3QMEA

Crystal structure of an anopheles gambiae odorant-binding protein agamobp22a with bound odorant cyclohexanone
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
133
structure length
119
Chain Sequence
ESVIESCSNAVQGAANDELKVHYRANEFPDDPVTHCFVRCIGLELNLYDDKYGVDLQANWENLGNSDDADEEFVAKHRACLEAKNLETIEDLCERAYSAFQCLREDYEMYQNNELWSHP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Odorant binding protein (AGAP010409-PA)
publication title Crystal Structures of an Anopheles gambiae Odorant-binding Protein AgamOBP22a and Complexes with Bound Odorants
rcsb
source organism Anopheles gambiae
molecule tags Transport protein
total genus 44
structure length 119
sequence length 133
ec nomenclature
pdb deposition date 2011-02-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.20 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 Pheromone/general odorant binding protein domain 3qmeA00
2GTEA 2KPHA 3FE9A 1TUJA 3FE8A 3B88A 3R1PA 3BFHA 3B86A 1OOGA 3CDNA 1OOIX 4OZDA 3DXLA 3NHIA 1ORGA 1XFRA 2WCJA 2QEBA 2QEHA 3L4LA 4JD9A 1OOFA 3Q8IA 2WC6A 5EL2A 3L4AA 3OGNA 3CYZA 1P28A 3D78A 4INWA 3B6XA 4INXA 3DZTA 3R1VA 3L47A 3D74A 2QEVA 2L2CA 2WCLA 3B7AA 2JPOA 3S0AA 2H8VA 3DYEA 3R72A 2QDIA 4PT1A 3R1OA 3RZSA 1LS8A 3DY9A 3V2LA 1C3YA 3FE6A 1TWOA 1C3ZA 3S0DA 3K1EA 3S0EA 2FJYA 2P70A 3D77A 1GM0A 3D75A 3CZ2A 5DICA 2WCKA 1OW4A 3S0FA 1OOHA 3NGVA 3QMEA 3D76A 3CABA 2ERBA 3BJHA 3CZ1A 3VB1A 1DQEA 3D73A 3S0GA 3S0BA 3BFBA 3B87A 3CZ0A 2PQLA 2WCMA 3BFAA 2WCHA 1T14A 1QWVA 4FQTA 3PJIA 3NHTA 2QEOA 2WC5A 4F7FA 2P71A 3N7HA
chains in the Genus database with same CATH superfamily
1BU3A 1PALA 1RK9A 1S6IA 1MUXA 5CSNA 1TNXA 4PHJA 4PCWA 1LKJA 4AOMA 4DRWA 2JC2A 3FWBA 3FE9A 1TUJA 3FE8A 1RECA 5BPJA 1XK4C 3O78A 3VGOA 2KQYA 2Q4UA 2ZN8A 2BCXA 2V53A 1K94A 4R1EA 3B86A 4Q04A 3BOWA 2KGRA 1SMGA 2KI4B 1KK7Z 2KDHA 2K2FA 2SCPA 2EGDA 2MHHA 1XFRA 1IJ6A 2QEHA 3BYAA 3GK1A 1WDCB 1NX2A 3I5IC 2WOSA 1BMOA 1H4BA 4WRIA 1EXRA 1IJ5A 2MAZA 4YI8A 2KOTA 2KHNA 2MA2A 2BE4A 1OMRA 3WHTB 3IF7A 3O2PA 3R1VA 4NDCA 3L47A 3VROA 1EH2A 4OV2A 2E6WA 1M46A 1IRJA 1DF0B 1NX0A 2NLNA 3DVJA 2QEVA 1A75A 1Y1XA 4BY4A 1QV0A 1B7TY 1AVSA 3SG2A 2WCLA 5J3XA 2LUXA 2KAXA 1PRWA 3S0AA 1QIWA 5PALA 2LP2A 1IGVA 1K90D 2L50A 2Y1MA 3LCPC 2ZRTA 3D10A 1DJZA 3R1OA 3RZSA 4MLWA 1MWNA 2I94A 4GUKA 4QJ3B 1K9UA 3IQQA 4JWQA 4ORCB 1TCOB 2JNXA 1UHJA 4C0KA 1NSHA 3DY9A 4MEWA 4AQJA 1H8BA 1AUIB 3I5IB 1N65A 3NXAA 2JPTA 3SG3A 1ZFSA 3PLFB 2HQWA 1QVIZ 3BOWB 2E30A 3DVEA 5HYDA 