3QMEA

Crystal structure of an anopheles gambiae odorant-binding protein agamobp22a with bound odorant cyclohexanone
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
133
structure length
119
Chain Sequence
ESVIESCSNAVQGAANDELKVHYRANEFPDDPVTHCFVRCIGLELNLYDDKYGVDLQANWENLGNSDDADEEFVAKHRACLEAKNLETIEDLCERAYSAFQCLREDYEMYQNNELWSHP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords Odorant binding protein (AGAP010409-PA)
publication title Crystal Structures of an Anopheles gambiae Odorant-binding Protein AgamOBP22a and Complexes with Bound Odorants
rcsb
source organism Anopheles gambiae
total genus 44
structure length 119
sequence length 133
ec nomenclature
pdb deposition date 2011-02-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.20 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 Pheromone/general odorant binding protein domain 3qmeA00
3B88A 1C3YA 4PT1A 3S0EA 3D75A 3FE9A 3BFHA 3DXLA 3PJIA 3D78A 3D73A 1TUJA 2P71A 3VB1A 3CDNA 1DQEA 3CZ0A 3S0FA 3DYEA 1OOIX 3NHIA 4INXA 2QEVA 2PQLA 2GTEA 4F7FA 2QDIA 3D74A 1QWVA 2JPOA 2QEHA 3V2LA 3S0DA 3S0BA 3L47A 2WCLA 3B7AA 3DY9A 2WC6A 2H8VA 1ORGA 3B87A 3K1EA 5EL2A 3RZSA 3DZTA 2P70A 3R1VA 1T14A 3FE6A 1P28A 2L2CA 3CYZA 2QEBA 3B6XA 3S0GA 3D76A 4JD9A 4OZDA 4INWA 4FQTA 1OOHA 1LS8A 2WCHA 2WC5A 3R1PA 3L4AA 3BFAA 2KPHA 5DICA 3S0AA 3FE8A 3L4LA 3R1OA 2QEOA 2WCKA 3NHTA 3OGNA 1OOFA 2WCJA 2ERBA 3NGVA 1XFRA 3CZ1A 2WCMA 3Q8IA 2FJYA 3D77A 1GM0A 3CZ2A 1OOGA 1OW4A 3N7HA 3BFBA 3CABA 3B86A 3QMEA 3R72A 1TWOA 1C3ZA 3BJHA
chains in the Genus database with same CATH superfamily
4TNCA 2D8NA 2CTNA 2H2KA 4MVFA 3CLNA 1AK8A 4M2QA 3TDZA 1YX7A 1UHNA 1CKKA 2LUCA 2BE6A 3D75A 4HSZA 1UHKA 2LLSA 4YRUA 2KAVA 2KFHA 5D7FA 1QLSA 3PJIA 1J7PA 1RECA 3NSLA 2OS8B 2M1UA 4N5XA 3JVTB 1SY9A 5CPVA 1IWQA 4YGEB 5K89A 4WRIA 1F8HA 4AQIA 2CXJA 1N2DA 2L4HA 3CZTX 3AKAA 3VB1A 1PVBA 2ZN9A 3SS3A 1KFXL 4P5OE 3ZNIA 1WY9A 4PHMA 4OV2A 1RJVA 1Y1UA 2F33A 3BXKA 1BLQA 1IJ6A 5DKQA 4I5JA 2KAXA 3S0FA 5HKYA 2M49B 3D10A 4INXA 2ISDA 1GQMA 5HKZA 4IJ7A 4DUQA 1DJHA 3I5HC 1KQMC 1PVAA 5I8NA 2KGRA 2F2OA 2JULA 3PALA 2LVVA 4YGDB 1QWVA 2O60A 4PALA 1A75A 2NCPA 1Y1AA 3EKHA 5IBWA 2I2RE 3S0BA 3L47A 3O2PA 1A03A 1EJ3A 3B7AA 3WXAA 2CNPA 1YRTB 2G9BA 2KYFA 1CFCA 1QV1A 5FI2A 4CPVA 3B87A 2LLUA 2ZKMX 2A4JA 1XFXO 1JFJA 1S6IA 3ZWHA 4I5KA 2BAPA 2YGUA 2WNDA 1IQ5A 3PLFB 2KDHA 3R1VA 5AEQA 1B8CA 3BOWA 2KYCA 5FI6A 2HPSA 2B1UA 1FW4A 4C0LA 5KTYA 3AAKA 2BKHB 2MJWB 2QEBA 2SCPA 1DGVA 1QX2A 