3LL8B

Crystal structure of calcineurin in complex with akap79 peptide
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
155
structure length
155
Chain Sequence
DADEIKRLGKRFKKLDLDNSGSLSVEEFMSLPELQQNPLVQRVIDIFDTDGNGEVDFKEFIEGVSQFSVKGDKEQKLRFAFRIYDMDKDGYISNGELFQVLKMMVGNNLKDTQLQQIVDKTIINADKDGDGRISFEEFCAVVGGLDIHKKMVVDV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Balanced interactions of calcineurin with AKAP79 regulate Ca(2+)-calcineurin-NFAT signaling.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/calcium binding protein
molecule keywords AKAP79 peptide
total genus 55
structure length 155
sequence length 155
chains with identical sequence D
ec nomenclature
pdb deposition date 2010-01-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00036 EF-hand_1 EF hand
B PF13202 EF-hand_5 EF hand
B PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3ll8B00
3SG6A 1CFCA 3BOWB 2KSPA 1QXPA 2WNDA 1M31A 4C0LA 2K2AA 2PASA 1FI6A 4GGNA 1TTXA 3WNXB 2HF5A 3BYAA 1WLZA 3DVEA 1AP4A 4DCKA 1SR6B 2K7DA 1XFZO 2LVKA 2EC6B 4MZJA 1XK4C 2KOTA 1BF5A 2K8MB 3DVKA 2I94A 1DVIA 2Y1MA 1TNQA 1KK7Y 3OX6A 1CB1A 1CLMA 1BOCA 1SR6C 1CMGA 1CM4A 1B8RA 4CLNA 1FBVA 2AUCA 4OKHA 2KFGA 1EJ3A 2BKHB 1NX2A 4GNKB 1YX8A 1KFUS 1J7QA 2I7AA 2LVIA 1OOJA 2MRDA 1EH2A 2HQ8A 5D69A 1NCYA 5GQQC 2K7CA 1QTXA 2KAXA 5CSFA 1NUBA 5HKWA 1SYMA 2VRGA 3BUMB 1PALA 3EKJA 4GUKA 1YUUA 4NQGA 1S1EA 2M7NA 1RWYA 1A75B 1N0YA 2KFHA 3LK0A 2M9GA 3NSLA 4L9MA 1MHOA 2QACA 1DJGA 1ALVA 4AQIA 2LUCA 4YGEB 1AJ5A 1SKTA 1DMOA 2MJWB 2BBMA 3SG3A 2JTTA 3VROA 1QIVA 1MQ1A 1D1OA 3I5HB 4HREE 2SCPA 2KGRA 1DJXA 2I18A 1S36A 4N5XA 2LLTA 1DJIA 1M45A 2KHNA 2LC5A 2R2IA 3WHUB 3TS5C 2NXQA 1AVSA 3SG7A 1S6IA 1OZOA 1Y1XA 2ZKMX 3JVTB 2L4IA 4PE1A 3LL8B 1M46A 4YI8A 2F33A 1J1DA 2O5GA 1DJHA 1CLBA 4FTGA 4A4CA 3BUXB 5HYDA 3CTNA 5I8NA 1BODA 2GV5A 1IKUA 1AHRA 2PMYA 2AAOA 4USLA 1YR5A 2PRUA 5ER5A 1LVCD 1YURA 2Y1NA 1N65A 4FQOA 1WLMA 2JOJA 1JC2A 1SCMB 3CGAA 1B9AA 2LNKA 1IQ3A 2HQWA 2L4HA 4I5NB 2A4JA 1CDLA 5AERA 4U8DA 3MSEB 1WDCB 3ICBA 1UURA 2TN4A 1IJ5A 3VRNA 2LMUA 3IF7A 1M39A 3M0WA 1QVIZ 2M0RA 1KQMC 4N1GA 1A03A 1W7JB 4P2YB 1V1FA 4DIRA 1OMVA 1DF0A 1SMGA 5KU1A 1PULA 2LCPA 2OTGC 2PSRA 1SRAA 2HETA 2M8UA 1DJWA 2QPTA 4A4BA 4BY4A 1J7PA 1KQVA 4PHJA 1KWOB 3TDZA 1MXEA 2M29A 3D0YA 1E8AA 4XYNA 1TOPA 1NIWA 2G2BA 2M49B 3I5GC 2NCPA 2OS8C 3GOFA 1SL7A 2FOTA 1NX3A 2H2KA 2K61A 4I5JA 5J3XA 2CT9A 4PHMA 3NSOA 2EHBA 2FCEA 4OCIA 2LV7A 4HRGA 4P5OE 2WCFA 3TZ1A 1F8HA 2OPOA 3CLNA 1K96A 2LMVA 3IQQA 4JWQA 4MVFA 5AEQA 1MR8A 1HQVA 1BT6A 1JF2A 5AXIA 1UHHA 1SBJA 2JWWA 1H8BA 2F3ZA 1SCVA 2Y5IA 3JTDC 2JZIA 2CBLA 4PHKA 1QVIY 1YVHA 1L7ZA 1TNPA 1JF0A 1GGWA 1K94A 2M97A 4IL1A 3O2PA 1XFXO 1AUIB 3I5HC 1QS7A 3PN7B 3I5FB 1PSBA 4ORBB 3SIAA 2F8PA 3CR4X 1YVLA 2H61A 4MZKA 4D1EA 3DD4A 3K21A 2MLFC 1IWQA 4YGDB 1PVBA 4PDZA 2E6WA 1A2XA 2JNXA 5FYXA 2M7LA 1A75A 2ZRTA 1YX7A 4AOMA 1J1EA 4NDDA 4MSPA 3A8RA 1CFPA 4WQ2A 1FF1A 4YGBB 1QASA 1XA5A 1F4QA 3EVUA 2ZNDA 4C0JA 4CFQA 5HKYA 3I5FC 3TUYC 1AJ4A 4CFRA 3DVMA 2M3WA 1EL4A 1U5IB 1LA3A 4C0KA 1RROA 1HT9A 3EVRA 2L0PA 4GGFA 4M2OA 3PATA 2KQYA 1WDCC 2KAYA 3DVJA 1L2OC 1TNWA 1BR4B 1YUTA 3RLZA 2G9BA 1JBAA 2BKIB 1K9KA 2ZNEA 1F54A 2MAZA 2EC6C 1SK6D 4PE0A 4PALA 4XJKA 4PE4A 2WOSA 1YRTB 2LAPA 1TN4A 3BOWA 3CR5X 2E30A 4AQJA 1ODBA 1KQMB 1K90D 3BXKA 1R2UA 1DF0B 1XFYO 4ORAB 5I2QA 1WY9A 2KI6C 2K0JA 2WORA 1N2DA 1S5GY 2ISDA 1BR1B 1XYDA 3AKBA 1GJYA 2JULA 2M1UA 1K95A 1QX2A 3FS7A 1RECA 2KI6D 2LM5A 2LUXA 3KPXA 1GQMA 1RJVA 1WRZA 1KK7Z 1TRFA 2L51A 3BQ3A 2F2OA 5DKQA 1FPWA 1VRKA 1S5GZ 1FI5A 2JXLA 3PALA 3EK4A 4YGAA 1C7WA 3WXAA 4ICBA 1S6JA 2JT0A 1Y0VH 2AMIA 3EK8A 1UHIA 4DUQA 4F0ZB 2ZN9A 1J7OA 1A29A 1IGVA 2NZ0A 1JWDA 1KFUL 4NDBA 1RTP1 2CTNA 4PHNA 1PRWA 3SJSA 3TDIA 1BU3A 2V53A 2P6BB 4YBHB 3JTDB 4ZCUA 1WRKA 1LXFC 1NCZA 1NCXA 2NLNA 5CSIA 1SY9A 4CIDA 2F3YA 2CXJA 1B1GA 1UHJA 1OQPA 4PE7A 2COLB 2KFFA 1UUSA 2L50A 3PN7C 2LP3A 1CKKA 4R1EA 2LE9B 3FIAA 3PM8A 5B8IB 1K2HA 1K9PA 1SL8A 4QJ3B 3FWCA 3TDUA 5CPVA 3JVTC 5G08A 2JRFA 2CCMA 1KSMA 1QV0A 2CNPA 2KYFA 4DRWA 2LLSA 1A4PA 5JJGA 1B7TZ 1K9UA 2D8NA 1Y6WA 3ZNIA 2O60A 4MZLA 4UPGA 1F55A 5IBWA 4MRYA 3TUYB 3VGOA 1BLQA 1TNXA 4WQ3A 1C7VA 1G4YR 3O6BA 4GBAA 5PALA 3DF0A 5HLOA 1K8UA 1QIWA 3A4UB 5DKNA 2ZFDA 2KI4B 1OSAA 4HRHA 5I2OA 4MRXA 1KWOC 3AKAA 3NSKA 2Q91A 5JOLA 1OMRA 1XVJA 1Y1AA 1B4CA 1WRLA 1L2OB 1XK4A 3I5GB 4N1FA 4WRIA 3EVVA 3SG4A 3HX4A 2JPTA 4YRUA 2LANA 3BUWB 5D7FA 2KBIA 1ZFSA 1ZMZA 3GK2A 1XFUO 3KHEA 1NSHA 1NX1A 1B7TY 4QJ5B 4ORCB 2LVJA 1IJ6A 1PK0D 2Q4UA 2GGMA 2IS9A 4DS7A 1RK9A 1UP5A 3CWGA 4M2QA 1QLSA 2KQ6A 3I5IC 4CPVA 1CDNA 2BCAA 2Y4QA 2M1KB 5K89A 1DJZA 3WHTB 4BY5A 1YUSA 5AFPA 5HLVA 2MBXA 1FW4A 1B8CA 1JFKA 1KSOA 1MUXA 2BL0B 2LP2A 5BPJA 1C07A 2ZN8A 1QX5B 4ETOA 1DT7B 2FCDA 2BBNA 1Q80A 4I5LB 1XO5A 4PCWA 1QLKA 1AK8A 1TCOB 4HSZA 1JFJA 4M2PA 2B1UA 1SPYA 1JUOA 1V1GA 1KFXS 3KF9A 4NDCA 3HCMA 1OZSA 1MF8B 5KSZA 1S6CA 1MWNA 2K7BA 2KGBC 5TNCA 2MHHA 1NX0A 2BL0C 4MEWA 5AANA 3ZWHA 4MLWA 1NWDA 1ZUZA 3BUOB 3OHMB 1S3PA 1ZOTB 2LHLA 2L5XB 3OX5A 1CLLA 4MBEA 4Q04A 3OB1B 4ZCVA 2JTZA 1OE9B 3C1VA 2WCEA 1LA0A 3SIBA 1KCYA 2KBMA 1KK8C 1B8LA 1UWOA 1TCFA 2FJUB 1IG5A 2BE6A 3RM1A 1CMFA 1CFDA 2JXCA 3DF0B 5KTYA 4GAOA 3SG5A 4JPZB 2KYCA 3OB2B 1BG1A 1GGZA 1DGVA 4YGCB 1H4BA 3NSIA 1M63B 1SNLA 2NCOA 3BUNB 3LCPC 1QV1A 1DGUA 1CDMA 2KI4C 4GGFC 4JQ0D 2HPSA 3PLFB 4YI9A 1CM1A 1ZACA 2JC2A 2LLUA 1EXRA 1S26D 3O4YA 1KK8B 3PSRA 3KEVA 3D0YB 4I5KA 3LLEA 4GFTA 4OV2A 