2JT0A 5AFPA 2OTGB 4GGFA 3K1EA 1F4QA 1B4CA 2BNXA 2ZFDA 1K2HA 1W7JB 1Z4HA 1KK7Y 4PALA 2NZ0A 3BXKA 1TRFA 3KO0A 3KF9A 2LLUA 1JFKA 4PE0A 2JRFA 1AJ4A 4GBAA 4C0JA 2WCKA 3ICBA 3OHMB 1OE9B 4CPVA 4QJ4B 1RFJA 2KBMA 3PM8A 1NIWA 2F3YA 1SL9A 3NGVA 1X02A 2PYQA 4GPLB 5CSJA 4D1EA 2ZKMX 1MXEA 1V1GA 2WCBA 3KHEA 4PHNA 2ISDA 1MXLC 1A75B 1MHOA 3VB1A 1LINA 2K7OA 3VRRA 1S6CA 1KWOB 2KFHA 1LA0A 3RLZA 2ZNEA 1A03A 1D1OA 1J7QA 1NCZA 2KFFA 2SASA 3S0GA 1DVIA 4I5JA 1IWQA 2KLEA 3KPXA 1U5IA 2ZN9A 4AQIA 1CFCA 1J7OA 3CZ0A 1KQVA 1GGWA 1QXPA 1WY9A 2B1UA 5KU1A 2LMVA 2KAYA 3D0YA 2PRUA 3JTDC 3ZNIA 3BFAA 2WCHA 1JUOA 1QWVA 5HKYA 1XFZO 4E68A 1CDPA 1FI6A 3PJIA 3NSKA 2QEOA 2LC5A 1QVIY 3DVMA 1S3PA 1DJHA 1XFWO 4ORBB 3NSOA 3GK2A 2CBLA 1IQ3A 4CIDA 1XO5A 5FYXA 2LUCA 2HF5A 3B88A 5G08A 1W7IB 4N1GA 3BFHA 2COLB 1Y1AA 2G9BA 2LVIA 3CDNA 4OZDA 3SIBA 2KFGA 2M9GA 4KYNA 1ORGA 1DF0A 3EVRA 3OX6A 2L4IA 1S1EA 3NSLA 3O4YA 3PM2A 3E3RA 1JSAA 4HRGA 5CPVA 4OKHA 3AAJA 1SRAA 1OZSA 2LHIA 1UHIA 3BQ3A 1J7RA 5I2LA 4INWA 1TOPA 1SR6C 2MJWB 3SG4A 2L5YA 3JTDB 5B8IB 1SY9A 5CSIA 1U5IB 2O60A 4INXA 3AAKA 1KFUL 1YVLA 4BY5A 2OPOA 1CB1A 2NCPA 3PSRA 1IG5A 2HQ8A 1UWOA 1ALWA 1UHHA 2JWWA 2JOJA 4JQ0D 1SCMC 1EG4A 1NX1A 4DIRA 5HL1A 4WQ2A 2JTZA 3D0YB 4GAOA 2LMTA 4MSPA 3NSIA 3SJSA 3TS5C 1K93D 2H8VA 2AMIA 3VRPA 1CTRA 1DELA 3PALA 4F7FA 2LAPA 4YGEB 4PT1A 1YUTA 1DGUA 1PK0D 1V1FA 2M0RA 4C0LA 4DS7A 1M45A 2Y4QA 1FW4A 1PVBA 2ZRSA 5I8NA 2I7AA 2L98A 2BE6A 2PMYA 3FE6A 4GFTA 1C3YA 1UHNA 1TWOA 2CXJA 2WC8A 1CDLA 3DD4A 4I5KA 4XJKA 1L2OC 3SG5A 1YUUA 2L51A 2CT9A 2AAOA 3TDZA 1K8UA 5HKZA 1RROA 1SR6B 3IVTA 3BUNB 2LANA 4L9MA 1JC2A 1A4PA 3D77A 4ICBA 5AEQA 2JXCA 3D75A 1SL8A 3CZ2A 3CGAA 1GM0A 2FJUB 2OS8C 4M2QA 1OMDA 1NPQA 2DOQA 3OB2B 1DEKA 1SCMB 1K95A 1ODBA 5ER5A 1JFJA 2LMUA 2KI6C 2GGMA 4I5LB 1OOHA 1F4OA 2LHLA 3CWGA 2KI6D 3WXAA 3FWCA 2QACA 5ER4X 3TS5B 5K89A 1B8LA 1K9KA 2K61A 1FI5A 1LA3A 1YUSA 3VRNA 3QMEA 3CR2A 2KLDA 2JTTA 3CABA 1Q80A 1DJYA 1SW8A 1B8RA 2JZIA 2KAVA 5D3OA 1F55A 2M8UA 1EJ3A 1OQPA 4NDDA 5HLOA 1K9PA 1MR8A 2CTNA 2D8NA 3D73A 5AERA 3OB1B 1CMFA 1C7VA 1YX8A 3LLEA 3EK4A 2BKIB 2H2KA 2M49B 5AXIA 1YRTB 1ZUZA 5HLVA 1MQ1A 1QTXA 1XVJA 4MRXA 1QS7A 3C1VA 2QPTA 4PDZA 4CFQA 2NXQA 5DKRA 5FI7A 4ZCVA 2OS8B 4HRHA 4XJKB 2LCPA 2GV5A 4JPZB 1J55A 2WC5A 1HT9A 1EG3A 2FOTA 1KSOA 1XFVO 1DC1A 2GTEA 1KFXS 2G2BA 2K8MB 2M7LA 1A2XA 4TNCA 1DJIA 1Y6WA 2KSPA 1CMGA 2FCDA 1VRKA 1CDNA 2O5GA 3I5GC 1S5GZ 4MZJA 2LE9B 1OOGA 4YRUA 4YGCB 3N7HA 1OZOA 2FCEA 1RWYA 2LNKA 1BR4B 1C7WA 1N0YA 2BCBA 