SL8 A;  1PSB A;  1A75 B;  2Y5I A;  1BR1 B;  1V1F A;  1FI6 A;  1CTR A;  1S1E A;  1YX8 A;  1SYM A;  2JT3 A;  1QLK A;  4BY5 A;  1MXL C;  2K7C A;  2MAZ A;  4YGD B;  1XYD A;  2LUC A;  2PMY A;  1XFY O;  4C0J A;  2IS9 A;  5B8I B;  1ODB A;  2H61 A;  4USL A;  4I5J A;  1PRW A;  1KFX S;  1OE9 B;  3CR5 X;  5DKN A;  4F0Z B;  1JFJ A;  1KQM C;  2BKI B;  3PM8 A;  1REC A;  4C0K A;  1B4C A;  2LE9 B;  3KO0 A;  1NPQ A;  3RLZ A;  1NIW A;  3D10 A;  3LLE A;  1QAS A;  5HKZ A;  1LIN A;  3NSK A;  1SW8 A;  1KSM A;  2PSR A;  1XK4 C;  2E6W A;  2WC8 A;  3C1V A;  3SG2 A;  2F8P A;  3E3R A;  1ZMZ A;  1MHO A;  3LL8 B;  4L9M A;  5FYX A;  1IG5 A;  2WCE A;  2F3Y A;  1IWQ A;  1W7J B;  2LM5 A;  3DVM A;  1TOP A;  4XJK B;  4BY4 A;  1DTL A;  1SMG A;  4JWQ A;  1F8H A;  1EG3 A;  2M97 A;  1FPW A;  3LK0 A;  2FJU B;  1LA3 A;  3BYA A;  1GQM A;  3LK1 A;  1TCF A;  1L2O C;  2LVJ A;  1TN4 A;  2CNP A;  4MEW A;  1YRU B;  2K7D A;  3BXK A;  2M49 B;  2FOT A;  1YUT A;  5KU1 A;  3TDI A;  4MVF A;  3F45 A;  4ORB B;  4NQG A;  1CDL A;  3WHT B;  1K9P A;  1XFX O;  1PK0 D;  2PAS A;  1KQV A;  5I2L A;  4PDZ A;  3AKB A;  3KF9 A;  2MHH A;  4QJ5 B;  1KK8 B;  2K7B A;  4GGN A;  4U8D A;  1Y0V H;  4JPZ B;  3DVK A;  1OMD A;  2K2F A;  1YX7 A;  3IF7 A;  1TRF A;  2KYC A;  1CM1 A;  2JT0 A;  4MRX A;  5AAN A;  1CMF A;  3A4U B;  1SBJ A;  1OQP A;  4GPL B;  1BR4 B;  2MRD A;  2JXC A;  3O6B A;  4DUQ A;  1BLQ A;  3HX4 A;  1A4P A;  2G9B A;  1IJ6 A;  2KAX A;  3DVE A;  4YI9 A;  2M3W A;  1NCY A;  1WRK A;  2O5G A;  5J3X A;  1UP5 A;  1A75 A;  3I5I C;  1IH0 A;  1XFZ O;  2JUL A;  1C07 A;  1EL4 A;  2KNE A;  2JC2 A;  2BL0 C;  1CLB A;  1SCM C;  1KK8 C;  2K61 A;  1KFX L;  1TCO B;  2K0J A;  1W7I B;  1A29 A;  1IKU A;  2EHB A;  2BKH B;  1XFU O;  4YBH B;  4YGC B;  2JNF A;  2KFG A;  3I5H B;  3SG7 A;  3EVR A;  4GBA A;  1RJV A;  3CR2 A;  2PAL A;  1KFU L;  4PE4 A;  1CDN A;  4NDC A;  1NYA A;  3EKJ A;  4GGF A;  3TUY C;  2OS8 C;  5F6T A;  5AFP A;  1F71 A;  1K95 A;  4IL1 A;  3DVJ A;  2LNK A;  2WCB A;  2LV7 A;  2KBI A;  2KFF A;  2RGI A;  1OMR A;  1MUX A;  2CXJ A;  1EJ3 A;  1M39 A;  3CLN A;  3LCP C;  1ZFS A;  1TTX A;  2BBN A;  2Q91 A;  4N5X A;  5ER5 A;  4DCK A;  2KGR A;  4C0L A;  2LAN A;  4FQO A;  1IQ5 A;  4XJK A;  1F70 A;  2KSP A;  1GGZ A;  1TNP A;  2WND A;  2LHI A;  1FI5 A;  4GFT A;  2LC5 A;  4TNC A;  3O78 A;  2KQY A;  2LHL A;  2F2O A;  1CB1 A;  2KYF A;  1G8I A;  1A03 A;  4DIR A;  1IQ3 A;  1DMO A;  1S6J A;  4I5K A;  3FWC A;  4MN0 A;  1QS7 A;  5D69 A;  2ZND A;  1JF0 A;  1QX7 A;  1YRT B;  2JT8 A;  1AJ4 A;  1F4Q A;  3BUN B;  3ZWH A;  2M1K B;  2AMI A;  3BOW B;  1KQM B;  1V1G A;  1XO5 A;  2M9G A;  1NCZ A;  3OX5 A;  4MBE A;  1NX0 A;  3AAK A;  1DJY