2QACA 2CT9A 2M8UA 3I5GC 3FIAA 2LVKA 2PMYA 3SIAA 1ZOTB 1MR8A 1QASA 4ICBA 1IKUA 2M3WA 3A4UB 3I5FC 3SG2A 1YURA 2KI4B 4YGAA 2LNKA 2BE4A 2F2PA 3SG6A 3BUOB 1LVCD 2L0PA 4DIRA 1AJ4A 2G2BA 2JWWA 1OZSA 2KPHA 3HX4A 3K21A 4GBAA 3TS5C 1CLBA 2K7CA 1A29A 1IGVA 1TIZA 2M97A 3OGNA 3PN7C 1M39A 1OOFA 4XYNA 4MN0A 5GQQC 1GGWA 1F71A 1K2HA 2ERBA 1B8LA 2LP3A 1AVSA 1XFRA 2BBNA 3F45A 4XJKA 1M45A 1PSBA 2OTGC 3SG5A 4CFRA 1IQ3A 2LHIA 2HQWA 1H8BA 3TUYB 1CFDA 1R2UA 1XK4A 2L5XB 3EK8A 2L50A 4AQJA 1RTP1 1G33A 3EKJA 3TDIA 3D0YA 2ZRSA 3QMEA 3R72A 4JWQA 4WQ2A 1SL9A 2KFGA 5F6TA 4UPGA 1CB1A 2KNEA 2NCOA 3BJHA 2JXCA 5PALA 2R2IA 3PM2A 1G8IA 1S3PA 1TCOB 1F4OA 3TS5B 1L7ZA 5KSZA 3OB2B 2L4IA 1BR4B 1IRJA 1KWOB 1WDCC 1XFUO 1MWNA 2F3ZA 1CNPA 4F0ZB 3GK4X 1IG5A 2M7LA 1NP8A 3LK1A 4NDDA 1KFUS 4AOMA 1XO5A 1S6CA 1XYDA 2FJUB 2LVJA 1BU3A 1LKJA 1SMGA 4CIDA 2GGMA 2E30A 3AKBA 1KK8B 3NSIA 3LLEA 1DQEA 1SRAA 1MUXA 1S6JA 3I5IB 4PE4A 1B47A 3OB1B 1TNWA 4P2YB 5HLVA 1F4QA 2LCPA 1QLKA 2KFFA 5I2QA 1UHJA 1SKTA 1UWOA 2O5GA 2FCEA 2QEVA 4MEWA 1QTXA 1MF8B 1JFKA 1NSHA 2JT8A 2PQLA 3EVUA 3OP0A 5JOLA 2KAYA 5AANA 4GGNA 4E68A 3VROA 2WCFA 1ZFSA 4NDCA 4F7FA 5I2LA 2QDIA 1OZOA 1QIWA 1BF5A 3ICBA 4YGCB 2JPOA 3DVKA 3V2LA 3S0DA 4NQGA 4MRXA 2DOQA 1W7JB 1FBVA 4JPZB 4U8DA 2MHHA 1PK0D 4DCKA 1JF0A 1NCZA 2H8VA 4HREE 1UHHA 2GGZA 4ORAB 2WOSA 2K0JA 1CFFA 2ZNEA 4Q04A 3SG7A 3PATA 3K1EA 4FQOA 1A2XA 1Y6WA 2LP2A 2P70A 2K2AA 1SL8A 2LV7A 1C07A 4DRWA 2LE9B 3CS1A 3SG4A 1OMDA 3GOFA 5I94A 1DMOA 2L98A 1JSAA 3DF0A 2ZN8A 3FE6A 2JT0A 1OQPA 1KQVA 1ODBA 5ER5A 1U5IB 2JOJA 1KFUL 1YTZC 4CFQA 1DJWA 2FOTA 2JXLA 2Q91A 3DVJA 1NCYA 2LUXA 2K7OA 1BG1A 2JPTA 3LL8B 3O78A 1M46A 1N0YA 1YX8A 2NXQA 4JD9A 5KU1A 1DJZA 1BODA 1B8RA 3FWBA 4GNKB 5D69A 3QRXA 3BYAA 1B9AA 2WCHA 2F8PA 1DJXA 2LVIA 1AUIB 2LANA 2Y5IA 1DF0A 2F3YA 4PCWA 5AXIA 3SG3A 2CBLA 2WC5A 1JUOA 1R6PA 2JT3A 3R1PA 3BFAA 3EG5B 2JRFA 3NSOA 1UURA 4MRYA 1Y0VH 2PRUA 1V1GA 2QEOA 2WCKA 3EK4A 1TNXA 3NHTA 3H4SE 1ALVA 1QJTA 2BL0C 2JU0A 2L5YA 1OSAA 2WCJA 3OX6A 4PHNA 1Y1XA 2LHLA 3CZ1A 4M2PA 1DJYA 4MSPA 2KHNA 2K61A 1J7QA 2BNXA 2WCMA 3NSKA 4OCIA 1A75B 3I5HB 1KQMB 1S5GZ 1XVJA 3HCMA 3WHUB 3PM8A 1OOJA 3IQQA 4OKHA 1B4CA 1F70A 4IL1A 2FJYA 3BQ3A 1EG3A 1J1EA 2Y4QA 4FTGA 1GM0A 2Y1MA 4ZCUA 1OW4A 1LXFC 1QV0A 3C1VA 3BFBA 1BOCA 1WRZA 3B86A 2PVBA 1TWOA 1WRKA 2AUCA 3OHMB 1K96A 3B88A 1UUSA 1V1FA 3JTDC 3KHEA 3BOWB 1QVIZ 2KSPA 1A4PA 2AMIA 2WCBA 1M31A 1Q80A 1TUJA 1XFVO 4GAOA 1SNLA 1C7VA 1J7OA 5CSFA 1YRUB 2LM5A 3I5GB 1XK4C 2V53A 1SR6C 1ZUZA 