3QMEA

Crystal structure of an anopheles gambiae odorant-binding protein agamobp22a with bound odorant cyclohexanone
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
133
structure length
119
Chain Sequence
ESVIESCSNAVQGAANDELKVHYRANEFPDDPVTHCFVRCIGLELNLYDDKYGVDLQANWENLGNSDDADEEFVAKHRACLEAKNLETIEDLCERAYSAFQCLREDYEMYQNNELWSHP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Odorant binding protein (AGAP010409-PA)
publication title Crystal Structures of an Anopheles gambiae Odorant-binding Protein AgamOBP22a and Complexes with Bound Odorants
rcsb
source organism Anopheles gambiae
molecule tags Transport protein
total genus 44
structure length 119
sequence length 133
ec nomenclature
pdb deposition date 2011-02-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.20 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 Pheromone/general odorant binding protein domain 3qmeA00
3CZ1A 1LS8A 2H8VA 4INWA 1OW4A 2FJYA 3L4LA 3K1EA 3PJIA 2JPOA 2QEVA 1OOHA 3FE6A 2QEHA 1OOIX 3R1PA 3CYZA 2L2CA 1OOFA 4FQTA 1P28A 2ERBA 2P70A 2GTEA 3R72A 4OZDA 4PT1A 2P71A 3B87A 3NHIA 2WC5A 3VB1A 2WCMA 3D76A 3BJHA 3D73A 3QMEA 2QEOA 3L4AA 3NGVA 3N7HA 4JD9A 1DQEA 3RZSA 3BFHA 3BFBA 2WCKA 3S0AA 5EL2A 2WC6A 1T14A 3CABA 3L47A 3CDNA 3DZTA 1XFRA 3Q8IA 3BFAA 4INXA 3D74A 3R1OA 3B7AA 3B88A 2WCJA 3OGNA 4F7FA 3S0GA 3S0DA 3NHTA 2QEBA 3D77A 1ORGA 3B6XA 3CZ0A 2WCLA 3CZ2A 2PQLA 2KPHA 3D75A 1OOGA 3DYEA 3D78A 3FE8A 5DICA 1C3YA 1C3ZA 3S0EA 3V2LA 3DXLA 3DY9A 3FE9A 1QWVA 3S0BA 3S0FA 3R1VA 1TUJA 2WCHA 2QDIA 1TWOA 1GM0A 3B86A
chains in the Genus database with same CATH superfamily
1QJTA 1YUSA 2JXCA 4CFRA 2KI6D 1B1GA 4GBAA 1B9AA 2BCXA 2TN4A 1J7RA 2K7OA 2QACA 3K21A 3RM1A 1F8HA 1QS7A 2CTNA 2WOSA 1SRAA 1TNQA 3FE6A 1OSAA 1W9ZA 2L2CA 1PSBA 2CXJA 4C0LA 4FQTA 1C7WA 1FW4A 3SG6A 1K9KA 3SG2A 1EH2A 1XFVO 1YTZC 2HQWA 2P70A 1DJWA 2ZRSA 4P2YB 4PE7A 5JJGA 1BLQA 5KSZA 5B8IB 1YUTA 3I5FB 3ICBA 4YBHB 1KK8C 1SCMC 2K0JA 2P71A 3VB1A 2L5XB 1JWDA 1PULA 3BJHA 3CR5X 3KO0A 1N65A 2LLUA 4IJ7A 1RTP1 4XYNA 2KFGA 3TS5B 2LUXA 4JD9A 1XYDA 2K61A 5I2OA 3EK7A 1CFFA 1LA0A 4Q04A 1SR6C 3C1VA 2HPSA 1PVAA 2JWWA 4WQ3A 1TNPA 3KF9A 2KAXA 3CGAA 1DJIA 1PVBA 1R6PA 5FI2A 2F8PA 1KK7Z 1B8RA 1LA3A 2JT0A 4IL1A 1ZMZA 2WC6A 1T14A 1DF0B 1Y6WA 3EVRA 1IIOA 3SS3A 3UO9A 3WHUB 2LMUA 4DRWA 2FOTA 2KFFA 3DZTA 3Q8IA 4PDZA 1C07A 3OX5A 4YGCB 2JZIA 1WRZA 5HKZA 2L2EA 4PE4A 1K96A 2SCPA 3PSRA 3D74A 1LVCD 2P6BB 1DJGA 1OMVA 3R1OA 1B4CA 3B7AA 1LKJA 5HLVA 1F4QA 2KBIA 