2PALA

Ionic interactions with parvalbumins. crystal structure determination of pike 4.10 parvalbumin in four different ionic environments
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
107
structure length
107
Chain Sequence
b'SFAGLKDADVAAALAACSAADSFKHKEFFAKVGLASKSLDDVKKAFYVIDQDKSGFIEEDELKLFLQNFSPSARALTDAETKAFLADGDKDGDGMIGVDEFAAMIKA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PARVALBUMIN
publication title Ionic interactions with parvalbumins. Crystal structure determination of pike 4.10 parvalbumin in four different ionic environments.
pubmed doi rcsb
source organism Esox lucius
molecule tags Calcium binding protein
total genus 39
structure length 107
sequence length 107
ec nomenclature
pdb deposition date 1990-11-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2palA00
1H8BA 2JZIA 1LA0A 1KFXL 1BU3A 1EJ3A 2I18A 2I7AA 2F2PA 4P5OE 5CSNA 4WQ3A 1M63B 1SR6C 1E8AA 1DJWA 4P2YB 4ETOA 1KCYA 4MVFA 1DJYA 4XYNA 2NCPA 1JWDA 2ZN8A 5I2OA 2JQ6A 1IGVA 5PALA 1JFKA 1QX7A 1KWOB 2AUCA 2K0JA 4XJKA 2K7BA 1AVSA 2O60A 1HQVA 1TN4A 1MR8A 2F8PA 2PMYA 2WORA 4CFRA 3AKAA 2JULA 1BG1A 2KYFA 4N1FA 1KFXS 2KBMA 1ALWA 3EK8A 3BUOB 2Q91A 1PSRA 3CLNA 1QV0A 2BCAA 1XFXO 2NCOA 4AOMA 2I94A 1UURA 2KI6D 5CSFA 1K9UA 4DRWA 1PALA 2PASA 4ZCUA 4UPGA 1H4BA 1WY9A 4MLWA 3KF9A 2LCPA 3SG4A 3NSOA 2JTTA 2OTGB 2L4HA 4JPZB 1SL8A 1BF5A 1S36A 2NLNA 3HX4A 3FWBA 4ZCVA 1SBJA 3BOWA 1LXFC 2KI4C 4YGBB 3TUYC 2CTNA 4Q04A 1DJGA 4YBHB 3TDZA 3LK0A 3VROA 4PHMA 2KQYA 1IJ5A 2MA2A 1TCOB 3LK1A 1C7VA 1MXLC 1SR6B 1CDLA 2LHIA 1SMGA 1XYDA 1IJ6A 1SPYA 1B8LA 5JOLA 1FI5A 1TOPA 4OR9B 1MWNA 2BL0C 2M8UA 1SW8A 2F33A 2LC5A 2KNEA 1FF1A 1CM1A 4OVNF 1DJXA 1K8UA 1OMVA 3EK7A 2K2AA 4PE1A 3KHEA 3SIAA 1GJYA 1LINA 3CGAA 4AQJA 1QVIY 4FTGA 2P6BB 1DF0A 2QPTA 1XFYO 2F3YA 2B1UA 2LMVA 4GUKA 1B4CA 4ORCB 2LLSA 4GGFC 3SIBA 1B7TZ 1K90D 1M45A 4WRIA 2M1KB 1CDPA 2NZ0A 1NCZA 2L0PA 2L98A 1G8IA 4A4CA 1M31A 1CLBA 1B9AA 4QJ5B 5HKWA 1J7RA 1MF8B 5J3XA 3EK4A 2KI4B 1WRZA 1J55A 1WLZA 1Y0VH 1EH2A 2V53A 4QJ4B 2M3WA 1SYMA 4ORAB 1CFPA 2M7NA 1UHIA 1KWOC 5HYDA 2WCFA 1QASA 1AUIB 1UHHA 1M46A 3TDIA 3CZTX 1BOCA 3O78A 1MQ1A 4MZJA 2BL0B 1JFJA 1A75B 4USLA 4WQ2A 2KDHA 1V1GA 3WHTB 1JBAA 2JOJA 3AAKA 1FW4A 1G4YR 4MEWA 2M97A 1BR1B 4HREE 2M0RA 4M2PA 4YGAA 1DGUA 2JRFA 2WCEA 1K2HA 4MRXA 1NCXA 2ZRSA 2CXJA 4I5LB 1LVCD 2CCMA 2KHNA 2OPOA 3O6BA 4YGEB 5DKQA 3NSLA 4PHJA 1PK0D 3BUMB 5AEQA 1YX7A 1TNQA 4F0ZB 2M9GA 1CNPA 1GGZA 1IQ3A 1F70A 1NCYA 2MAZA 2LMUA 1MUXA 1TRFA 1ZACA 1F4OA 1MHOA 2ZKMX 2H61A 5D69A 2VRGA 4BY4A 1HT9A 5FYXA 1CLLA 1W7JB 4FQOA 1D1OA 2E6WA 1L2OC 1BODA 5DKRA 2HPSA 1JUOA 5F6TA 1CMGA 1UUSA 2O5GA 3ICBA 1CKKA 4OCIA 2GGZA 1XO5A 1JF0A 2Y5IA 2R2IA 3CR5X 2PRUA 3DF0A 1L7ZA 1KK7Y 1K96A 1N0YA 1QIWA 1B1GA 2KI6C 1DVIA 1J7PA 5B8IB 5HLOA 2PVBA 3H4SE 1K9PA 2SCPA 3K21A 4GGNA 3EKHA 2WCBA 3PFVA 1YUTA 1SCMB 3OX6A 4DS7A 1YVLA 2EC6B 3CS1A 1F71A 1S5GZ 1J7OA 2M49B 2LANA 1C7WA 2KFGA 1YRTB 1WDCC 1CDMA 1J1DA 2LLTA 2LVKA 4GFTA 1QS7A 1EG3A 1V1FA 1EL4A 4MZKA 3SJSA 2LVJA 3I5FC 3RLZA 2BE6A 5AXIA 1TNXA 5HLVA 1NX1A 2LUCA 2AMIA 3CWGA 5IBWA 1OE9B 4NDCA 3EKJA 3FIAA 1XFUO 1S5GY 2HETA 5BPJA 1BMOA 2BE4A 1OQPA 1N65A 4CFQA 1SRAA 3VRPA 5KTYA 4PHKA 2KQ6A 1RK9A 1L2OB 4I5NB 2KSPA 4D1EA 1QVIZ 1G33A 2GV5A 2EHBA 1ZFSA 3JTDC 2HF5A 2KOTA 2MBXA 1XFWO 3NSKA 2JXLA 1SL7A 2L5XB 3CR2A 3GOFA 1UHJA 1ZMZA 2JT8A 4ICBA 3BUWB 1IG5A 1YVHA 2TN4A 1QJTA 1DT7B 1S6CA 1JF2A 3IQOA 2CNPA 4XJKB 1KQVA 1GGWA 3D0YA 1KK8C 1UHKA 1Y1UA 2BCBA 2F2OA 4YI9A 2SASA 5CSIA 2KGRA 2FOTA 4HRHA 1QATA 1YURA 2ZNEA 3O2PA 2JC2A 1SL9A 1TNWA 2LHLA 2ZRTA 1WDCB 1R2UA 1Y1AA 5JJGA 1DGVA 1A4PA 3SG2A 1YX8A 4PDZA 1ZOTB 3CR4X 3OP0A 5I2QA 5K89A 3I5FB 3DD4A 4GNKB 2JXCA 2L50A 2OS8B 1ODBA 3I5IC 1RWYA 2HQ8A 1CFFA 1PVAA 3C1VA 2Y4QA 4ORBB 1SNLA 1CMFA 1TNPA 4HSZA 3BOWB 5CPVA 3VRQA 1NPQA 2JT0A 4I5KA 3JTDB 2KAVA 2M29A 2PSRA 1X02A 4YRUA 1JSAA 1AJ5A 4M2QA 1DTLA 1AK8A 4YGDB 1SCMC 3RM1A 1XFZO 1NIWA 2EC6C 3O4YA 1CLMA 3D10A 1QLSA 2D8NA 3OX5A 3EVUA 1KK8B 2MLFC 3BQ3A 3VGOA 3EVVA 4N1GA 1DJIA 2WOSA 4MSPA 1S26D 4L9MA 3LCPC 5G08A 4NQGA 4HRGA 3GK4X 3KPXA 1OZOA 2LLUA 1IKUA 2DOQA 3WXAA 1BJFA 1NYAA 1U5IA 1RFJA 2JTZA 3M0WA 1DF0B 2I2RE 4YI8A 3ZWHA 5KU1A 1KFUL 1FI6A 1OSAA 3GK2A 1KK7Z 1RECA 2L51A 2KFHA 2Q4UA 2KAYA 1WLMA 1K93D 1XK4A 4N5XA 2KBIA 5GQQC 3I5IB 1UHNA 2BBMA 2ISDA 2Y1NA 3WNXB 1F54A 3OHMB 2K7CA 2FCDA 1A03A 1K95A 3CTNA 3LL8B 1EG4A 1YTZC 2E30A 3BYAA 2H2KA 3KEVA 1MXEA 1IQ5A 1CDNA 1KFUS 4DUQA 3VRNA 2Y1MA 1C07A 1OMDA 1QLKA 1NX2A 4PALA 2ZNDA 2BBNA 2ZN9A 1CB1A 2L4IA 1GQMA 1NSHA 1S6IA 2BCXA 3PLFB 2GGMA 1QTXA 2EGDA 1YR5A 1F55A 4JQ0D 3KO0A 4MRYA 3I5GC 2K2FA 1KQMB 1OOJA 1F8HA 3WHUB 1XA5A 5AANA 4DCKA 1WRLA 1OMRA 1PVBA 2OS8C 1SKTA 3SG5A 2MLEC 2RGIA 4E68A 2JU0A 1FPWA 2MRDA 1XVJA 5I2LA 3QRXA 5I8NA 4PE0A 3JVTB 1QX2A 4PE4A 3FS7A 4QJ3B 2FJUB 1YUSA 3PN7C 3TS5C 4GPLB 1A2XA 1AHRA 3GK1A 4MN0A 4M2OA 1U5IB 3SG3A 1LKJA 4IL1A 4MZLA 2HQWA 1Y1XA 1OZSA 1SY9A 2BKIB 2LMTA 5ER5A 4OKHA 2JWWA 1PRWA 4NDDA 1DJHA 4TNCA 2COLB 4CPVA 2LUXA 5AERA 4DIRA 3TDUA 1NX0A 2K7DA 5D7FA 2A4JA 4PE7A 1A75A 1WRKA 2K61A 2LNKA 3PATA 3LLEA 1BLQA 2QACA 4PCWA 1ALVA 1R6PA 2FCEA 3I5HC 1NP8A 2WC8A 3DF0B 3EVRA 1CFDA 2CT9A 3PALA 1S6JA 2G9BA 4C0KA 2LVVA 1AP4A 3HCMA 1B8RA 2LP3A 1KSMA 3AKBA 5HKZA 2MHHA 1UWOA 3I5GB 3BUNB 1SK6D 1FBVA 1NX3A 1JC2A 1W7IB 4GGFA 1S3PA 2NXQA 2LM5A 4I5JA 3PM8A 1YRUB 4C0JA 3OB2B 4CLNA 1CFCA 2KFFA 1PSBA 1F4QA 1SCVA 2BKHB 4BY5A 2M1UA 3NSIA 1LA3A 3VRRA 2M7LA 1RROA 1QXPA 1VRKA 3NXAA 1IH0A 4MBEA 1YUUA 3TZ1A 2CBLA 5HKYA 2LP2A 3E3RA 1RTP1 1TIZA 3BXKA 1N2DA 3MSEB 3PN7B 1RJVA 5DKNA 3A4UB 3TS5B 4PHNA 4AQIA 4U8DA 1IRJA 3SG6A 1S1EA 1TCFA 2G2BA 1J1EA 4JWQA 3TUYB 1QIVA 2JNFA 2BECA 4OV2A 2LV7A 1NWDA 1DJZA 4C0LA 1M39A 1QV1A 1A29A 3SG7A 2KAXA 1B7TY 3F45A 2AAOA 1Q80A 2F3ZA 1AJ4A 3DVMA 2K7OA 3IQQA 3I5HB 4YGCB 3IF7A 5ER4X 2LVIA 1EXRA 5TNCA 2KGBC 1CM4A 1K9KA 1KQMC 3FWCA 1CTRA 2LE9B 1IWQA 2ZFDA 1PULA 3DVJA 4NDBA 2JPTA 1J7QA 4GBAA 4A4BA 5KSZA 2KYCA 3D0YB 1ZUZA 1BT6A 3BUXB 5CSJA 4GAOA 1K94A 3JVTC 1XFVO 3A8RA 3AAJA 2JT3A 1UP5A 2MJWB 2K8MB 2OTGC 1Y6WA 4R1EA 2JNXA 1B8CA 3DVKA 2IS9A 1B47A 3ZNIA 4CIDA 2WNDA 1QX5B 3OB1B 1DMOA 3DVEA 2H61C 2L2EA 1NUBA 1TTXA 2LAPA 1BR4B 3PSRA 5AFPA 1KSOA 1XK4C 2PALA