1NIWA 2LMUA 5HYDA 1S1EA 3CR5X 3I5FB 1TTXA 4GFTA 1K9PA 1QATA 1MXEA 1SYMA 3CZ0A 1WLMA 4QJ4B 1ALWA 1OOIX 2BBMA 3NHIA 4JQ0D 4L9MA 1UP5A 1BMOA 3EK7A 1NPQA 5HL1A 3SJSA 3OX5A 2EC6C 5BPJA 2KOTA 1SCMC 2EGDA 3A8RA 3VRPA 1TOPA 3BUMB 5DKRA 2NZ0A 2P6BB 3PN7B 1CDMA 3D74A 2QEHA 4I5LB 4MLWA 1D1OA 1IH0A 3NXAA 5D3OA 1TNQA 4XJKB 1YUUA 1MQ1A 1YVHA 2WCLA 3LCPC 2AAOA 3DY9A 4WQ3A 1FI6A 2WC6A 2HF5A 4R1EA 3IQOA 1CMFA 1J1DA 1NX0A 4DS7A 2OTGB 1F54A 1RWYA 4QJ3B 1J7RA 2CCMA 1B7TZ 1AJ5A 1K9KA 2LMVA 2K7BA 3FWCA 3O4XA 1SR6B 3DZTA 5EL2A 1CDPA 5I2OA 3RZSA 1CLLA 1SK6D 3D0YB 4ZCVA 4CLNA 4ORCB 1CLMA 1RROA 1CFPA 1IJ5A 1OMRA 2ZFDA 1HT9A 2OS8C 1EG4A 3CTNA 1P28A 2HETA 2JNFA 2L2CA 2IS9A 3CYZA 4YI9A 2PASA 2KI6C 1DTLA 1S5GY 1BR1B 2K7DA 2PSRA 2I94A 2EC6B 3B6XA 2M1KB 4PE1A 1WDCB 3KEVA 4N1FA 4OZDA 3CWGA 2M29A 4GGFC 4INWA 4N1GA 4FQTA 1OOHA 5G08A 2K60A 1DC1A 1SBJA 5DKNA 2MBXA 1QX5B 4GGFA 2FCDA 1LINA 1TRFA 1M63B 1NX2A 5J3XA 1NUBA 4YBHB 1W7IB 1GGZA 4YI8A 1KK7Z 1QX7A 1QVIY 2KLEA 3MSEB 3VRQA 3SIBA 3R1OA 3SS5A 1K9UA 2KI6D 4MZKA 4HRHA 4GUKA 1U5IA 5FYXA 1PSRA 1QS7A 2KQ6A 3UNWA 1F55A 1EXRA 3NGVA 2KQYA 3AAJA 3DVMA 1UHIA 3O4YA 1RFJA 2JQ6A 2KGBC 3Q8IA 1CTRA 4PE0A 2Y1NA 1FPWA 3VRRA 1KSMA 2I18A 3RM1A 2PYQA 2MA2A 4MZJA 2WC8A 4PE7A 1MHOA 1XFWO 2OPOA 1C3ZA 4C0KA 1K8UA 4KYNA 1DELA 1C3YA 1CDLA 1Z2CB 4OVNF 4PT1A 3S0EA 1CDNA 1K93D 1QXPA 2L2EA 2M7NA 1EH2A 2MRDA 5HKWA 3FE9A 3DF0B 3BFHA 1TCFA 1W9ZA 3DXLA 4HRGA 3PSRA 2JNXA 2ZRTA 3CR4X 3D73A 3D78A 3DD4A 2P71A 2KI4C 3VGOA 2L51A 2ZNDA 1QIVA 1IIOA 1CM4A 2LLTA 2SASA 1K94A 1NCXA 1ZACA 1TN4A 1NX1A 1B7TY 1BT6A 2E6WA 2LMTA 3CGAA 3M0WA 2JTTA 4MZLA 1NYAA 3CDNA 3SS4A 1G4YR 1E8AA 1XFZO 4QJ5B 2K2FA 3FS7A 1DF0B 1N65A 5FI7A 1TNPA 3KPXA 1DGUA 3GK2A 3TZ1A 1YR5A 2BCAA 1ZMZA 3DYEA 3WNXB 4YGBB 1KCYA 1AP4A 1AHRA 4C0JA 2BECA 1SCVA 2BCBA 2M0RA 5CSIA 2GTEA 1S26D 2WCEA 3KF9A 1DJGA 3E3RA 3TUYC 5CSNA 4A4CA 2BL0B 1XFYO 2WORA 3RLZA 1MXLC 3BUNB 4ORBB 2EHBA 1X02A 2H61C 4I5NB 2BKIB 1ORGA 4M2OA 3VRNA 1B1GA 1KK7Y 1BJFA 2H61A 5HLOA 1YVLA 2HQ8A 2LC5A 1CMGA 5ER4X 2KLDA 4ETOA 1KSOA 1JWDA 3IF7A 1H4BA 1KWOC 2M9GA 4GPLB 1LA3A 2JZIA 1NX3A 4D1EA 1T14A 1SSEB 3EVRA 1OE9B 1DT7B 4A4BA 1L2OC 1PRWA 2KBMA 1PALA 3JTDB 4NDBA 5AFPA 2GV5A 1WLZA 5CSJA 3S0GA 1K90D 1YUTA 2TN4A 4PDZA 3D76A 1KK8C 2MLEC 4BY4A 5AERA 1DJIA 5TNCA 5B8IB 3I5IC 1DEKA 2MAZA 2JC2A 1LS8A 1OMVA 2RGIA 5JJGA 1HQVA 4PHKA 3DVEA 1JF2A 1SPYA 1NWDA 1YUSA 3L4AA 3UO9A 3IVTA 5DICA 4USLA 3TDUA 3S0AA 1KFXS 1K95A 3FE8A 3L4LA 2I7AA 2BCXA 2NLNA 3PFVA 4BY5A 1LA0A 1Z4HA 4JKTA 1GJYA 1SL7A 1TUZA 1VRKA 1JC2A 1XA5A 3GK1A 2KBIA 1RK9A 4OR9B 1SW8A 1FI5A 3BUWB 3JVTC 2K8MB 2Q4UA 3CR2A 3WHTB 3O6BA 3LK0A 4PHJA 1SCMB 1L2OB 1S36A 1WRLA 2PALA 2MLFC 3EVVA 2JTZA 2LAPA 4MBEA 1EL4A 2VRGA 3D77A 1C7WA 2COLB 3CZ2A 1OOGA 3BUXB 3N7HA 1JBAA 1J55A 1CM1A 3KO0A 1PULA 3CABA 1DVIA 2QPTA 1FF1A 3OBVA