1LKJA 1CFFA 1QATA 1X02A 2BCXA 4GPLB 1JSAA 3VRRA 3EKHA 1U5IA 1MXLC 1IRJA 5CSJA 2LVVA 2OTGB 3D10A 2JQ6A 1G33A 1IQ5A 1SCMC 2KNEA 2L98A 2F2PA 2RGIA 1KFXL 3IQOA 2JNFA 2K2FA 1DTLA 2BECA 1CDPA 3VRPA 1F4OA 1Y1UA 2KDHA 3EK7A 3I5IB 2DOQA 1DJYA 2LMTA 1CNPA 2MA2A 2BE4A 1TIZA 1RFJA 3E3RA 4XJKB 5F6TA 1YRUB 3NXAA 3OP0A 1OMDA 2ZRSA 4QJ4B 1BMOA 3AAKA 4TNCA 1F71A 3AAJA 2KAVA 1SW8A 1XFVO 3SG2A 1BJFA 1K93D 1UHKA 2BCBA 4OR9B 5DKRA 1G8IA 2K7OA 2LHIA 1XFWO 2L2EA 2WCBA 3CS1A 1NPQA 1YTZC 1W7IB 3VRQA 3KO0A 2PVBA 3LK1A 1IH0A 1SL9A 1QJTA 2OS8B 1EG3A 5HKZA 3PFVA 3TS5B 1J55A 2JT3A 3GK1A 4OVNF 1UHNA 2H61C 1R6PA 1ALWA 3CR2A 4E68A 3O78A 5I2LA 1EG4A 1QX7A 2JU0A 1NYAA 1NP8A 1PVAA 2PALA 3QRXA 1F70A 3FWBA 3H4SE 5CSNA 2SASA 2EGDA 2JT8A 2WC8A 1CTRA 3CZTX 2I2RE 1B47A 3F45A 3GK4X 1PSRA 2MLEC 5ER4X 1J7RA 4MN0A 2GGZA 1LINA
chains in the Genus database with same CATH superfamily
3SG6A 1CFCA 3BOWB 2KSPA 3R1OA 1QXPA 2FJYA 2WNDA 1M31A 4C0LA 2K2AA 2PASA 1FI6A 4GGNA 1TTXA 3WNXB 2HF5A 3BYAA 1WLZA 3DVEA 1AP4A 4DCKA 1SR6B 2K7DA 1XFZO 2LVKA 2QDIA 2EC6B 4MZJA 1XK4C 2KOTA 1BF5A 1OOHA 2K8MB 3SS5A 3DVKA 2I94A 1DVIA 2Y1MA 1TNQA 1KK7Y 3OX6A 1CB1A 1CLMA 1BOCA 2L5YA 1SR6C 1CMGA 1CM4A 1B8RA 4CLNA 1FBVA 2AUCA 4OKHA 2KFGA 1EJ3A 2BKHB 1NX2A 4GNKB 1YX8A 1KFUS 1J7QA 2I7AA 2LVIA 1OOJA 2MRDA 3B7AA 3FE9A 2HQ8A 5D69A 5FI6A 1NCYA 1EH2A 5GQQC 2K7CA 1QTXA 2KAXA 3CZ0A 1NUBA 5CSFA 5HKWA 1SYMA 2VRGA 3BUMB 1PALA 3EKJA 4GUKA 1YUUA 3NGVA 4KYNA 3O4XA 1S1EA 4NQGA 2M7NA 1RWYA 1A75B 1N0YA 2KFHA 3LK0A 2M9GA 3NSLA 3SS3A 4L9MA 1ORGA 2GTEA 1MHOA 2QACA 1DJGA 5I94A 1ALVA 4OZDA 4AQIA 2LUCA 4YGEB 1AJ5A 1SKTA 1DMOA 2MJWB 2BBMA 3DZTA 3SG3A 2JTTA 3S0AA 3VROA 1QIVA 1MQ1A 1D1OA 3I5HB 4HREE 5D3OA 2SCPA 2KGRA 1DJXA 2I18A 5FI7A 1S36A 4N5XA 2LLTA 1DJIA 1M45A 2KHNA 2LC5A 5FI2A 2R2IA 1OOIX 3WHUB 3TS5C 2NXQA 1AVSA 2WC6A 3SG7A 1S6IA 1OZOA 1Y1XA 2ZKMX 3JVTB 2L4IA 2QEHA 4PE1A 3LL8B 3V2LA 1M46A 4YI8A 2F33A 1J1DA 2O5GA 1DJHA 1CLBA 3UNWA 4FTGA 4A4CA 3BUXB 4JKTA 5HYDA 3CTNA 2QEVA 5I8NA 1BODA 2GV5A 1IKUA 1AHRA 2PMYA 2AAOA 4USLA 1YR5A 3K1EA 2PRUA 5ER5A 1LVCD 1YURA 2Y1NA 1N65A 4FQOA 1WLMA 2JOJA 1JC2A 1SCMB 3CGAA 1B9AA 2LNKA 1IQ3A 2HQWA 2L4HA 4I5NB 2A4JA 1CDLA 5AERA 4U8DA 3MSEB 1WDCB 3ICBA 3RZSA 1UURA 2TN4A 3CZ1A 1IJ5A 3VRNA 2LMUA 3IF7A 1M39A 2WC5A 3M0WA 3Q8IA 1QVIZ 2L2CA 2M0RA 1KQMC 1C3YA 4N1GA 1A03A 1W7JB 1DQEA 4P2YB 1V1FA 4DIRA 1OMVA 1P28A 1DF0A 1SMGA 5KU1A 1PULA 5DICA 2LCPA 2OTGC 2PSRA 3L4AA 1SRAA 2HETA 2M8UA 1DJWA 2QPTA 4A4BA 4BY4A 1J7PA 1KQVA 4PHJA 1KWOB 3TDZA 1MXEA 2M29A 3D0YA 1E8AA 4XYNA 1TOPA 1NIWA 2G2BA 2M49B 3I5GC 1T14A 2K60A 2NCPA 2OS8C 3GOFA 1SL7A 2FOTA 1NX3A 2H2KA 2K61A 4I5JA 5J3XA 2CT9A 4PHMA 3NSOA 2EHBA 2FCEA 4OCIA 2LV7A 1OOFA 4HRGA 2WCFA 4P5OE 3TZ1A 1F8HA 2OPOA 3CLNA 1K96A 2LMVA 3IQQA 4JWQA 4MVFA 5AEQA 1MR8A 1HQVA 1BT6A 1JF2A 1QWVA 5AXIA 1UHHA 2WCMA 1SBJA 2JWWA 1H8BA 2F3ZA 2WCLA 1SCVA 3PJIA 2Y5IA 3JTDC 2JZIA 2CBLA 4PHKA 1QVIY 1YVHA 1L7ZA 1TNPA 1JF0A 1OOGA 5HL1A 1GGWA 1K94A 2M97A 4IL1A 3O2PA 1XFXO 1AUIB 3I5HC 1QS7A 3PN7B 3I5FB 1PSBA 4ORBB 3SIAA 3D78A 2F8PA 3CR4X 1YVLA 3L4LA 2H61A 4MZKA 4D1EA 3DD4A 3K21A 2MLFC 1IWQA 4YGDB 1PVBA 4PDZA 2E6WA 1A2XA 2JNXA 5FYXA 2M7LA 1A75A 2ZRTA 1YX7A 5EL2A 1J1EA 4AOMA 4NDDA 4MSPA 3A8RA 1CFPA 2QEBA 4WQ2A 1FF1A 4YGBB 1QASA 3CYZA 1XA5A 1F4QA 3EVUA 2ZNDA 4C0JA 4CFQA 5HKYA 3I5FC 3TUYC 1AJ4A 4CFRA 3DVMA 2M3WA 1EL4A 2WCHA 1U5IB 3CABA 1LA3A 4C0KA 1RROA 1HT9A 3EVRA 2L0PA 4GGFA 4M2OA 3PATA 2KQYA 1WDCC 2KAYA 3DVJA 1L2OC 1TNWA 1BR4B 1YUTA 3RLZA 2G9BA 1JBAA 2BKIB 1K9KA 2ZNEA 1F54A 2MAZA 3S0GA 2EC6C 2WCJA 1SK6D 4PE0A 4PALA 4XJKA 4PE4A 2WOSA 1YRTB 2LAPA 1TN4A 3N7HA 3BOWA 3CR5X 2E30A 4AQJA 1ODBA 1KQMB 1K90D 1LS8A 1R2UA 1DF0B 3BXKA 1XFYO 4ORAB 2P70A 5I2QA 1WY9A 2KI6C 2K0JA 2WORA 1N2DA 3S0BA 1S5GY 2ISDA 1BR1B 1XYDA 3AKBA 1GJYA 2JULA 1GM0A 2M1UA 1K95A 1QX2A 3FS7A 1RECA 2KI6D 2LM5A 2LUXA 3KPXA 3B88A 1GQMA 1C3ZA 1RJVA 1WRZA 1KK7Z 1TRFA 2L51A 3BQ3A 2F2OA 5DKQA 1FPWA 1VRKA 1S5GZ 1FI5A 2JXLA 3IVTA 3PALA 3EK4A 4YGAA 1C7WA 3WXAA 4ICBA 2PYQA 1S6JA 2JT0A 1Y0VH 2AMIA 3EK8A 1UHIA 4DUQA 4F0ZB 3B87A 2ZN9A 1J7OA 1A29A 1IGVA 2NZ0A 1JWDA 3DXLA 1KFUL 4NDBA 1RTP1 2CTNA 4PHNA 1PRWA 3SJSA 3TDIA 1BU3A 2ERBA 4FQTA 2V53A 2P6BB 4JD9A 4YBHB 3JTDB 4ZCUA 4F7FA 1OW4A 1TWOA 1WRKA 1LXFC 1NCZA 1NCXA 2NLNA 5CSIA 1SY9A 4CIDA 2F3YA 2CXJA 1B1GA 1UHJA 1OQPA 4PE7A 2COLB 2KFFA 1UUSA 2L50A 3PN7C 2LP3A 1CKKA 4R1EA 3D76A 2LE9B 3FIAA 3PM8A 5B8IB 1K2HA 1K9PA 1SL8A 2QEOA 4QJ3B 3FWCA 3TDUA 3FE8A 3D73A 3JVTC 5CPVA 5G08A 2JRFA 2YGUA 2CCMA 3DY9A 1KSMA 1QV0A 2CNPA 2KYFA 4DRWA 2LLSA 1A4PA 5JJGA 1B7TZ 1K9UA 2D8NA 1Y6WA 3ZNIA 2O60A 4MZLA 4UPGA 1F55A 5IBWA 1DC1A 4MRYA 3TUYB 3VGOA 1BLQA 3D75A 1TNXA 4WQ3A 1C7VA 1G4YR 3O6BA 4GBAA 4IJ7A 5PALA 3DF0A 5HLOA 1K8UA 1QIWA 3A4UB 5DKNA 2ZFDA 2KI4B 1OSAA 4HRHA 5I2OA 4MRXA 3CDNA 1KWOC 3AKAA 3NSKA 2Q91A 2KLEA 1OMRA 5JOLA 3S0DA 1XVJA 1Y1AA 1B4CA 1WRLA 1L2OB 1XK4A 3I5GB 4N1FA 4WRIA 3EVVA 3SG4A 3HX4A 2JPTA 4YRUA 2LANA 3BUWB 5D7FA 2KBIA 1ZFSA 1ZMZA 3GK2A 1XFUO 3KHEA 1NSHA 1NX1A 1B7TY 4QJ5B 4ORCB 3BFBA 2LVJA 1IJ6A 1PK0D 2Q4UA 2GGMA 3QMEA 3B6XA 2IS9A 4DS7A 1RK9A 1UP5A 3CWGA 4M2QA 1QLSA 3D74A 2KQ6A 3I5IC 4CPVA 1CDNA 2BCAA 3B86A 2Y4QA 2M1KB 5K89A 1DJZA 3WHTB 4BY5A 1YUSA 5AFPA 5HLVA 2MBXA 1FW4A 3FE6A 1B8CA 3BFAA 1JFKA 1KSOA 4INXA 1MUXA 2BL0B 2LP2A 5BPJA 3DYEA 1C07A 2ZN8A 1QX5B 4ETOA 1DT7B 2FCDA 2BAPA 2BBNA 1Q80A 3NHTA 4I5LB 1XO5A 4PCWA 1QLKA 3BJHA 3SS4A 1AK8A 1TCOB 4HSZA 4PT1A 4M2PA 2B1UA 1DELA 1JFJA 