2KDHA 3PLFB 5AFPA 2KOTA 1CFCA 1CLBA 1PRWA 3D0YA 4PE0A 3BOWA 4YGDB 2L98A 3NHTA 1FI6A 1EXRA 1UWOA 2FJUB 1JF2A 3EKJA 2ZN9A 3D77A 3E3RA 1BT6A 2JQ6A 2JNFA 4JPZB 2LNKA 3CWGA 1TCFA 3GK2A 2WCBA 3CZ2A 4C0KA 1AJ5A 1SBJA 2CT9A 3OX6A 4CLNA 5CSFA 1Z4HA 2L4HA 2MAZA 2LV7A 3LL8B 1NYAA 1H8BA 3IVTA 1DJXA 3I5IB 4MN0A 2SASA 2M0RA 5DKQA 1JC2A 1FF1A 5CSNA 2NXQA 2M7LA 1KQMB 2JXLA 1QVIY 1CDMA 3DVMA 4A4CA 2MHHA 4MEWA 1GJYA 1DVIA 1LINA 2Y4QA 3S0EA 3DXLA 1HQVA 1QV1A 1NPQA 4HRGA 1OMDA 4GGNA 3S0BA 4WQ2A 4WRIA 3R1VA 1TNXA 5BPJA 1NCYA 2EC6B 4YI9A 1GGWA 4N5XA 1FI5A 4FQOA 1IKUA 3AKBA 3DVJA 4YRUA 1KSOA 3DF0B 3TDUA 5HL1A 1BODA 2B1UA 2RGIA 5HKYA 1MF8B 3O4YA 1FPWA 3CZ1A 2LVJA 2LAPA 1Y0VH 2CCMA 1TIZA 2G9BA 2ZRTA 1OW4A 1SW8A 4FTGA 2M3WA 3K1EA 1M63B 4PALA 3PM8A 1PK0D 4CPVA 2KAVA 1OOFA 1DT7B 2K7DA 3ZWHA 3BXKA 1IRJA 5K89A 1E8AA 2E6WA 3H4SE 1IJ6A 1KFXS 1WRKA 1UHKA 2ERBA 4USLA 1MWNA 5D69A 5JOLA 3SG3A 1Y1XA 3R72A 1XFXO 4PT1A 4GAOA 2ZNDA 1B47A 4C0JA 2WC5A 2WCMA 3D73A 1TNWA 1CDNA 1MUXA 2K7BA 1G33A 2LP3A 2QEOA 4PHKA 1NX3A 1K93D 1WRLA 3GK1A 1IG5A 3L4AA 2NZ0A 2L5YA 1V1GA 2LLTA 3UNWA 1S1EA 1DEKA 2M1UA 4NDBA 3O4XA 2KHNA 3BFHA 2ZKMX 3NSOA 3VRRA 3BFBA 2VRGA 2KGBC 2LVKA 2GGZA 4GGFC 1XVJA 2WCKA 3S0AA 1KFUS 1K9UA 1KFXL 3SG5A 5EL2A 1M46A 1F4OA 3LK1A 4XJKB 2COLB 2CNPA 2IS9A 1F55A 1NSHA 3CDNA 2FCEA 5I8NA 2KQYA 2H61C 4QJ4B 2KI4B 2KQ6A 2NLNA 2I2RE 3BQ3A 4L9MA 3IQOA 4M2QA 5AEQA 3RLZA 3BFAA 3WHTB 4MRYA 2JPTA 1ODBA 1XFWO 1RECA 1TRFA 3B88A 1CB1A 1NWDA 4N1FA 1S5GY 2F33A 1UHNA 2KI4C 2LHLA 3OGNA 1IQ3A 4F7FA 1YR5A 1Q80A 3I5FC 3S0GA 3S0DA 1KFUL 2BE6A 3TDZA 1DF0A 2AUCA 2GV5A 2JTZA 1SSEB 4PHNA 3TS5C 3CZTX 1M45A 1J7QA 1ORGA 1NUBA 1B7TY 1OMRA 1OE9B 3SS4A 2WCLA 1OOJA 4MLWA 1RFJA 1C7VA 2QPTA 1S26D 1ALWA 4GPLB 1S3PA 2KFHA 2PQLA 2KPHA 4M2OA 4M2PA 5AERA 1QVIZ 2Y1NA 5PALA 3DD4A 1XFZO 4GUKA 4MRXA 3BYAA 2WCFA 3SG4A 4DS7A 1J7OA 2WORA 1S6JA 2KSPA 3PN7B 4F0ZB 1EL4A 2JT8A 1SMGA 2DOQA 2AMIA 1Y1AA 1FBVA 1C3ZA 1QLSA 3V2LA 5IBWA 3EK8A 4BY4A 5DKRA 1F54A 1UHHA 5CPVA 3FE9A 1K95A 1QWVA 1KWOB 1A75B 2WNDA 3PN7C 4ORCB 2MJWB 1Y1UA 3OB2B 2MLEC 1TUJA 1CNPA 1CLLA 4BY5A 1W7IB 1PSRA 2BCAA 3QRXA 2WCHA 4TNCA 1AUIB 1G4YR 1V1FA 1J55A 1KWOC 2HQ8A 2QDIA 1TUZA 1U5IB 1IQ5A 2BE4A 1SL8A 3GOFA 1JBAA 1H4BA 2LP2A 3OP0A 3DVEA 1DGVA 2LMVA 1QATA 1NCXA 3ZNIA 4QJ3B 2L51A 2MA2A 2JU0A 3BUXB 1QX7A 2MRDA 3PJIA 2JPOA 2QEHA 4UPGA 3I5IC 1KCYA 3CYZA 3D0YB 1BU3A 1J1DA 1S36A 3BOWB 1P28A 3LK0A 1BG1A 1AP4A 1JFJA 1CM1A 1KQMC 1GQMA 2D8NA 3A4UB 1ZACA 5CSJA 1L7ZA 1W7JB 