chains in the Genus database with same CATH superfamily
1H8BA 2JZIA 1LA0A 1KFXL 1BU3A 1EJ3A 2I18A 2I7AA 2F2PA 4P5OE 5CSNA 4WQ3A 1M63B 1SR6C 1E8AA 1DJWA 3FE6A 4P2YB 4ETOA 1KCYA 2P70A 4JKTA 4MVFA 1DJYA 4XYNA 2NCPA 1JWDA 2ZN8A 5I2OA 2JQ6A 1IGVA 5PALA 1JFKA 1QX7A 1KWOB 2AUCA 2K0JA 3B88A 4XJKA 2K7BA 1AVSA 2O60A 1HQVA 2PQLA 1TN4A 1MR8A 2F8PA 2PMYA 2BAPA 2WORA 4CFRA 3AKAA 2JULA 1BG1A 2KYFA 1OOGA 4N1FA 1KFXS 2KBMA 1ALWA 3EK8A 4JD9A 3BUOB 2Q91A 1PSRA 3CLNA 1QV0A 2BCAA 1XFXO 2NCOA 4AOMA 2I94A 1UURA 2KI6D 5CSFA 1K9UA 4DRWA 3V2LA 1PALA 2PASA 4ZCUA 4UPGA 2KLEA 1H4BA 1WY9A 2WC5A 3KF9A 4MLWA 2LCPA 3SG4A 3NSOA 2JTTA 2OTGB 2L4HA 4JPZB 1SL8A 1BF5A 2L2CA 1S36A 2NLNA 3HX4A 5HL1A 3FWBA 2WC6A 4ZCVA 1SBJA 3BOWA 1LXFC 2KI4C 4YGBB 2QEBA 3TUYC 2CTNA 4Q04A 1DJGA 4YBHB 3TDZA 3LK0A 3VROA 4PHMA 2KQYA 1IJ5A 2MA2A 1TCOB 3LK1A 1OW4A 1C7VA 1MXLC 1SR6B 1CDLA 3VB1A 2LHIA 1SMGA 1XYDA 1IJ6A 1SPYA 1B8LA 5JOLA 1FI5A 1TOPA 1T14A 4OR9B 1MWNA 3BJHA 2BL0C 2M8UA 1SW8A 2F33A 2LC5A 2KNEA 1FF1A 1CM1A 4OVNF 1DJXA 1K8UA 1OMVA 3EK7A 2K2AA 3SS4A 4PE1A 3KHEA 3SIAA 1GJYA 1LINA 3CGAA 4AQJA 1QVIY 4FTGA 2P6BB 1DF0A 3DZTA 2QPTA 1XFYO 2F3YA 2B1UA 2LMVA 4GUKA 1B4CA 4ORCB 2LLSA 4GGFC 3B86A 3SIBA 1B7TZ 1K90D 1M45A 4WRIA 2M1KB 1CDPA 2NZ0A 1NCZA 2L0PA 2L98A 1G8IA 3D74A 4A4CA 1M31A 1CLBA 1B9AA 4QJ5B 5HKWA 1J7RA 1MF8B 5J3XA 3EK4A 2KI4B 1WRZA 1J55A 1WLZA 1Y0VH 1EH2A 2V53A 4QJ4B 2M3WA 1SYMA 4ORAB 1CFPA 2M7NA 1UHIA 1KWOC 3Q8IA 3R1VA 5HYDA 2WCFA 1QASA 2KLDA 1AUIB 1UHHA 1M46A 4F7FA 3K1EA 3TDIA 3CZTX 1BOCA 3O78A 1MQ1A 4MZJA 2BL0B 1JFJA 1A75B 4USLA 4WQ2A 2KDHA 1V1GA 3WHTB 1OOHA 3D77A 1JBAA 2JOJA 3AAKA 1FW4A 1G4YR 4MEWA 2M97A 3S0FA 1BR1B 4HREE 2M0RA 2WCLA 4M2PA 4YGAA 1DGUA 2JRFA 2WCEA 1K2HA 4MRXA 3OGNA 1NCXA 2ZRSA 3DY9A 2CXJA 5I94A 4I5LB 1LVCD 2CCMA 2KHNA 2OPOA 3O6BA 4YGEB 5DKQA 3NSLA 3BFAA 1PK0D 3BUMB 4PHJA 1YX7A 1TNQA 4KYNA 5AEQA 4F0ZB 2M9GA 1CNPA 1GGZA 1IQ3A 1F70A 1NCYA 2BNXA 2MAZA 2LMUA 1MUXA 1TRFA 1ZACA 1F4OA 1MHOA 2ZKMX 2H61A 5D69A 2VRGA 4BY4A 1HT9A 5FYXA 1CLLA 1W7JB 4FQOA 1D1OA 2E6WA 1L2OC 1BODA 5DKRA 2HPSA 1JUOA 3NHTA 5F6TA 3DYEA 1UUSA 2O5GA 3ICBA 1CMGA 1CKKA 4OCIA 2GGZA 1XO5A 1JF0A 2Y5IA 2R2IA 3CR5X 2PRUA 3DF0A 1L7ZA 1KK7Y 1K96A 1N0YA 1QIWA 1B1GA 2KI6C 1DVIA 2PYQA 1J7PA 5B8IB 5HLOA 2PVBA 3H4SE 1K9PA 2SCPA 3K21A 4GGNA 3EKHA 2WCBA 3PFVA 1YUTA 1SCMB 3OX6A 4DS7A 1YVLA 2EC6B 3CS1A 1F71A 1S5GZ 1J7OA 1C3YA 2M49B 2LANA 1C7WA 2KFGA 1YRTB 3CABA 1WDCC 1CDMA 3S0GA 1J1DA 2LLTA 2LVKA 3CZ1A 4GFTA 1QS7A 1EG3A 1V1FA 1EL4A 4MZKA 3SJSA 1P28A 2LVJA 3I5FC 3RLZA 1QWVA 2BE6A 5AXIA 1TNXA 5HLVA 1NX1A 1Z4HA 2AMIA 2LUCA 3CWGA 5IBWA 1IIOA 1OE9B 4NDCA 3EKJA 3FIAA 1XFUO 1S5GY 1DEKA 2HETA 5BPJA 1BMOA 2BE4A 1OQPA 1N65A 4CFQA 1SRAA 3VRPA 5KTYA 4PHKA 2KQ6A 1RK9A 1L2OB 4I5NB 2KSPA 4D1EA 1QVIZ 1TUJA 1G33A 2GV5A 2EHBA 1ZFSA 3JTDC 3D78A 2HF5A 2KOTA 2MBXA 1XFWO 3NSKA 2JXLA 1SL7A 2L5XB 3CR2A 3GOFA 1UHJA 1OOIX 1ZMZA 2JT8A 4ICBA 3BUWB 1ORGA 1IG5A 1YVHA 3UO9A 2TN4A 1QJTA 1DT7B 1S6CA 4FQTA 1JF2A 3IQOA 2CNPA 2QEVA 4XJKB 1KQVA 1GGWA 3D0YA 1KK8C 1UHKA 1Y1UA 2BCBA 2F2OA 4YI9A 2SASA 5CSIA 2KGRA 1C3ZA 2FOTA 4HRHA 1QATA 5FI6A 1YURA 2ZNEA 3D76A 3O2PA 2JC2A 1SL9A 1Z2CB 1TNWA 2LHLA 2ZRTA 1WDCB 1R2UA 1Y1AA 5JJGA 1DGVA 1A4PA 3SG2A 1YX8A 3NGVA 1LS8A 4PDZA 2WCHA 1ZOTB 3CR4X 3OP0A 5I2QA 5K89A 3I5FB 3DD4A 4GNKB 4IJ7A 2JXCA 2L50A 2OS8B 1ODBA 3S0EA 3I5IC 1RWYA 2HQ8A 1CFFA 1PVAA 3C1VA 2Y4QA 4ORBB 1SNLA 3PM2A 3D73A 1CMFA 1TNPA 4HSZA 3BOWB 5CPVA 3VRQA 3S0AA 1NPQA 2JT0A 4I5KA 3JTDB 2KAVA 2M29A 2JPOA 1X02A 2PSRA 4YRUA 3D75A 3UNWA 2GTEA 1JSAA 1AJ5A 3BFBA 4M2QA 1DTLA 1AK8A 3CZ0A 1DQEA 4YGDB 3SS5A 1SCMC 3RM1A 1XFZO 1NIWA 2EC6C 3O4YA 1CLMA 3D10A 1QLSA 1SSEB 2D8NA 3OX5A 3EVUA 1KK8B 2MLFC 3BQ3A 3VGOA 1TWOA 3EVVA 4N1GA 1DJIA 2WOSA 4MSPA 1S26D 1W9ZA 3L4LA 3LCPC 4L9MA 5G08A 4NQGA 4HRGA 3GK4X 3KPXA 1OZOA 2LLUA 1IKUA 2DOQA 3WXAA 1BJFA 1TUZA 1NYAA 1U5IA 1RFJA 2JTZA 3M0WA 1DF0B 2I2RE 4YI8A 3ZWHA 5KU1A 1KFUL 1FI6A 1OSAA 3GK2A 1KK7Z 1RECA 2L51A 2KFHA 2Q4UA 2KAYA 1WLMA 1K93D 1XK4A 4N5XA 2KBIA 5FI2A 5GQQC 3I5IB 1UHNA 2WCKA 3NHIA 2H8VA 3L4AA 2QEOA 2BBMA 2ISDA 2Y1NA 3WNXB 1F54A 3OHMB 2K7CA 2FCDA 1A03A 3O4XA 1K95A 3CTNA 3LL8B 1EG4A 1YTZC 2E30A 3DXLA 3BYAA 2H2KA 3KEVA 1MXEA 1IQ5A 1CDNA 1KFUS 4DUQA 3VRNA 2Y1MA 1C07A 1OMDA 2QDIA 1QLKA 1NX2A 4PALA 2ZNDA 2BBNA 2ZN9A 1CB1A 2L4IA 1GQMA 1NSHA 1S6IA 1XFRA 2BCXA 3PLFB 2KPHA 2GGMA 2WCMA 1QTXA 2EGDA 1YR5A 1F55A 4JQ0D 3KO0A 4MRYA 3I5GC 2QEHA 2K2FA 1KQMB 1OOJA 1F8HA 3WHUB 2WCJA 1XA5A 5AANA 3S0BA 4DCKA 1WRLA 1OMRA 5DICA 1PVBA 2OS8C 1SKTA 3SG5A 2MLEC 2RGIA 4E68A 2JU0A 1FPWA 2MRDA 1XVJA 3L47A 5I2LA 3QRXA 1OOFA 5I8NA 4PE0A 3JVTB 1QX2A 4PE4A 3FS7A 4QJ3B 2FJUB 3SS3A 1GM0A 1YUSA 3PN7C 