2H61A 1CM4A 2WNDA 4FTGA 4MRYA 1J1DA 4YGAA 2QEBA 1Z2CB 4M2PA 4PE1A 3L4LA 1GJYA 3EVVA 4JD9A 1YX7A 2L0PA 3PFVA 1IKUA 2F8PA 1OOFA 1XFXO 1TCFA 2WC6A 3L4AA 3OGNA 3CYZA 1P28A 3D78A 2K7BA 4IJ7A 3CTNA 4YBHB 3EK8A 2H61C 4OVNF 3DZTA 1FBVA 1K96A 2F2OA 2L4HA 3D74A 3EKJA 2EC6C 2HPSA 3PATA 3LK1A 1LVCD 1G8IA 1QX2A 4DUQA 4GGNA 1NP8A 5D7FA 4N5XA 2I18A 2L2CA 3HX4A 3FIAA 3RM1A 3SS5A 1UUSA 4A4BA 3R72A 1XFUO 1OMVA 3EKHA 4YGBB 2EHBA 1KSMA 1QX7A 1TIZA 1JF0A 1HQVA 2MLEC 1WLZA 1KCYA 1M39A 2MBXA 1FF1A 1BLQA 1LS8A 1B9AA 2LLSA 1S6JA 1IQ5A 5FI6A 1Y0VH 2I2RE 1IIOA 4FQOA 3F45A 3MSEB 4P2YB 1UP5A 4U8DA 2F33A 1UURA 2PASA 1S5GY 2M7NA 2LVVA 1CLBA 3QRXA 2P70A 3WNXB 1OSAA 3FS7A 1N2DA 2LP3A 1SK6D 1DTLA 1ZACA 2JT8A 5DICA 3BUMB 1CDMA 1TTXA 1WRZA 1YTZC 2EC6B 3WHUB 4A4CA 1OW4A 3KEVA 4GNKB 2BAPA 1CM1A 2JT3A 3EVUA 3LK0A 5KTYA 2Q91A 5AANA 2M3WA 5JOLA 3SS4A 1S26D 3UNWA 2K60A 3TDUA 3ZWHA 3UO9A 1SBJA 2M97A 2PVBA 3CS1A 1B1GA 1CFPA 1DGVA 1DJGA 2ERBA 5CSFA 2JXLA 1ALVA 1DQEA 3CR4X 1OOJA 4DCKA 5IBWA 2TN4A 1R6PA 2MLFC 4QJ5B 1SKTA 1AK8A 3M0WA 3AKBA 3S0BA 3TZ1A 2WCEA 3B87A 4CLNA 1F8HA 3BUOB 1YR5A 4PHMA 3I5FC 2JU0A 2KNEA 1TUZA 4USLA 1NX3A 1NYAA 1L7ZA 1UHKA 4PHKA 4WQ3A 2BL0C 3EK7A 5TNCA 1CFFA 4M2OA 2WCFA 1QATA 1QJTA 3A8RA 2JQ6A 1XA5A 2KYCA 2OTGC 3NHTA 4CFRA 1C07A 1F54A 1WLMA 1XFYO 2KPHA 3DF0A 1RTP1 3SG7A 1ZMZA 3SG6A 2L2EA 4PE4A 1CKKA 1DJWA 2PSRA 2F2PA 3I5HC 5DKNA 1TNWA 3A4UB 1CLLA 3R1PA 2ZNDA 1NUBA 2M1UA 3H4SE 1BF5A 3EG5B 1L2OB 1PSBA 3CZTX 4HREE 1OOIX 3DXLA 3OBVA 1E8AA 3NHIA 1SYMA 5I2QA 1G33A 2F3ZA 1XYDA 2WCJA 3K21A 1Y1UA 2LVKA 1MF8B 4ZCUA 3VRQA 1KWOC 3I5FB 1A29A 2L5XB 3CR5X 3Q8IA 5KSZA 1M31A 1NCXA 5EL2A 1BODA 1AHRA 4OR9B 2R2IA 1JBAA 3B6XA 2BL0B 4NQGA 4MN0A 1KK8C 5I94A 2MRDA 4F0ZB 1PULA 3CLNA 1TNPA 2LVJA 2BBNA 2VRGA 2YGUA 3TDIA 1M63B 1DMOA 1RJVA 4YGDB 1SNLA 2JNFA 3B7AA 2NCOA 3OX5A 3PN7C 1CNPA 1F70A 2BCAA 2BKHB 2JPOA 3I5HB 4I5NB 1DT7B 1YURA 3DYEA 4GGFC 1KFUS 1FPWA 1GGZA 4UPGA 4MZLA 2QDIA 2AUCA 1AJ5A 3DF0B 1JWDA 5HKWA 1YVHA 2Y5IA 5F6TA 3JVTC 2K7DA 1SSEB 1BJFA 3V2LA 3LL8B 5DKQA 2KBIA 1IH0A 2BECA 4XYNA 2A4JA 3AKAA 1QX5B 3TUYC 1WRLA 1LXFC 1C3ZA 2JULA 4MBEA 3S0DA 2P6BB 2FJYA 2KYFA 1CLMA 1KK8B 3DVKA 3GK4X 1EL4A 3S0EA 1G4YR 1KQMC 1QV1A 1B8CA 2Y1NA 1YRUB 1QASA 1SCVA 3O4XA 5I2OA 1TN4A 2BBMA 3OP0A 3SIAA 4P5OE 4N1FA 3IQOA 4HSZA 3I5GB 2LLTA 3S0FA 1NCYA 1WRKA 3HCMA 3PN7B 1R2UA 1J1EA 4PE7A 2K7CA 1BR1B 2LM5A 5D69A 3D76A 1CFDA 4IL1A 3CZ1A 1ZOTB 3BJHA 2CNPA 3O6BA 1BG1A 1W9ZA 2K0JA 3JVTB 2HETA 2KQ6A 1AP4A 2LV7A 3GOFA 4NDBA 2K2AA 2KI4C 2CCMA 1J7PA 4YI9A 2GGZA 3TUYB 4ETOA 1B47A 3BFBA 4JKTA 2M1KB 1PSRA 1WDCC 2M29A 1QIVA 4MVFA 1KFXL 2PQLA 1BT6A 1B7TZ 4MZKA 1QLSA 1BOCA 1F71A 1KQMB 1TNQA 3SS3A 4ORAB 2WCMA 2IS9A 1T14A 4OCIA 1XK4A 2WORA 4FQTA 1SPYA 1QLKA 1GQMA 2PALA 3BUXB 3BUWB 1JF2A 2KGBC 5GQQC 1NWDA 1PVAA 1DJXA 1SL7A 5JJGA 1S36A 2P71A 5FI2A 2RGIA