2WC8A 4OR9B 2Y5IA 1NCZA 1XFYO 3LCPC 1IWQA 2PASA 5AXIA 3TDIA 2JNXA 2KAYA 4ETOA 1KK7Y 1YRTB 3B87A 3NHIA 4MSPA 4U8DA 3D76A 1EG4A 2K2AA 3QMEA 3WXAA 2BKHB 2PRUA 3HX4A 4QJ5B 2KLEA 2EC6C 1TTXA 3NGVA 3HCMA 1CKKA 4PHMA 4YGAA 1PALA 2L4IA 4GNKB 3JVTB 2I7AA 2L50A 1X02A 1ALVA 3NSKA 4MBEA 1UHJA 3I5HB 3BUNB 1BOCA 3EVVA 1NIWA 1DC1A 3MSEB 2G2BA 3CABA 1WDCB 1K2HA 5DKNA 1G8IA 1SL7A 2M1KB 1EJ3A 1JF0A 1RJVA 1S5GZ 1IJ5A 2BKIB 4GGFA 3VROA 1SYMA 1VRKA 1XFRA 1CMFA 1J7PA 4INXA 1OQPA 2OTGB 1CDPA 1DMOA 2LVIA 1UUSA 2F2PA 2BL0B 2F3YA 2PSRA 1N0YA 2H61A 2BNXA 2F2OA 1YX7A 4HREE 5GQQC 1B7TZ 1SKTA 2OTGC 4MZLA 5D7FA 4XJKA 2M29A 2QEBA 3EVUA 1NP8A 1OZOA 1CFPA 4OCIA 1SCVA 4P5OE 2GGMA 3FS7A 4PCWA 4JQ0D 1RROA 1A2XA 1JUOA 1QIWA 1NX0A 1YRUB 2LE9B 3B6XA 5AANA 3TUYB 3PM2A 2YGUA 2BAPA 1QV0A 2ISDA 1A03A 3OBVA 1M39A 4YGBB 1QX2A 2JRFA 2PVBA 2LCPA 1AHRA 1K90D 2K60A 4ICBA 1F71A 1TCOB 1JFKA 3LLEA 3NXAA 1OOGA 2KYCA 2OS8B 1WY9A 2M8UA 5I94A 1CM4A 3O78A 4YGEB 3BUOB 2CBLA 1YX8A 1B8LA 5J3XA 5DICA 2OS8C 1IH0A 4D1EA 4I5KA 3VRQA 4DIRA 5ER5A 1SL9A 1HT9A 1QTXA 2EHBA 3CS1A 1DJHA 4JWQA 1MHOA 2M97A 3WNXB 2KI6C 3NSIA 3TZ1A 3DY9A 1KK8B 1SCMB 2HF5A 3OHMB 4DUQA 2PMYA 2BBMA 2JC2A 2BECA 2L0PA 1NX1A 1YUUA 3EK4A 2E30A 3CR4X 1S6IA 5FI6A 4AQIA 1QX5B 2LUCA 4ZCVA 1ZFSA 2OPOA 1CMGA 3EG5B 4CIDA 3O2PA 3GK4X 1SR6B 4YI8A 3DVKA 3FWCA 4OVNF 3B86A 1BMOA 3OB1B 1LS8A 2H8VA 4INWA 2ZNEA 2K7CA 2PYQA 1K94A 3IQQA 2FJYA 1CDLA 3L4LA 4PHJA 1A75A 1XK4A 5F6TA 1DELA 3PFVA 1MXLC 1AK8A 1XA5A 2QEVA 1OOHA 3NSLA 1OOIX 3CR2A 1M31A 3R1PA 4HRHA 4I5JA 1C3YA 2AAOA 5KTYA 4OKHA 4AQJA 5D3OA 1U5IA 5HLOA 2KYFA 1KQVA 4A4BA 1WLMA 2GTEA 2EGDA 1WLZA 4OZDA 2BBNA 4HSZA 4NQGA 2LHIA 1ZOTB 4MZKA 1XK4C 2I18A 2ZN8A 2MLFC 2K8MB 4R1EA 4ORAB 1SY9A 1QIVA 2M7NA 2KGRA 1MR8A 3AAKA 3N7HA 1KSMA 1MQ1A 4N1GA 1OZSA 1DQEA 1QASA 2JOJA 3CTNA 4ORBB 1QLKA 3CLNA 3KEVA 3VRNA 4ZCUA 1DTLA 2A4JA 4OV2A 5TNCA 3RZSA 1JSAA 1A29A 4JKTA 1QXPA 3FIAA 5G08A 3VGOA 2Y1MA 3AKAA 2LC5A 2JTTA 5FYXA 5I2LA 3DF0A 3SS5A 1K9PA 1BR4B 1IGVA 1S6CA 3JTDB 3L47A 3O6BA 2I94A 2KLDA 2NCPA 4MZJA 1R2UA 2M49B 1A4PA 2LLSA 2R2IA 4I5LB 3JTDC 3PALA 1BF5A 2V53A 2WCJA 3SIAA 1NX2A 2K2FA 5KU1A 2JT3A 2F3ZA 1J1EA 1YVHA 1CTRA 2MBXA 4NDDA 3SIBA 1B8CA 1SNLA 1LXFC 3KPXA 3VRPA 2Q4UA 2KNEA 2H2KA 1K8UA 1BJFA 1RK9A 3A8RA 2M9GA 1Z2CB 2LANA 5HKWA 1BR1B 5I2QA 1ZUZA 3CZ0A 3IF7A 3PATA 1DJZA 1N2DA 1UP5A 5CSIA 3KHEA 5ER4X 1F70A 2PALA 1DJYA 3JVTC 1GGZA 1TN4A 3I5GB 2LM5A 2O5GA 1MXEA 1TOPA 3I5HC 2NCOA 1RWYA 3D75A 1D1OA 4I5NB 3F45A 1CFDA 1WDCC 1AJ4A 1YVLA 3I5GC 4MVFA 3DYEA 4NDCA 1CLMA 2BCBA 3D78A 3BUWB 1SK6D 1XO5A 3FE8A 2Q91A 5FI7A 3AAJA 2KBMA 4CFQA 1EG3A 2ZFDA 3BUMB 2BL0C 3FWBA 3M0WA 1L2OB 3EKHA 1UURA 2LMTA 1UHIA 4DCKA 4E68A 3S0FA 3SJSA 1DGUA 1XFUO 4GFTA 5HYDA 1AVSA 4AOMA 1YURA 2HETA 1L2OC 2JULA 4KYNA 3D10A 2FCDA 1TWOA 1GM0A 3TUYC 2O60A 2WCEA 4PE1A 2LVVA 1SPYA 3SG7A