1SPYA 1JUOA 1V1GA 2KPHA 2WCKA 1SSEB 1KFXS 3KF9A 4NDCA 3HCMA 1OZSA 1MF8B 2PQLA 5KSZA 1S6CA 1MWNA 2K7BA 2KGBC 3NHIA 2MHHA 5TNCA 1NX0A 2BL0C 4MEWA 5AANA 3ZWHA 4MLWA 1NWDA 1ZUZA 3BUOB 3OHMB 1S3PA 1ZOTB 2LHLA 2L5XB 3OX5A 1CLLA 4MBEA 4Q04A 3OB1B 4ZCVA 2JTZA 1OE9B 3C1VA 3VB1A 2WCEA 1LA0A 3SIBA 1KCYA 2KBMA 1KK8C 1B8LA 1UWOA 1TCFA 2FJUB 1IG5A 2BE6A 3S0FA 3RM1A 2P71A 1CMFA 2KLDA 1CFDA 2JXCA 3DF0B 5KTYA 4GAOA 3SG5A 4JPZB 2KYCA 3OB2B 1BG1A 1GGZA 1DGVA 4YGCB 1H4BA 3NSIA 1M63B 1SNLA 2NCOA 3BUNB 3LCPC 1QV1A 1DGUA 1CDMA 2KI4C 4GGFC 4JQ0D 2HPSA 3PLFB 4YI9A 1CM1A 1ZACA 2JC2A 2LLUA 1EXRA 1S26D 3O4YA 1KK8B 3PSRA 3KEVA 3D0YB 4I5KA 3LLEA 4GFTA 4OV2A 1LKJA 1CFFA 1QATA 1X02A 2BCXA 4GPLB 1JSAA 3VRRA 3EKHA 1U5IA 1MXLC 1IRJA 1XFRA 5CSJA 2LVVA 2OTGB 3D10A 2JQ6A 1G33A 1IQ5A 1SCMC 2KNEA 2L98A 2F2PA 2RGIA 3S0EA 1KFXL 3BFHA 3IQOA 2JNFA 2K2FA 4INWA 3L47A 1DTLA 2BECA 3R1PA 1CDPA 3VRPA 3PM2A 1F4OA 1Y1UA 2KDHA 3R1VA 3EK7A 3I5IB 2DOQA 1DJYA 2LMTA 1CNPA 1Z2CB 2MA2A 1IIOA 2BE4A 1TIZA 1RFJA 3E3RA 4XJKB 3OGNA 5F6TA 1YRUB 3NXAA 3OP0A 1OMDA 2ZRSA 1W9ZA 4QJ4B 2JPOA 1BMOA 3AAKA 4TNCA 1F71A 3AAJA 2KAVA 1SW8A 1XFVO 3SG2A 1Z4HA 1BJFA 1K93D 1UHKA 2BCBA 4OR9B 5DKRA 1G8IA 2K7OA 2LHIA 1DEKA 1XFWO 2L2EA 2WCBA 3CS1A 1NPQA 1TUZA 1YTZC 1W7IB 3VRQA 3KO0A 2PVBA 3LK1A 1IH0A 1SL9A 3R72A 1QJTA 3EG5B 2OS8B 1EG3A 5HKZA 3PFVA 3TS5B 1J55A 2JT3A 3GK1A 4OVNF 1UHNA 2H61C 3CZ2A 1R6PA 1ALWA 3CR2A 4E68A 3O78A 5I2LA 1EG4A 1QX7A 2JU0A 1TUJA 1NYAA 1NP8A 1PVAA 2PALA 3QRXA 1F70A 3FWBA 3UO9A 3H4SE 5CSNA 2H8VA 2SASA 2EGDA 2JT8A 2WC8A 1CTRA 3OBVA 3CZTX 2I2RE 3D77A 1B47A 2BNXA 3F45A 3GK4X 1PSRA 2MLEC 5ER4X 1J7RA 4MN0A 2GGZA 1LINA
chains in the Genus database with same CATH topology
3SG6A 1CFCA 3BOWB 2KSPA 1QXPA 2WNDA 1M31A 4C0LA 2K2AA 2PASA 1FI6A 4GGNA 1TTXA 3WNXB 2HF5A 3BYAA 1WLZA 3DVEA 1AP4A 4DCKA 1SR6B 2K7DA 1XFZO 2LVKA 2EC6B 4MZJA 1XK4C 2KOTA 1BF5A 2K8MB 3DVKA 2I94A 1DVIA 2Y1MA 1TNQA 1KK7Y 3OX6A 1CB1A 1CLMA 1BOCA 1SR6C 1CMGA 1CM4A 1B8RA 4CLNA 1FBVA 2AUCA 4OKHA 2KFGA 1EJ3A 2BKHB 1NX2A 4GNKB 1YX8A 1KFUS 1J7QA 2I7AA 2LVIA 1OOJA 2MRDA 1EH2A 2HQ8A 5D69A 1NCYA 5GQQC 2K7CA 1QTXA 2KAXA 5CSFA 1NUBA 5HKWA 1SYMA 2VRGA 3BUMB 1PALA 3EKJA 4GUKA 1YUUA 4NQGA 1S1EA 2M7NA 1RWYA 1A75B 1N0YA 2KFHA 3LK0A 2M9GA 3NSLA 4L9MA 1MHOA 2QACA 1DJGA 1ALVA 4AQIA 2LUCA 4YGEB 1AJ5A 1SKTA 1DMOA 2MJWB 2BBMA 3SG3A 2JTTA 3VROA 1QIVA 1MQ1A 1D1OA 3I5HB 4HREE 2SCPA 2KGRA 1DJXA 2I18A 1S36A 4N5XA 2LLTA 1DJIA 1M45A 2KHNA 2LC5A 2R2IA 3WHUB 3TS5C 2NXQA 1AVSA 3SG7A 1S6IA 1OZOA 1Y1XA 2ZKMX 3JVTB 2L4IA 4PE1A 3LL8B 1M46A 4YI8A 2F33A 1J1DA 2O5GA 1DJHA 1CLBA 4FTGA 4A4CA 3BUXB 5HYDA 3CTNA 5I8NA 1BODA 2GV5A 1IKUA 1AHRA 2PMYA 2AAOA 4USLA 1YR5A 2PRUA 5ER5A 1LVCD 1YURA 2Y1NA 1N65A 4FQOA 1WLMA 2JOJA 1JC2A 1SCMB 3CGAA 1B9AA 2LNKA 1IQ3A 2HQWA 2L4HA 4I5NB 2A4JA 1CDLA 5AERA 4U8DA 3MSEB 1WDCB 3ICBA 1UURA 2TN4A 1IJ5A 3VRNA 2LMUA 3IF7A 1M39A 3M0WA 1QVIZ 2M0RA 1KQMC 4N1GA 1A03A 1W7JB 4P2YB 1V1FA 4DIRA 1OMVA 1DF0A 1SMGA 5KU1A 1PULA 2LCPA 2OTGC 2PSRA 1SRAA 2HETA 2M8UA 1DJWA 2QPTA 4A4BA 4BY4A 1J7PA 1KQVA 4PHJA 1KWOB 3TDZA 1MXEA 2M29A 3D0YA 1E8AA 4XYNA 1TOPA 1NIWA 2G2BA 2M49B 3I5GC 2NCPA 2OS8C 3GOFA 1SL7A 2FOTA 1NX3A 2H2KA 2K61A 4I5JA 5J3XA 2CT9A 4PHMA 3NSOA 2EHBA 2FCEA 4OCIA 2LV7A 4HRGA 4P5OE 2WCFA 3TZ1A 1F8HA 2OPOA 3CLNA 1K96A 2LMVA 3IQQA 4JWQA 4MVFA 5AEQA 1MR8A 1HQVA 1BT6A 1JF2A 5AXIA 1UHHA 1SBJA 2JWWA 1H8BA 2F3ZA 1SCVA 2Y5IA 3JTDC 2JZIA 2CBLA 4PHKA 1QVIY 1YVHA 1L7ZA 1TNPA 1JF0A 1GGWA 1K94A 2M97A 4IL1A 3O2PA 1XFXO 1AUIB 3I5HC 1QS7A 3PN7B 3I5FB 1PSBA 4ORBB 3SIAA 2F8PA 3CR4X 1YVLA 2H61A 4MZKA 4D1EA 3DD4A 3K21A 2MLFC 1IWQA 4YGDB 1PVBA 4PDZA 2E6WA 1A2XA 2JNXA 5FYXA 2M7LA 1A75A 2ZRTA 1YX7A 4AOMA 1J1EA 4NDDA 4MSPA 3A8RA 1CFPA 4WQ2A 1FF1A 4YGBB 1QASA 1XA5A 1F4QA 3EVUA 2ZNDA 4C0JA 4CFQA 5HKYA 3I5FC 3TUYC 1AJ4A 4CFRA 3DVMA 2M3WA 1EL4A 1U5IB 1LA3A 4C0KA 1RROA 1HT9A 3EVRA 2L0PA 4GGFA 4M2OA 3PATA 2KQYA 1WDCC 2KAYA 3DVJA 1L2OC 1TNWA 1BR4B 1YUTA 3RLZA 2G9BA 1JBAA 2BKIB 1K9KA 2ZNEA 1F54A 2MAZA 2EC6C 1SK6D 4PE0A 4PALA 4XJKA 4PE4A 2WOSA 1YRTB 2LAPA 1TN4A 3BOWA 3CR5X 2E30A 4AQJA 1ODBA 1KQMB 1K90D 3BXKA 1R2UA 1DF0B 1XFYO 4ORAB 5I2QA 1WY9A 2KI6C 2K0JA 2WORA 1N2DA 1S5GY 2ISDA 1BR1B 1XYDA 3AKBA 1GJYA 2JULA 2M1UA 1K95A 1QX2A 3FS7A 1RECA 2KI6D 2LM5A 2LUXA 3KPXA 1GQMA 1RJVA 1WRZA 1KK7Z 1TRFA 2L51A 3BQ3A 2F2OA 5DKQA 1FPWA 1VRKA 1S5GZ 1FI5A 2JXLA 3PALA 3EK4A 4YGAA 1C7WA 3WXAA 4ICBA 1S6JA 2JT0A 1Y0VH 2AMIA 3EK8A 1UHIA 4DUQA 4F0ZB 2ZN9A 1J7OA 1A29A 1IGVA 2NZ0A 1JWDA 1KFUL 4NDBA 1RTP1 2CTNA 4PHNA 1PRWA 3SJSA 3TDIA 1BU3A 2V53A 2P6BB 4YBHB 3JTDB 4ZCUA 1WRKA 1LXFC 1NCZA 1NCXA 2NLNA 5CSIA 1SY9A 4CIDA 2F3YA 2CXJA 1B1GA 1UHJA 1OQPA 4PE7A 2COLB 2KFFA 1UUSA 2L50A 3PN7C 2LP3A 1CKKA 4R1EA 2LE9B 3FIAA 3PM8A 5B8IB 1K2HA 1K9PA 1SL8A 4QJ3B 3FWCA 3TDUA 5CPVA 3JVTC 5G08A 2JRFA 2CCMA 1KSMA 1QV0A 2CNPA 2KYFA 4DRWA 2LLSA 1A4PA 5JJGA 1B7TZ 1K9UA 2D8NA 1Y6WA 3ZNIA 2O60A 4MZLA 4UPGA 1F55A 5IBWA 4MRYA 3TUYB 3VGOA 1BLQA 1TNXA 4WQ3A 1C7VA 1G4YR 3O6BA 4GBAA 5PALA 3DF0A 5HLOA 1K8UA 1QIWA 3A4UB 5DKNA 2ZFDA 2KI4B 1OSAA 4HRHA 5I2OA 4MRXA 1KWOC 3AKAA 3NSKA 2Q91A 5JOLA 1OMRA 1XVJA 1Y1AA 1B4CA 1WRLA 1L2OB 1XK4A 3I5GB 4N1FA 4WRIA 3EVVA 3SG4A 3HX4A 2JPTA 4YRUA 2LANA 3BUWB 5D7FA 2KBIA 1ZFSA 1ZMZA 3GK2A 1XFUO 3KHEA 1NSHA 1NX1A 1B7TY 4QJ5B 4ORCB 2LVJA 1IJ6A 1PK0D 2Q4UA 2GGMA 2IS9A 4DS7A 1RK9A 1UP5A 3CWGA 4M2QA 1QLSA 2KQ6A 3I5IC 4CPVA 1CDNA 2BCAA 2Y4QA 2M1KB 5K89A 1DJZA 3WHTB 4BY5A 1YUSA 5AFPA 