A;  2BE4 A;  5AER A;  3NSO A;  4WQ3 A;  1CDM A;  1UHI A;  2LAP A;  4ZCU A;  3KHE A;  1JSA A;  2JOJ A;  1SR6 C;  3EVV A;  3GK2 A;  1DJI A;  2M7L A;  2KDH A;  2F2P A;  2Y4Q A;  2JRF A;  2L4H A;  3KPX A;  5CSJ A;  1DJZ A;  1AVS A;  1BOC A;  1ALV A;  4ORC B;  1ZOT B;  1L2O B;  1D1O A;  1KFU S;  2Y1M A;  3SG6 A;  4DRW A;  2WOS A;  1PVB A;  1SCV A;  1JWD A;  1YVL A;  2R2I A;  1WLZ A;  3K21 A;  5HYD A;  1OSA A;  1DJW A;  1CLL A;  1Y6W A;  2EGD A;  5GQQ C;  1TNQ A;  4Q04 A;  4YGE B;  1UUS A;  2FCD A;  4PCW A;  4D1E A;  3VRO A;  1DJG A;  1ZAC A;  4I5N B;  3SIA A;  3SIB A;  1QTX A;  3CWG A;  1MWN A;  3CR4 X;  2ZRT A;  4ZCV A;  1BJF A;  1DJX A;  1VRK A;  4PHM A;  2CBL A;  2OTG B;  2FCE A;  2JTZ A;  2WCF A;  4N1F A;  1B1G A;  5IBW A;  2KQ6 A;  1MXE A;  2M8U A;  1K90 D;  1AJ5 A;  3I5G C;  1K8U A;  2JPT A;  3CTN A;  1KWO B;  1NX2 A;  1G4Y R;  1BG1 A;  2BCB A;  2H2K A;  3I5I B;  4M2Q A;  5HLV A;  1CFF A;  2BL0 B;  1AK8 A;  1CKK A;  1SCM B;  2NXQ A;  1M63 B;  1JBA A;  3DD4 A;  1MF8 B;  3I5F C;  3OP0 A;  5AXI A;  3PAT A;  2BBM A;  3CGA A;  3JTD C;  2BCX A;  2NCP A;  3BOW A;  4MZJ A;  2OTG C;  3BUO B;  3FS7 A;  2K2A A;  5CSI A;  3OX6 A;  2MBX A;  1EH2 A;  1HQV A;  1Y1A A;  2QAC A;  2Y1N A;  2OS8 B;  3HCM A;  1KWO C;  3TDZ A;  3TUY B;  4AQJ A;  1JUO A;  3CS1 A;  4CPV A;  4XYN A;  1XK4 A;  2GV5 A;  3TS5 C;  1SL9 A;  2NZ0 A;  2PRU A;  1NX3 A;  2ISD A;  3SG3 A;  1IJ5 A; 
#chains in the Genus database with same CATH topology
 1DF0 B;  3DF0 B;  1J55 A;  2WCM A;  4CLN A;  1M45 A;  4FTG A;  4HRG A;  3GK4 X;  5BPJ A;  1K9U A;  4PE1 A;  4ETO A;  1PAL A;  1RRO A;  1XVJ A;  2BCA A;  2B1U A;  1CFD A;  1C3Z A;  5HLO A;  1S6I A;  1YR5 A;  4OZD A;  2JZI A;  2LUX A;  2M0R A;  1LA0 A;  2KAV A;  3BUX B;  1J7O A;  1SK6 D;  1P28 A;  1UHK A;  2MLF C;  3D78 A;  3TZ1 A;  3EVU A;  1PUL A;  3FE9 A;  1QVI Y;  5K89 A;  2LVK A;  1QJT A;  1S36 A;  1B7T Z;  1BU3 A;  1Y1X A;  4YGB B;  1H8B A;  2LMU A;  5ER4 X;  4YRU A;  2I94 A;  5I8N A;  1B7T Y;  1GM0 A;  1YVH A;  1DGU A;  2YGU A;  3EK7 A;  2LMV A;  4INW A;  4PAL A;  2LLS A;  4A4B A;  1CM4 A;  3JVT C;  4AOM A;  3H4S E;  1X02 A;  1J7P A;  1ZUZ A;  1XA5 A;  2H61 C;  1SR6 B;  4QJ3 B;  2SCP A;  2HQW A;  1B8L A;  1OW4 A;  3BQ3 A;  1MQ1 A;  2L2C A;  1DC1 A;  1TNW A;  1J7R A;  1QAT A;  5D3O A;  2QEB A;  2GGZ A;  4CID A;  2ERB A;  3WNX B;  4OV2 A;  4PHN A;  4MLW A;  1Z2C B;  3OHM B;  2CTN A;  3VB1 A;  1J1E A;  4CFR A;  3CZ1 A;  3VGO A;  3SG4 A;  1BT6 A;  5PAL A;  5DKR A;  2WC5 A;  3OB2 B;  3NHT A;  1DT7 B;  5KTY A;  3KEV A;  1CFC A;  1FW4 A;  4GAO A;  3PN7 C;  4R1E A;  1WY9 A;  3UO9 A;  1NSH A;  1QIW A;  1QV1 A;  1PVA A;  3FWB A;  1NP8 A;  