chains in the Genus database with same CATH topology
3CZ1A 1LS8A 2H8VA 4INWA 1OW4A 2FJYA 3L4LA 3K1EA 3PJIA 2JPOA 2QEVA 1OOHA 3FE6A 2QEHA 1OOIX 3R1PA 3CYZA 2L2CA 1OOFA 4FQTA 1P28A 2ERBA 2P70A 2GTEA 3R72A 4OZDA 4PT1A 2P71A 3B87A 3NHIA 2WC5A 3VB1A 2WCMA 3D76A 3BJHA 3D73A 3QMEA 2QEOA 3L4AA 3NGVA 3N7HA 4JD9A 1DQEA 3RZSA 3BFHA 3BFBA 2WCKA 3S0AA 5EL2A 2WC6A 1T14A 3CABA 3L47A 3CDNA 3DZTA 1XFRA 3Q8IA 3BFAA 4INXA 3D74A 3R1OA 3B7AA 3B88A 2WCJA 3OGNA 4F7FA 3S0GA 3S0DA 3NHTA 2QEBA 3D77A 1ORGA 3B6XA 3CZ0A 2WCLA 3CZ2A 2PQLA 2KPHA 3D75A 1OOGA 3DYEA 3D78A 3FE8A 5DICA 1C3YA 1C3ZA 3S0EA 3V2LA 3DXLA 3DY9A 3FE9A 1QWVA 3S0BA 3S0FA 3R1VA 1TUJA 2WCHA 2QDIA 1TWOA 1GM0A 3B86A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CZ1 A;  1LS8 A;  2H8V A;  4INW A;  1OW4 A;  2FJY A;  3L4L A;  3K1E A;  3PJI A;  2JPO A;  2QEV A;  1OOH A;  3FE6 A;  2QEH A;  1OOI X;  3R1P A;  3CYZ A;  2L2C A;  1OOF A;  4FQT A;  1P28 A;  2ERB A;  2P70 A;  2GTE A;  3R72 A;  4OZD A;  4PT1 A;  2P71 A;  3B87 A;  3NHI A;  2WC5 A;  3VB1 A;  2WCM A;  3D76 A;  3BJH A;  3D73 A;  3QME A;  2QEO A;  3L4A A;  3NGV A;  3N7H A;  4JD9 A;  1DQE A;  3RZS A;  3BFH A;  3BFB A;  2WCK A;  3S0A A;  5EL2 A;  2WC6 A;  1T14 A;  3CAB A;  3L47 A;  3CDN A;  3DZT A;  1XFR A;  3Q8I A;  3BFA A;  4INX A;  3D74 A;  3R1O A;  3B7A A;  3B88 A;  2WCJ A;  3OGN A;  4F7F A;  3S0G A;  3S0D A;  3NHT A;  2QEB A;  3D77 A;  1ORG A;  3B6X A;  3CZ0 A;  2WCL A;  3CZ2 A;  2PQL A;  2KPH A;  3D75 A;  1OOG A;  3DYE A;  3D78 A;  3FE8 A;  5DIC A;  1C3Y A;  1C3Z A;  3S0E A;  3V2L A;  3DXL A;  3DY9 A;  3FE9 A;  1QWV A;  3S0B A;  3S0F A;  3R1V A;  1TUJ A;  2WCH A;  2QDI A;  1TWO A;  1GM0 A;  3B86 A; 
#chains in the Genus database with same CATH topology
 1QJT A;  1YUS A;  2JXC A;  4CFR A;  2KI6 D;  1B1G A;  4GBA A;  1B9A A;  2BCX A;  2TN4 A;  1J7R A;  2K7O A;  2QAC A;  3K21 A;  3RM1 A;  1F8H A;  1QS7 A;  2CTN A;  2WOS A;  1SRA A;  1TNQ A;  3FE6 A;  1OSA A;  1W9Z A;  2L2C A;  1PSB A;  2CXJ A;  4C0L A;  4FQT A;  1C7W A;  1FW4 A;  3SG6 A;  1K9K A;  3SG2 A;  1EH2 A;  1XFV O;  1YTZ C;  2HQW A;  2P70 A;  1DJW A;  2ZRS A;  4P2Y