3TS5C 4GPLB 1A2XA 2ERBA 1AHRA 3GK1A 4MN0A 4M2OA 1U5IB 3SG3A 1LKJA 2K60A 4IL1A 4MZLA 2HQWA 1Y1XA 1OZSA 3N7HA 1SY9A 2BKIB 2LMTA 5ER5A 4OKHA 2JWWA 1PRWA 3FE8A 1DJHA 4NDDA 2COLB 4TNCA 2LUXA 4CPVA 5AERA 3R1PA 3CZ2A 4DIRA 3TDUA 1NX0A 3QMEA 2K7DA 5D7FA 2A4JA 4PE7A 5D3OA 1A75A 1WRKA 2K61A 2LNKA 3PATA 3LLEA 3S0DA 2QACA 4INXA 4PCWA 1ALVA 1BLQA 1R6PA 2FCEA 3I5HC 1NP8A 2WC8A 3RZSA 3DF0B 3EVRA 3IVTA 1CFDA 2CT9A 3PALA 1S6JA 2G9BA 4C0KA 2LVVA 3OBVA 3HCMA 1AP4A 1B8RA 2LP3A 1KSMA 3AKBA 5HKZA 2MHHA 1UWOA 3I5GB 3BUNB 3R72A 1SK6D 1FBVA 1NX3A 1JC2A 1W7IB 4GGFA 1S3PA 2NXQA 2LM5A 4I5JA 3PM8A 1YRUB 4C0JA 3OB2B 4CLNA 1DC1A 1CFCA 2KFFA 3CDNA 1PSBA 1F4QA 1SCVA 2BKHB 4BY5A 3B87A 2M1UA 3NSIA 1LA3A 3VRRA 2M7LA 1RROA 1VRKA 1QXPA 3NXAA 1IH0A 4MBEA 1YUUA 3TZ1A 2CBLA 5HKYA 2LP2A 3E3RA 1RTP1 1TIZA 3BXKA 1N2DA 3MSEB 3PN7B 1RJVA 5DKNA 3A4UB 5FI7A 4PHNA 3TS5B 4U8DA 4AQIA 1IRJA 3SG6A 1S1EA 1TCFA 2G2BA 1J1EA 2P71A 4JWQA 3BFHA 5EL2A 3TUYB 1QIVA 2JNFA 2BECA 4PT1A 4OV2A 2LV7A 3EG5B 1NWDA 1DJZA 4C0LA 1M39A 1QV1A 1A29A 3SG7A 2KAXA 1B7TY 3F45A 2AAOA 1Q80A 1DELA 2F3ZA 1AJ4A 3DVMA 2K7OA 3IQQA 3I5HB 4YGCB 3IF7A 5ER4X 2LVIA 1EXRA 2YGUA 3FE9A 5TNCA 2KGBC 1CM4A 3B7AA 1K9KA 1KQMC 3CYZA 1CTRA 2LE9B 1IWQA 2ZFDA 1PULA 3DVJA 3FWCA 4NDBA 2JPTA 3R1OA 1J7QA 4GBAA 4INWA 4A4BA 5KSZA 2KYCA 3D0YB 1ZUZA 1BT6A 3BUXB 5CSJA 3PJIA 4GAOA 1K94A 3JVTC 4OZDA 1XFVO 3A8RA 3AAJA 2JT3A 2FJYA 1UP5A 2MJWB 2K8MB 2OTGC 1Y6WA 4R1EA 2JNXA 1B8CA 3DVKA 2IS9A 1B47A 3ZNIA 4CIDA 2WNDA 1QX5B 3OB1B 1DMOA 2L5YA 3DVEA 2H61C 2L2EA 1NUBA 3B6XA 1TTXA 2LAPA 1BR4B 3PSRA 5AFPA 1KSOA 1XK4C 2PALA
chains in the Genus database with same CATH topology
1H8BA 2JZIA 1LA0A 1KFXL 1BU3A 1EJ3A 2I18A 2I7AA 2F2PA 4P5OE 5CSNA 4WQ3A 1M63B 1SR6C 1E8AA 1DJWA 4P2YB 4ETOA 1KCYA 4MVFA 1DJYA 4XYNA 2NCPA 1JWDA 2ZN8A 5I2OA 2JQ6A 1IGVA 5PALA 1JFKA 1QX7A 1KWOB 2AUCA 2K0JA 4XJKA 2K7BA 1AVSA 2O60A 1HQVA 1TN4A 1MR8A 2F8PA 2PMYA 2WORA 4CFRA 3AKAA 2JULA 1BG1A 2KYFA 4N1FA 1KFXS 2KBMA 1ALWA 3EK8A 3BUOB 2Q91A 1PSRA 3CLNA 1QV0A 2BCAA 1XFXO 2NCOA 4AOMA 2I94A 1UURA 2KI6D 5CSFA 1K9UA 4DRWA 1PALA 2PASA 4ZCUA 4UPGA 1H4BA 1WY9A 4MLWA 3KF9A 2LCPA 3SG4A 3NSOA 2JTTA 2OTGB 2L4HA 4JPZB 1SL8A 1BF5A 1S36A 2NLNA 3HX4A 3FWBA 4ZCVA 1SBJA 3BOWA 1LXFC 2KI4C 4YGBB 3TUYC 2CTNA 4Q04A 1DJGA 4YBHB 3TDZA 3LK0A 3VROA 4PHMA 2KQYA 1IJ5A 2MA2A 1TCOB 3LK1A 1C7VA 1MXLC 1SR6B 1CDLA 2LHIA 1SMGA 1XYDA 1IJ6A 1SPYA 1B8LA 5JOLA 1FI5A 1TOPA 4OR9B 1MWNA 2BL0C 2M8UA 1SW8A 2F33A 2LC5A 2KNEA 1FF1A 1CM1A 4OVNF 1DJXA 1K8UA 1OMVA 3EK7A 2K2AA 4PE1A 3KHEA 3SIAA 1GJYA 1LINA 3CGAA 4AQJA 1QVIY 4FTGA 2P6BB 1DF0A 2QPTA 1XFYO 2F3YA 2B1UA 2LMVA 4GUKA 1B4CA 4ORCB 2LLSA 4GGFC 3SIBA 1B7TZ 1K90D 1M45A 4WRIA 2M1KB 1CDPA 2NZ0A 1NCZA 2L0PA 2L98A 1G8IA 4A4CA 1M31A 1CLBA 1B9AA 4QJ5B 5HKWA 1J7RA 1MF8B 5J3XA 3EK4A 2KI4B 1WRZA 1J55A 1WLZA 1Y0VH 1EH2A 2V53A 4QJ4B 2M3WA 1SYMA 4ORAB 1CFPA 2M7NA 1UHIA 1KWOC 5HYDA 2WCFA 1QASA 1AUIB 1UHHA 1M46A 3TDIA 3CZTX 1BOCA 3O78A 1MQ1A 4MZJA 2BL0B 1JFJA 1A75B 4USLA 4WQ2A 2KDHA 1V1GA 3WHTB 1JBAA 2JOJA 3AAKA 1FW4A 1G4YR 4MEWA 2M97A 1BR1B 4HREE 2M0RA 4M2PA 4YGAA 1DGUA 2JRFA 2WCEA 1K2HA 4MRXA 1NCXA 2ZRSA 2CXJA 4I5LB 1LVCD 2CCMA 2KHNA 2OPOA 3O6BA 4YGEB 5DKQA 3NSLA 4PHJA 1PK0D 3BUMB 5AEQA 1YX7A 1TNQA 4F0ZB 2M9GA 1CNPA 1GGZA 1IQ3A 1F70A 1NCYA 2MAZA 2LMUA 1MUXA 1TRFA 1ZACA 1F4OA 1MHOA 2ZKMX 2H61A 5D69A 2VRGA 4BY4A 1HT9A 5FYXA 1CLLA 1W7JB 4FQOA 1D1OA 2E6WA 1L2OC 1BODA 5DKRA 2HPSA 1JUOA 5F6TA 1CMGA 1UUSA 2O5GA 3ICBA 1CKKA 4OCIA 2GGZA 1XO5A 1JF0A 2Y5IA 2R2IA 3CR5X 2PRUA 3DF0A 1L7ZA 1KK7Y 1K96A 1N0YA 1QIWA 1B1GA 2KI6C 1DVIA 1J7PA 5B8IB 5HLOA 2PVBA 3H4SE 1K9PA 2SCPA 3K21A 4GGNA 3EKHA 2WCBA 3PFVA 1YUTA 1SCMB 3OX6A 4DS7A 1YVLA 2EC6B 3CS1A 1F71A 1S5GZ 1J7OA 2M49B 2LANA 1C7WA 2KFGA 1YRTB 1WDCC 1CDMA 1J1DA 2LLTA 2LVKA 4GFTA 1QS7A 1EG3A 1V1FA 1EL4A 4MZKA 3SJSA 2LVJA 3I5FC 3RLZA 2BE6A 5AXIA 1TNXA 5HLVA 1NX1A 2LUCA 2AMIA 3CWGA 5IBWA 1OE9B 4NDCA 3EKJA 3FIAA 1XFUO 1S5GY 2HETA 5BPJA 1BMOA 2BE4A 1OQPA 1N65A 4CFQA 1SRAA 3VRPA 5KTYA 4PHKA 2KQ6A 1RK9A 1L2OB 4I5NB 2KSPA 4D1EA 1QVIZ 1G33A 2GV5A 2EHBA 1ZFSA 3JTDC 2HF5A 2KOTA 2MBXA 1XFWO 3NSKA 2JXLA 1SL7A 2L5XB 3CR2A 3GOFA 1UHJA 1ZMZA 2JT8A 4ICBA 3BUWB 1IG5A 1YVHA 2TN4A 1QJTA 1DT7B 1S6CA 1JF2A 3IQOA 2CNPA 4XJKB 1KQVA 1GGWA 3D0YA 1KK8C 1UHKA 1Y1UA 2BCBA 2F2OA 4YI9A 2SASA 5CSIA 2KGRA 2FOTA 4HRHA 1QATA 1YURA 2ZNEA 3O2PA 2JC2A 1SL9A 1TNWA 2LHLA 2ZRTA 1WDCB 1R2UA 1Y1AA 5JJGA 1DGVA 1A4PA 3SG2A 1YX8A 4PDZA 1ZOTB 3CR4X 3OP0A 5I2QA 5K89A 3I5FB 3DD4A 4GNKB 2JXCA 2L50A 2OS8B 1ODBA 3I5IC 1RWYA 2HQ8A 1CFFA 1PVAA 3C1VA 2Y4QA 4ORBB 1SNLA 1CMFA 1TNPA 4HSZA 3BOWB 5CPVA 3VRQA 1NPQA 2JT0A 4I5KA 3JTDB 2KAVA 2M29A 2PSRA 1X02A 4YRUA 1JSAA 1AJ5A 4M2QA 1DTLA 1AK8A 4YGDB 1SCMC 3RM1A 1XFZO 1NIWA 2EC6C 3O4YA 1CLMA 3D10A 1QLSA 2D8NA 3OX5A 3EVUA 1KK8B 2MLFC 3BQ3A 3VGOA 3EVVA 4N1GA 1DJIA 2WOSA 4MSPA 1S26D 4L9MA 3LCPC 5G08A 4NQGA 4HRGA 3GK4X 3KPXA 1OZOA 2LLUA 1IKUA 2DOQA 3WXAA 1BJFA 1NYAA 1U5IA 1RFJA 2JTZA 3M0WA 1DF0B 2I2RE 4YI8A 3ZWHA 5KU1A 1KFUL 1FI6A 1OSAA 3GK2A 1KK7Z 1RECA 2L51A 2KFHA 2Q4UA 2KAYA 1WLMA 1K93D 1XK4A 4N5XA 2KBIA 5GQQC 3I5IB 1UHNA 2BBMA 2ISDA 2Y1NA 3WNXB 1F54A 3OHMB 2K7CA 2FCDA 1A03A 1K95A 3CTNA 3LL8B 1EG4A 1YTZC 2E30A 3BYAA 2H2KA 3KEVA 1MXEA 1IQ5A 1CDNA 1KFUS 4DUQA 3VRNA 2Y1MA 1C07A 1OMDA 1QLKA 1NX2A 4PALA 2ZNDA 2BBNA 2ZN9A 1CB1A 2L4IA 1GQMA 1NSHA 1S6IA 2BCXA 3PLFB 2GGMA 1QTXA 2EGDA 1YR5A 1F55A 4JQ0D 3KO0A 4MRYA 3I5GC 2K2FA 1KQMB 1OOJA 