2PVB A;  4AQI A;  3PJI A;  3VRP A;  1AP4 A;  1C7V A;  1K2H A;  1QLS A;  1AHR A;  1RTP 1;  2P70 A;  2L0P A;  2ZKM X;  1SL7 A;  2G2B A;  1B8R A;  1JF2 A;  3B86 A;  2KAY A;  2ZNE A;  4MRY A;  2TN4 A;  3ZNI A;  3CDN A;  2KI4 B;  1BOD A;  3B7A A;  3EKH A;  1DF0 A;  3DF0 A;  2QEH A;  2HPS A;  1NUB A;  1S5G Z;  2DOQ A;  4PHK A;  1IIO A;  2BEC A;  5HKW A;  5HL1 A;  1TUZ A;  3OGN A;  1F55 A;  1WDC B;  1EG4 A;  2P6B B;  1LVC D;  1B47 A;  1S5G Y;  2L98 A;  4YGA A;  1CDP A;  2F33 A;  3I5G B;  3V2L A;  2NLN A;  1F4O A;  2QPT A;  2L50 A;  3PAL A;  1JC2 A;  2WOR A;  3BFB A;  1GGW A;  2E30 A;  4HRE E;  4WQ2 A;  2EC6 C;  1K9K A;  2HET A;  1DVI A;  1KSO A;  2ZN9 A;  4NDD A;  1BMO A;  2JNX A;  2BAP A;  1WLM A;  3I5F B;  2KI4 C;  3O2P A;  1QV0 A;  3JTD B;  1UUR A;  1HT9 A;  1E8A A;  1MR8 A;  1C7W A;  5CSF A;  2LVI A;  1Y1U A;  2L4I A;  1WDC C;  2QEV A;  1DGV A;  4YI8 A;  3DXL A;  2I18 A;  2LMT A;  3D75 A;  3BUW B;  3VRQ A;  2ZRS A;  2GGM A;  1S26 D;  3EG5 B;  5KSZ A;  2Q4U A;  1YTZ C;  1CFP A;  3AKA A;  3TS5 B;  4P5O E;  1SPY A;  2BNX A;  3NSL A;  4GNK B;  2LP2 A;  1YUR A;  1OZS A;  5CSN A;  3TDU A;  5JOL A;  4PE0 A;  2KOT A;  1TNX A;  3QRX A;  2MJW B;  4M2O A;  4WRI A;  2M1U A;  5I2O A;  4GGF C;  1OOJ A;  4QJ4 B;  3GK1 A;  1K93 D;  1R2U A;  2GTE A;  4OCI A;  4HRH A;  1IGV A;  4MZK A;  1J7Q A;  3BUM B;  4UPG A;  2ZN8 A;  3CZT X;  2L51 A;  4ORA B;  1R6P A;  3M0W A;  1SY9 A;  4OKH A;  1M46 A;  1WRZ A;  1H4B A;  3B6X A;  1KCY A;  4ICB A;  3SG5 A;  2K8M B;  1SKT A;  2KLD A;  2KI6 D;  2M7N A;  1S6C A;  1U5I B;  3EK4 A;  5HKY A;  2V53 A;  3SJS A;  3R72 A;  3D0Y B;  4M2P A;  2JTT A;  1EXR A;  3NSI A;  4OR9 B;  4A4C A;  1GJY A;  1UHH A;  3EK8 A;  1J1D A;  1QX2 A;  3VRN A;  1KK7 Z;  3WHU B;  3A8R A;  1DJH A;  1NWD A;  4OVN F;  2ZFD A;  1BF5 A;  2VRG A;  2L5X B;  2COL B;  2LVV A;  3JVT B;  1SSE B;  1KK7 Y;  1QX5 B;  2LP3 A;  1UHN A;  1QIV A;  3O4Y A;  1QXP A;  2WCJ A;  3O4X A;  1Z4H A;  1QVI Z;  1NX1 A;  1Q80 A;  2SAS A;  2LLT A;  2NCO A;  3OBV A;  3WXA A;  1UHJ A;  2OPO A;  3S0A A;  4GUK A;  2K60 A;  1OMV A;  5D7F A;  4MSP A;  5JJG A;  1XFV O;  1TIZ A;  2F3Z A;  1B8C A;  3S0D A;  2K7O A;  1FBV A;  1YUS A;  1G33 A;  2CT9 A;  2D8N A;  1SNL A;  3ICB A;  4PE7 A;  2MLE C;  4N1G A;  1LXF C;  3OB1 B;  1YUU A;  3D77 A;  3PFV A;  3FIA A;  1B9A A;  1JFK A;  3PSR A;  5G08 A;  2JU0 A;  4PHJ A;  1T14 A;  1CMG A;  3PN7 B;  4MZL A;  4NDB A;  3S0F A;  1N2D A;  1FF1 A;  1A2X A;  1LKJ A;  2AAO A;  3MSE B;  1CNP A;  2I7A A;  3R1P A;  2AUC A;  3NXA A;  4JQ0 D;  3S0B A;  1K94 A;  2M29 A;  4DS7 A;  1S3P A;  2HF5 A;  2LLU A;  5AEQ A;  2HQ8 A;  5CPV A;  2KBM A;  5TNC A;  1N0Y A;  2L2E