chains in the Genus database with same CATH topology
2GTEA 2KPHA 3FE9A 1TUJA 3FE8A 3B88A 3R1PA 3BFHA 3B86A 1OOGA 3CDNA 1OOIX 4OZDA 3DXLA 3NHIA 1ORGA 1XFRA 2WCJA 2QEBA 2QEHA 3L4LA 4JD9A 1OOFA 3Q8IA 2WC6A 5EL2A 3L4AA 3OGNA 3CYZA 1P28A 3D78A 4INWA 3B6XA 4INXA 3DZTA 3R1VA 3L47A 3D74A 2QEVA 2L2CA 2WCLA 3B7AA 2JPOA 3S0AA 2H8VA 3DYEA 3R72A 2QDIA 4PT1A 3R1OA 3RZSA 1LS8A 3DY9A 3V2LA 1C3YA 3FE6A 1TWOA 1C3ZA 3S0DA 3K1EA 3S0EA 2FJYA 2P70A 3D77A 1GM0A 3D75A 3CZ2A 5DICA 2WCKA 1OW4A 3S0FA 1OOHA 3NGVA 3QMEA 3D76A 3CABA 2ERBA 3BJHA 3CZ1A 3VB1A 1DQEA 3D73A 3S0GA 3S0BA 3BFBA 3B87A 3CZ0A 2PQLA 2WCMA 3BFAA 2WCHA 1T14A 1QWVA 4FQTA 3PJIA 3NHTA 2QEOA 2WC5A 4F7FA 2P71A 3N7HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GTE A;  2KPH A;  3FE9 A;  1TUJ A;  3FE8 A;  3B88 A;  3R1P A;  3BFH A;  3B86 A;  1OOG A;  3CDN A;  1OOI X;  4OZD A;  3DXL A;  3NHI A;  1ORG A;  1XFR A;  2WCJ A;  2QEB A;  2QEH A;  3L4L A;  4JD9 A;  1OOF A;  3Q8I A;  2WC6 A;  5EL2 A;  3L4A A;  3OGN A;  3CYZ A;  1P28 A;  3D78 A;  4INW A;  3B6X A;  4INX A;  3DZT A;  3R1V A;  3L47 A;  3D74 A;  2QEV A;  2L2C A;  2WCL A;  3B7A A;  2JPO A;  3S0A A;  2H8V A;  3DYE A;  3R72 A;  2QDI A;  4PT1 A;  3R1O A;  3RZS A;  1LS8 A;  3DY9 A;  3V2L A;  1C3Y A;  3FE6 A;  1TWO A;  1C3Z A;  3S0D A;  3K1E A;  3S0E A;  2FJY A;  2P70 A;  3D77 A;  1GM0 A;  3D75 A;  3CZ2 A;  5DIC A;  2WCK A;  1OW4 A;  3S0F A;  1OOH A;  3NGV A;  3QME A;  3D76 A;  3CAB A;  2ERB A;  3BJH A;  3CZ1 A;  3VB1 A;  1DQE A;  3D73 A;  3S0G A;  3S0B A;  3BFB A;  3B87 A;  3CZ0 A;  2PQL A;  2WCM A;  3BFA A;  2WCH A;  1T14 A;  1QWV A;  4FQT A;  3PJI A;  3NHT A;  2QEO A;  2WC5 A;  4F7F A;  2P71 A;  3N7H A; 
#chains in the Genus database with same CATH topology
 1BU3 A;  1PAL A;  1RK9 A;  1S6I A;  1MUX A;  5CSN A;  1TNX A;  4PHJ A;  4PCW A;  1LKJ A;  4AOM A;  4DRW A;  2JC2 A;  3FWB A;  3FE9 A;  1TUJ A;  3FE8 A;  1REC A;  5BPJ A;  1XK4 C;  3O78 A;  3VGO A;  2KQY A;  2Q4U A;  2ZN8 A;  2BCX A;  2V53 A;  1K94 A;  4R1E A;  3B86 A;  4Q04 A;  3BOW A;  2KGR A;  1SMG A;  2KI4 B;  1KK7 Z;  2KDH A;  2K2F A;  2SCP A;  2EGD A;  2MHH A;  1XFR