B;  4PE7 A;  5JJG A;  1BLQ A;  5KSZ A;  5B8I B;  1YUT A;  3I5F B;  3ICB A;  4YBH B;  1KK8 C;  1SCM C;  2K0J A;  2P71 A;  3VB1 A;  2L5X B;  1JWD A;  1PUL A;  3BJH A;  3CR5 X;  3KO0 A;  1N65 A;  2LLU A;  4IJ7 A;  1RTP 1;  4XYN A;  2KFG A;  3TS5 B;  2LUX A;  4JD9 A;  1XYD A;  2K61 A;  5I2O A;  3EK7 A;  1CFF A;  1LA0 A;  4Q04 A;  1SR6 C;  3C1V A;  2HPS A;  1PVA A;  2JWW A;  4WQ3 A;  1TNP A;  3KF9 A;  2KAX A;  3CGA A;  1DJI A;  1PVB A;  1R6P A;  5FI2 A;  2F8P A;  1KK7 Z;  1B8R A;  1LA3 A;  2JT0 A;  4IL1 A;  1ZMZ A;  2WC6 A;  1T14 A;  1DF0 B;  1Y6W A;  3EVR A;  1IIO A;  3SS3 A;  3UO9 A;  3WHU B;  2LMU A;  4DRW A;  2FOT A;  2KFF A;  3DZT A;  3Q8I A;  4PDZ A;  1C07 A;  3OX5 A;  4YGC B;  2JZI A;  1WRZ A;  5HKZ A;  2L2E A;  4PE4 A;  1K96 A;  2SCP A;  3PSR A;  3D74 A;  1LVC D;  2P6B B;  1DJG A;  1OMV A;  3R1O A;  1B4C A;  3B7A A;  1LKJ A;  5HLV A;  1F4Q A;  2KBI A;  2KDH A;  3PLF B;  5AFP A;  2KOT A;  1CFC A;  1CLB A;  1PRW A;  3D0Y A;  4PE0 A;  3BOW A;  4YGD B;  2L98 A;  3NHT A;  1FI6 A;  1EXR A;  1UWO A;  2FJU B;  1JF2 A;  3EKJ A;  2ZN9 A;  3D77 A;  3E3R A;  1BT6 A;  2JQ6 A;  2JNF A;  4JPZ B;  2LNK A;  3CWG A;  1TCF A;  3GK2 A;  2WCB A;  3CZ2 A;  4C0K A;  1AJ5 A;  1SBJ A;  2CT9 A;  3OX6 A;  4CLN A;  5CSF A;  1Z4H A;  2L4H A;  2MAZ A;  2LV7 A;  3LL8 B;  1NYA A;  1H8B A;  3IVT A;  1DJX A;  3I5I B;  4MN0 A;  2SAS A;  2M0R A;  5DKQ A;  1JC2 A;  1FF1 A;  5CSN A;  2NXQ A;  2M7L A;  1KQM B;  2JXL A;  1QVI Y;  1CDM A;  3DVM A;  4A4C A;  2MHH A;  4MEW A;  1GJY A;  1DVI A;  1LIN A;  2Y4Q A;  3S0E A;  3DXL A;  1HQV A;  1QV1 A;  1NPQ A;  4HRG A;  1OMD A;  4GGN A;  3S0B A;  4WQ2 A;  4WRI A;  3R1V A;  1TNX A;  5BPJ A;  1NCY A;  2EC6 B;  4YI9 A;  1GGW A;  4N5X A;  1FI5 A;  4FQO A;  1IKU A;  3AKB A;  3DVJ A;  4YRU A;  1KSO A;  3DF0 B;  3TDU A;  5HL1 A;  1BOD A;  2B1U A;  2RGI A;  5HKY A;  1MF8 B;  3O4Y A;  1FPW A;  3CZ1 A;  2LVJ A;  2LAP A;  1Y0V H;  2CCM A;  1TIZ A;  2G9B A;  2ZRT A;  1OW4 A;  1SW8 A;  4FTG A;  2M3W A;  3K1E A;  1M63 B;  4PAL A;  3PM8 A;  1PK0 D;  4CPV A;  2KAV A;  1OOF A;  1DT7 B;  2K7D A;  3ZWH A;  3BXK A;  1IRJ A;  5K89 A;  1E8A A;  2E6W A;  3H4S E;  1IJ6 A;  1KFX S;  1WRK A;  1UHK A;  2ERB A;  4USL A;  1MWN A;  5D69 A;  5JOL A;  3SG3 A;  1Y1X A;  3R72 A;  1XFX O;  4PT1 A;  4GAO A;  2ZND A;  1B47 A;  4C0J A;  2WC5 A;  2WCM A;  3D73 A;  1TNW A;  1CDN A;  1MUX A;  2K7B A;  1G33 A;  2LP3 A;  2QEO A;  4PHK A;  1NX3 A;  1K93 D;  1WRL A;  3GK1 A;  