A;  1K96 A;  1L7Z A;  1UWO A;  2MA2 A;  4HSZ A;  1ALW A;  1NCX A;  1OOH A;  2JXL A;  3GOF A;  3I5H C;  1OZO A;  1DQE A;  2KGB C;  1RWY A;  2LCP A;  1N65 A;  1RFJ A;  3IQO A;  5I2Q A;  2JQ6 A;  1CLM A;  1C3Y A;  5EL2 A;  1WRL A;  1IRJ A;  2KFH A;  3VRR A;  1AUI B;  3BFH A;  2O60 A;  1PSR A;  3AAJ A;  5DKQ A;  4CFQ A;  2CCM A;  2EC6 B;  2I2R E;  2BE6 A;  2L5Y A;  1F54 A;  1U5I A;  3L4L A;  2A4J A;  2KI6 C;  1SRA A;  1RK9 A;  3D0Y A;  1M31 A;  4P2Y B;  3IQQ A;  2JWW A;  2KHN A;  1XFR A;  3PLF B;  4I5L B;  4E68 A;  3BFA A;  3RM1 A;  1XFW O;  1SL8 A;  1PSB A;  1A75 B;  2Y5I A;  1BR1 B;  1V1F A;  1FI6 A;  1CTR A;  1S1E A;  1YX8 A;  1SYM A;  2JT3 A;  1QLK A;  4BY5 A;  1TUJ A;  1MXL C;  2K7C A;  2MAZ A;  4YGD B;  1XYD A;  2LUC A;  3D74 A;  2PMY A;  1XFY O;  4C0J A;  2IS9 A;  5B8I B;  1ODB A;  2WCK A;  2H61 A;  4USL A;  4I5J A;  1PRW A;  1KFX S;  1OE9 B;  3CR5 X;  5DKN A;  4F0Z B;  1JFJ A;  1KQM C;  2BKI B;  3PM8 A;  1REC A;  4C0K A;  1B4C A;  2LE9 B;  3KO0 A;  1NPQ A;  5FI2 A;  3RLZ A;  1NIW A;  3D10 A;  3LLE A;  1QAS A;  5HKZ A;  1LIN A;  3NSK A;  1SW8 A;  1KSM A;  2PSR A;  2WC6 A;  1XK4 C;  1DEL A;  2E6W A;  2WC8 A;  3C1V A;  3SG2 A;  2F8P A;  3E3R A;  1ZMZ A;  1MHO A;  3LL8 B;  4L9M A;  5FYX A;  1IG5 A;  2WCE A;  2F3Y A;  1IWQ A;  1W7J B;  2KPH A;  2LM5 A;  3DVM A;  3K1E A;  1TOP A;  3SS3 A;  1ORG A;  3UNW A;  4XJK B;  4BY4 A;  1DTL A;  1SMG A;  4JWQ A;  1F8H A;  1EG3 A;  2M97 A;  1FPW A;  4KYN A;  3LK0 A;  2FJU B;  1LA3 A;  3BYA A;  1GQM A;  3LK1 A;  1TCF A;  1L2O C;  2LVJ A;  1TN4 A;  2CNP A;  4MEW A;  1YRU B;  2K7D A;  3B87 A;  3BXK A;  5FI7 A;  2M49 B;  2FOT A;  1YUT A;  5KU1 A;  3TDI A;  4MVF A;  3F45 A;  4ORB B;  4NQG A;  1CDL A;  3WHT B;  3NHI A;  1K9P A;  1XFX O;  1PK0 D;  2PAS A;  1KQV A;  4AQJ A;  2WCL A;  5I2L A;  4PDZ A;  1OOI X;  3AKB A;  3KF9 A;  2MHH A;  4QJ5 B;  1KK8 B;  2K7B A;  4GGN A;  4U8D A;  1Y0V H;  4JPZ B;  3DVK A;  1OMD A;  3S0E A;  3S0G A;  2K2F A;  4PT1 A;  1YX7 A;  3IF7 A;  1TRF A;  2KYC A;  1CM1 A;  2JT0 A;  3R1V A;  4MRX A;  5AAN A;  1CMF A;  3A4U B;  1SBJ A;  1W9Z A;  1OQP A;  4GPL B;  1BR4 B;  2MRD A;  2JXC A;  3O6B A;  4DUQ A;  1BLQ A;  3HX4 A;  1A4P A;  2G9B A;  1IJ6 A;  2KAX A;  3DVE A;  4YI9 A;  2M3W A;  1NCY A;  1WRK A;  2O5G A;  5J3X A;  5I94 A;  2PQL A;  1UP5 A;  1A75 A;  3I5I C;  1IH0 A;  1XFZ O;  2JUL A;  1C07 A;  1EL4 A;  2KNE A;  2JC2 A;  2BL0 C;  3PM2 A;  1CLB A;  1SCM C;  1OOF A;  1KK8 C;  2K61 A;  1KFX L;  1TCO B;  2K0J A;  1W7I B;  1A29 A;  1IKU A;  2EHB A;  2BKH B;  1XFU O;  4YBH B;  4YGC B;  2JNF A;  2KFG A;  2P71 A;  3I5H B;  3SG7 A;  3EVR A;  4GBA A;  1RJV A;  3CR2 A;  2PAL A;  1KFU L;  