1F8HA 3WHUB 1XA5A 5AANA 4DCKA 1WRLA 1OMRA 1PVBA 2OS8C 1SKTA 3SG5A 2MLEC 2RGIA 4E68A 2JU0A 1FPWA 2MRDA 1XVJA 5I2LA 3QRXA 5I8NA 4PE0A 3JVTB 1QX2A 4PE4A 3FS7A 4QJ3B 2FJUB 1YUSA 3PN7C 3TS5C 4GPLB 1A2XA 1AHRA 3GK1A 4MN0A 4M2OA 1U5IB 3SG3A 1LKJA 4IL1A 4MZLA 2HQWA 1Y1XA 1OZSA 1SY9A 2BKIB 2LMTA 5ER5A 4OKHA 2JWWA 1PRWA 4NDDA 1DJHA 4TNCA 2COLB 4CPVA 2LUXA 5AERA 4DIRA 3TDUA 1NX0A 2K7DA 5D7FA 2A4JA 4PE7A 1A75A 1WRKA 2K61A 2LNKA 3PATA 3LLEA 1BLQA 2QACA 4PCWA 1ALVA 1R6PA 2FCEA 3I5HC 1NP8A 2WC8A 3DF0B 3EVRA 1CFDA 2CT9A 3PALA 1S6JA 2G9BA 4C0KA 2LVVA 1AP4A 3HCMA 1B8RA 2LP3A 1KSMA 3AKBA 5HKZA 2MHHA 1UWOA 3I5GB 3BUNB 1SK6D 1FBVA 1NX3A 1JC2A 1W7IB 4GGFA 1S3PA 2NXQA 2LM5A 4I5JA 3PM8A 1YRUB 4C0JA 3OB2B 4CLNA 1CFCA 2KFFA 1PSBA 1F4QA 1SCVA 2BKHB 4BY5A 2M1UA 3NSIA 1LA3A 3VRRA 2M7LA 1RROA 1QXPA 1VRKA 3NXAA 1IH0A 4MBEA 1YUUA 3TZ1A 2CBLA 5HKYA 2LP2A 3E3RA 1RTP1 1TIZA 3BXKA 1N2DA 3MSEB 3PN7B 1RJVA 5DKNA 3A4UB 3TS5B 4PHNA 4AQIA 4U8DA 1IRJA 3SG6A 1S1EA 1TCFA 2G2BA 1J1EA 4JWQA 3TUYB 1QIVA 2JNFA 2BECA 4OV2A 2LV7A 1NWDA 1DJZA 4C0LA 1M39A 1QV1A 1A29A 3SG7A 2KAXA 1B7TY 3F45A 2AAOA 1Q80A 2F3ZA 1AJ4A 3DVMA 2K7OA 3IQQA 3I5HB 4YGCB 3IF7A 5ER4X 2LVIA 1EXRA 5TNCA 2KGBC 1CM4A 1K9KA 1KQMC 3FWCA 1CTRA 2LE9B 1IWQA 2ZFDA 1PULA 3DVJA 4NDBA 2JPTA 1J7QA 4GBAA 4A4BA 5KSZA 2KYCA 3D0YB 1ZUZA 1BT6A 3BUXB 5CSJA 4GAOA 1K94A 3JVTC 1XFVO 3A8RA 3AAJA 2JT3A 1UP5A 2MJWB 2K8MB 2OTGC 1Y6WA 4R1EA 2JNXA 1B8CA 3DVKA 2IS9A 1B47A 3ZNIA 4CIDA 2WNDA 1QX5B 3OB1B 1DMOA 3DVEA 2H61C 2L2EA 1NUBA 1TTXA 2LAPA 1BR4B 3PSRA 5AFPA 1KSOA 1XK4C 2PALA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1H8B A;  2JZI A;  1LA0 A;  1KFX L;  1BU3 A;  1EJ3 A;  2I18 A;  2I7A A;  2F2P A;  4P5O E;  5CSN A;  4WQ3 A;  1M63 B;  1SR6 C;  1E8A A;  1DJW A;  4P2Y B;  4ETO A;  1KCY A;  4MVF A;  1DJY A;  4XYN A;  2NCP A;  1JWD A;  2ZN8 A;  5I2O A;  2JQ6 A;  1IGV A;  5PAL A;  1JFK A;  1QX7 A;  1KWO B;  2AUC A;  2K0J A;  4XJK A;  2K7B A;  1AVS A;  2O60 A;  1HQV A;  1TN4 A;  1MR8 A;  2F8P A;  2PMY A;  2WOR A;  4CFR A;  3AKA A;  2JUL A;  1BG1 A;  2KYF A;  4N1F A;  1KFX S;  2KBM A;  1ALW A;  3EK8 A;  3BUO B;  2Q91 A;  1PSR A;  3CLN A;  1QV0 A;  2BCA A;  1XFX O;  2NCO A;  4AOM A;  2I94 A;  1UUR A;  2KI6 D;  5CSF A;  1K9U A;  4DRW A;  1PAL A;  2PAS A;  4ZCU A;  4UPG A;  1H4B A;  1WY9 A;  4MLW A;  3KF9 A;  2LCP A;  3SG4 A;  3NSO A;  2JTT A;  2OTG B;  2L4H A;  4JPZ B;  1SL8 A;  1BF5 A;  1S36 A;  2NLN A;  3HX4 A;  3FWB A;  4ZCV A;  1SBJ A;  3BOW A;  1LXF C;  2KI4 C;  4YGB B;  3TUY C;  2CTN A;  4Q04 A;  1DJG A;  4YBH B;  3TDZ A;  3LK0 A;  3VRO A;  4PHM A;  2KQY A;  1IJ5 A;  2MA2 A;  1TCO B;  3LK1 A;  1C7V A;  1MXL C;  1SR6 B;  1CDL A;  2LHI A;  1SMG A;  1XYD A;  1IJ6 A;  1SPY A;  1B8L A;  5JOL A;  1FI5 A;  1TOP A;  4OR9 B;  1MWN A;  2BL0 C;  2M8U A;  1SW8 A;  2F33 A;  2LC5 A;  2KNE A;  1FF1 A;  1CM1 A;  4OVN F;  1DJX A;  1K8U A;  1OMV A;  3EK7 A;  2K2A A;  4PE1 A;  3KHE A;  3SIA A;  1GJY A;  1LIN A;  3CGA A;  4AQJ A;  1QVI Y;  4FTG A;  2P6B B;  1DF0 A;  2QPT A;  1XFY O;  2F3Y A;  2B1U A;  2LMV A;  4GUK A;  1B4C A;  4ORC B;  2LLS A;  4GGF C;  3SIB A;  1B7T Z;  1K90 D;  1M45 A;  4WRI A;  2M1K B;  1CDP A;  2NZ0 A;  1NCZ A;  2L0P A;  2L98 A;  1G8I A;  4A4C A;  1M31 A;  1CLB A;  1B9A A;  4QJ5 B;  5HKW A;  1J7R A;  1MF8 B;  5J3X A;  3EK4 A;  2KI4 B;  1WRZ A;  1J55 A;  1WLZ A;  1Y0V H;  1EH2 A;  2V53 A;  4QJ4 B;  2M3W A;  1SYM A;  4ORA B;  1CFP A;  2M7N A;  1UHI A;  1KWO C;  5HYD A;  2WCF A;  1QAS A;  1AUI B;  1UHH A;  1M46 A;  3TDI A;  3CZT X;  1BOC A;  3O78 A;  1MQ1 A;  4MZJ A;  2BL0 B;  1JFJ A;  1A75 B;  4USL A;  4WQ2 A;  2KDH A;  1V1G A;  3WHT B;  1JBA A;  2JOJ A;  3AAK A;  1FW4 A;  1G4Y R;  4MEW A;  2M97 A;  1BR1 B;  4HRE E;  2M0R A;  4M2P A;  4YGA A;  1DGU A;  2JRF A;  2WCE A;  1K2H A;  4MRX A;  1NCX A;  2ZRS A;  2CXJ A;  4I5L B;  1LVC D;  2CCM A;  2KHN A;  2OPO A;  3O6B A;  4YGE B;  5DKQ A;  3NSL A;  4PHJ A;  1PK0 D;  3BUM B;  5AEQ A;  1YX7 A;  1TNQ A;  4F0Z B;  2M9G A;  1CNP A;  1GGZ A;  1IQ3 A;  1F70 A;  1NCY A;  2MAZ A;  2LMU A;  1MUX A;  1TRF A;  1ZAC A;  1F4O A;  1MHO A;  2ZKM X;  2H61 A;  5D69 A;  2VRG A;  4BY4 A;  1HT9 A;  5FYX A;  1CLL A;  1W7J B;  4FQO A;  1D1O A;  2E6W A;  1L2O C;  1BOD A;  5DKR A;  2HPS A;  1JUO A;  5F6T A;  1CMG A;  1UUS A;  2O5G A;  3ICB A;  1CKK A;  4OCI A;  2GGZ A;  1XO5 A;  1JF0 A;  2Y5I A;  2R2I A;  3CR5 X;  2PRU A;  3DF0 A;  1L7Z A;  1KK7 Y;  1K96 A;  1N0Y A;  1QIW A;  1B1G A;  2KI6 C;  1DVI A;  1J7P A;  5B8I B;  5HLO A;  2PVB A;  3H4S E;  1K9P A;  2SCP A;  3K21 A;  4GGN A;  3EKH A;  2WCB A;  3PFV A;  1YUT A;  1SCM B;  3OX6 A;  4DS7 A;  1YVL A;  2EC6 B;  3CS1 A;  1F71 A;  1S5G Z;  1J7O A;  2M49 B;  2LAN A;  1C7W A;  2KFG A;  1YRT B;  1WDC C;  1CDM A;  1J1D A;  2LLT A;  2LVK A;  4GFT A;  1QS7 A;  1EG3 A;  1V1F A;  1EL4 A;  4MZK A;  3SJS A;  2LVJ A;  3I5F C;  3RLZ A;  2BE6 A;  5AXI A;  1TNX A;  5HLV A;  1NX1 A;  2LUC A;  2AMI A;  3CWG A;  5IBW A;  1OE9 B;  4NDC A;  3EKJ A;  3FIA A;  1XFU O;  1S5G Y;  2HET A;  5BPJ A;  1BMO A;  2BE4 A;  1OQP A;  1N65 A;  4CFQ A;  1SRA A;  3VRP A;  5KTY A;  4PHK A;  2KQ6 A;  1RK9 A;  1L2O B;  4I5N B;  2KSP A;  4D1E A;  1QVI Z;  1G33 A;  2GV5 A;  2EHB A;  1ZFS A;  3JTD C;  2HF5 A;  2KOT A;  2MBX A;  1XFW O;  3NSK A;  2JXL A;  1SL7 A;  2L5X B;  3CR2 A;  3GOF A;  1UHJ A;  1ZMZ A;  2JT8 A;  4ICB A;  3BUW B;  1IG5 A;  1YVH A;  