5HLVA 2MBXA 1FW4A 1B8CA 1JFKA 1KSOA 1MUXA 2BL0B 2LP2A 5BPJA 1C07A 2ZN8A 1QX5B 4ETOA 1DT7B 2FCDA 2BBNA 1Q80A 4I5LB 1XO5A 4PCWA 1QLKA 1AK8A 1TCOB 4HSZA 1JFJA 4M2PA 2B1UA 1SPYA 1JUOA 1V1GA 1KFXS 3KF9A 4NDCA 3HCMA 1OZSA 1MF8B 5KSZA 1S6CA 1MWNA 2K7BA 2KGBC 5TNCA 2MHHA 1NX0A 2BL0C 4MEWA 5AANA 3ZWHA 4MLWA 1NWDA 1ZUZA 3BUOB 3OHMB 1S3PA 1ZOTB 2LHLA 2L5XB 3OX5A 1CLLA 4MBEA 4Q04A 3OB1B 4ZCVA 2JTZA 1OE9B 3C1VA 2WCEA 1LA0A 3SIBA 1KCYA 2KBMA 1KK8C 1B8LA 1UWOA 1TCFA 2FJUB 1IG5A 2BE6A 3RM1A 1CMFA 1CFDA 2JXCA 3DF0B 5KTYA 4GAOA 3SG5A 4JPZB 2KYCA 3OB2B 1BG1A 1GGZA 1DGVA 4YGCB 1H4BA 3NSIA 1M63B 1SNLA 2NCOA 3BUNB 3LCPC 1QV1A 1DGUA 1CDMA 2KI4C 4GGFC 4JQ0D 2HPSA 3PLFB 4YI9A 1CM1A 1ZACA 2JC2A 2LLUA 1EXRA 1S26D 3O4YA 1KK8B 3PSRA 3KEVA 3D0YB 4I5KA 3LLEA 4GFTA 4OV2A 1LKJA 1CFFA 1QATA 1X02A 2BCXA 4GPLB 1JSAA 3VRRA 3EKHA 1U5IA 1MXLC 1IRJA 5CSJA 2LVVA 2OTGB 3D10A 2JQ6A 1G33A 1IQ5A 1SCMC 2KNEA 2L98A 2F2PA 2RGIA 1KFXL 3IQOA 2JNFA 2K2FA 1DTLA 2BECA 1CDPA 3VRPA 1F4OA 1Y1UA 2KDHA 3EK7A 3I5IB 2DOQA 1DJYA 2LMTA 1CNPA 2MA2A 2BE4A 1TIZA 1RFJA 3E3RA 4XJKB 5F6TA 1YRUB 3NXAA 3OP0A 1OMDA 2ZRSA 4QJ4B 1BMOA 3AAKA 4TNCA 1F71A 3AAJA 2KAVA 1SW8A 1XFVO 3SG2A 1BJFA 1K93D 1UHKA 2BCBA 4OR9B 5DKRA 1G8IA 2K7OA 2LHIA 1XFWO 2L2EA 2WCBA 3CS1A 1NPQA 1YTZC 1W7IB 3VRQA 3KO0A 2PVBA 3LK1A 1IH0A 1SL9A 1QJTA 2OS8B 1EG3A 5HKZA 3PFVA 3TS5B 1J55A 2JT3A 3GK1A 4OVNF 1UHNA 2H61C 1R6PA 1ALWA 3CR2A 4E68A 3O78A 5I2LA 1EG4A 1QX7A 2JU0A 1NYAA 1NP8A 1PVAA 2PALA 3QRXA 1F70A 3FWBA 3H4SE 5CSNA 2SASA 2EGDA 2JT8A 2WC8A 1CTRA 3CZTX 2I2RE 1B47A 3F45A 3GK4X 1PSRA 2MLEC 5ER4X 1J7RA 4MN0A 2GGZA 1LINA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SG6 A;  1CFC A;  3BOW B;  2KSP A;  1QXP A;  2WND A;  1M31 A;  4C0L A;  2K2A A;  2PAS A;  1FI6 A;  4GGN A;  1TTX A;  3WNX B;  2HF5 A;  3BYA A;  1WLZ A;  3DVE A;  1AP4 A;  4DCK A;  1SR6 B;  2K7D A;  1XFZ O;  2LVK A;  2EC6 B;  4MZJ A;  1XK4 C;  2KOT A;  1BF5 A;  2K8M B;  3DVK A;  2I94 A;  1DVI A;  2Y1M A;  1TNQ A;  1KK7 Y;  3OX6 A;  1CB1 A;  1CLM A;  1BOC A;  1SR6 C;  1CMG A;  1CM4 A;  1B8R A;  4CLN A;  1FBV A;  2AUC A;  4OKH A;  2KFG A;  1EJ3 A;  2BKH B;  1NX2 A;  4GNK B;  1YX8 A;  1KFU S;  1J7Q A;  2I7A A;  2LVI A;  1OOJ A;  2MRD A;  1EH2 A;  2HQ8 A;  5D69 A;  1NCY A;  5GQQ C;  2K7C A;  1QTX A;  2KAX A;  5CSF A;  1NUB A;  5HKW A;  1SYM A;  2VRG A;  3BUM B;  1PAL A;  3EKJ A;  4GUK A;  1YUU A;  4NQG A;  1S1E A;  2M7N A;  1RWY A;  1A75 B;  1N0Y A;  2KFH A;  3LK0 A;  2M9G A;  3NSL A;  4L9M A;  1MHO A;  2QAC A;  1DJG A;  1ALV A;  4AQI A;  2LUC A;  4YGE B;  1AJ5 A;  1SKT A;  1DMO A;  2MJW B;  2BBM A;  3SG3 A;  2JTT A;  3VRO A;  1QIV A;  1MQ1 A;  1D1O A;  3I5H B;  4HRE E;  2SCP A;  2KGR A;  1DJX A;  2I18 A;  1S36 A;  4N5X A;  2LLT A;  1DJI A;  1M45 A;  2KHN A;  2LC5 A;  2R2I A;  3WHU B;  3TS5 C;  2NXQ A;  1AVS A;  3SG7 A;  1S6I A;  1OZO A;  1Y1X A;  2ZKM X;  3JVT B;  2L4I A;  4PE1 A;  3LL8 B;  1M46 A;  4YI8 A;  2F33 A;  1J1D A;  2O5G A;  1DJH A;  1CLB A;  4FTG A;  4A4C A;  3BUX B;  5HYD A;  3CTN A;  5I8N A;  1BOD A;  2GV5 A;  1IKU A;  1AHR A;  2PMY A;  2AAO A;  4USL A;  1YR5 A;  2PRU A;  5ER5 A;  1LVC D;  1YUR A;  2Y1N A;  1N65 A;  4FQO A;  1WLM A;  2JOJ A;  1JC2 A;  1SCM B;  3CGA A;  1B9A A;  2LNK A;  1IQ3 A;  2HQW A;  2L4H A;  4I5N B;  2A4J A;  1CDL A;  5AER A;  4U8D A;  3MSE B;  1WDC B;  3ICB A;  1UUR A;  2TN4 A;  1IJ5 A;  3VRN A;  2LMU A;  3IF7 A;  1M39 A;  3M0W A;  1QVI Z;  2M0R A;  1KQM C;  4N1G A;  1A03 A;  1W7J B;  4P2Y B;  1V1F A;  4DIR A;  1OMV A;  1DF0 A;  1SMG A;  5KU1 A;  1PUL A;  2LCP A;  2OTG C;  2PSR A;  1SRA A;  2HET A;  2M8U A;  1DJW A;  2QPT A;  4A4B A;  4BY4 A;  1J7P A;  1KQV A;  4PHJ A;  1KWO B;  3TDZ A;  1MXE A;  2M29 A;  3D0Y A;  1E8A A;  4XYN A;  1TOP A;  1NIW A;  2G2B A;  2M49 B;  3I5G C;  2NCP A;  2OS8 C;  3GOF A;  1SL7 A;  2FOT A;  1NX3 A;  2H2K A;  2K61 A;  4I5J A;  5J3X A;  2CT9 A;  4PHM A;  3NSO A;  2EHB A;  2FCE A;  4OCI A;  2LV7 A;  4HRG A;  4P5O E;  2WCF A;  3TZ1 A;  1F8H A;  2OPO A;  3CLN A;  1K96 A;  2LMV A;  3IQQ A;  4JWQ A;  4MVF A;  5AEQ A;  1MR8 A;  1HQV A;  1BT6 A;  1JF2 A;  5AXI A;  1UHH A;  1SBJ A;  2JWW A;  1H8B A;  2F3Z A;  1SCV A;  2Y5I A;  3JTD C;  2JZI A;  2CBL A;  4PHK A;  1QVI Y;  1YVH A;  1L7Z A;  1TNP A;  1JF0 A;  1GGW A;  1K94 A;  2M97 A;  4IL1 A;  3O2P A;  1XFX O;  1AUI B;  3I5H C;  1QS7 A;  3PN7 B;  3I5F B;  1PSB A;  4ORB B;  3SIA A;  2F8P A;  3CR4 X;  1YVL A;  2H61 A;  4MZK A;  4D1E A;  3DD4 A;  3K21 A;  2MLF C;  1IWQ A;  4YGD B;  1PVB A;  4PDZ A;  2E6W A;  1A2X A;  2JNX A;  5FYX A;  2M7L A;  1A75 A;  2ZRT A;  1YX7 A;  4AOM A;  1J1E A;  4NDD A;  4MSP A;  3A8R A;  1CFP A;  4WQ2 A;  1FF1 A;  4YGB B;  1QAS A;  1XA5 A;  1F4Q A;  3EVU A;  2ZND A;  4C0J A;  4CFQ A;  5HKY A;  3I5F C;  3TUY C;  1AJ4 A;  4CFR A;  3DVM A;  2M3W A;  1EL4 A;  1U5I B;  1LA3 A;  4C0K A;  1RRO A;  1HT9 A;  3EVR A;  2L0P A;  4GGF A;  4M2O A;  3PAT A;  2KQY A;  1WDC C;  2KAY A;  3DVJ A;  1L2O C;  1TNW A;  1BR4 B;  1YUT A;  3RLZ A;  2G9B A;  1JBA A;  2BKI B;  1K9K A;  2ZNE A;  1F54 A;  2MAZ A;  2EC6 C;  1SK6 D;  4PE0 A;  4PAL A;  4XJK A;  4PE4 A;  2WOS A;  1YRT B;  2LAP A;  1TN4 A;  3BOW A;  3CR5 X;  2E30 A;  4AQJ A;  1ODB A;  1KQM B;  1K90 D;  3BXK A;  1R2U A;  1DF0 B;  1XFY O;  4ORA B;  5I2Q A;  1WY9 A;  2KI6 C;  2K0J A;  2WOR A;  1N2D A;  1S5G Y;  2ISD A;  1BR1 B;  1XYD A;  3AKB A;  1GJY A;  2JUL A;  2M1U