1IG5 A;  3L4A A;  2NZ0 A;  2L5Y A;  1V1G A;  2LLT A;  3UNW A;  1S1E A;  1DEK A;  2M1U A;  4NDB A;  3O4X A;  2KHN A;  3BFH A;  2ZKM X;  3NSO A;  3VRR A;  3BFB A;  2VRG A;  2KGB C;  2LVK A;  2GGZ A;  4GGF C;  1XVJ A;  2WCK A;  3S0A A;  1KFU S;  1K9U A;  1KFX L;  3SG5 A;  5EL2 A;  1M46 A;  1F4O A;  3LK1 A;  4XJK B;  2COL B;  2CNP A;  2IS9 A;  1F55 A;  1NSH A;  3CDN A;  2FCE A;  5I8N A;  2KQY A;  2H61 C;  4QJ4 B;  2KI4 B;  2KQ6 A;  2NLN A;  2I2R E;  3BQ3 A;  4L9M A;  3IQO A;  4M2Q A;  5AEQ A;  3RLZ A;  3BFA A;  3WHT B;  4MRY A;  2JPT A;  1ODB A;  1XFW O;  1REC A;  1TRF A;  3B88 A;  1CB1 A;  1NWD A;  4N1F A;  1S5G Y;  2F33 A;  1UHN A;  2KI4 C;  2LHL A;  3OGN A;  1IQ3 A;  4F7F A;  1YR5 A;  1Q80 A;  3I5F C;  3S0G A;  3S0D A;  1KFU L;  2BE6 A;  3TDZ A;  1DF0 A;  2AUC A;  2GV5 A;  2JTZ A;  1SSE B;  4PHN A;  3TS5 C;  3CZT X;  1M45 A;  1J7Q A;  1ORG A;  1NUB A;  1B7T Y;  1OMR A;  1OE9 B;  3SS4 A;  2WCL A;  1OOJ A;  4MLW A;  1RFJ A;  1C7V A;  2QPT A;  1S26 D;  1ALW A;  4GPL B;  1S3P A;  2KFH A;  2PQL A;  2KPH A;  4M2O A;  4M2P A;  5AER A;  1QVI Z;  2Y1N A;  5PAL A;  3DD4 A;  1XFZ O;  4GUK A;  4MRX A;  3BYA A;  2WCF A;  3SG4 A;  4DS7 A;  1J7O A;  2WOR A;  1S6J A;  2KSP A;  3PN7 B;  4F0Z B;  1EL4 A;  2JT8 A;  1SMG A;  2DOQ A;  2AMI A;  1Y1A A;  1FBV A;  1C3Z A;  1QLS A;  3V2L A;  5IBW A;  3EK8 A;  4BY4 A;  5DKR A;  1F54 A;  1UHH A;  5CPV A;  3FE9 A;  1K95 A;  1QWV A;  1KWO B;  1A75 B;  2WND A;  3PN7 C;  4ORC B;  2MJW B;  1Y1U A;  3OB2 B;  2MLE C;  1TUJ A;  1CNP A;  1CLL A;  4BY5 A;  1W7I B;  1PSR A;  2BCA A;  3QRX A;  2WCH A;  4TNC A;  1AUI B;  1G4Y R;  1V1F A;  1J55 A;  1KWO C;  2HQ8 A;  2QDI A;  1TUZ A;  1U5I B;  1IQ5 A;  2BE4 A;  1SL8 A;  3GOF A;  1JBA A;  1H4B A;  2LP2 A;  3OP0 A;  3DVE A;  1DGV A;  2LMV A;  1QAT A;  1NCX A;  3ZNI A;  4QJ3 B;  2L51 A;  2MA2 A;  2JU0 A;  3BUX B;  1QX7 A;  2MRD A;  3PJI A;  2JPO A;  2QEH A;  4UPG A;  3I5I C;  1KCY A;  3CYZ A;  3D0Y B;  1BU3 A;  1J1D A;  1S36 A;  3BOW B;  1P28 A;  3LK0 A;  1BG1 A;  1AP4 A;  1JFJ A;  1CM1 A;  1KQM C;  1GQM A;  2D8N A;  3A4U B;  1ZAC A;  5CSJ A;  1L7Z A;  1W7J B;  2WC8 A;  4OR9 B;  2Y5I A;  1NCZ A;  1XFY O;  3LCP C;  1IWQ A;  2PAS A;  5AXI A;  3TDI A;  2JNX A;  2KAY A;  4ETO A;  1KK7 Y;  1YRT B;  3B87 A;  3NHI A;  4MSP A;  4U8D A;  3D76 A;  1EG4 A;  2K2A A;  3QME A;  3WXA A;  2BKH B;  2PRU A;  3HX4 A;  4QJ5 B;  2KLE A;  2EC6 C;  1TTX A;  3NGV A;  3HCM A;  1CKK A;  4PHM A;  4YGA A;  