2TN4 A;  1QJT A;  1DT7 B;  1S6C A;  1JF2 A;  3IQO A;  2CNP A;  4XJK B;  1KQV A;  1GGW A;  3D0Y A;  1KK8 C;  1UHK A;  1Y1U A;  2BCB A;  2F2O A;  4YI9 A;  2SAS A;  5CSI A;  2KGR A;  2FOT A;  4HRH A;  1QAT A;  1YUR A;  2ZNE A;  3O2P A;  2JC2 A;  1SL9 A;  1TNW A;  2LHL A;  2ZRT A;  1WDC B;  1R2U A;  1Y1A A;  5JJG A;  1DGV A;  1A4P A;  3SG2 A;  1YX8 A;  4PDZ A;  1ZOT B;  3CR4 X;  3OP0 A;  5I2Q A;  5K89 A;  3I5F B;  3DD4 A;  4GNK B;  2JXC A;  2L50 A;  2OS8 B;  1ODB A;  3I5I C;  1RWY A;  2HQ8 A;  1CFF A;  1PVA A;  3C1V A;  2Y4Q A;  4ORB B;  1SNL A;  1CMF A;  1TNP A;  4HSZ A;  3BOW B;  5CPV A;  3VRQ A;  1NPQ A;  2JT0 A;  4I5K A;  3JTD B;  2KAV A;  2M29 A;  2PSR A;  1X02 A;  4YRU A;  1JSA A;  1AJ5 A;  4M2Q A;  1DTL A;  1AK8 A;  4YGD B;  1SCM C;  3RM1 A;  1XFZ O;  1NIW A;  2EC6 C;  3O4Y A;  1CLM A;  3D10 A;  1QLS A;  2D8N A;  3OX5 A;  3EVU A;  1KK8 B;  2MLF C;  3BQ3 A;  3VGO A;  3EVV A;  4N1G A;  1DJI A;  2WOS A;  4MSP A;  1S26 D;  4L9M A;  3LCP C;  5G08 A;  4NQG A;  4HRG A;  3GK4 X;  3KPX A;  1OZO A;  2LLU A;  1IKU A;  2DOQ A;  3WXA A;  1BJF A;  1NYA A;  1U5I A;  1RFJ A;  2JTZ A;  3M0W A;  1DF0 B;  2I2R E;  4YI8 A;  3ZWH A;  5KU1 A;  1KFU L;  1FI6 A;  1OSA A;  3GK2 A;  1KK7 Z;  1REC A;  2L51 A;  2KFH A;  2Q4U A;  2KAY A;  1WLM A;  1K93 D;  1XK4 A;  4N5X A;  2KBI A;  5GQQ C;  3I5I B;  1UHN A;  2BBM A;  2ISD A;  2Y1N A;  3WNX B;  1F54 A;  3OHM B;  2K7C A;  2FCD A;  1A03 A;  1K95 A;  3CTN A;  3LL8 B;  1EG4 A;  1YTZ C;  2E30 A;  3BYA A;  2H2K A;  3KEV A;  1MXE A;  1IQ5 A;  1CDN A;  1KFU S;  4DUQ A;  3VRN A;  2Y1M A;  1C07 A;  1OMD A;  1QLK A;  1NX2 A;  4PAL A;  2ZND A;  2BBN A;  2ZN9 A;  1CB1 A;  2L4I A;  1GQM A;  1NSH A;  1S6I A;  2BCX A;  3PLF B;  2GGM A;  1QTX A;  2EGD A;  1YR5 A;  1F55 A;  4JQ0 D;  3KO0 A;  4MRY A;  3I5G C;  2K2F A;  1KQM B;  1OOJ A;  1F8H A;  3WHU B;  1XA5 A;  5AAN A;  4DCK A;  1WRL A;  1OMR A;  1PVB A;  2OS8 C;  1SKT A;  3SG5 A;  2MLE C;  2RGI A;  4E68 A;  2JU0 A;  1FPW A;  2MRD A;  1XVJ A;  5I2L A;  3QRX A;  5I8N A;  4PE0 A;  3JVT B;  1QX2 A;  4PE4 A;  3FS7 A;  4QJ3 B;  2FJU B;  1YUS A;  3PN7 C;  3TS5 C;  4GPL B;  1A2X A;  1AHR A;  3GK1 A;  4MN0 A;  4M2O A;  1U5I B;  3SG3 A;  1LKJ A;  4IL1 A;  4MZL A;  2HQW A;  1Y1X A;  1OZS A;  1SY9 A;  2BKI B;  2LMT A;  5ER5 A;  4OKH A;  2JWW A;  1PRW A;  4NDD A;  1DJH A;  4TNC A;  2COL B;  4CPV A;  2LUX A;  5AER A;  4DIR A;  3TDU A;  1NX0 A;  2K7D A;  5D7F A;  2A4J A;  4PE7 A;  1A75 A;  1WRK A;  2K61 A;  2LNK A;  3PAT A;  3LLE A;  1BLQ A;  2QAC A;  4PCW A;  1ALV A;  1R6P A;  2FCE A;  3I5H C;  1NP8 A;  2WC8 A;  3DF0 B;  3EVR A;  1CFD A;  2CT9 A;  3PAL A;  1S6J A;  2G9B A;  4C0K A;  2LVV A;  1AP4 A;  3HCM A;  1B8R A;  2LP3 A;  1KSM A;  3AKB A;  5HKZ A;  2MHH A;  1UWO A;  3I5G B;  3BUN B;  1SK6 D;  1FBV A;  1NX3 A;  1JC2 A;  1W7I B;  4GGF A;  1S3P A;  2NXQ A;  2LM5 A;  4I5J A;  3PM8 A;  1YRU B;  4C0J A;  3OB2 B;  4CLN A;  1CFC A;  2KFF A;  1PSB A;  1F4Q A;  1SCV A;  2BKH B;  4BY5 A;  2M1U A;  3NSI A;  1LA3 A;  3VRR A;  2M7L A;  1RRO A;  1QXP A;  1VRK A;  3NXA A;  1IH0 A;  4MBE A;  1YUU A;  3TZ1 A;  2CBL A;  5HKY A;  2LP2 A;  3E3R A;  1RTP 1;  1TIZ A;  3BXK A;  1N2D A;  3MSE B;  3PN7 B;  1RJV A;  5DKN A;  3A4U B;  3TS5 B;  4PHN A;  4AQI A;  4U8D A;  1IRJ A;  3SG6 A;  1S1E A;  1TCF A;  2G2B A;  1J1E A;  4JWQ A;  3TUY B;  1QIV A;  2JNF A;  2BEC A;  4OV2 A;  2LV7 A;  1NWD A;  1DJZ A;  4C0L A;  1M39 A;  1QV1 A;  1A29 A;  3SG7 A;  2KAX A;  1B7T Y;  3F45 A;  2AAO A;  1Q80 A;  2F3Z A;  1AJ4 A;  3DVM A;  2K7O A;  3IQQ A;  3I5H B;  4YGC B;  3IF7 A;  5ER4 X;  2LVI A;  1EXR A;  5TNC A;  2KGB C;  1CM4 A;  1K9K A;  1KQM C;  3FWC A;  1CTR A;  2LE9 B;  1IWQ A;  2ZFD A;  1PUL A;  3DVJ A;  4NDB A;  2JPT A;  1J7Q A;  4GBA A;  4A4B A;  5KSZ A;  2KYC A;  3D0Y B;  1ZUZ A;  1BT6 A;  3BUX B;  5CSJ A;  4GAO A;  1K94 A;  3JVT C;  1XFV O;  3A8R A;  3AAJ A;  2JT3 A;  1UP5 A;  2MJW B;  2K8M B;  2OTG C;  1Y6W A;  4R1E A;  2JNX A;  1B8C A;  3DVK A;  2IS9 A;  1B47 A;  3ZNI A;  4CID A;  2WND A;  1QX5 B;  3OB1 B;  1DMO A;  3DVE A;  2H61 C;  2L2E A;  1NUB A;  1TTX A;  2LAP A;  1BR4 B;  3PSR A;  5AFP A;  1KSO A;  1XK4 C;  2PAL A; 
#chains in the Genus database with same CATH topology
 1H8B A;  2JZI A;  1LA0 A;  1KFX L;  1BU3 A;  1EJ3 A;  2I18 A;  2I7A A;  2F2P A;  4P5O E;  5CSN A;  4WQ3 A;  1M63 B;  1SR6 C;  1E8A A;  1DJW A;  3FE6 A;  4P2Y B;  4ETO A;  1KCY A;  2P70 A;  4JKT A;  4MVF A;  1DJY A;  4XYN A;  2NCP A;  1JWD A;  2ZN8 A;  5I2O A;  2JQ6 A;  1IGV A;  5PAL A;  1JFK A;  1QX7 A;  1KWO B;  2AUC A;  2K0J A;  3B88 A;  4XJK A;  2K7B A;  1AVS A;  2O60 A;  1HQV A;  2PQL A;  1TN4 A;  1MR8 A;  2F8P A;  2PMY A;  2BAP A;  2WOR A;  4CFR A;  3AKA A;  2JUL A;  1BG1 A;  2KYF A;  1OOG A;  4N1F A;  1KFX S;  2KBM A;  1ALW A;  3EK8 A;  4JD9 A;  3BUO B;  2Q91 A;  1PSR A;  3CLN A;  1QV0 A;  2BCA A;  1XFX O;  2NCO A;  4AOM A;  2I94 A;  1UUR A;  2KI6 D;  5CSF A;  1K9U A;  4DRW A;  3V2L A;  1PAL A;  2PAS A;  4ZCU A;  4UPG A;  2KLE A;  1H4B A;  1WY9 A;  2WC5 A;  3KF9 A;  4MLW A;  2LCP A;  3SG4 A;  3NSO A;  2JTT A;  2OTG B;  2L4H A;  4JPZ B;  1SL8 A;  1BF5 A;  2L2C A;  1S36 A;  2NLN A;  3HX4 A;  5HL1 A;  3FWB A;  2WC6 A;  4ZCV A;  1SBJ A;  3BOW A;  1LXF C;  2KI4 C;  4YGB B;  2QEB A;  3TUY C;  2CTN A;  4Q04 A;  1DJG A;  4YBH B;  3TDZ A;  3LK0 A;  3VRO A;  4PHM A;  2KQY A;  1IJ5 A;  2MA2 