chains in the Genus database with same CATH topology
3B88A 1C3YA 4PT1A 3S0EA 3D75A 3FE9A 3BFHA 3DXLA 3PJIA 3D78A 3D73A 1TUJA 2P71A 3VB1A 3CDNA 1DQEA 3CZ0A 3S0FA 3DYEA 1OOIX 3NHIA 4INXA 2QEVA 2PQLA 2GTEA 4F7FA 2QDIA 3D74A 1QWVA 2JPOA 2QEHA 3V2LA 3S0DA 3S0BA 3L47A 2WCLA 3B7AA 3DY9A 2WC6A 2H8VA 1ORGA 3B87A 3K1EA 5EL2A 3RZSA 3DZTA 2P70A 3R1VA 1T14A 3FE6A 1P28A 2L2CA 3CYZA 2QEBA 3B6XA 3S0GA 3D76A 4JD9A 4OZDA 4INWA 4FQTA 1OOHA 1LS8A 2WCHA 2WC5A 3R1PA 3L4AA 3BFAA 2KPHA 5DICA 3S0AA 3FE8A 3L4LA 3R1OA 2QEOA 2WCKA 3NHTA 3OGNA 1OOFA 2WCJA 2ERBA 3NGVA 1XFRA 3CZ1A 2WCMA 3Q8IA 2FJYA 3D77A 1GM0A 3CZ2A 1OOGA 1OW4A 3N7HA 3BFBA 3CABA 3B86A 3QMEA 3R72A 1TWOA 1C3ZA 3BJHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3B88 A;  1C3Y A;  4PT1 A;  3S0E A;  3D75 A;  3FE9 A;  3BFH A;  3DXL A;  3PJI A;  3D78 A;  3D73 A;  1TUJ A;  2P71 A;  3VB1 A;  3CDN A;  1DQE A;  3CZ0 A;  3S0F A;  3DYE A;  1OOI X;  3NHI A;  4INX A;  2QEV A;  2PQL A;  2GTE A;  4F7F A;  2QDI A;  3D74 A;  1QWV A;  2JPO A;  2QEH A;  3V2L A;  3S0D A;  3S0B A;  3L47 A;  2WCL A;  3B7A A;  3DY9 A;  2WC6 A;  2H8V A;  1ORG A;  3B87 A;  3K1E A;  5EL2 A;  3RZS A;  3DZT A;  2P70 A;  3R1V A;  1T14 A;  3FE6 A;  1P28 A;  2L2C A;  3CYZ A;  2QEB A;  3B6X A;  3S0G A;  3D76 A;  4JD9 A;  4OZD A;  4INW A;  4FQT A;  1OOH A;  1LS8 A;  2WCH A;  2WC5 A;  3R1P A;  3L4A A;  3BFA A;  2KPH A;  5DIC A;  3S0A A;  3FE8 A;  3L4L A;  3R1O A;  2QEO A;  2WCK A;  3NHT A;  3OGN A;  1OOF A;  2WCJ A;  2ERB A;  3NGV A;  1XFR A;  3CZ1 A;  2WCM A;  3Q8I A;  2FJY A;  3D77 A;  1GM0 A;  3CZ2 A;  1OOG A;  1OW4 A;  3N7H A;  3BFB A;  3CAB A;  3B86 A;  3QME A;  3R72 A;  1TWO A;  1C3Z A;  3BJH A; 
#chains in the Genus database with same CATH topology
 4TNC A;  2D8N A;  2CTN A;  2H2K A;  4MVF A;  3CLN A;  1AK8 A;  4M2Q A;  3TDZ A;  1YX7 A;  1UHN A;  1CKK A;  2LUC A;  2BE6 A;  3D75 A;  4HSZ A;  1UHK A;  2LLS A;  4YRU A;  2KAV A;  2KFH A;  5D7F A;  1QLS A;  3PJI A;  1J7P A;  1REC A;  3NSL A;  2OS8 B;  2M1U A;  4N5X A;  3JVT B;  1SY9 A;  5CPV A;  1IWQ A;  4YGE B;  5K89 A;  4WRI A;  1F8H A;  4AQI A;  2CXJ A;  1N2D A;  2L4H A;  3CZT X;  