1PAL A;  2L4I A;  4GNK B;  3JVT B;  2I7A A;  2L50 A;  1X02 A;  1ALV A;  3NSK A;  4MBE A;  1UHJ A;  3I5H B;  3BUN B;  1BOC A;  3EVV A;  1NIW A;  1DC1 A;  3MSE B;  2G2B A;  3CAB A;  1WDC B;  1K2H A;  5DKN A;  1G8I A;  1SL7 A;  2M1K B;  1EJ3 A;  1JF0 A;  1RJV A;  1S5G Z;  1IJ5 A;  2BKI B;  4GGF A;  3VRO A;  1SYM A;  1VRK A;  1XFR A;  1CMF A;  1J7P A;  4INX A;  1OQP A;  2OTG B;  1CDP A;  1DMO A;  2LVI A;  1UUS A;  2F2P A;  2BL0 B;  2F3Y A;  2PSR A;  1N0Y A;  2H61 A;  2BNX A;  2F2O A;  1YX7 A;  4HRE E;  5GQQ C;  1B7T Z;  1SKT A;  2OTG C;  4MZL A;  5D7F A;  4XJK A;  2M29 A;  2QEB A;  3EVU A;  1NP8 A;  1OZO A;  1CFP A;  4OCI A;  1SCV A;  4P5O E;  2GGM A;  3FS7 A;  4PCW A;  4JQ0 D;  1RRO A;  1A2X A;  1JUO A;  1QIW A;  1NX0 A;  1YRU B;  2LE9 B;  3B6X A;  5AAN A;  3TUY B;  3PM2 A;  2YGU A;  2BAP A;  1QV0 A;  2ISD A;  1A03 A;  3OBV A;  1M39 A;  4YGB B;  1QX2 A;  2JRF A;  2PVB A;  2LCP A;  1AHR A;  1K90 D;  2K60 A;  4ICB A;  1F71 A;  1TCO B;  1JFK A;  3LLE A;  3NXA A;  1OOG A;  2KYC A;  2OS8 B;  1WY9 A;  2M8U A;  5I94 A;  1CM4 A;  3O78 A;  4YGE B;  3BUO B;  2CBL A;  1YX8 A;  1B8L A;  5J3X A;  5DIC A;  2OS8 C;  1IH0 A;  4D1E A;  4I5K A;  3VRQ A;  4DIR A;  5ER5 A;  1SL9 A;  1HT9 A;  1QTX A;  2EHB A;  3CS1 A;  1DJH A;  4JWQ A;  1MHO A;  2M97 A;  3WNX B;  2KI6 C;  3NSI A;  3TZ1 A;  3DY9 A;  1KK8 B;  1SCM B;  2HF5 A;  3OHM B;  4DUQ A;  2PMY A;  2BBM A;  2JC2 A;  2BEC A;  2L0P A;  1NX1 A;  1YUU A;  3EK4 A;  2E30 A;  3CR4 X;  1S6I A;  5FI6 A;  4AQI A;  1QX5 B;  2LUC A;  4ZCV A;  1ZFS A;  2OPO A;  1CMG A;  3EG5 B;  4CID A;  3O2P A;  3GK4 X;  1SR6 B;  4YI8 A;  3DVK A;  3FWC A;  4OVN F;  3B86 A;  1BMO A;  3OB1 B;  1LS8 A;  2H8V A;  4INW A;  2ZNE A;  2K7C A;  2PYQ A;  1K94 A;  3IQQ A;  2FJY A;  1CDL A;  3L4L A;  4PHJ A;  1A75 A;  1XK4 A;  5F6T A;  1DEL A;  3PFV A;  1MXL C;  1AK8 A;  1XA5 A;  2QEV A;  1OOH A;  3NSL A;  1OOI X;  3CR2 A;  1M31 A;  3R1P A;  4HRH A;  4I5J A;  1C3Y A;  2AAO A;  5KTY A;  4OKH A;  4AQJ A;  5D3O A;  1U5I A;  5HLO A;  2KYF A;  1KQV A;  4A4B A;  1WLM A;  2GTE A;  2EGD A;  1WLZ A;  4OZD A;  2BBN A;  4HSZ A;  4NQG A;  2LHI A;  1ZOT B;  4MZK A;  1XK4 C;  2I18 A;  2ZN8 A;  2MLF C;  2K8M B;  4R1E A;  4ORA B;  1SY9 A;  1QIV A;  2M7N A;  2KGR A;  1MR8 A;  3AAK A;  3N7H A;  1KSM A;  1MQ1 A;  4N1G A;  1OZS A;  1DQE A;  1QAS A;  2JOJ A;  3CTN A;  4ORB B;  1QLK A;  3CLN A;  3KEV A;  3VRN A;  4ZCU A;  1DTL A;  2A4J A;  4OV2 A;  5TNC A;  3RZS A;  1JSA