A;  1K95 A;  1QX2 A;  3FS7 A;  1REC A;  2KI6 D;  2LM5 A;  2LUX A;  3KPX A;  1GQM A;  1RJV A;  1WRZ A;  1KK7 Z;  1TRF A;  2L51 A;  3BQ3 A;  2F2O A;  5DKQ A;  1FPW A;  1VRK A;  1S5G Z;  1FI5 A;  2JXL A;  3PAL A;  3EK4 A;  4YGA A;  1C7W A;  3WXA A;  4ICB A;  1S6J A;  2JT0 A;  1Y0V H;  2AMI A;  3EK8 A;  1UHI A;  4DUQ A;  4F0Z B;  2ZN9 A;  1J7O A;  1A29 A;  1IGV A;  2NZ0 A;  1JWD A;  1KFU L;  4NDB A;  1RTP 1;  2CTN A;  4PHN A;  1PRW A;  3SJS A;  3TDI A;  1BU3 A;  2V53 A;  2P6B B;  4YBH B;  3JTD B;  4ZCU A;  1WRK A;  1LXF C;  1NCZ A;  1NCX A;  2NLN A;  5CSI A;  1SY9 A;  4CID A;  2F3Y A;  2CXJ A;  1B1G A;  1UHJ A;  1OQP A;  4PE7 A;  2COL B;  2KFF A;  1UUS A;  2L50 A;  3PN7 C;  2LP3 A;  1CKK A;  4R1E A;  2LE9 B;  3FIA A;  3PM8 A;  5B8I B;  1K2H A;  1K9P A;  1SL8 A;  4QJ3 B;  3FWC A;  3TDU A;  5CPV A;  3JVT C;  5G08 A;  2JRF A;  2CCM A;  1KSM A;  1QV0 A;  2CNP A;  2KYF A;  4DRW A;  2LLS A;  1A4P A;  5JJG A;  1B7T Z;  1K9U A;  2D8N A;  1Y6W A;  3ZNI A;  2O60 A;  4MZL A;  4UPG A;  1F55 A;  5IBW A;  4MRY A;  3TUY B;  3VGO A;  1BLQ A;  1TNX A;  4WQ3 A;  1C7V A;  1G4Y R;  3O6B A;  4GBA A;  5PAL A;  3DF0 A;  5HLO A;  1K8U A;  1QIW A;  3A4U B;  5DKN A;  2ZFD A;  2KI4 B;  1OSA A;  4HRH A;  5I2O A;  4MRX A;  1KWO C;  3AKA A;  3NSK A;  2Q91 A;  5JOL A;  1OMR A;  1XVJ A;  1Y1A A;  1B4C A;  1WRL A;  1L2O B;  1XK4 A;  3I5G B;  4N1F A;  4WRI A;  3EVV A;  3SG4 A;  3HX4 A;  2JPT A;  4YRU A;  2LAN A;  3BUW B;  5D7F A;  2KBI A;  1ZFS A;  1ZMZ A;  3GK2 A;  1XFU O;  3KHE A;  1NSH A;  1NX1 A;  1B7T Y;  4QJ5 B;  4ORC B;  2LVJ A;  1IJ6 A;  1PK0 D;  2Q4U A;  2GGM A;  2IS9 A;  4DS7 A;  1RK9 A;  1UP5 A;  3CWG A;  4M2Q A;  1QLS A;  2KQ6 A;  3I5I C;  4CPV A;  1CDN A;  2BCA A;  2Y4Q A;  2M1K B;  5K89 A;  1DJZ A;  3WHT B;  4BY5 A;  1YUS A;  5AFP A;  5HLV A;  2MBX A;  1FW4 A;  1B8C A;  1JFK A;  1KSO A;  1MUX A;  2BL0 B;  2LP2 A;  5BPJ A;  1C07 A;  2ZN8 A;  1QX5 B;  4ETO A;  1DT7 B;  2FCD A;  2BBN A;  1Q80 A;  4I5L B;  1XO5 A;  4PCW A;  1QLK A;  1AK8 A;  1TCO B;  4HSZ A;  1JFJ A;  4M2P A;  2B1U A;  1SPY A;  1JUO A;  1V1G A;  1KFX S;  3KF9 A;  4NDC A;  3HCM A;  1OZS A;  1MF8 B;  5KSZ A;  1S6C A;  1MWN A;  2K7B A;  2KGB C;  5TNC A;  2MHH A;  1NX0 A;  2BL0 C;  4MEW A;  5AAN A;  3ZWH A;  4MLW A;  1NWD A;  1ZUZ A;  3BUO B;  3OHM B;  1S3P A;  1ZOT B;  2LHL A;  2L5X B;  3OX5 A;  1CLL A;  4MBE A;  4Q04 A;  3OB1 B;  4ZCV A;  2JTZ A;  1OE9 B;  3C1V A;  2WCE A;  1LA0 A;  3SIB A;  1KCY A;  2KBM A;  1KK8 C;  1B8L A;  1UWO A;  1TCF A;  2FJU B;  1IG5 A;  2BE6 A;  3RM1 A;  1CMF A;  1CFD A;  2JXC A;  3DF0 B;  5KTY A;  4GAO A;  3SG5 A;  4JPZ B;  2KYC A;  3OB2 B;  1BG1 A;  1GGZ A;  1DGV A;  4YGC B;  1H4B A;  3NSI A;  1M63 B;  1SNL A;  2NCO A;  3BUN B;  3LCP C;  1QV1 A;  1DGU A;  1CDM A;  2KI4 C;  4GGF C;  4JQ0 D;  2HPS A;  3PLF B;  4YI9 A;  1CM1 A;  1ZAC A;  2JC2 A;  2LLU A;  1EXR A;  1S26 D;  3O4Y A;  1KK8 B;  3PSR A;  3KEV A;  3D0Y B;  4I5K A;  3LLE A;  4GFT A;  4OV2 A;  1LKJ A;  1CFF A;  1QAT A;  1X02 A;  2BCX A;  4GPL B;  1JSA A;  3VRR A;  3EKH A;  1U5I A;  1MXL C;  1IRJ A;  5CSJ A;  2LVV A;  2OTG B;  3D10 A;  2JQ6 A;  1G33 A;  1IQ5 A;  1SCM C;  2KNE A;  2L98 A;  2F2P A;  2RGI A;  1KFX L;  3IQO A;  2JNF A;  2K2F A;  1DTL A;  2BEC A;  1CDP A;  3VRP A;  1F4O A;  1Y1U A;  2KDH A;  3EK7 A;  3I5I B;  2DOQ A;  1DJY A;  2LMT A;  1CNP A;  2MA2 A;  2BE4 A;  1TIZ A;  1RFJ A;  3E3R A;  4XJK B;  5F6T A;  1YRU B;  3NXA A;  3OP0 A;  1OMD A;  2ZRS A;  4QJ4 B;  1BMO A;  3AAK A;  4TNC A;  1F71 A;  3AAJ A;  2KAV A;  1SW8 A;  1XFV O;  3SG2 A;  1BJF A;  1K93 D;  1UHK A;  2BCB A;  4OR9 B;  5DKR A;  1G8I A;  2K7O A;  2LHI A;  1XFW O;  2L2E A;  2WCB A;  3CS1 A;  1NPQ A;  1YTZ C;  1W7I B;  3VRQ A;  3KO0 A;  2PVB A;  3LK1 A;  1IH0 A;  1SL9 A;  1QJT A;  2OS8 B;  1EG3 A;  5HKZ A;  3PFV A;  3TS5 B;  1J55 A;  2JT3 A;  3GK1 A;  4OVN F;  1UHN A;  2H61 C;  1R6P A;  1ALW A;  3CR2 A;  4E68 A;  3O78 A;  5I2L A;  1EG4 A;  1QX7 A;  2JU0 A;  1NYA A;  1NP8 A;  1PVA A;  2PAL A;  3QRX A;  1F70 A;  3FWB A;  3H4S E;  5CSN A;  2SAS A;  2EGD A;  2JT8 A;  2WC8 A;  1CTR A;  3CZT X;  2I2R E;  1B47 A;  3F45 A;  3GK4 X;  1PSR A;  2MLE C;  5ER4 X;  1J7R A;  4MN0 A;  2GGZ A;  1LIN A; 
#chains in the Genus database with same CATH topology
 3SG6 A;  1CFC A;  3BOW B;  2KSP A;  3R1O A;  1QXP A;  2FJY A;  2WND A;  1M31 A;  4C0L A;  2K2A A;  2PAS A;  1FI6 A;  4GGN A;  1TTX A;  3WNX B;  2HF5 A;  3BYA A;  1WLZ A;  3DVE A;  1AP4 A;  4DCK A;  1SR6 B;  2K7D A;  1XFZ O;  2LVK A;  2QDI A;  2EC6 B;  4MZJ A;  1XK4 C;  2KOT A;  1BF5 A;  1OOH A;  2K8M B;  3SS5 A;  3DVK A;  2I94 A;  1DVI A;  2Y1M A;  1TNQ A;  1KK7 Y;  3OX6 A;  1CB1 A;  1CLM A;  1BOC A;  2L5Y A;  1SR6 C;  1CMG A;  1CM4 A;  1B8R A;  4CLN A;  1FBV A;  2AUC A;  4OKH A;  2KFG A;  1EJ3 A;  2BKH B;  1NX2 A;  4GNK B;  1YX8 A;  1KFU S;  1J7Q A;  2I7A A;  2LVI A;  1OOJ A;  2MRD A;  3B7A A;  3FE9 A;  2HQ8 A;  5D69 A;  5FI6 A;  1NCY A;  1EH2 A;  5GQQ C;  2K7C A;  1QTX A;  2KAX A;  3CZ0 A;  1NUB A;  5CSF A;  5HKW A;  1SYM A;  2VRG A;  3BUM B;  1PAL A;  3EKJ A;  4GUK A;  1YUU A;  3NGV A;  4KYN A;  3O4X A;  1S1E A;  4NQG A;  2M7N A;  1RWY A;  1A75 B;  1N0Y A;  2KFH A;  3LK0 A;  2M9G A;  3NSL A;  3SS3 A;  4L9M A;  1ORG A;  2GTE A;  1MHO A;  2QAC A;  1DJG A;  5I94 A;  1ALV A;  4OZD A;  4AQI A;  2LUC A;  4YGE B;  1AJ5 A;  1SKT A;  1DMO A;  2MJW B;  2BBM A;  3DZT