3AKA A;  3VB1 A;  1PVB A;  2ZN9 A;  3SS3 A;  1KFX L;  4P5O E;  3ZNI A;  1WY9 A;  4PHM A;  4OV2 A;  1RJV A;  1Y1U A;  2F33 A;  3BXK A;  1BLQ A;  1IJ6 A;  5DKQ A;  4I5J A;  2KAX A;  3S0F A;  5HKY A;  2M49 B;  3D10 A;  4INX A;  2ISD A;  1GQM A;  5HKZ A;  4IJ7 A;  4DUQ A;  1DJH A;  3I5H C;  1KQM C;  1PVA A;  5I8N A;  2KGR A;  2F2O A;  2JUL A;  3PAL A;  2LVV A;  4YGD B;  1QWV A;  2O60 A;  4PAL A;  1A75 A;  2NCP A;  1Y1A A;  3EKH A;  5IBW A;  2I2R E;  3S0B A;  3L47 A;  3O2P A;  1A03 A;  1EJ3 A;  3B7A A;  3WXA A;  2CNP A;  1YRT B;  2G9B A;  2KYF A;  1CFC A;  1QV1 A;  5FI2 A;  4CPV A;  3B87 A;  2LLU A;  2ZKM X;  2A4J A;  1XFX O;  1JFJ A;  1S6I A;  3ZWH A;  4I5K A;  2BAP A;  2YGU A;  2WND A;  1IQ5 A;  3PLF B;  2KDH A;  3R1V A;  5AEQ A;  1B8C A;  3BOW A;  2KYC A;  5FI6 A;  2HPS A;  2B1U A;  1FW4 A;  4C0L A;  5KTY A;  3AAK A;  2BKH B;  2MJW B;  2QEB A;  2SCP A;  1DGV A;  1QX2 A;  2QAC A;  2CT9 A;  2M8U A;  3I5G C;  3FIA A;  2LVK A;  2PMY A;  3SIA A;  1ZOT B;  1MR8 A;  1QAS A;  4ICB A;  1IKU A;  2M3W A;  3A4U B;  3I5F C;  3SG2 A;  1YUR A;  2KI4 B;  4YGA A;  2LNK A;  2BE4 A;  2F2P A;  3SG6 A;  3BUO B;  1LVC D;  2L0P A;  4DIR A;  1AJ4 A;  2G2B A;  2JWW A;  1OZS A;  2KPH A;  3HX4 A;  3K21 A;  4GBA A;  3TS5 C;  1CLB A;  2K7C A;  1A29 A;  1IGV A;  1TIZ A;  2M97 A;  3OGN A;  3PN7 C;  1M39 A;  1OOF A;  4XYN A;  4MN0 A;  5GQQ C;  1GGW A;  1F71 A;  1K2H A;  2ERB A;  1B8L A;  2LP3 A;  1AVS A;  1XFR A;  2BBN A;  3F45 A;  4XJK A;  1M45 A;  1PSB A;  2OTG C;  3SG5 A;  4CFR A;  1IQ3 A;  2LHI A;  2HQW A;  1H8B A;  3TUY B;  1CFD A;  1R2U A;  1XK4 A;  2L5X B;  3EK8 A;  2L50 A;  4AQJ A;  1RTP 1;  1G33 A;  3EKJ A;  3TDI A;  3D0Y A;  2ZRS A;  3QME A;  3R72 A;  4JWQ A;  4WQ2 A;  1SL9 A;  2KFG A;  5F6T A;  4UPG A;  1CB1 A;  2KNE A;  2NCO A;  3BJH A;  2JXC A;  5PAL A;  2R2I A;  3PM2 A;  1G8I A;  1S3P A;  1TCO B;  1F4O A;  3TS5 B;  1L7Z A;  5KSZ A;  3OB2 B;  2L4I A;  1BR4 B;  1IRJ A;  1KWO B;  1WDC C;  1XFU O;  1MWN A;  2F3Z A;  1CNP A;  4F0Z B;  3GK4 X;  1IG5 A;  2M7L A;  1NP8 A;  3LK1 A;  4NDD A;  1KFU S;  4AOM A;  1XO5 A;  1S6C A;  1XYD A;  2FJU B;  2LVJ A;  1BU3 A;  1LKJ A;  1SMG A;  4CID A;  2GGM A;  2E30 A;  3AKB A;  1KK8 B;  3NSI A;  3LLE A;  1DQE A;  1SRA A;  1MUX A;  1S6J A;  3I5I B;  4PE4 A;  1B47 A;  3OB1 B;  1TNW A;  4P2Y B;  5HLV A;  1F4Q A;  2LCP A;  1QLK A;  2KFF A;  5I2Q A;  1UHJ A;  1SKT A;  1UWO A;  2O5G A;  2FCE A;  2QEV A;  4MEW A;  1QTX A;  1MF8 B;  