3N7H A;  4PE4 A;  1CDN A;  4NDC A;  2FJY A;  1NYA A;  3EKJ A;  4GGF A;  3IVT A;  2OS8 C;  5F6T A;  5AFP A;  3TUY C;  1F71 A;  1K95 A;  4IL1 A;  3DVJ A;  2LNK A;  2KLE A;  2LV7 A;  2WCB A;  2KBI A;  2KFF A;  2RGI A;  1OMR A;  2WCH A;  2QDI A;  1MUX A;  2QEO A;  2CXJ A;  1EJ3 A;  1M39 A;  3BJH A;  3CLN A;  1TWO A;  3LCP C;  1ZFS A;  1TTX A;  2BBN A;  2Q91 A;  4N5X A;  5ER5 A;  4DCK A;  2KGR A;  4C0L A;  2LAN A;  4FQO A;  1IQ5 A;  4XJK A;  1F70 A;  2KSP A;  1GGZ A;  1TNP A;  2WND A;  2LHI A;  3B88 A;  1FI5 A;  4GFT A;  3CZ0 A;  2LC5 A;  4TNC A;  3O78 A;  2KQY A;  2LHL A;  2F2O A;  1CB1 A;  2KYF A;  3QME A;  1G8I A;  1A03 A;  2H8V A;  2JPO A;  4DIR A;  1IQ3 A;  1DMO A;  1S6J A;  3RZS A;  4I5K A;  3FWC A;  4MN0 A;  1QS7 A;  5D69 A;  2ZND A;  1JF0 A;  1QX7 A;  1YRT B;  2JT8 A;  1AJ4 A;  1F4Q A;  3BUN B;  3ZWH A;  2M1K B;  2AMI A;  3BOW B;  1KQM B;  1V1G A;  1XO5 A;  2M9G A;  1NCZ A;  3OX5 A;  4FQT A;  4MBE A;  1NX0 A;  3AAK A;  1LS8 A;  1DJY A;  2BE4 A;  5AER A;  3NSO A;  4WQ3 A;  1CDM A;  1UHI A;  2LAP A;  4ZCU A;  3KHE A;  1JSA A;  3DYE A;  2JOJ A;  1SR6 C;  3EVV A;  3D73 A;  1DEK A;  3GK2 A;  3CZ2 A;  1DJI A;  3D76 A;  2M7L A;  2KDH A;  5DIC A;  2F2P A;  2Y4Q A;  2JRF A;  2L4H A;  3KPX A;  5CSJ A;  1DJZ A;  1AVS A;  4IJ7 A;  1BOC A;  1ALV A;  3FE6 A;  4ORC B;  1ZOT B;  1L2O B;  1D1O A;  1KFU S;  2Y1M A;  3SG6 A;  4DRW A;  2WOS A;  1PVB A;  1SCV A;  1JWD A;  1YVL A;  2R2I A;  1WLZ A;  3K21 A;  2PYQ A;  5HYD A;  1OSA A;  1DJW A;  1CLL A;  1Y6W A;  2EGD A;  5GQQ C;  1TNQ A;  4Q04 A;  4YGE B;  1UUS A;  2FCD A;  4PCW A;  4D1E A;  3VRO A;  1DJG A;  3Q8I A;  1ZAC A;  3DZT A;  4I5N B;  3SIA A;  3SIB A;  1QTX A;  3CAB A;  3CWG A;  1MWN A;  3CR4 X;  2ZRT A;  4ZCV A;  3FE8 A;  1BJF A;  1DJX A;  1VRK A;  4INX A;  1OOG A;  4PHM A;  5FI6 A;  2CBL A;  2OTG B;  2FCE A;  2JTZ A;  2WCF A;  4N1F A;  3SS4 A;  5IBW A;  1B1G A;  2KQ6 A;  1MXE A;  2M8U A;  4F7F A;  1K90 D;  1AJ5 A;  3I5G C;  1K8U A;  2JPT A;  3CTN A;  1KWO B;  3CYZ A;  1NX2 A;  3NGV A;  1G4Y R;  4JD9 A;  3DY9 A;  3L47 A;  1BG1 A;  2BCB A;  2H2K A;  3I5I B;  4M2Q A;  5HLV A;  1CFF A;  2BL0 B;  1AK8 A;  1CKK A;  1SCM B;  2NXQ A;  1M63 B;  1JBA A;  3DD4 A;  1MF8 B;  3I5F C;  3OP0 A;  5AXI A;  3PAT A;  4JKT A;  2BBM A;  3CGA A;  3JTD C;  2BCX A;  2NCP A;  3BOW A;  3L4A A;  4MZJ A;  2OTG C;  3BUO B;  3FS7 A;  2K2A A;  5CSI A;  3OX6 A;  2MBX A;  1EH2 A;  1HQV A;  1Y1A A;  2QAC A;  2Y1N A;  2OS8 B;  3HCM A;  1KWO C;  3SS5 A;  3TDZ A;  3TUY B;  1JUO A;  3CS1 A;  4CPV A;  4XYN A;  1XK4 A;  2GV5 A;  1QWV A;  3TS5 C;  1SL9 A;  2NZ0 A;  2PRU A;  3R1O A;  1NX3 A;  2ISD A;  3SG3 A;  1IJ5 A; 