A;  1TCO B;  3LK1 A;  1OW4 A;  1C7V A;  1MXL C;  1SR6 B;  1CDL A;  3VB1 A;  2LHI A;  1SMG A;  1XYD A;  1IJ6 A;  1SPY A;  1B8L A;  5JOL A;  1FI5 A;  1TOP A;  1T14 A;  4OR9 B;  1MWN A;  3BJH A;  2BL0 C;  2M8U A;  1SW8 A;  2F33 A;  2LC5 A;  2KNE A;  1FF1 A;  1CM1 A;  4OVN F;  1DJX A;  1K8U A;  1OMV A;  3EK7 A;  2K2A A;  3SS4 A;  4PE1 A;  3KHE A;  3SIA A;  1GJY A;  1LIN A;  3CGA A;  4AQJ A;  1QVI Y;  4FTG A;  2P6B B;  1DF0 A;  3DZT A;  2QPT A;  1XFY O;  2F3Y A;  2B1U A;  2LMV A;  4GUK A;  1B4C A;  4ORC B;  2LLS A;  4GGF C;  3B86 A;  3SIB A;  1B7T Z;  1K90 D;  1M45 A;  4WRI A;  2M1K B;  1CDP A;  2NZ0 A;  1NCZ A;  2L0P A;  2L98 A;  1G8I A;  3D74 A;  4A4C A;  1M31 A;  1CLB A;  1B9A A;  4QJ5 B;  5HKW A;  1J7R A;  1MF8 B;  5J3X A;  3EK4 A;  2KI4 B;  1WRZ A;  1J55 A;  1WLZ A;  1Y0V H;  1EH2 A;  2V53 A;  4QJ4 B;  2M3W A;  1SYM A;  4ORA B;  1CFP A;  2M7N A;  1UHI A;  1KWO C;  3Q8I A;  3R1V A;  5HYD A;  2WCF A;  1QAS A;  2KLD A;  1AUI B;  1UHH A;  1M46 A;  4F7F A;  3K1E A;  3TDI A;  3CZT X;  1BOC A;  3O78 A;  1MQ1 A;  4MZJ A;  2BL0 B;  1JFJ A;  1A75 B;  4USL A;  4WQ2 A;  2KDH A;  1V1G A;  3WHT B;  1OOH A;  3D77 A;  1JBA A;  2JOJ A;  3AAK A;  1FW4 A;  1G4Y R;  4MEW A;  2M97 A;  3S0F A;  1BR1 B;  4HRE E;  2M0R A;  2WCL A;  4M2P A;  4YGA A;  1DGU A;  2JRF A;  2WCE A;  1K2H A;  4MRX A;  3OGN A;  1NCX A;  2ZRS A;  3DY9 A;  2CXJ A;  5I94 A;  4I5L B;  1LVC D;  2CCM A;  2KHN A;  2OPO A;  3O6B A;  4YGE B;  5DKQ A;  3NSL A;  3BFA A;  1PK0 D;  3BUM B;  4PHJ A;  1YX7 A;  1TNQ A;  4KYN A;  5AEQ A;  4F0Z B;  2M9G A;  1CNP A;  1GGZ A;  1IQ3 A;  1F70 A;  1NCY A;  2BNX A;  2MAZ A;  2LMU A;  1MUX A;  1TRF A;  1ZAC A;  1F4O A;  1MHO A;  2ZKM X;  2H61 A;  5D69 A;  2VRG A;  4BY4 A;  1HT9 A;  5FYX A;  1CLL A;  1W7J B;  4FQO A;  1D1O A;  2E6W A;  1L2O C;  1BOD A;  5DKR A;  2HPS A;  1JUO A;  3NHT A;  5F6T A;  3DYE A;  1UUS A;  2O5G A;  3ICB A;  1CMG A;  1CKK A;  4OCI A;  2GGZ A;  1XO5 A;  1JF0 A;  2Y5I A;  2R2I A;  3CR5 X;  2PRU A;  3DF0 A;  1L7Z A;  1KK7 Y;  1K96 A;  1N0Y A;  1QIW A;  1B1G A;  2KI6 C;  1DVI A;  2PYQ A;  1J7P A;  5B8I B;  5HLO A;  2PVB A;  3H4S E;  1K9P A;  2SCP A;  3K21 A;  4GGN A;  3EKH A;  2WCB A;  3PFV A;  1YUT A;  1SCM B;  3OX6 A;  4DS7 A;  1YVL A;  2EC6 B;  3CS1 A;  1F71 A;  1S5G Z;  1J7O A;  1C3Y A;  2M49 B;  2LAN A;  1C7W A;  2KFG A;  1YRT B;  3CAB A;  1WDC C;  1CDM A;  3S0G A;  1J1D A;  2LLT A;  2LVK A;  3CZ1 A;  4GFT A;  1QS7 A;  1EG3 A;  1V1F A;  1EL4 A;  4MZK A;  3SJS A;  1P28 A;  2LVJ A;  3I5F C;  3RLZ A;  1QWV A;  2BE6 A;  5AXI A;  1TNX A;  5HLV A;  1NX1 A;  1Z4H A;  2AMI A;  2LUC A;  3CWG A;  5IBW A;  1IIO A;  1OE9 B;  4NDC A;  3EKJ A;  3FIA A;  1XFU O;  1S5G Y;  1DEK A;  2HET A;  5BPJ A;  1BMO A;  2BE4 A;  1OQP A;  1N65 A;  4CFQ A;  1SRA A;  3VRP A;  5KTY A;  4PHK A;  2KQ6 A;  1RK9 A;  1L2O B;  4I5N B;  2KSP A;  4D1E A;  1QVI Z;  1TUJ A;  1G33 A;  2GV5 A;  2EHB A;  1ZFS A;  3JTD C;  3D78 A;  2HF5 A;  2KOT A;  2MBX A;  1XFW O;  3NSK A;  2JXL A;  1SL7 A;  2L5X B;  3CR2 A;  3GOF A;  1UHJ A;  1OOI X;  1ZMZ A;  2JT8 A;  4ICB A;  3BUW B;  1ORG A;  1IG5 A;  1YVH A;  3UO9 A;  2TN4 A;  1QJT A;  1DT7 B;  1S6C A;  4FQT A;  1JF2 A;  3IQO A;  2CNP A;  2QEV A;  4XJK B;  1KQV A;  1GGW A;  3D0Y A;  1KK8 C;  1UHK A;  1Y1U A;  2BCB A;  2F2O A;  4YI9 A;  2SAS A;  5CSI A;  2KGR A;  1C3Z A;  2FOT A;  4HRH A;  1QAT A;  5FI6 A;  1YUR A;  2ZNE A;  3D76 A;  3O2P A;  2JC2 A;  1SL9 A;  1Z2C B;  1TNW A;  2LHL A;  2ZRT A;  1WDC B;  1R2U A;  1Y1A A;  5JJG A;  1DGV A;  1A4P A;  3SG2 A;  1YX8 A;  3NGV A;  1LS8 A;  4PDZ A;  2WCH A;  1ZOT B;  3CR4 X;  3OP0 A;  5I2Q A;  5K89 A;  3I5F B;  3DD4 A;  4GNK B;  4IJ7 A;  2JXC A;  2L50 A;  2OS8 B;  1ODB A;  3S0E A;  3I5I C;  1RWY A;  2HQ8 A;  1CFF A;  1PVA A;  3C1V A;  2Y4Q A;  4ORB B;  1SNL A;  3PM2 A;  3D73 A;  1CMF A;  1TNP A;  4HSZ A;  3BOW B;  5CPV A;  3VRQ A;  3S0A A;  1NPQ A;  2JT0 A;  4I5K A;  3JTD B;  2KAV A;  2M29 A;  2JPO A;  1X02 A;  2PSR A;  4YRU A;  3D75 A;  3UNW A;  2GTE A;  1JSA A;  1AJ5 A;  3BFB A;  4M2Q A;  1DTL A;  1AK8 A;  3CZ0 A;  1DQE A;  4YGD B;  3SS5 A;  1SCM C;  3RM1 A;  1XFZ O;  1NIW A;  2EC6 C;  3O4Y A;  1CLM A;  3D10 A;  1QLS A;  1SSE B;  2D8N A;  3OX5 A;  3EVU A;  1KK8 B;  2MLF C;  3BQ3 A;  3VGO A;  1TWO A;  3EVV A;  4N1G A;  1DJI A;  2WOS A;  4MSP A;  1S26 D;  1W9Z A;  3L4L A;  3LCP C;  4L9M A;  5G08 A;  4NQG A;  4HRG A;  3GK4 X;  3KPX A;  1OZO A;  2LLU A;  1IKU A;  2DOQ A;  3WXA A;  1BJF A;  1TUZ A;  1NYA A;  1U5I A;  1RFJ A;  2JTZ A;  3M0W A;  1DF0 B;  2I2R E;  4YI8 A;  3ZWH A;  5KU1 A;  1KFU L;  1FI6 A;  1OSA A;  3GK2 A;  1KK7 Z;  1REC A;  2L51 A;  2KFH A;  2Q4U A;  2KAY A;  1WLM A;  1K93 D;  1XK4 A;  4N5X A;  2KBI A;  5FI2 A;  5GQQ C;  3I5I B;  1UHN A;  2WCK A;  3NHI A;  2H8V A;  3L4A A;  2QEO A;  2BBM A;  2ISD A;  2Y1N A;  3WNX B;  1F54 A;  3OHM B;  2K7C A;  2FCD A;  1A03 A;  3O4X A;  1K95 A;  3CTN A;  3LL8 B;  1EG4 A;  1YTZ C;  2E30 A;  3DXL A;  3BYA A;  2H2K A;  3KEV A;  1MXE A;  1IQ5 A;  1CDN A;  1KFU S;  4DUQ A;  3VRN A;  2Y1M A;  1C07 A;  1OMD A;  2QDI A;  1QLK A;  1NX2 A;  4PAL A;  2ZND A;  2BBN A;  2ZN9 A;  1CB1 A;  2L4I A;  1GQM A;  1NSH A;  1S6I A;  1XFR A;  2BCX A;  3PLF B;  2KPH A;  2GGM A;  2WCM A;  1QTX A;  2EGD A;  1YR5 A;  1F55 A;  4JQ0 D;  3KO0 A;  4MRY A;  3I5G C;  2QEH A;  2K2F A;  1KQM B;  1OOJ A;  1F8H A;  3WHU B;  