1JFK A;  1NSH A;  2JT8 A;  2PQL A;  3EVU A;  3OP0 A;  5JOL A;  2KAY A;  5AAN A;  4GGN A;  4E68 A;  3VRO A;  2WCF A;  1ZFS A;  4NDC A;  4F7F A;  5I2L A;  2QDI A;  1OZO A;  1QIW A;  1BF5 A;  3ICB A;  4YGC B;  2JPO A;  3DVK A;  3V2L A;  3S0D A;  4NQG A;  4MRX A;  2DOQ A;  1W7J B;  1FBV A;  4JPZ B;  4U8D A;  2MHH A;  1PK0 D;  4DCK A;  1JF0 A;  1NCZ A;  2H8V A;  4HRE E;  1UHH A;  2GGZ A;  4ORA B;  2WOS A;  2K0J A;  1CFF A;  2ZNE A;  4Q04 A;  3SG7 A;  3PAT A;  3K1E A;  4FQO A;  1A2X A;  1Y6W A;  2LP2 A;  2P70 A;  2K2A A;  1SL8 A;  2LV7 A;  1C07 A;  4DRW A;  2LE9 B;  3CS1 A;  3SG4 A;  1OMD A;  3GOF A;  5I94 A;  1DMO A;  2L98 A;  1JSA A;  3DF0 A;  2ZN8 A;  3FE6 A;  2JT0 A;  1OQP A;  1KQV A;  1ODB A;  5ER5 A;  1U5I B;  2JOJ A;  1KFU L;  1YTZ C;  4CFQ A;  1DJW A;  2FOT A;  2JXL A;  2Q91 A;  3DVJ A;  1NCY A;  2LUX A;  2K7O A;  1BG1 A;  2JPT A;  3LL8 B;  3O78 A;  1M46 A;  1N0Y A;  1YX8 A;  2NXQ A;  4JD9 A;  5KU1 A;  1DJZ A;  1BOD A;  1B8R A;  3FWB A;  4GNK B;  5D69 A;  3QRX A;  3BYA A;  1B9A A;  2WCH A;  2F8P A;  1DJX A;  2LVI A;  1AUI B;  2LAN A;  2Y5I A;  1DF0 A;  2F3Y A;  4PCW A;  5AXI A;  3SG3 A;  2CBL A;  2WC5 A;  1JUO A;  1R6P A;  2JT3 A;  3R1P A;  3BFA A;  3EG5 B;  2JRF A;  3NSO A;  1UUR A;  4MRY A;  1Y0V H;  2PRU A;  1V1G A;  2QEO A;  2WCK A;  3EK4 A;  1TNX A;  3NHT A;  3H4S E;  1ALV A;  1QJT A;  2BL0 C;  2JU0 A;  2L5Y A;  1OSA A;  2WCJ A;  3OX6 A;  4PHN A;  1Y1X A;  2LHL A;  3CZ1 A;  4M2P A;  1DJY A;  4MSP A;  2KHN A;  2K61 A;  1J7Q A;  2BNX A;  2WCM A;  3NSK A;  4OCI A;  1A75 B;  3I5H B;  1KQM B;  1S5G Z;  1XVJ A;  3HCM A;  3WHU B;  3PM8 A;  1OOJ A;  3IQQ A;  4OKH A;  1B4C A;  1F70 A;  4IL1 A;  2FJY A;  3BQ3 A;  1EG3 A;  1J1E A;  2Y4Q A;  4FTG A;  1GM0 A;  2Y1M A;  4ZCU A;  1OW4 A;  1LXF C;  1QV0 A;  3C1V A;  3BFB A;  1BOC A;  1WRZ A;  3B86 A;  2PVB A;  1TWO A;  1WRK A;  2AUC A;  3OHM B;  1K96 A;  3B88 A;  1UUS A;  1V1F A;  3JTD C;  3KHE A;  3BOW B;  1QVI Z;  2KSP A;  1A4P A;  2AMI A;  2WCB A;  1M31 A;  1Q80 A;  1TUJ A;  1XFV O;  4GAO A;  1SNL A;  1C7V A;  1J7O A;  5CSF A;  1YRU B;  2LM5 A;  3I5G B;  1XK4 C;  2V53 A;  1SR6 C;  1ZUZ A;  1NIW A;  2LMU A;  5HYD A;  1S1E A;  3CR5 X;  3I5F B;  1TTX A;  4GFT A;  1K9P A;  1QAT A;  1MXE A;  1SYM A;  3CZ0 A;  1WLM A;  4QJ4 B;  1ALW A;  1OOI X;  2BBM A;  3NHI A;  4JQ0 D;  4L9M A;  1UP5 A;  1BMO A;  3EK7 A;  1NPQ A;  5HL1 A;  3SJS A;  3OX5 A;  2EC6 C;  5BPJ A;  2KOT A;  1SCM C;  2EGD A;  3A8R A;  