#chains in the Genus database with same CATH homology
 1DF0 B;  3DF0 B;  1J55 A;  4CLN A;  1M45 A;  4FTG A;  4HRG A;  3GK4 X;  5BPJ A;  1K9U A;  4PE1 A;  4ETO A;  1PAL A;  1RRO A;  1XVJ A;  2BCA A;  2B1U A;  1CFD A;  5HLO A;  1S6I A;  1YR5 A;  2JZI A;  2LUX A;  2M0R A;  1LA0 A;  2KAV A;  3BUX B;  1J7O A;  1SK6 D;  1UHK A;  2MLF C;  3TZ1 A;  3EVU A;  1PUL A;  1QVI Y;  5K89 A;  2LVK A;  1QJT A;  1S36 A;  1B7T Z;  1BU3 A;  1Y1X A;  4YGB B;  1H8B A;  2LMU A;  5ER4 X;  4YRU A;  2I94 A;  5I8N A;  1B7T Y;  1YVH A;  1DGU A;  3EK7 A;  4PAL A;  2LMV A;  2LLS A;  4A4B A;  1CM4 A;  3JVT C;  4AOM A;  3H4S E;  1X02 A;  1J7P A;  1ZUZ A;  1XA5 A;  2H61 C;  1SR6 B;  4QJ3 B;  2SCP A;  2HQW A;  1B8L A;  3BQ3 A;  1MQ1 A;  1TNW A;  1J7R A;  1QAT A;  4CID A;  2GGZ A;  3WNX B;  4OV2 A;  4PHN A;  4MLW A;  3OHM B;  2CTN A;  1J1E A;  4CFR A;  3VGO A;  3SG4 A;  1BT6 A;  5PAL A;  5DKR A;  3OB2 B;  1DT7 B;  5KTY A;  3KEV A;  1CFC A;  1FW4 A;  4GAO A;  3PN7 C;  4R1E A;  1WY9 A;  1NSH A;  1QIW A;  1QV1 A;  1PVA A;  3FWB A;  1NP8 A;  2PVB A;  4AQI A;  3VRP A;  1AP4 A;  1C7V A;  1K2H A;  1QLS A;  1AHR A;  1RTP 1;  2L0P A;  2ZKM X;  1SL7 A;  2G2B A;  1B8R A;  1JF2 A;  2KAY A;  2ZNE A;  4MRY A;  2TN4 A;  3ZNI A;  2KI4 B;  1BOD A;  3EKH A;  1DF0 A;  3DF0 A;  2HPS A;  1NUB A;  1S5G Z;  2DOQ A;  4PHK A;  2BEC A;  5HKW A;  1F55 A;  1WDC B;  1EG4 A;  2P6B B;  1LVC D;  1B47 A;  1S5G Y;  2L98 A;  4YGA A;  1CDP A;  2F33 A;  3I5G B;  2NLN A;  1F4O A;  2QPT A;  2L50 A;  3PAL A;  1JC2 A;  2WOR A;  1GGW A;  2E30 A;  4HRE E;  4WQ2 A;  2EC6 C;  1K9K A;  2HET A;  1DVI A;  1KSO A;  2ZN9 A;  4NDD A;  1BMO A;  2JNX A;  1WLM A;  3I5F B;  2KI4 C;  3O2P A;  1QV0 A;  3JTD B;  1UUR A;  1HT9 A;  1E8A A;  1MR8 A;  1C7W A;  5CSF A;  2LVI A;  1Y1U A;  2L4I A;  1WDC C;  1DGV A;  4YI8 A;  2I18 A;  2LMT A;  3VRQ A;  3BUW B;  2ZRS A;  2GGM A;  1S26 D;  5KSZ A;  2Q4U A;  1YTZ C;  1CFP A;  3AKA A;  3TS5 B;  4P5O E;  1SPY A;  3NSL A;  4GNK B;  2LP2 A;  1YUR A;  1OZS A;  5CSN A;  3TDU A;  5JOL A;  4PE0 A;  2KOT A;  1TNX A;  3QRX A;  2MJW B;  4M2O A;  4WRI A;  2M1U A;  5I2O A;  4GGF C;  1OOJ A;  4QJ4 B;  3GK1 A;  1K93 D;  1R2U A;  4OCI A;  4HRH A;  1IGV A;  4MZK A;  1J7Q A;  3BUM B;  4UPG A;  2ZN8 A;  3CZT X;  2L51 A;  4ORA B;  1R6P A;  3M0W A;  1SY9 A;  4OKH A;  1M46 A;  1WRZ A;  1H4B A;  1KCY A;  4ICB A;  3SG5 A;  2K8M B;  1SKT A;  2KI6 D;  2M7N A;  5HKY A;  1S6C A;  1U5I B;  3EK4 A;  2V53 A;  3SJS A;  4M2P A;  3D0Y B;  2JTT A;  1EXR A;  3NSI A;  4OR9 B;  4A4C A;  1GJY A;  1UHH A;  3EK8 A;  1J1D A;  1QX2 A;  3VRN A;  1KK7 Z;  3WHU B;  3A8R A;  1DJH A;  1NWD A;  4OVN F;  2ZFD A;  1BF5 A;  2VRG A;  2L5X B;  2COL