A;  1IJ6 A;  2QEH A;  3BYA A;  3GK1 A;  1WDC B;  1NX2 A;  3I5I C;  2WOS A;  1BMO A;  1H4B A;  4WRI A;  1EXR A;  1IJ5 A;  2MAZ A;  4YI8 A;  2KOT A;  2KHN A;  2MA2 A;  2BE4 A;  1OMR A;  3WHT B;  3IF7 A;  3O2P A;  3R1V A;  4NDC A;  3L47 A;  3VRO A;  1EH2 A;  4OV2 A;  2E6W A;  1M46 A;  1IRJ A;  1DF0 B;  1NX0 A;  2NLN A;  3DVJ A;  2QEV A;  1A75 A;  1Y1X A;  4BY4 A;  1QV0 A;  1B7T Y;  1AVS A;  3SG2 A;  2WCL A;  5J3X A;  2LUX A;  2KAX A;  1PRW A;  3S0A A;  1QIW A;  5PAL A;  2LP2 A;  1IGV A;  1K90 D;  2L50 A;  2Y1M A;  3LCP C;  2ZRT A;  3D10 A;  1DJZ A;  3R1O A;  3RZS A;  4MLW A;  1MWN A;  2I94 A;  4GUK A;  4QJ3 B;  1K9U A;  3IQQ A;  4JWQ A;  4ORC B;  1TCO B;  2JNX A;  1UHJ A;  4C0K A;  1NSH A;  3DY9 A;  4MEW A;  4AQJ A;  1H8B A;  1AUI B;  3I5I B;  1N65 A;  3NXA A;  2JPT A;  3SG3 A;  1ZFS A;  3PLF B;  2HQW A;  1QVI Z;  3BOW B;  2E30 A;  3DVE A;  5HYD A;  2JT0 A;  5AFP A;  2OTG B;  4GGF A;  3K1E A;  1F4Q A;  1B4C A;  2BNX A;  2ZFD A;  1K2H A;  1W7J B;  1Z4H A;  1KK7 Y;  4PAL A;  2NZ0 A;  3BXK A;  1TRF A;  3KO0 A;  3KF9 A;  2LLU A;  1JFK A;  4PE0 A;  2JRF A;  1AJ4 A;  4GBA A;  4C0J A;  2WCK A;  3ICB A;  3OHM B;  1OE9 B;  4CPV A;  4QJ4 B;  1RFJ A;  2KBM A;  3PM8 A;  1NIW A;  2F3Y A;  1SL9 A;  3NGV A;  1X02 A;  2PYQ A;  4GPL B;  5CSJ A;  4D1E A;  2ZKM X;  1MXE A;  1V1G A;  2WCB A;  3KHE A;  4PHN A;  2ISD A;  1MXL C;  1A75 B;  1MHO A;  3VB1 A;  1LIN A;  2K7O A;  3VRR A;  1S6C A;  1KWO B;  2KFH A;  1LA0 A;  3RLZ A;  2ZNE A;  1A03 A;  1D1O A;  1J7Q A;  1NCZ A;  2KFF A;  2SAS A;  3S0G A;  1DVI A;  4I5J A;  1IWQ A;  2KLE A;  3KPX A;  1U5I A;  2ZN9 A;  4AQI A;  1CFC A;  1J7O A;  3CZ0 A;  1KQV A;  1GGW A;  1QXP A;  1WY9 A;  2B1U A;  5KU1 A;  2LMV A;  2KAY A;  3D0Y A;  2PRU A;  3JTD C;  3ZNI A;  3BFA A;  2WCH A;  1JUO A;  1QWV A;  5HKY A;  1XFZ O;  4E68 A;  1CDP A;  1FI6 A;  3PJI A;  3NSK A;  2QEO A;  2LC5 A;  1QVI Y;  3DVM A;  1S3P A;  1DJH A;  1XFW O;  4ORB B;  3NSO A;  3GK2 A;  2CBL A;  1IQ3 A;  4CID A;  1XO5 A;  5FYX A;  2LUC A;  2HF5 A;  3B88 A;  5G08 A;  1W7I B;  4N1G A;  3BFH A;  2COL B;  1Y1A A;  2G9B A;  2LVI A;  3CDN A;  4OZD A;  3SIB A;  2KFG A;  2M9G A;  4KYN A;  1ORG A;  1DF0 A;  3EVR A;  3OX6 A;  2L4I A;  1S1E A;  3NSL A;  3O4Y A;  3PM2 A;  3E3R A;  1JSA A;  4HRG A;  5CPV A;  4OKH A;  3AAJ A;  1SRA A;  1OZS A;  2LHI A;  1UHI A;  3BQ3 A;  1J7R A;  5I2L A;  4INW A;  1TOP A;  1SR6 C;  2MJW B;  3SG4 A;  2L5Y A;  3JTD B;  5B8I B;  1SY9 A;  5CSI