3VRP A;  1TOP A;  3BUM B;  5DKR A;  2NZ0 A;  2P6B B;  3PN7 B;  1CDM A;  3D74 A;  2QEH A;  4I5L B;  4MLW A;  1D1O A;  1IH0 A;  3NXA A;  5D3O A;  1TNQ A;  4XJK B;  1YUU A;  1MQ1 A;  1YVH A;  2WCL A;  3LCP C;  2AAO A;  3DY9 A;  4WQ3 A;  1FI6 A;  2WC6 A;  2HF5 A;  4R1E A;  3IQO A;  1CMF A;  1J1D A;  1NX0 A;  4DS7 A;  2OTG B;  1F54 A;  1RWY A;  4QJ3 B;  1J7R A;  2CCM A;  1B7T Z;  1AJ5 A;  1K9K A;  2LMV A;  2K7B A;  3FWC A;  3O4X A;  1SR6 B;  3DZT A;  5EL2 A;  1CDP A;  5I2O A;  3RZS A;  1CLL A;  1SK6 D;  3D0Y B;  4ZCV A;  4CLN A;  4ORC B;  1CLM A;  1RRO A;  1CFP A;  1IJ5 A;  1OMR A;  2ZFD A;  1HT9 A;  2OS8 C;  1EG4 A;  3CTN A;  1P28 A;  2HET A;  2JNF A;  2L2C A;  2IS9 A;  3CYZ A;  4YI9 A;  2PAS A;  2KI6 C;  1DTL A;  1S5G Y;  1BR1 B;  2K7D A;  2PSR A;  2I94 A;  2EC6 B;  3B6X A;  2M1K B;  4PE1 A;  1WDC B;  3KEV A;  4N1F A;  4OZD A;  3CWG A;  2M29 A;  4GGF C;  4INW A;  4N1G A;  4FQT A;  1OOH A;  5G08 A;  2K60 A;  1DC1 A;  1SBJ A;  5DKN A;  2MBX A;  1QX5 B;  4GGF A;  2FCD A;  1LIN A;  1TRF A;  1M63 B;  1NX2 A;  5J3X A;  1NUB A;  4YBH B;  1W7I B;  1GGZ A;  4YI8 A;  1KK7 Z;  1QX7 A;  1QVI Y;  2KLE A;  3MSE B;  3VRQ A;  3SIB A;  3R1O A;  3SS5 A;  1K9U A;  2KI6 D;  4MZK A;  4HRH A;  4GUK A;  1U5I A;  5FYX A;  1PSR A;  1QS7 A;  2KQ6 A;  3UNW A;  1F55 A;  1EXR A;  3NGV A;  2KQY A;  3AAJ A;  3DVM A;  1UHI A;  3O4Y A;  1RFJ A;  2JQ6 A;  2KGB C;  3Q8I A;  1CTR A;  4PE0 A;  2Y1N A;  1FPW A;  3VRR A;  1KSM A;  2I18 A;  3RM1 A;  2PYQ A;  2MA2 A;  4MZJ A;  2WC8 A;  4PE7 A;  1MHO A;  1XFW O;  2OPO A;  1C3Z A;  4C0K A;  1K8U A;  4KYN A;  1DEL A;  1C3Y A;  1CDL A;  1Z2C B;  4OVN F;  4PT1 A;  3S0E A;  1CDN A;  1K93 D;  1QXP A;  2L2E A;  2M7N A;  1EH2 A;  2MRD A;  5HKW A;  3FE9 A;  3DF0 B;  3BFH A;  1TCF A;  1W9Z A;  3DXL A;  4HRG A;  3PSR A;  2JNX A;  2ZRT A;  3CR4 X;  3D73 A;  3D78 A;  3DD4 A;  2P71 A;  2KI4 C;  3VGO A;  2L51 A;  2ZND A;  1QIV A;  1IIO A;  1CM4 A;  2LLT A;  2SAS A;  1K94 A;  1NCX A;  1ZAC A;  1TN4 A;  1NX1 A;  1B7T Y;  1BT6 A;  2E6W A;  2LMT A;  3CGA A;  3M0W A;  2JTT A;  4MZL A;  1NYA A;  3CDN A;  3SS4 A;  1G4Y R;  1E8A A;  1XFZ O;  4QJ5 B;  2K2F A;  3FS7 A;  1DF0 B;  1N65 A;  5FI7 A;  1TNP A;  3KPX A;  1DGU A;  3GK2 A;  3TZ1 A;  1YR5 A;  2BCA A;  1ZMZ A;  3DYE A;  3WNX B;  4YGB B;  1KCY A;  1AP4 A;  1AHR A;  4C0J A;  2BEC A;  1SCV A;  2BCB A;  2M0R A;  5CSI A;  2GTE A;  1S26 D;  2WCE A;  3KF9 A;  1DJG A;  3E3R A;  3TUY C;  5CSN A;  4A4C A;  