B;  2LVV A;  3JVT B;  1KK7 Y;  1QX5 B;  2LP3 A;  1UHN A;  1QIV A;  3O4Y A;  1QXP A;  1QVI Z;  1NX1 A;  1Q80 A;  2SAS A;  2LLT A;  2NCO A;  3WXA A;  1UHJ A;  2OPO A;  4GUK A;  1OMV A;  5D7F A;  4MSP A;  5JJG A;  1XFV O;  1TIZ A;  2F3Z A;  1B8C A;  2K7O A;  1FBV A;  1YUS A;  1G33 A;  2CT9 A;  2D8N A;  1SNL A;  3ICB A;  4PE7 A;  2MLE C;  4N1G A;  1LXF C;  3OB1 B;  1YUU A;  3PFV A;  3FIA A;  1B9A A;  1JFK A;  3PSR A;  5G08 A;  2JU0 A;  4PHJ A;  1CMG A;  3PN7 B;  4MZL A;  4NDB A;  1N2D A;  1FF1 A;  1A2X A;  1LKJ A;  2AAO A;  3MSE B;  1CNP A;  2I7A A;  2AUC A;  3NXA A;  4JQ0 D;  1K94 A;  2M29 A;  4DS7 A;  1S3P A;  2HF5 A;  2LLU A;  5AEQ A;  2HQ8 A;  5CPV A;  2KBM A;  5TNC A;  1N0Y A;  2L2E A;  1K96 A;  1L7Z A;  1UWO A;  2MA2 A;  4HSZ A;  1ALW A;  1NCX A;  3I5H C;  2JXL A;  3GOF A;  1OZO A;  2KGB C;  1RWY A;  2LCP A;  1N65 A;  1RFJ A;  3IQO A;  5I2Q A;  2JQ6 A;  1CLM A;  1WRL A;  1IRJ A;  2KFH A;  3VRR A;  1AUI B;  2O60 A;  1PSR A;  3AAJ A;  5DKQ A;  4CFQ A;  2CCM A;  2EC6 B;  2I2R E;  2BE6 A;  1F54 A;  1U5I A;  2A4J A;  2KI6 C;  1SRA A;  1RK9 A;  3D0Y A;  1M31 A;  4P2Y B;  3IQQ A;  2JWW A;  2KHN A;  3PLF B;  4I5L B;  4E68 A;  3RM1 A;  1XFW O;  1SL8 A;  1PSB A;  1A75 B;  2Y5I A;  1BR1 B;  1V1F A;  1FI6 A;  1CTR A;  1S1E A;  1YX8 A;  1SYM A;  2JT3 A;  1QLK A;  4BY5 A;  1MXL C;  2K7C A;  2MAZ A;  4YGD B;  1XYD A;  2LUC A;  2PMY A;  1XFY O;  4C0J A;  2IS9 A;  5B8I B;  1ODB A;  2H61 A;  4USL A;  4I5J A;  1PRW A;  1KFX S;  1OE9 B;  3CR5 X;  5DKN A;  4F0Z B;  1JFJ A;  1KQM C;  2BKI B;  3PM8 A;  1REC A;  4C0K A;  1B4C A;  2LE9 B;  3KO0 A;  1NPQ A;  3RLZ A;  1NIW A;  3D10 A;  3LLE A;  1QAS A;  5HKZ A;  1LIN A;  3NSK A;  1SW8 A;  1KSM A;  2PSR A;  1XK4 C;  2E6W A;  2WC8 A;  3C1V A;  3SG2 A;  2F8P A;  3E3R A;  1ZMZ A;  1MHO A;  3LL8 B;  4L9M A;  5FYX A;  1IG5 A;  2WCE A;  2F3Y A;  1IWQ A;  1W7J B;  2LM5 A;  3DVM A;  1TOP A;  4XJK B;  4BY4 A;  1DTL A;  1SMG A;  4JWQ A;  1F8H A;  1EG3 A;  2M97 A;  1FPW A;  3LK0 A;  2FJU B;  1LA3 A;  3BYA A;  1GQM A;  3LK1 A;  1TCF A;  1L2O C;  2LVJ A;  1TN4 A;  2CNP A;  4MEW A;  1YRU B;  2K7D A;  3BXK A;  2M49 B;  2FOT A;  1YUT A;  5KU1 A;  3TDI A;  4MVF A;  3F45 A;  4ORB B;  4NQG A;  1CDL A;  3WHT B;  1K9P A;  1XFX O;  1PK0 D;  2PAS A;  1KQV A;  5I2L A;  4PDZ A;  3AKB A;  3KF9 A;  2MHH A;  4QJ5 B;  1KK8 B;  2K7B A;  4GGN A;  4U8D A;  1Y0V H;  4JPZ B;  3DVK A;  1OMD A;  2K2F A;  1YX7 A;  3IF7 A;  1TRF A;  2KYC A;  1CM1 A;  2JT0 A;  4MRX A;  5AAN A;  1CMF A;  3A4U B;  1SBJ A;  1OQP A;  4GPL B;  1BR4 B;  2MRD A;  2JXC A;  3O6B A;  4DUQ A;  1BLQ A;  3HX4 A;  1A4P A;  2G9B A;  1IJ6 A;  2KAX A;  3DVE A;  4YI9 A;  2M3W A;  