A;  1U5I B;  2O60 A;  4INX A;  3AAK A;  1KFU L;  1YVL A;  4BY5 A;  2OPO A;  1CB1 A;  2NCP A;  3PSR A;  1IG5 A;  2HQ8 A;  1UWO A;  1ALW A;  1UHH A;  2JWW A;  2JOJ A;  4JQ0 D;  1SCM C;  1EG4 A;  1NX1 A;  4DIR A;  5HL1 A;  4WQ2 A;  2JTZ A;  3D0Y B;  4GAO A;  2LMT A;  4MSP A;  3NSI A;  3SJS A;  3TS5 C;  1K93 D;  2H8V A;  2AMI A;  3VRP A;  1CTR A;  1DEL A;  3PAL A;  4F7F A;  2LAP A;  4YGE B;  4PT1 A;  1YUT A;  1DGU A;  1PK0 D;  1V1F A;  2M0R A;  4C0L A;  4DS7 A;  1M45 A;  2Y4Q A;  1FW4 A;  1PVB A;  2ZRS A;  5I8N A;  2I7A A;  2L98 A;  2BE6 A;  2PMY A;  3FE6 A;  4GFT A;  1C3Y A;  1UHN A;  1TWO A;  2CXJ A;  2WC8 A;  1CDL A;  3DD4 A;  4I5K A;  4XJK A;  1L2O C;  3SG5 A;  1YUU A;  2L51 A;  2CT9 A;  2AAO A;  3TDZ A;  1K8U A;  5HKZ A;  1RRO A;  1SR6 B;  3IVT A;  3BUN B;  2LAN A;  4L9M A;  1JC2 A;  1A4P A;  3D77 A;  4ICB A;  5AEQ A;  2JXC A;  3D75 A;  1SL8 A;  3CZ2 A;  3CGA A;  1GM0 A;  2FJU B;  2OS8 C;  4M2Q A;  1OMD A;  1NPQ A;  2DOQ A;  3OB2 B;  1DEK A;  1SCM B;  1K95 A;  1ODB A;  5ER5 A;  1JFJ A;  2LMU A;  2KI6 C;  2GGM A;  4I5L B;  1OOH A;  1F4O A;  2LHL A;  3CWG A;  2KI6 D;  3WXA A;  3FWC A;  2QAC A;  5ER4 X;  3TS5 B;  5K89 A;  1B8L A;  1K9K A;  2K61 A;  1FI5 A;  1LA3 A;  1YUS A;  3VRN A;  3QME A;  3CR2 A;  2KLD A;  2JTT A;  3CAB A;  1Q80 A;  1DJY A;  1SW8 A;  1B8R A;  2JZI A;  2KAV A;  5D3O A;  1F55 A;  2M8U A;  1EJ3 A;  1OQP A;  4NDD A;  5HLO A;  1K9P A;  1MR8 A;  2CTN A;  2D8N A;  3D73 A;  5AER A;  3OB1 B;  1CMF A;  1C7V A;  1YX8 A;  3LLE A;  3EK4 A;  2BKI B;  2H2K A;  2M49 B;  5AXI A;  1YRT B;  1ZUZ A;  5HLV A;  1MQ1 A;  1QTX A;  1XVJ A;  4MRX A;  1QS7 A;  3C1V A;  2QPT A;  4PDZ A;  4CFQ A;  2NXQ A;  5DKR A;  5FI7 A;  4ZCV A;  2OS8 B;  4HRH A;  4XJK B;  2LCP A;  2GV5 A;  4JPZ B;  1J55 A;  2WC5 A;  1HT9 A;  1EG3 A;  2FOT A;  1KSO A;  1XFV O;  1DC1 A;  2GTE A;  1KFX S;  2G2B A;  2K8M B;  2M7L A;  1A2X A;  4TNC A;  1DJI A;  1Y6W A;  2KSP A;  1CMG A;  2FCD A;  1VRK A;  1CDN A;  2O5G A;  3I5G C;  1S5G Z;  4MZJ A;  2LE9 B;  1OOG A;  4YRU A;  4YGC B;  3N7H A;  1OZO A;  2FCE A;  1RWY A;  2LNK A;  1BR4 B;  1C7W A;  1N0Y A;  2BCB A;  2H61 A;  1CM4 A;  2WND A;  4FTG A;  4MRY A;  1J1D A;  4YGA A;  2QEB A;  1Z2C B;  4M2P A;  4PE1 A;  3L4L A;  1GJY A;  3EVV A;  4JD9 A;  1YX7 A;  2L0P A;  3PFV A;  1IKU A;  2F8P A;  1OOF A;  1XFX O;  1TCF A;  2WC6 A;  3L4A A;  3OGN A;  3CYZ A;  1P28 A;  3D78 A;  2K7B A;  4IJ7 A;  3CTN A;  4YBH B;  3EK8 A;  2H61 C;  4OVN F;  