2BL0 B;  1XFY O;  2WOR A;  3RLZ A;  1MXL C;  3BUN B;  4ORB B;  2EHB A;  1X02 A;  2H61 C;  4I5N B;  2BKI B;  1ORG A;  4M2O A;  3VRN A;  1B1G A;  1KK7 Y;  1BJF A;  2H61 A;  5HLO A;  1YVL A;  2HQ8 A;  2LC5 A;  1CMG A;  5ER4 X;  2KLD A;  4ETO A;  1KSO A;  1JWD A;  3IF7 A;  1H4B A;  1KWO C;  2M9G A;  4GPL B;  1LA3 A;  2JZI A;  1NX3 A;  4D1E A;  1T14 A;  1SSE B;  3EVR A;  1OE9 B;  1DT7 B;  4A4B A;  1L2O C;  1PRW A;  2KBM A;  1PAL A;  3JTD B;  4NDB A;  5AFP A;  2GV5 A;  1WLZ A;  5CSJ A;  3S0G A;  1K90 D;  1YUT A;  2TN4 A;  4PDZ A;  3D76 A;  1KK8 C;  2MLE C;  4BY4 A;  5AER A;  1DJI A;  5TNC A;  5B8I B;  3I5I C;  1DEK A;  2MAZ A;  2JC2 A;  1LS8 A;  1OMV A;  2RGI A;  5JJG A;  1HQV A;  4PHK A;  3DVE A;  1JF2 A;  1SPY A;  1NWD A;  1YUS A;  3L4A A;  3UO9 A;  3IVT A;  5DIC A;  4USL A;  3TDU A;  3S0A A;  1KFX S;  1K95 A;  3FE8 A;  3L4L A;  2I7A A;  2BCX A;  2NLN A;  3PFV A;  4BY5 A;  1LA0 A;  1Z4H A;  4JKT A;  1GJY A;  1SL7 A;  1TUZ A;  1VRK A;  1JC2 A;  1XA5 A;  3GK1 A;  2KBI A;  1RK9 A;  4OR9 B;  1SW8 A;  1FI5 A;  3BUW B;  3JVT C;  2K8M B;  2Q4U A;  3CR2 A;  3WHT B;  3O6B A;  3LK0 A;  4PHJ A;  1SCM B;  1L2O B;  1S36 A;  1WRL A;  2PAL A;  2MLF C;  3EVV A;  2JTZ A;  2LAP A;  4MBE A;  1EL4 A;  2VRG A;  3D77 A;  1C7W A;  2COL B;  3CZ2 A;  1OOG A;  3BUX B;  3N7H A;  1JBA A;  1J55 A;  1CM1 A;  3KO0 A;  1PUL A;  3CAB A;  1DVI A;  2QPT A;  1FF1 A;  3OBV A; 
#chains in the Genus database with same CATH homology
 3B88 A;  1C3Y A;  4PT1 A;  3S0E A;  3D75 A;  3FE9 A;  3BFH A;  3DXL A;  3PJI A;  3D78 A;  3D73 A;  1TUJ A;  2P71 A;  3VB1 A;  3CDN A;  1DQE A;  3CZ0 A;  3S0F A;  3DYE A;  1OOI X;  3NHI A;  4INX A;  2QEV A;  2PQL A;  2GTE A;  4F7F A;  2QDI A;  3D74 A;  1QWV A;  2JPO A;  2QEH A;  3V2L A;  3S0D A;  3S0B A;  3L47 A;  2WCL A;  3B7A A;  3DY9 A;  2WC6 A;  2H8V A;  1ORG A;  3B87 A;  3K1E A;  5EL2 A;  3RZS A;  3DZT A;  2P70 A;  3R1V A;  1T14 A;  3FE6 A;  1P28 A;  2L2C A;  3CYZ A;  2QEB A;  3B6X A;  3S0G A;  3D76 A;  4JD9 A;  4OZD A;  4INW A;  4FQT A;  1OOH A;  1LS8 A;  2WCH A;  2WC5 A;  3R1P A;  3L4A A;  3BFA A;  2KPH A;  5DIC A;  3S0A A;  3FE8 A;  3L4L A;  3R1O A;  2QEO A;  2WCK A;  3NHT A;  3OGN A;  1OOF A;  2WCJ A;  2ERB A;  3NGV A;  1XFR A;  3CZ1 A;  2WCM A;  3Q8I A;  2FJY A;  3D77 A;  1GM0 A;  3CZ2 A;  1OOG A;  1OW4 A;  3N7H A;  3BFB A;  3CAB A;  3B86 A;  3QME A;  3R72 A;  1TWO A;  1C3Z A;  3BJH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...