A;  3SG3 A;  2JTT A;  3S0A A;  3VRO A;  1QIV A;  1MQ1 A;  1D1O A;  3I5H B;  4HRE E;  5D3O A;  2SCP A;  2KGR A;  1DJX A;  2I18 A;  5FI7 A;  1S36 A;  4N5X A;  2LLT A;  1DJI A;  1M45 A;  2KHN A;  2LC5 A;  5FI2 A;  2R2I A;  1OOI X;  3WHU B;  3TS5 C;  2NXQ A;  1AVS A;  2WC6 A;  3SG7 A;  1S6I A;  1OZO A;  1Y1X A;  2ZKM X;  3JVT B;  2L4I A;  2QEH A;  4PE1 A;  3LL8 B;  3V2L A;  1M46 A;  4YI8 A;  2F33 A;  1J1D A;  2O5G A;  1DJH A;  1CLB A;  3UNW A;  4FTG A;  4A4C A;  3BUX B;  4JKT A;  5HYD A;  3CTN A;  2QEV A;  5I8N A;  1BOD A;  2GV5 A;  1IKU A;  1AHR A;  2PMY A;  2AAO A;  4USL A;  1YR5 A;  3K1E A;  2PRU A;  5ER5 A;  1LVC D;  1YUR A;  2Y1N A;  1N65 A;  4FQO A;  1WLM A;  2JOJ A;  1JC2 A;  1SCM B;  3CGA A;  1B9A A;  2LNK A;  1IQ3 A;  2HQW A;  2L4H A;  4I5N B;  2A4J A;  1CDL A;  5AER A;  4U8D A;  3MSE B;  1WDC B;  3ICB A;  3RZS A;  1UUR A;  2TN4 A;  3CZ1 A;  1IJ5 A;  3VRN A;  2LMU A;  3IF7 A;  1M39 A;  2WC5 A;  3M0W A;  3Q8I A;  1QVI Z;  2L2C A;  2M0R A;  1KQM C;  1C3Y A;  4N1G A;  1A03 A;  1W7J B;  1DQE A;  4P2Y B;  1V1F A;  4DIR A;  1OMV A;  1P28 A;  1DF0 A;  1SMG A;  5KU1 A;  1PUL A;  5DIC A;  2LCP A;  2OTG C;  2PSR A;  3L4A A;  1SRA A;  2HET A;  2M8U A;  1DJW A;  2QPT A;  4A4B A;  4BY4 A;  1J7P A;  1KQV A;  4PHJ A;  1KWO B;  3TDZ A;  1MXE A;  2M29 A;  3D0Y A;  1E8A A;  4XYN A;  1TOP A;  1NIW A;  2G2B A;  2M49 B;  3I5G C;  1T14 A;  2K60 A;  2NCP A;  2OS8 C;  3GOF A;  1SL7 A;  2FOT A;  1NX3 A;  2H2K A;  2K61 A;  4I5J A;  5J3X A;  2CT9 A;  4PHM A;  3NSO A;  2EHB A;  2FCE A;  4OCI A;  2LV7 A;  1OOF A;  4HRG A;  2WCF A;  4P5O E;  3TZ1 A;  1F8H A;  2OPO A;  3CLN A;  1K96 A;  2LMV A;  3IQQ A;  4JWQ A;  4MVF A;  5AEQ A;  1MR8 A;  1HQV A;  1BT6 A;  1JF2 A;  1QWV A;  5AXI A;  1UHH A;  2WCM A;  1SBJ A;  2JWW A;  1H8B A;  2F3Z A;  2WCL A;  1SCV A;  3PJI A;  2Y5I A;  3JTD C;  2JZI A;  2CBL A;  4PHK A;  1QVI Y;  1YVH A;  1L7Z A;  1TNP A;  1JF0 A;  1OOG A;  5HL1 A;  1GGW A;  1K94 A;  2M97 A;  4IL1 A;  3O2P A;  1XFX O;  1AUI B;  3I5H C;  1QS7 A;  3PN7 B;  3I5F B;  1PSB A;  4ORB B;  3SIA A;  3D78 A;  2F8P A;  3CR4 X;  1YVL A;  3L4L A;  2H61 A;  4MZK A;  4D1E A;  3DD4 A;  3K21 A;  2MLF C;  1IWQ A;  4YGD B;  1PVB A;  4PDZ A;  2E6W A;  1A2X A;  2JNX A;  5FYX A;  2M7L A;  1A75 A;  2ZRT A;  1YX7 A;  5EL2 A;  1J1E A;  4AOM A;  4NDD A;  4MSP A;  3A8R A;  1CFP A;  2QEB A;  4WQ2 A;  1FF1 A;  4YGB B;  1QAS A;  3CYZ A;  1XA5 A;  1F4Q A;  3EVU A;  2ZND A;  4C0J A;  4CFQ A;  5HKY A;  3I5F C;  3TUY C;  1AJ4 A;  4CFR A;  3DVM A;  2M3W A;  1EL4 A;  2WCH A;  1U5I B;  3CAB A;  1LA3 A;  4C0K A;  1RRO A;  1HT9 A;  3EVR A;  2L0P A;  4GGF A;  4M2O A;  3PAT A;  2KQY A;  1WDC C;  2KAY A;  3DVJ A;  1L2O C;  1TNW A;  1BR4 B;  1YUT A;  3RLZ A;  2G9B A;  1JBA A;  2BKI B;  1K9K A;  2ZNE A;  1F54 A;  2MAZ A;  3S0G A;  2EC6 C;  2WCJ A;  1SK6 D;  4PE0 A;  4PAL A;  4XJK A;  4PE4 A;  2WOS A;  1YRT B;  2LAP A;  1TN4 A;  3N7H A;  3BOW A;  3CR5 X;  2E30 A;  4AQJ A;  1ODB A;  1KQM B;  1K90 D;  1LS8 A;  1R2U A;  1DF0 B;  3BXK A;  1XFY O;  4ORA B;  2P70 A;  5I2Q A;  1WY9 A;  2KI6 C;  2K0J A;  2WOR A;  1N2D A;  3S0B A;  1S5G Y;  2ISD A;  1BR1 B;  1XYD A;  3AKB A;  1GJY A;  2JUL A;  1GM0 A;  2M1U A;  1K95 A;  1QX2 A;  3FS7 A;  1REC A;  2KI6 D;  2LM5 A;  2LUX A;  3KPX A;  3B88 A;  1GQM A;  1C3Z A;  1RJV A;  1WRZ A;  1KK7 Z;  1TRF A;  2L51 A;  3BQ3 A;  2F2O A;  5DKQ A;  1FPW A;  1VRK A;  1S5G Z;  1FI5 A;  2JXL A;  3IVT A;  3PAL A;  3EK4 A;  4YGA A;  1C7W A;  3WXA A;  4ICB A;  2PYQ A;  1S6J A;  2JT0 A;  1Y0V H;  2AMI A;  3EK8 A;  1UHI A;  4DUQ A;  4F0Z B;  3B87 A;  2ZN9 A;  1J7O A;  1A29 A;  1IGV A;  2NZ0 A;  1JWD A;  3DXL A;  1KFU L;  4NDB A;  1RTP 1;  2CTN A;  4PHN A;  1PRW A;  3SJS A;  3TDI A;  1BU3 A;  2ERB A;  4FQT A;  2V53 A;  2P6B B;  4JD9 A;  4YBH B;  3JTD B;  4ZCU A;  4F7F A;  1OW4 A;  1TWO A;  1WRK A;  1LXF C;  1NCZ A;  1NCX A;  2NLN A;  5CSI A;  1SY9 A;  4CID A;  2F3Y A;  2CXJ A;  1B1G A;  1UHJ A;  1OQP A;  4PE7 A;  2COL B;  2KFF A;  1UUS A;  2L50 A;  3PN7 C;  2LP3 A;  1CKK A;  4R1E A;  3D76 A;  2LE9 B;  3FIA A;  3PM8 A;  5B8I B;  1K2H A;  1K9P A;  1SL8 A;  2QEO A;  4QJ3 B;  3FWC A;  3TDU A;  3FE8 A;  3D73 A;  3JVT C;  5CPV A;  5G08 A;  2JRF A;  2YGU A;  2CCM A;  3DY9 A;  1KSM A;  1QV0 A;  2CNP A;  2KYF A;  4DRW A;  2LLS A;  1A4P A;  5JJG A;  1B7T Z;  1K9U A;  2D8N A;  1Y6W A;  3ZNI A;  2O60 A;  4MZL A;  4UPG A;  1F55 A;  5IBW A;  1DC1 A;  4MRY A;  3TUY B;  3VGO A;  1BLQ A;  3D75 A;  1TNX A;  4WQ3 A;  1C7V A;  1G4Y R;  3O6B A;  4GBA A;  4IJ7 A;  5PAL A;  3DF0 A;  5HLO A;  1K8U A;  1QIW A;  3A4U B;  5DKN A;  2ZFD A;  2KI4 B;  1OSA A;  4HRH A;  5I2O A;  4MRX A;  3CDN A;  1KWO C;  3AKA A;  3NSK A;  2Q91 A;  2KLE A;  1OMR A;  5JOL A;  3S0D A;  1XVJ A;  1Y1A A;  1B4C A;  1WRL A;  1L2O B;  1XK4 A;  3I5G B;  4N1F A;  4WRI A;  3EVV A;  3SG4 A;  3HX4 A;  2JPT A;  4YRU A;  2LAN A;  3BUW B;  5D7F A;  2KBI A;  1ZFS A;  1ZMZ A;  3GK2 A;  1XFU O;  3KHE A;  1NSH A;  1NX1 A;  1B7T Y;  4QJ5 B;  4ORC B;  3BFB A;  2LVJ A;  1IJ6 A;  1PK0 D;  2Q4U A;  2GGM A;  3QME A;  3B6X A;  2IS9 A;  4DS7 A;  1RK9 A;  1UP5 A;  3CWG A;  4M2Q A;  1QLS A;  3D74 A;  2KQ6 A;  3I5I C;  4CPV A;  1CDN A;  2BCA A;  3B86 A;  2Y4Q A;  2M1K B;  5K89 A;  1DJZ A;  3WHT B;  4BY5 A;  1YUS A;  5AFP A;  5HLV A;  2MBX A;  1FW4 A;  3FE6 A;  1B8C A;  3BFA A;  1JFK A;  1KSO A;  4INX A;  1MUX A;  