3DZT A;  1FBV A;  1K96 A;  2F2O A;  2L4H A;  3D74 A;  3EKJ A;  2EC6 C;  2HPS A;  3PAT A;  3LK1 A;  1LVC D;  1G8I A;  1QX2 A;  4DUQ A;  4GGN A;  1NP8 A;  5D7F A;  4N5X A;  2I18 A;  2L2C A;  3HX4 A;  3FIA A;  3RM1 A;  3SS5 A;  1UUS A;  4A4B A;  3R72 A;  1XFU O;  1OMV A;  3EKH A;  4YGB B;  2EHB A;  1KSM A;  1QX7 A;  1TIZ A;  1JF0 A;  1HQV A;  2MLE C;  1WLZ A;  1KCY A;  1M39 A;  2MBX A;  1FF1 A;  1BLQ A;  1LS8 A;  1B9A A;  2LLS A;  1S6J A;  1IQ5 A;  5FI6 A;  1Y0V H;  2I2R E;  1IIO A;  4FQO A;  3F45 A;  3MSE B;  4P2Y B;  1UP5 A;  4U8D A;  2F33 A;  1UUR A;  2PAS A;  1S5G Y;  2M7N A;  2LVV A;  1CLB A;  3QRX A;  2P70 A;  3WNX B;  1OSA A;  3FS7 A;  1N2D A;  2LP3 A;  1SK6 D;  1DTL A;  1ZAC A;  2JT8 A;  5DIC A;  3BUM B;  1CDM A;  1TTX A;  1WRZ A;  1YTZ C;  2EC6 B;  3WHU B;  4A4C A;  1OW4 A;  3KEV A;  4GNK B;  2BAP A;  1CM1 A;  2JT3 A;  3EVU A;  3LK0 A;  5KTY A;  2Q91 A;  5AAN A;  2M3W A;  5JOL A;  3SS4 A;  1S26 D;  3UNW A;  2K60 A;  3TDU A;  3ZWH A;  3UO9 A;  1SBJ A;  2M97 A;  2PVB A;  3CS1 A;  1B1G A;  1CFP A;  1DGV A;  1DJG A;  2ERB A;  5CSF A;  2JXL A;  1ALV A;  1DQE A;  3CR4 X;  1OOJ A;  4DCK A;  5IBW A;  2TN4 A;  1R6P A;  2MLF C;  4QJ5 B;  1SKT A;  1AK8 A;  3M0W A;  3AKB A;  3S0B A;  3TZ1 A;  2WCE A;  3B87 A;  4CLN A;  1F8H A;  3BUO B;  1YR5 A;  4PHM A;  3I5F C;  2JU0 A;  2KNE A;  1TUZ A;  4USL A;  1NX3 A;  1NYA A;  1L7Z A;  1UHK A;  4PHK A;  4WQ3 A;  2BL0 C;  3EK7 A;  5TNC A;  1CFF A;  4M2O A;  2WCF A;  1QAT A;  1QJT A;  3A8R A;  2JQ6 A;  1XA5 A;  2KYC A;  2OTG C;  3NHT A;  4CFR A;  1C07 A;  1F54 A;  1WLM A;  1XFY O;  2KPH A;  3DF0 A;  1RTP 1;  3SG7 A;  1ZMZ A;  3SG6 A;  2L2E A;  4PE4 A;  1CKK A;  1DJW A;  2PSR A;  2F2P A;  3I5H C;  5DKN A;  1TNW A;  3A4U B;  1CLL A;  3R1P A;  2ZND A;  1NUB A;  2M1U A;  3H4S E;  1BF5 A;  3EG5 B;  1L2O B;  1PSB A;  3CZT X;  4HRE E;  1OOI X;  3DXL A;  3OBV A;  1E8A A;  3NHI A;  1SYM A;  5I2Q A;  1G33 A;  2F3Z A;  1XYD A;  2WCJ A;  3K21 A;  1Y1U A;  2LVK A;  1MF8 B;  4ZCU A;  3VRQ A;  1KWO C;  3I5F B;  1A29 A;  2L5X B;  3CR5 X;  3Q8I A;  5KSZ A;  1M31 A;  1NCX A;  5EL2 A;  1BOD A;  1AHR A;  4OR9 B;  2R2I A;  1JBA A;  3B6X A;  2BL0 B;  4NQG A;  4MN0 A;  1KK8 C;  5I94 A;  2MRD A;  4F0Z B;  1PUL A;  3CLN A;  1TNP A;  2LVJ A;  2BBN A;  2VRG A;  2YGU A;  3TDI A;  1M63 B;  1DMO A;  1RJV A;  4YGD B;  1SNL A;  2JNF A;  3B7A A;  2NCO A;  3OX5 A;  3PN7 C;  1CNP A;  1F70 A;  2BCA A;  2BKH B;  2JPO A;  3I5H B;  4I5N B;  1DT7 