1NCY A;  1WRK A;  2O5G A;  5J3X A;  1UP5 A;  1A75 A;  3I5I C;  1IH0 A;  1XFZ O;  2JUL A;  1C07 A;  1EL4 A;  2KNE A;  2JC2 A;  2BL0 C;  1CLB A;  1SCM C;  1KK8 C;  2K61 A;  1KFX L;  1TCO B;  2K0J A;  1W7I B;  1A29 A;  1IKU A;  2EHB A;  2BKH B;  1XFU O;  4YBH B;  4YGC B;  2JNF A;  2KFG A;  3I5H B;  3SG7 A;  3EVR A;  4GBA A;  1RJV A;  3CR2 A;  2PAL A;  1KFU L;  4PE4 A;  1CDN A;  4NDC A;  1NYA A;  3EKJ A;  4GGF A;  3TUY C;  2OS8 C;  5F6T A;  5AFP A;  1F71 A;  1K95 A;  4IL1 A;  3DVJ A;  2LNK A;  2WCB A;  2LV7 A;  2KBI A;  2KFF A;  2RGI A;  1OMR A;  1MUX A;  2CXJ A;  1EJ3 A;  1M39 A;  3CLN A;  3LCP C;  1ZFS A;  1TTX A;  2BBN A;  2Q91 A;  4N5X A;  5ER5 A;  4DCK A;  2KGR A;  4C0L A;  2LAN A;  4FQO A;  1IQ5 A;  4XJK A;  1F70 A;  2KSP A;  1GGZ A;  1TNP A;  2WND A;  2LHI A;  1FI5 A;  4GFT A;  2LC5 A;  4TNC A;  3O78 A;  2KQY A;  2LHL A;  2F2O A;  1CB1 A;  2KYF A;  1G8I A;  1A03 A;  4DIR A;  1IQ3 A;  1DMO A;  1S6J A;  4I5K A;  3FWC A;  4MN0 A;  1QS7 A;  5D69 A;  2ZND A;  1JF0 A;  1QX7 A;  1YRT B;  2JT8 A;  1AJ4 A;  1F4Q A;  3BUN B;  3ZWH A;  2M1K B;  2AMI A;  3BOW B;  1KQM B;  1V1G A;  1XO5 A;  2M9G A;  1NCZ A;  3OX5 A;  4MBE A;  1NX0 A;  3AAK A;  1DJY A;  2BE4 A;  5AER A;  3NSO A;  4WQ3 A;  1CDM A;  1UHI A;  2LAP A;  4ZCU A;  3KHE A;  1JSA A;  2JOJ A;  1SR6 C;  3EVV A;  3GK2 A;  1DJI A;  2M7L A;  2KDH A;  2F2P A;  2Y4Q A;  2JRF A;  2L4H A;  3KPX A;  5CSJ A;  1DJZ A;  1AVS A;  1BOC A;  1ALV A;  4ORC B;  1ZOT B;  1L2O B;  1D1O A;  1KFU S;  2Y1M A;  3SG6 A;  4DRW A;  2WOS A;  1PVB A;  1SCV A;  1JWD A;  1YVL A;  2R2I A;  1WLZ A;  3K21 A;  5HYD A;  1OSA A;  1DJW A;  1CLL A;  1Y6W A;  2EGD A;  5GQQ C;  1TNQ A;  4Q04 A;  4YGE B;  1UUS A;  2FCD A;  4PCW A;  4D1E A;  3VRO A;  1DJG A;  1ZAC A;  4I5N B;  3SIA A;  3SIB A;  1QTX A;  3CWG A;  1MWN A;  3CR4 X;  2ZRT A;  4ZCV A;  1BJF A;  1DJX A;  1VRK A;  4PHM A;  2CBL A;  2OTG B;  2FCE A;  2JTZ A;  2WCF A;  4N1F A;  1B1G A;  5IBW A;  2KQ6 A;  1MXE A;  2M8U A;  1K90 D;  1AJ5 A;  3I5G C;  1K8U A;  2JPT A;  3CTN A;  1KWO B;  1NX2 A;  1G4Y R;  1BG1 A;  2BCB A;  2H2K A;  3I5I B;  4M2Q A;  5HLV A;  1CFF A;  2BL0 B;  1AK8 A;  1CKK A;  1SCM B;  2NXQ A;  1M63 B;  1JBA A;  3DD4 A;  1MF8 B;  3I5F C;  3OP0 A;  5AXI A;  3PAT A;  2BBM A;  3CGA A;  3JTD C;  2BCX A;  2NCP A;  3BOW A;  4MZJ A;  2OTG C;  3BUO B;  3FS7 A;  2K2A A;  5CSI A;  3OX6 A;  2MBX A;  1EH2 A;  1HQV A;  1Y1A A;  2QAC A;  2Y1N A;  2OS8 B;  3HCM A;  1KWO C;  3TDZ A;  3TUY B;  4AQJ A;  1JUO A;  3CS1 A;  4CPV A;  4XYN A;  1XK4 A;  2GV5 A;  3TS5 C;  1SL9 A;  2NZ0 A;  2PRU A;  1NX3 A;  2ISD A;  3SG3 A;  1IJ5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...