2WCJ A;  1XA5 A;  5AAN A;  3S0B A;  4DCK A;  1WRL A;  1OMR A;  5DIC A;  1PVB A;  2OS8 C;  1SKT A;  3SG5 A;  2MLE C;  2RGI A;  4E68 A;  2JU0 A;  1FPW A;  2MRD A;  1XVJ A;  3L47 A;  5I2L A;  3QRX A;  1OOF A;  5I8N A;  4PE0 A;  3JVT B;  1QX2 A;  4PE4 A;  3FS7 A;  4QJ3 B;  2FJU B;  3SS3 A;  1GM0 A;  1YUS A;  3PN7 C;  3TS5 C;  4GPL B;  1A2X A;  2ERB A;  1AHR A;  3GK1 A;  4MN0 A;  4M2O A;  1U5I B;  3SG3 A;  1LKJ A;  2K60 A;  4IL1 A;  4MZL A;  2HQW A;  1Y1X A;  1OZS A;  3N7H A;  1SY9 A;  2BKI B;  2LMT A;  5ER5 A;  4OKH A;  2JWW A;  1PRW A;  3FE8 A;  1DJH A;  4NDD A;  2COL B;  4TNC A;  2LUX A;  4CPV A;  5AER A;  3R1P A;  3CZ2 A;  4DIR A;  3TDU A;  1NX0 A;  3QME A;  2K7D A;  5D7F A;  2A4J A;  4PE7 A;  5D3O A;  1A75 A;  1WRK A;  2K61 A;  2LNK A;  3PAT A;  3LLE A;  3S0D A;  2QAC A;  4INX A;  4PCW A;  1ALV A;  1BLQ A;  1R6P A;  2FCE A;  3I5H C;  1NP8 A;  2WC8 A;  3RZS A;  3DF0 B;  3EVR A;  3IVT A;  1CFD A;  2CT9 A;  3PAL A;  1S6J A;  2G9B A;  4C0K A;  2LVV A;  3OBV A;  3HCM A;  1AP4 A;  1B8R A;  2LP3 A;  1KSM A;  3AKB A;  5HKZ A;  2MHH A;  1UWO A;  3I5G B;  3BUN B;  3R72 A;  1SK6 D;  1FBV A;  1NX3 A;  1JC2 A;  1W7I B;  4GGF A;  1S3P A;  2NXQ A;  2LM5 A;  4I5J A;  3PM8 A;  1YRU B;  4C0J A;  3OB2 B;  4CLN A;  1DC1 A;  1CFC A;  2KFF A;  3CDN A;  1PSB A;  1F4Q A;  1SCV A;  2BKH B;  4BY5 A;  3B87 A;  2M1U A;  3NSI A;  1LA3 A;  3VRR A;  2M7L A;  1RRO A;  1VRK A;  1QXP A;  3NXA A;  1IH0 A;  4MBE A;  1YUU A;  3TZ1 A;  2CBL A;  5HKY A;  2LP2 A;  3E3R A;  1RTP 1;  1TIZ A;  3BXK A;  1N2D A;  3MSE B;  3PN7 B;  1RJV A;  5DKN A;  3A4U B;  5FI7 A;  4PHN A;  3TS5 B;  4U8D A;  4AQI A;  1IRJ A;  3SG6 A;  1S1E A;  1TCF A;  2G2B A;  1J1E A;  2P71 A;  4JWQ A;  3BFH A;  5EL2 A;  3TUY B;  1QIV A;  2JNF A;  2BEC A;  4PT1 A;  4OV2 A;  2LV7 A;  3EG5 B;  1NWD A;  1DJZ A;  4C0L A;  1M39 A;  1QV1 A;  1A29 A;  3SG7 A;  2KAX A;  1B7T Y;  3F45 A;  2AAO A;  1Q80 A;  1DEL A;  2F3Z A;  1AJ4 A;  3DVM A;  2K7O A;  3IQQ A;  3I5H B;  4YGC B;  3IF7 A;  5ER4 X;  2LVI A;  1EXR A;  2YGU A;  3FE9 A;  5TNC A;  2KGB C;  1CM4 A;  3B7A A;  1K9K A;  1KQM C;  3CYZ A;  1CTR A;  2LE9 B;  1IWQ A;  2ZFD A;  1PUL A;  3DVJ A;  3FWC A;  4NDB A;  2JPT A;  3R1O A;  1J7Q A;  4GBA A;  4INW A;  4A4B A;  5KSZ A;  2KYC A;  3D0Y B;  1ZUZ A;  1BT6 A;  3BUX B;  5CSJ A;  3PJI A;  4GAO A;  1K94 A;  3JVT C;  4OZD A;  1XFV O;  3A8R A;  3AAJ A;  2JT3 A;  2FJY A;  1UP5 A;  2MJW B;  2K8M B;  2OTG C;  1Y6W A;  4R1E A;  2JNX A;  1B8C A;  3DVK A;  2IS9 A;  1B47 A;  3ZNI A;  4CID A;  2WND A;  1QX5 B;  3OB1 B;  1DMO A;  2L5Y A;  3DVE A;  2H61 C;  2L2E A;  1NUB A;  3B6X A;  1TTX A;  2LAP A;  1BR4 B;  3PSR A;  5AFP A;  1KSO A;  1XK4 C;  2PAL A; 
#chains in the Genus database with same CATH homology
 1H8B A;  2JZI A;  1LA0 A;  1KFX L;  1BU3 A;  1EJ3 A;  2I18 A;  2I7A A;  2F2P A;  4P5O E;  5CSN A;  4WQ3 A;  1M63 B;  1SR6 C;  1E8A A;  1DJW A;  4P2Y B;  4ETO A;  1KCY A;  4MVF A;  1DJY A;  4XYN A;  2NCP A;  1JWD A;  2ZN8 A;  5I2O A;  2JQ6 A;  1IGV A;  5PAL A;  1JFK A;  1QX7 A;  1KWO B;  2AUC A;  2K0J A;  4XJK A;  2K7B A;  1AVS A;  2O60 A;  1HQV A;  1TN4 A;  1MR8 A;  2F8P A;  2PMY A;  2WOR A;  4CFR A;  3AKA A;  2JUL A;  1BG1 A;  2KYF A;  4N1F A;  1KFX S;  2KBM A;  1ALW A;  3EK8 A;  3BUO B;  2Q91 A;  1PSR A;  3CLN A;  1QV0 A;  2BCA A;  1XFX O;  2NCO A;  4AOM A;  2I94 A;  1UUR A;  2KI6 D;  5CSF A;  1K9U A;  4DRW A;  1PAL A;  2PAS A;  4ZCU A;  4UPG A;  1H4B A;  1WY9 A;  4MLW A;  3KF9 A;  2LCP A;  3SG4 A;  3NSO A;  2JTT A;  2OTG B;  2L4H A;  4JPZ B;  1SL8 A;  1BF5 A;  1S36 A;  2NLN A;  3HX4 A;  3FWB A;  4ZCV A;  1SBJ A;  3BOW A;  1LXF C;  2KI4 C;  4YGB B;  3TUY C;  2CTN A;  4Q04 A;  1DJG A;  4YBH B;  3TDZ A;  3LK0 A;  3VRO A;  4PHM A;  2KQY A;  1IJ5 A;  2MA2 A;  1TCO B;  3LK1 A;  1C7V A;  1MXL C;  1SR6 B;  1CDL A;  2LHI A;  1SMG A;  1XYD A;  1IJ6 A;  1SPY A;  1B8L A;  5JOL A;  1FI5 A;  1TOP A;  4OR9 B;  1MWN A;  2BL0 C;  2M8U A;  1SW8 A;  2F33 A;  2LC5 A;  2KNE A;  1FF1 A;  1CM1 A;  4OVN F;  1DJX A;  1K8U A;  1OMV A;  3EK7 A;  2K2A A;  4PE1 A;  3KHE A;  3SIA A;  1GJY A;  1LIN A;  3CGA A;  4AQJ A;  1QVI Y;  4FTG A;  2P6B B;  1DF0 A;  2QPT A;  1XFY O;  2F3Y A;  2B1U A;  2LMV A;  4GUK A;  1B4C A;  4ORC B;  2LLS A;  4GGF C;  3SIB A;  1B7T Z;  1K90 D;  1M45 A;  4WRI A;  2M1K B;  1CDP A;  2NZ0 A;  1NCZ A;  2L0P A;  2L98 A;  1G8I A;  4A4C A;  1M31 A;  1CLB A;  1B9A A;  4QJ5 B;  5HKW A;  1J7R A;  1MF8 B;  5J3X A;  3EK4 A;  2KI4 B;  1WRZ A;  1J55 A;  1WLZ A;  1Y0V H;  1EH2 A;  2V53 A;  4QJ4 B;  2M3W A;  1SYM A;  4ORA B;  1CFP A;  2M7N A;  1UHI A;  1KWO C;  5HYD A;  2WCF A;  1QAS A;  1AUI B;  1UHH A;  1M46 A;  3TDI A;  3CZT X;  1BOC A;  3O78 A;  1MQ1 A;  4MZJ A;  2BL0 B;  1JFJ A;  1A75 B;  4USL A;  4WQ2 A;  2KDH A;  1V1G A;  3WHT B;  1JBA A;  2JOJ A;  3AAK A;  1FW4 A;  1G4Y R;  4MEW A;  2M97 A;  1BR1 B;  4HRE E;  2M0R A;  4M2P A;  4YGA A;  1DGU A;  2JRF A;  2WCE A;  1K2H A;  4MRX A;  1NCX A;  2ZRS A;  2CXJ A;  4I5L B;  1LVC D;  2CCM A;  2KHN A;  2OPO A;  3O6B A;  4YGE B;  5DKQ A;  3NSL A;  4PHJ A;  1PK0 D;  3BUM B;  5AEQ A;  1YX7 A;  1TNQ A;  4F0Z B;  2M9G A;  1CNP A;  1GGZ A;  1IQ3 A;  1F70 A;  1NCY A;  2MAZ A;  2LMU A;  1MUX A;  1TRF A;  1ZAC A;  1F4O A;  1MHO A;  2ZKM X;  2H61 A;  5D69 A;  2VRG A;  4BY4 A;  1HT9 A;  5FYX A;  1CLL A;  1W7J B;  4FQO A;  1D1O A;  2E6W A;  1L2O C;  1BOD A;  