B;  1YUR A;  3DYE A;  4GGF C;  1KFU S;  1FPW A;  1GGZ A;  4UPG A;  4MZL A;  2QDI A;  2AUC A;  1AJ5 A;  3DF0 B;  1JWD A;  5HKW A;  1YVH A;  2Y5I A;  5F6T A;  3JVT C;  2K7D A;  1SSE B;  1BJF A;  3V2L A;  3LL8 B;  5DKQ A;  2KBI A;  1IH0 A;  2BEC A;  4XYN A;  2A4J A;  3AKA A;  1QX5 B;  3TUY C;  1WRL A;  1LXF C;  1C3Z A;  2JUL A;  4MBE A;  3S0D A;  2P6B B;  2FJY A;  2KYF A;  1CLM A;  1KK8 B;  3DVK A;  3GK4 X;  1EL4 A;  3S0E A;  1G4Y R;  1KQM C;  1QV1 A;  1B8C A;  2Y1N A;  1YRU B;  1QAS A;  1SCV A;  3O4X A;  5I2O A;  1TN4 A;  2BBM A;  3OP0 A;  3SIA A;  4P5O E;  4N1F A;  3IQO A;  4HSZ A;  3I5G B;  2LLT A;  3S0F A;  1NCY A;  1WRK A;  3HCM A;  3PN7 B;  1R2U A;  1J1E A;  4PE7 A;  2K7C A;  1BR1 B;  2LM5 A;  5D69 A;  3D76 A;  1CFD A;  4IL1 A;  3CZ1 A;  1ZOT B;  3BJH A;  2CNP A;  3O6B A;  1BG1 A;  1W9Z A;  2K0J A;  3JVT B;  2HET A;  2KQ6 A;  1AP4 A;  2LV7 A;  3GOF A;  4NDB A;  2K2A A;  2KI4 C;  2CCM A;  1J7P A;  4YI9 A;  2GGZ A;  3TUY B;  4ETO A;  1B47 A;  3BFB A;  4JKT A;  2M1K B;  1PSR A;  1WDC C;  2M29 A;  1QIV A;  4MVF A;  1KFX L;  2PQL A;  1BT6 A;  1B7T Z;  4MZK A;  1QLS A;  1BOC A;  1F71 A;  1KQM B;  1TNQ A;  3SS3 A;  4ORA B;  2WCM A;  2IS9 A;  1T14 A;  4OCI A;  1XK4 A;  2WOR A;  4FQT A;  1SPY A;  1QLK A;  1GQM A;  2PAL A;  3BUX B;  3BUW B;  1JF2 A;  2KGB C;  5GQQ C;  1NWD A;  1PVA A;  1DJX A;  1SL7 A;  5JJG A;  1S36 A;  2P71 A;  5FI2 A;  2RGI A; 
#chains in the Genus database with same CATH homology
 2GTE A;  2KPH A;  3FE9 A;  1TUJ A;  3FE8 A;  3B88 A;  3R1P A;  3BFH A;  3B86 A;  1OOG A;  3CDN A;  1OOI X;  4OZD A;  3DXL A;  3NHI A;  1ORG A;  1XFR A;  2WCJ A;  2QEB A;  2QEH A;  3L4L A;  4JD9 A;  1OOF A;  3Q8I A;  2WC6 A;  5EL2 A;  3L4A A;  3OGN A;  3CYZ A;  1P28 A;  3D78 A;  4INW A;  3B6X A;  4INX A;  3DZT A;  3R1V A;  3L47 A;  3D74 A;  2QEV A;  2L2C A;  2WCL A;  3B7A A;  2JPO A;  3S0A A;  2H8V A;  3DYE A;  3R72 A;  2QDI A;  4PT1 A;  3R1O A;  3RZS A;  1LS8 A;  3DY9 A;  3V2L A;  1C3Y A;  3FE6 A;  1TWO A;  1C3Z A;  3S0D A;  3K1E A;  3S0E A;  2FJY A;  2P70 A;  3D77 A;  1GM0 A;  3D75 A;  3CZ2 A;  5DIC A;  2WCK A;  1OW4 A;  3S0F A;  1OOH A;  3NGV A;  3QME A;  3D76 A;  3CAB A;  2ERB A;  3BJH A;  3CZ1 A;  3VB1 A;  1DQE A;  3D73 A;  3S0G A;  3S0B A;  3BFB A;  3B87 A;  3CZ0 A;  2PQL A;  2WCM A;  3BFA A;  2WCH A;  1T14 A;  1QWV A;  4FQT A;  3PJI A;  3NHT A;  2QEO A;  2WC5 A;  4F7F A;  2P71 A;  3N7H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...