A;  1A29 A;  4JKT A;  1QXP A;  3FIA A;  5G08 A;  3VGO A;  2Y1M A;  3AKA A;  2LC5 A;  2JTT A;  5FYX A;  5I2L A;  3DF0 A;  3SS5 A;  1K9P A;  1BR4 B;  1IGV A;  1S6C A;  3JTD B;  3L47 A;  3O6B A;  2I94 A;  2KLD A;  2NCP A;  4MZJ A;  1R2U A;  2M49 B;  1A4P A;  2LLS A;  2R2I A;  4I5L B;  3JTD C;  3PAL A;  1BF5 A;  2V53 A;  2WCJ A;  3SIA A;  1NX2 A;  2K2F A;  5KU1 A;  2JT3 A;  2F3Z A;  1J1E A;  1YVH A;  1CTR A;  2MBX A;  4NDD A;  3SIB A;  1B8C A;  1SNL A;  1LXF C;  3KPX A;  3VRP A;  2Q4U A;  2KNE A;  2H2K A;  1K8U A;  1BJF A;  1RK9 A;  3A8R A;  2M9G A;  1Z2C B;  2LAN A;  5HKW A;  1BR1 B;  5I2Q A;  1ZUZ A;  3CZ0 A;  3IF7 A;  3PAT A;  1DJZ A;  1N2D A;  1UP5 A;  5CSI A;  3KHE A;  5ER4 X;  1F70 A;  2PAL A;  1DJY A;  3JVT C;  1GGZ A;  1TN4 A;  3I5G B;  2LM5 A;  2O5G A;  1MXE A;  1TOP A;  3I5H C;  2NCO A;  1RWY A;  3D75 A;  1D1O A;  4I5N B;  3F45 A;  1CFD A;  1WDC C;  1AJ4 A;  1YVL A;  3I5G C;  4MVF A;  3DYE A;  4NDC A;  1CLM A;  2BCB A;  3D78 A;  3BUW B;  1SK6 D;  1XO5 A;  3FE8 A;  2Q91 A;  5FI7 A;  3AAJ A;  2KBM A;  4CFQ A;  1EG3 A;  2ZFD A;  3BUM B;  2BL0 C;  3FWB A;  3M0W A;  1L2O B;  3EKH A;  1UUR A;  2LMT A;  1UHI A;  4DCK A;  4E68 A;  3S0F A;  3SJS A;  1DGU A;  1XFU O;  4GFT A;  5HYD A;  1AVS A;  4AOM A;  1YUR A;  2HET A;  1L2O C;  2JUL A;  4KYN A;  3D10 A;  2FCD A;  1TWO A;  1GM0 A;  3TUY C;  2O60 A;  2WCE A;  4PE1 A;  2LVV A;  1SPY A;  3SG7 A; 
#chains in the Genus database with same CATH homology
 3CZ1 A;  1LS8 A;  2H8V A;  4INW A;  1OW4 A;  2FJY A;  3L4L A;  3K1E A;  3PJI A;  2JPO A;  2QEV A;  1OOH A;  3FE6 A;  2QEH A;  1OOI X;  3R1P A;  3CYZ A;  2L2C A;  1OOF A;  4FQT A;  1P28 A;  2ERB A;  2P70 A;  2GTE A;  3R72 A;  4OZD A;  4PT1 A;  2P71 A;  3B87 A;  3NHI A;  2WC5 A;  3VB1 A;  2WCM A;  3D76 A;  3BJH A;  3D73 A;  3QME A;  2QEO A;  3L4A A;  3NGV A;  3N7H A;  4JD9 A;  1DQE A;  3RZS A;  3BFH A;  3BFB A;  2WCK A;  3S0A A;  5EL2 A;  2WC6 A;  1T14 A;  3CAB A;  3L47 A;  3CDN A;  3DZT A;  1XFR A;  3Q8I A;  3BFA A;  4INX A;  3D74 A;  3R1O A;  3B7A A;  3B88 A;  2WCJ A;  3OGN A;  4F7F A;  3S0G A;  3S0D A;  3NHT A;  2QEB A;  3D77 A;  1ORG A;  3B6X A;  3CZ0 A;  2WCL A;  3CZ2 A;  2PQL A;  2KPH A;  3D75 A;  1OOG A;  3DYE A;  3D78 A;  3FE8 A;  5DIC A;  1C3Y A;  1C3Z A;  3S0E A;  3V2L A;  3DXL A;  3DY9 A;  3FE9 A;  1QWV A;  3S0B A;  3S0F A;  3R1V A;  1TUJ A;  2WCH A;  2QDI A;  1TWO A;  1GM0 A;  3B86 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...