5DKR A;  2HPS A;  1JUO A;  5F6T A;  1CMG A;  1UUS A;  2O5G A;  3ICB A;  1CKK A;  4OCI A;  2GGZ A;  1XO5 A;  1JF0 A;  2Y5I A;  2R2I A;  3CR5 X;  2PRU A;  3DF0 A;  1L7Z A;  1KK7 Y;  1K96 A;  1N0Y A;  1QIW A;  1B1G A;  2KI6 C;  1DVI A;  1J7P A;  5B8I B;  5HLO A;  2PVB A;  3H4S E;  1K9P A;  2SCP A;  3K21 A;  4GGN A;  3EKH A;  2WCB A;  3PFV A;  1YUT A;  1SCM B;  3OX6 A;  4DS7 A;  1YVL A;  2EC6 B;  3CS1 A;  1F71 A;  1S5G Z;  1J7O A;  2M49 B;  2LAN A;  1C7W A;  2KFG A;  1YRT B;  1WDC C;  1CDM A;  1J1D A;  2LLT A;  2LVK A;  4GFT A;  1QS7 A;  1EG3 A;  1V1F A;  1EL4 A;  4MZK A;  3SJS A;  2LVJ A;  3I5F C;  3RLZ A;  2BE6 A;  5AXI A;  1TNX A;  5HLV A;  1NX1 A;  2LUC A;  2AMI A;  3CWG A;  5IBW A;  1OE9 B;  4NDC A;  3EKJ A;  3FIA A;  1XFU O;  1S5G Y;  2HET A;  5BPJ A;  1BMO A;  2BE4 A;  1OQP A;  1N65 A;  4CFQ A;  1SRA A;  3VRP A;  5KTY A;  4PHK A;  2KQ6 A;  1RK9 A;  1L2O B;  4I5N B;  2KSP A;  4D1E A;  1QVI Z;  1G33 A;  2GV5 A;  2EHB A;  1ZFS A;  3JTD C;  2HF5 A;  2KOT A;  2MBX A;  1XFW O;  3NSK A;  2JXL A;  1SL7 A;  2L5X B;  3CR2 A;  3GOF A;  1UHJ A;  1ZMZ A;  2JT8 A;  4ICB A;  3BUW B;  1IG5 A;  1YVH A;  2TN4 A;  1QJT A;  1DT7 B;  1S6C A;  1JF2 A;  3IQO A;  2CNP A;  4XJK B;  1KQV A;  1GGW A;  3D0Y A;  1KK8 C;  1UHK A;  1Y1U A;  2BCB A;  2F2O A;  4YI9 A;  2SAS A;  5CSI A;  2KGR A;  2FOT A;  4HRH A;  1QAT A;  1YUR A;  2ZNE A;  3O2P A;  2JC2 A;  1SL9 A;  1TNW A;  2LHL A;  2ZRT A;  1WDC B;  1R2U A;  1Y1A A;  5JJG A;  1DGV A;  1A4P A;  3SG2 A;  1YX8 A;  4PDZ A;  1ZOT B;  3CR4 X;  3OP0 A;  5I2Q A;  5K89 A;  3I5F B;  3DD4 A;  4GNK B;  2JXC A;  2L50 A;  2OS8 B;  1ODB A;  3I5I C;  1RWY A;  2HQ8 A;  1CFF A;  1PVA A;  3C1V A;  2Y4Q A;  4ORB B;  1SNL A;  1CMF A;  1TNP A;  4HSZ A;  3BOW B;  5CPV A;  3VRQ A;  1NPQ A;  2JT0 A;  4I5K A;  3JTD B;  2KAV A;  2M29 A;  2PSR A;  1X02 A;  4YRU A;  1JSA A;  1AJ5 A;  4M2Q A;  1DTL A;  1AK8 A;  4YGD B;  1SCM C;  3RM1 A;  1XFZ O;  1NIW A;  2EC6 C;  3O4Y A;  1CLM A;  3D10 A;  1QLS A;  2D8N A;  3OX5 A;  3EVU A;  1KK8 B;  2MLF C;  3BQ3 A;  3VGO A;  3EVV A;  4N1G A;  1DJI A;  2WOS A;  4MSP A;  1S26 D;  4L9M A;  3LCP C;  5G08 A;  4NQG A;  4HRG A;  3GK4 X;  3KPX A;  1OZO A;  2LLU A;  1IKU A;  2DOQ A;  3WXA A;  1BJF A;  1NYA A;  1U5I A;  1RFJ A;  2JTZ A;  3M0W A;  1DF0 B;  2I2R E;  4YI8 A;  3ZWH A;  5KU1 A;  1KFU L;  1FI6 A;  1OSA A;  3GK2 A;  1KK7 Z;  1REC A;  2L51 A;  2KFH A;  2Q4U A;  2KAY A;  1WLM A;  1K93 D;  1XK4 A;  4N5X A;  2KBI A;  5GQQ C;  3I5I B;  1UHN A;  2BBM A;  2ISD A;  2Y1N A;  3WNX B;  1F54 A;  3OHM B;  2K7C A;  2FCD A;  1A03 A;  1K95 A;  3CTN A;  3LL8 B;  1EG4 A;  1YTZ C;  2E30 A;  3BYA A;  2H2K A;  3KEV A;  1MXE A;  1IQ5 A;  1CDN A;  1KFU S;  4DUQ A;  3VRN A;  2Y1M A;  1C07 A;  1OMD A;  1QLK A;  1NX2 A;  4PAL A;  2ZND A;  2BBN A;  2ZN9 A;  1CB1 A;  2L4I A;  1GQM A;  1NSH A;  1S6I A;  2BCX A;  3PLF B;  2GGM A;  1QTX A;  2EGD A;  1YR5 A;  1F55 A;  4JQ0 D;  3KO0 A;  4MRY A;  3I5G C;  2K2F A;  1KQM B;  1OOJ A;  1F8H A;  3WHU B;  1XA5 A;  5AAN A;  4DCK A;  1WRL A;  1OMR A;  1PVB A;  2OS8 C;  1SKT A;  3SG5 A;  2MLE C;  2RGI A;  4E68 A;  2JU0 A;  1FPW A;  2MRD A;  1XVJ A;  5I2L A;  3QRX A;  5I8N A;  4PE0 A;  3JVT B;  1QX2 A;  4PE4 A;  3FS7 A;  4QJ3 B;  2FJU B;  1YUS A;  3PN7 C;  3TS5 C;  4GPL B;  1A2X A;  1AHR A;  3GK1 A;  4MN0 A;  4M2O A;  1U5I B;  3SG3 A;  1LKJ A;  4IL1 A;  4MZL A;  2HQW A;  1Y1X A;  1OZS A;  1SY9 A;  2BKI B;  2LMT A;  5ER5 A;  4OKH A;  2JWW A;  1PRW A;  4NDD A;  1DJH A;  4TNC A;  2COL B;  4CPV A;  2LUX A;  5AER A;  4DIR A;  3TDU A;  1NX0 A;  2K7D A;  5D7F A;  2A4J A;  4PE7 A;  1A75 A;  1WRK A;  2K61 A;  2LNK A;  3PAT A;  3LLE A;  1BLQ A;  2QAC A;  4PCW A;  1ALV A;  1R6P A;  2FCE A;  3I5H C;  1NP8 A;  2WC8 A;  3DF0 B;  3EVR A;  1CFD A;  2CT9 A;  3PAL A;  1S6J A;  2G9B A;  4C0K A;  2LVV A;  1AP4 A;  3HCM A;  1B8R A;  2LP3 A;  1KSM A;  3AKB A;  5HKZ A;  2MHH A;  1UWO A;  3I5G B;  3BUN B;  1SK6 D;  1FBV A;  1NX3 A;  1JC2 A;  1W7I B;  4GGF A;  1S3P A;  2NXQ A;  2LM5 A;  4I5J A;  3PM8 A;  1YRU B;  4C0J A;  3OB2 B;  4CLN A;  1CFC A;  2KFF A;  1PSB A;  1F4Q A;  1SCV A;  2BKH B;  4BY5 A;  2M1U A;  3NSI A;  1LA3 A;  3VRR A;  2M7L A;  1RRO A;  1QXP A;  1VRK A;  3NXA A;  1IH0 A;  4MBE A;  1YUU A;  3TZ1 A;  2CBL A;  5HKY A;  2LP2 A;  3E3R A;  1RTP 1;  1TIZ A;  3BXK A;  1N2D A;  3MSE B;  3PN7 B;  1RJV A;  5DKN A;  3A4U B;  3TS5 B;  4PHN A;  4AQI A;  4U8D A;  1IRJ A;  3SG6 A;  1S1E A;  1TCF A;  2G2B A;  1J1E A;  4JWQ A;  3TUY B;  1QIV A;  2JNF A;  2BEC A;  4OV2 A;  2LV7 A;  1NWD A;  1DJZ A;  4C0L A;  1M39 A;  1QV1 A;  1A29 A;  3SG7 A;  2KAX A;  1B7T Y;  3F45 A;  2AAO A;  1Q80 A;  2F3Z A;  1AJ4 A;  3DVM A;  2K7O A;  3IQQ A;  3I5H B;  4YGC B;  3IF7 A;  5ER4 X;  2LVI A;  1EXR A;  5TNC A;  2KGB C;  1CM4 A;  1K9K A;  1KQM C;  3FWC A;  1CTR A;  2LE9 B;  1IWQ A;  2ZFD A;  1PUL A;  3DVJ A;  4NDB A;  2JPT A;  1J7Q A;  4GBA A;  4A4B A;  5KSZ A;  2KYC A;  3D0Y B;  1ZUZ A;  1BT6 A;  3BUX B;  5CSJ A;  4GAO A;  1K94 A;  3JVT C;  1XFV O;  3A8R A;  3AAJ A;  2JT3 A;  1UP5 A;  2MJW B;  2K8M B;  2OTG C;  1Y6W A;  4R1E A;  2JNX A;  1B8C A;  3DVK A;  2IS9 A;  1B47 A;  3ZNI A;  4CID A;  2WND A;  1QX5 B;  3OB1 B;  1DMO A;  3DVE A;  2H61 C;  2L2E A;  1NUB A;  1TTX A;  2LAP A;  1BR4 B;  3PSR A;  5AFP A;  1KSO A;  1XK4 C;  2PAL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...