2BL0 B;  2LP2 A;  5BPJ A;  3DYE A;  1C07 A;  2ZN8 A;  1QX5 B;  4ETO A;  1DT7 B;  2FCD A;  2BAP A;  2BBN A;  1Q80 A;  3NHT A;  4I5L B;  1XO5 A;  4PCW A;  1QLK A;  3BJH A;  3SS4 A;  1AK8 A;  1TCO B;  4HSZ A;  4PT1 A;  4M2P A;  2B1U A;  1DEL A;  1JFJ A;  1SPY A;  1JUO A;  1V1G A;  2KPH A;  2WCK A;  1SSE B;  1KFX S;  3KF9 A;  4NDC A;  3HCM A;  1OZS A;  1MF8 B;  2PQL A;  5KSZ A;  1S6C A;  1MWN A;  2K7B A;  2KGB C;  3NHI A;  2MHH A;  5TNC A;  1NX0 A;  2BL0 C;  4MEW A;  5AAN A;  3ZWH A;  4MLW A;  1NWD A;  1ZUZ A;  3BUO B;  3OHM B;  1S3P A;  1ZOT B;  2LHL A;  2L5X B;  3OX5 A;  1CLL A;  4MBE A;  4Q04 A;  3OB1 B;  4ZCV A;  2JTZ A;  1OE9 B;  3C1V A;  3VB1 A;  2WCE A;  1LA0 A;  3SIB A;  1KCY A;  2KBM A;  1KK8 C;  1B8L A;  1UWO A;  1TCF A;  2FJU B;  1IG5 A;  2BE6 A;  3S0F A;  3RM1 A;  2P71 A;  1CMF A;  2KLD A;  1CFD A;  2JXC A;  3DF0 B;  5KTY A;  4GAO A;  3SG5 A;  4JPZ B;  2KYC A;  3OB2 B;  1BG1 A;  1GGZ A;  1DGV A;  4YGC B;  1H4B A;  3NSI A;  1M63 B;  1SNL A;  2NCO A;  3BUN B;  3LCP C;  1QV1 A;  1DGU A;  1CDM A;  2KI4 C;  4GGF C;  4JQ0 D;  2HPS A;  3PLF B;  4YI9 A;  1CM1 A;  1ZAC A;  2JC2 A;  2LLU A;  1EXR A;  1S26 D;  3O4Y A;  1KK8 B;  3PSR A;  3KEV A;  3D0Y B;  4I5K A;  3LLE A;  4GFT A;  4OV2 A;  1LKJ A;  1CFF A;  1QAT A;  1X02 A;  2BCX A;  4GPL B;  1JSA A;  3VRR A;  3EKH A;  1U5I A;  1MXL C;  1IRJ A;  1XFR A;  5CSJ A;  2LVV A;  2OTG B;  3D10 A;  2JQ6 A;  1G33 A;  1IQ5 A;  1SCM C;  2KNE A;  2L98 A;  2F2P A;  2RGI A;  3S0E A;  1KFX L;  3BFH A;  3IQO A;  2JNF A;  2K2F A;  4INW A;  3L47 A;  1DTL A;  2BEC A;  3R1P A;  1CDP A;  3VRP A;  3PM2 A;  1F4O A;  1Y1U A;  2KDH A;  3R1V A;  3EK7 A;  3I5I B;  2DOQ A;  1DJY A;  2LMT A;  1CNP A;  1Z2C B;  2MA2 A;  1IIO A;  2BE4 A;  1TIZ A;  1RFJ A;  3E3R A;  4XJK B;  3OGN A;  5F6T A;  1YRU B;  3NXA A;  3OP0 A;  1OMD A;  2ZRS A;  1W9Z A;  4QJ4 B;  2JPO A;  1BMO A;  3AAK A;  4TNC A;  1F71 A;  3AAJ A;  2KAV A;  1SW8 A;  1XFV O;  3SG2 A;  1Z4H A;  1BJF A;  1K93 D;  1UHK A;  2BCB A;  4OR9 B;  5DKR A;  1G8I A;  2K7O A;  2LHI A;  1DEK A;  1XFW O;  2L2E A;  2WCB A;  3CS1 A;  1NPQ A;  1TUZ A;  1YTZ C;  1W7I B;  3VRQ A;  3KO0 A;  2PVB A;  3LK1 A;  1IH0 A;  1SL9 A;  3R72 A;  1QJT A;  3EG5 B;  2OS8 B;  1EG3 A;  5HKZ A;  3PFV A;  3TS5 B;  1J55 A;  2JT3 A;  3GK1 A;  4OVN F;  1UHN A;  2H61 C;  3CZ2 A;  1R6P A;  1ALW A;  3CR2 A;  4E68 A;  3O78 A;  5I2L A;  1EG4 A;  1QX7 A;  2JU0 A;  1TUJ A;  1NYA A;  1NP8 A;  1PVA A;  2PAL A;  3QRX A;  1F70 A;  3FWB A;  3UO9 A;  3H4S E;  5CSN A;  2H8V A;  2SAS A;  2EGD A;  2JT8 A;  2WC8 A;  1CTR A;  3OBV A;  3CZT X;  2I2R E;  3D77 A;  1B47 A;  2BNX A;  3F45 A;  3GK4 X;  1PSR A;  2MLE C;  5ER4 X;  1J7R A;  4MN0 A;  2GGZ A;  1LIN A; 
#chains in the Genus database with same CATH homology
 3SG6 A;  1CFC A;  3BOW B;  2KSP A;  1QXP A;  2WND A;  1M31 A;  4C0L A;  2K2A A;  2PAS A;  1FI6 A;  4GGN A;  1TTX A;  3WNX B;  2HF5 A;  3BYA A;  1WLZ A;  3DVE A;  1AP4 A;  4DCK A;  1SR6 B;  2K7D A;  1XFZ O;  2LVK A;  2EC6 B;  4MZJ A;  1XK4 C;  2KOT A;  1BF5 A;  2K8M B;  3DVK A;  2I94 A;  1DVI A;  2Y1M A;  1TNQ A;  1KK7 Y;  3OX6 A;  1CB1 A;  1CLM A;  1BOC A;  1SR6 C;  1CMG A;  1CM4 A;  1B8R A;  4CLN A;  1FBV A;  2AUC A;  4OKH A;  2KFG A;  1EJ3 A;  2BKH B;  1NX2 A;  4GNK B;  1YX8 A;  1KFU S;  1J7Q A;  2I7A A;  2LVI A;  1OOJ A;  2MRD A;  1EH2 A;  2HQ8 A;  5D69 A;  1NCY A;  5GQQ C;  2K7C A;  1QTX A;  2KAX A;  5CSF A;  1NUB A;  5HKW A;  1SYM A;  2VRG A;  3BUM B;  1PAL A;  3EKJ A;  4GUK A;  1YUU A;  4NQG A;  1S1E A;  2M7N A;  1RWY A;  1A75 B;  1N0Y A;  2KFH A;  3LK0 A;  2M9G A;  3NSL A;  4L9M A;  1MHO A;  2QAC A;  1DJG A;  1ALV A;  4AQI A;  2LUC A;  4YGE B;  1AJ5 A;  1SKT A;  1DMO A;  2MJW B;  2BBM A;  3SG3 A;  2JTT A;  3VRO A;  1QIV A;  1MQ1 A;  1D1O A;  3I5H B;  4HRE E;  2SCP A;  2KGR A;  1DJX A;  2I18 A;  1S36 A;  4N5X A;  2LLT A;  1DJI A;  1M45 A;  2KHN A;  2LC5 A;  2R2I A;  3WHU B;  3TS5 C;  2NXQ A;  1AVS A;  3SG7 A;  1S6I A;  1OZO A;  1Y1X A;  2ZKM X;  3JVT B;  2L4I A;  4PE1 A;  3LL8 B;  1M46 A;  4YI8 A;  2F33 A;  1J1D A;  2O5G A;  1DJH A;  1CLB A;  4FTG A;  4A4C A;  3BUX B;  5HYD A;  3CTN A;  5I8N A;  1BOD A;  2GV5 A;  1IKU A;  1AHR A;  2PMY A;  2AAO A;  4USL A;  1YR5 A;  2PRU A;  5ER5 A;  1LVC D;  1YUR A;  2Y1N A;  1N65 A;  4FQO A;  1WLM A;  2JOJ A;  1JC2 A;  1SCM B;  3CGA A;  1B9A A;  2LNK A;  1IQ3 A;  2HQW A;  2L4H A;  4I5N B;  2A4J A;  1CDL A;  5AER A;  4U8D A;  3MSE B;  1WDC B;  3ICB A;  1UUR A;  2TN4 A;  1IJ5 A;  3VRN A;  2LMU A;  3IF7 A;  1M39 A;  3M0W A;  1QVI Z;  2M0R A;  1KQM C;  4N1G A;  1A03 A;  1W7J B;  4P2Y B;  1V1F A;  4DIR A;  1OMV A;  1DF0 A;  1SMG A;  5KU1 A;  1PUL A;  2LCP A;  2OTG C;  2PSR A;  1SRA A;  2HET A;  2M8U A;  1DJW A;  2QPT A;  4A4B A;  4BY4 A;  1J7P A;  1KQV A;  4PHJ A;  1KWO B;  3TDZ A;  1MXE A;  2M29 A;  3D0Y A;  1E8A A;  4XYN A;  1TOP A;  1NIW A;  2G2B A;  2M49 B;  3I5G C;  2NCP A;  2OS8 C;  3GOF A;  1SL7 A;  2FOT A;  1NX3 A;  2H2K A;  2K61 A;  4I5J A;  5J3X A;  2CT9 A;  4PHM A;  3NSO A;  2EHB A;  2FCE A;  4OCI A;  2LV7 A;  4HRG A;  4P5O E;  2WCF A;  3TZ1 A;  1F8H A;  2OPO A;  3CLN A;  1K96 A;  2LMV A;  3IQQ A;  4JWQ A;  4MVF A;  5AEQ A;  1MR8 A;  1HQV A;  1BT6 A;  1JF2 A;  5AXI A;  1UHH A;  1SBJ A;  2JWW A;  1H8B A;  2F3Z A;  1SCV A;  2Y5I A;  3JTD C;  2JZI A;  2CBL A;  4PHK A;  1QVI Y;  1YVH A;  1L7Z A;  1TNP A;  1JF0 A;  1GGW A;  1K94 A;  2M97 A;  4IL1 A;  3O2P A;  1XFX O;  1AUI B;  3I5H C;  1QS7 A;  3PN7 B;  3I5F B;  1PSB A;  4ORB B;  3SIA A;  2F8P A;  3CR4 X;  1YVL A;  2H61 A;  4MZK A;  4D1E A;  3DD4 A;  3K21 A;  2MLF C;  1IWQ A;  4YGD B;  1PVB A;  4PDZ A;  2E6W A;  1A2X A;  2JNX A;  5FYX A;  2M7L A;  1A75 A;  2ZRT A;  1YX7 A;  4AOM A;  1J1E A;  4NDD A;  4MSP A;  3A8R A;  1CFP A;  4WQ2 A;  1FF1 A;  4YGB B;  1QAS A;  1XA5 A;  1F4Q A;  3EVU A;  2ZND A;  4C0J A;  4CFQ A;  5HKY A;  3I5F C;  3TUY C;  1AJ4 A;  4CFR A;  3DVM A;  2M3W A;  1EL4 A;  1U5I B;  1LA3 A;  4C0K A;  1RRO A;  1HT9 A;  3EVR A;  2L0P A;  4GGF A;  4M2O A;  3PAT A;  2KQY A;  1WDC C;  2KAY A;  3DVJ A;  1L2O C;  1TNW A;  1BR4 B;  1YUT A;  3RLZ A;  2G9B A;  1JBA A;  2BKI B;  1K9K A;  2ZNE A;  1F54 A;  2MAZ A;  2EC6 C;  1SK6 D;  4PE0 A;  4PAL A;  4XJK A;  4PE4 A;  2WOS A;  1YRT B;  2LAP A;  1TN4 A;  3BOW A;  3CR5 X;  2E30 A;  4AQJ A;  1ODB A;  1KQM B;  1K90 D;  3BXK A;  1R2U A;  1DF0 B;  1XFY O;  4ORA B;  5I2Q A;  1WY9 A;  2KI6 C;  2K0J A;  2WOR A;  1N2D A;  1S5G Y;  2ISD A;  1BR1 B;  1XYD A;  3AKB A;  1GJY A;  2JUL A;  2M1U A;  1K95 A;  1QX2 A;  3FS7 A;  1REC A;  2KI6 D;  2LM5 A;  2LUX A;  3KPX A;  1GQM A;  1RJV A;  1WRZ A;  1KK7 Z;  1TRF A;  2L51 A;  3BQ3 A;  2F2O A;  5DKQ A;  1FPW A;  1VRK A;  1S5G Z;  1FI5 A;  2JXL A;  3PAL A;  3EK4 A;  4YGA A;  1C7W A;  3WXA A;  4ICB A;  1S6J A;  2JT0 A;  1Y0V H;  2AMI A;  3EK8 A;  1UHI A;  4DUQ A;  4F0Z B;  2ZN9 A;  1J7O A;  1A29 A;  1IGV A;  2NZ0 A;  1JWD A;  1KFU L;  4NDB A;  1RTP 1;  2CTN A;  4PHN A;  1PRW A;  3SJS A;  3TDI A;  1BU3 A;  2V53 A;  2P6B B;  4YBH B;  3JTD B;  4ZCU A;  1WRK A;  1LXF C;  1NCZ A;  1NCX A;  2NLN A;  5CSI A;  1SY9 A;  4CID A;  2F3Y A;  2CXJ A;  1B1G A;  1UHJ A;  1OQP A;  4PE7 A;  2COL B;  2KFF A;  1UUS A;  2L50 A;  3PN7 C;  2LP3 A;  1CKK A;  4R1E A;  2LE9 B;  3FIA A;  3PM8 A;  5B8I B;  1K2H A;  1K9P A;  1SL8 A;  4QJ3 B;  3FWC A;  3TDU A;  5CPV A;  3JVT C;  5G08 A;  2JRF A;  2CCM A;  1KSM A;  1QV0 A;  2CNP A;  2KYF A;  4DRW A;  2LLS A;  1A4P A;  5JJG A;  1B7T Z;  1K9U A;  2D8N A;  1Y6W A;  3ZNI A;  2O60 A;  4MZL A;  4UPG A;  1F55 A;  5IBW A;  4MRY A;  3TUY B;  3VGO A;  1BLQ A;  1TNX A;  4WQ3 A;  1C7V A;  1G4Y R;  3O6B A;  4GBA A;  5PAL A;  3DF0 A;  5HLO A;  1K8U A;  1QIW A;  3A4U B;  5DKN A;  2ZFD A;  2KI4 B;  1OSA A;  4HRH A;  5I2O A;  4MRX A;  1KWO C;  3AKA A;  3NSK A;  2Q91 A;  5JOL A;  1OMR A;  1XVJ A;  1Y1A A;  1B4C A;  1WRL A;  1L2O B;  1XK4 A;  3I5G B;  4N1F A;  4WRI A;  3EVV A;  3SG4 A;  3HX4 A;  2JPT A;  4YRU A;  2LAN A;  3BUW B;  5D7F A;  2KBI A;  1ZFS A;  1ZMZ A;  3GK2 A;  1XFU O;  3KHE A;  1NSH A;  1NX1 A;  1B7T Y;  4QJ5 B;  4ORC B;  2LVJ A;  1IJ6 A;  1PK0 D;  2Q4U A;  2GGM A;  2IS9 A;  4DS7 A;  1RK9 A;  1UP5 A;  3CWG A;  4M2Q A;  1QLS A;  2KQ6 A;  3I5I C;  4CPV A;  1CDN A;  2BCA A;  2Y4Q A;  2M1K B;  5K89 A;  1DJZ A;  3WHT B;  4BY5 A;  1YUS A;  5AFP A;  5HLV A;  2MBX A;  1FW4 A;  1B8C A;  1JFK A;  1KSO A;  1MUX A;  2BL0 B;  2LP2 A;  5BPJ A;  1C07 A;  2ZN8 A;  1QX5 B;  4ETO A;  1DT7 B;  2FCD A;  2BBN A;  1Q80 A;  4I5L B;  1XO5 A;  4PCW A;  1QLK A;  1AK8 A;  1TCO B;  4HSZ A;  1JFJ A;  4M2P A;  2B1U A;  1SPY A;  1JUO A;  1V1G A;  1KFX S;  3KF9 A;  4NDC A;  3HCM A;  1OZS A;  1MF8 B;  5KSZ A;  1S6C A;  1MWN A;  2K7B A;  2KGB C;  5TNC A;  2MHH A;  1NX0 A;  2BL0 C;  4MEW A;  5AAN A;  3ZWH A;  4MLW A;  1NWD A;  1ZUZ A;  3BUO B;  3OHM B;  1S3P A;  1ZOT B;  2LHL A;  2L5X B;  3OX5 A;  1CLL A;  4MBE A;  4Q04 A;  3OB1 B;  4ZCV A;  2JTZ A;  1OE9 B;  3C1V A;  2WCE A;  1LA0 A;  3SIB A;  1KCY A;  2KBM A;  1KK8 C;  1B8L A;  1UWO A;  1TCF A;  2FJU B;  1IG5 A;  2BE6 A;  3RM1 A;  1CMF A;  1CFD A;  2JXC A;  3DF0 B;  5KTY A;  4GAO A;  3SG5 A;  4JPZ B;  2KYC A;  3OB2 B;  1BG1 A;  1GGZ A;  1DGV A;  4YGC B;  1H4B A;  3NSI A;  1M63 B;  1SNL A;  2NCO A;  3BUN B;  3LCP C;  1QV1 A;  1DGU A;  1CDM A;  2KI4 C;  4GGF C;  4JQ0 D;  2HPS A;  3PLF B;  4YI9 A;  1CM1 A;  1ZAC A;  2JC2 A;  2LLU A;  1EXR A;  1S26 D;  3O4Y A;  1KK8 B;  3PSR A;  3KEV A;  3D0Y B;  4I5K A;  3LLE A;  4GFT A;  4OV2 A;  1LKJ A;  1CFF A;  1QAT A;  1X02 A;  2BCX A;  4GPL B;  1JSA A;  3VRR A;  3EKH A;  1U5I A;  1MXL C;  1IRJ A;  5CSJ A;  2LVV A;  2OTG B;  3D10 A;  2JQ6 A;  1G33 A;  1IQ5 A;  1SCM C;  2KNE A;  2L98 A;  2F2P A;  2RGI A;  1KFX L;  3IQO A;  2JNF A;  2K2F A;  1DTL A;  2BEC A;  1CDP A;  3VRP A;  1F4O A;  1Y1U A;  2KDH A;  3EK7 A;  3I5I B;  2DOQ A;  1DJY A;  2LMT A;  1CNP A;  2MA2 A;  2BE4 A;  1TIZ A;  1RFJ A;  3E3R A;  4XJK B;  5F6T A;  1YRU B;  3NXA A;  3OP0 A;  1OMD A;  2ZRS A;  4QJ4 B;  1BMO A;  3AAK A;  4TNC A;  1F71 A;  3AAJ A;  2KAV A;  1SW8 A;  1XFV O;  3SG2 A;  1BJF A;  1K93 D;  1UHK A;  2BCB A;  4OR9 B;  5DKR A;  1G8I A;  2K7O A;  2LHI A;  1XFW O;  2L2E A;  2WCB A;  3CS1 A;  1NPQ A;  1YTZ C;  1W7I B;  3VRQ A;  3KO0 A;  2PVB A;  3LK1 A;  1IH0 A;  1SL9 A;  1QJT A;  2OS8 B;  1EG3 A;  5HKZ A;  3PFV A;  3TS5 B;  1J55 A;  2JT3 A;  3GK1 A;  4OVN F;  1UHN A;  2H61 C;  1R6P A;  1ALW A;  3CR2 A;  4E68 A;  3O78 A;  5I2L A;  1EG4 A;  1QX7 A;  2JU0 A;  1NYA A;  1NP8 A;  1PVA A;  2PAL A;  3QRX A;  1F70 A;  3FWB A;  3H4S E;  5CSN A;  2SAS A;  2EGD A;  2JT8 A;  2WC8 A;  1CTR A;  3CZT X;  2I2R E;  1B47 A;  3F45 A;  3GK4 X;  1PSR A;  2MLE C;  5ER4 X;  1J7R A;  4MN0 A;  2GGZ A;  1LIN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...