2PALA

Ionic interactions with parvalbumins. crystal structure determination of pike 4.10 parvalbumin in four different ionic environments
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
107
structure length
107
Chain Sequence
SFAGLKDADVAAALAACSAADSFKHKEFFAKVGLASKSLDDVKKAFYVIDQDKSGFIEEDELKLFLQNFSPSARALTDAETKAFLADGDKDGDGMIGVDEFAAMIKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Calcium binding protein
molecule keywords PARVALBUMIN
publication title Ionic interactions with parvalbumins. Crystal structure determination of pike 4.10 parvalbumin in four different ionic environments.
pubmed doi rcsb
source organism Esox lucius
total genus 39
structure length 107
sequence length 107
ec nomenclature
pdb deposition date 1990-11-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2palA00
1QS7A 2F3ZA 4QJ5B 1DJHA 2BKHB 4UPGA 1CKKA 1K94A 1F8HA 1MXEA 1YVLA 1ZOTB 1L2OB 2BCXA 1WRLA 2EHBA 2SCPA 2LUCA 4MBEA 3CS1A 1C7VA 1KK8B 1YVHA 3I5GC 1QX7A 3IQQA 2K7OA 4GFTA 1S6CA 1RWYA 1SRAA 2M7LA 1XFUO 3C1VA 4JQ0D 1TNXA 2JNXA 5I2QA 2GGMA 1SNLA 2K7DA 5HLOA 3DD4A 3DVKA 3CR2A 2BBNA 1CLLA 1BODA 2L50A 2K2FA 2BL0C 2BBMA 3I5IB 5I2OA 5K89A 2QACA 2CT9A 1XFWO 2KI6D 1DJWA 2E30A 3CLNA 4N1GA 3VRNA 1CFFA 2KAXA 1DJYA 2Q91A 1QV1A 4XJKB 3A8RA 1QX2A 2KHNA 1F71A 4ZCVA 1V1FA 3IF7A 1DJXA 3F45A 1J1EA 1W7IB 1BJFA 1AK8A 2BE6A 2Y4QA 4MZJA 1JC2A 1KK7Z 4MN0A 2KOTA 1L2OC 1A29A 4HSZA 1QTXA 2F2PA 1S26D 1TOPA 1XFVO 2KBMA 2KFFA 1B7TZ 1DF0A 3SG6A 1QLSA 1CMGA 1K96A 4OV2A 4WQ2A 2F3YA 4PHKA 3CGAA 1KK8C 3ZNIA 2JT8A 3FWCA 2JRFA 2LHLA 2F2OA 3DVJA 3PM8A 2JTZA 2K7CA 4YGAA 3RLZA 4JPZB 1SCMB 1EG4A 1JBAA 5CSFA 2I18A 1NCZA 2H61C 1PVBA 2ZRTA 1K9UA 1N2DA 1UURA 1F4QA 1SCVA 2FCDA 4PHJA 1J1DA 3EK7A 4WRIA 1FBVA 4YI9A 3I5IC 2ZNEA 2Y1MA 3PN7B 4NDBA 4QJ4B 1G8IA 2CBLA 4C0LA 2L98A 1QIWA 2H61A 3A4UB 3TDZA 4DUQA 1B4CA 1SMGA 2PSRA 3QRXA 4YBHB 1KWOB 2CTNA 1MF8B 2V53A 3KEVA 4GBAA 1J7QA 1JWDA 5BPJA 5HKWA 3CZTX 4A4BA 4CFQA 1WLZA 1F4OA 1B47A 1NP8A 1NWDA 2BECA 3PATA 1RJVA 1IWQA 3OB2B 2OS8C 2DOQA 4FTGA 3BXKA 3K21A 4ZCUA 1R6PA 3TUYC 2KQ6A 1SK6D 2MLEC 1XFYO 1YRTB 4CPVA 4L9MA 1OMRA 1NX1A 4HREE 4MEWA 2JC2A 3OHMB 1NCXA 3PALA 3VRPA 1JFJA 3EKJA 1HT9A 1XA5A 3WXAA 1SL7A 1M46A 1LA0A 4DCKA 1CNPA 4YRUA 1XK4A 1BU3A 2D8NA 1CFDA 1KCYA 1IKUA 2AUCA 4ORBB 1LINA 1S5GZ 3GOFA 4GNKB 3TZ1A 4AOMA 3LL8B 1EJ3A 1UHJA 3NSKA 2LUXA 1SW8A 1BT6A 2OPOA 3KF9A 5FYXA 1CLMA 2LVJA 1CB1A 2Y1NA 2WCBA 3SG4A 2ZN9A 2MRDA 3PN7C 2F8PA 4HRGA 1CDNA 5DKNA 1OMDA 1AP4A 2P6BB 1IG5A 2K7BA 4DS7A 4C0JA 4PE0A 5ER5A 1KWOC 2M1KB 1KFUS 2I2RE 2ZNDA 1IH0A 2L2EA 1SR6C 2PVBA 2JU0A 1MXLC 5AXIA 1ALWA 3PSRA 5DKQA 2M8UA 2CXJA 1BR1B 2RGIA 1NYAA 3FS7A 2LLUA 1AHRA 4YGBB 1IJ5A 2KGBC 3I5FB 4ICBA 1TRFA 3VRQA 1FW4A 1CDMA 1NX2A 3JTDB 1SL9A 3KPXA 1M39A 3AKAA 3JVTC 1XO5A 1CDPA 2GV5A 1RTP1 1AJ4A 1CMFA 4GGFC 1DJIA 1WY9A 1C7WA 1S3PA 1UP5A 1NX0A 4PALA 2LLTA 1AVSA 1UHHA 3BUMB 2JT0A 1M31A 2E6WA 5CPVA 1Y1AA 1EXRA 4PHNA 1N65A 4OR9B 5AANA 4YGEB 2Y5IA 1NIWA 2NXQA 4ETOA 5AERA 1U5IA 1OSAA 2MHHA 1V1GA 4QJ3B 3SG3A 1H4BA 1UHNA 1TNQA 1FI5A 2LANA 1Y0VH 5AEQA 1BLQA 3LLEA 1A75B 3OP0A 2G9BA 1QX5B 1DT7B 1KFXS 2HETA 1K2HA 3LCPC 1GJYA 1WDCC 1Q80A 4D1EA 3BOWB 1S1EA 1B8CA 1QATA 4WQ3A 2KYFA 1OE9B 1ZMZA 1MQ1A 1L7ZA 2JZIA 1J55A 2BKIB 3CWGA 1K9PA 2ZRSA 1NUBA 2LMUA 4Q04A 3D0YA 1FPWA 2K61A 3PLFB 1S6JA 3IQOA 5I8NA 5TNCA 2CCMA 2K8MB 3JTDC 2M0RA 3EK4A 2KAYA 3WNXB 4MRXA 4MZLA 3PFVA 4MLWA 1K9KA 3BUWB 4N1FA 5JOLA 2L4HA 3OB1B 4PE1A 2LP2A 1ZFSA 2KI4B 2M7NA 3BUOB 1FI6A 1KSMA 4NDDA 5I2LA 2ZN8A 1TCOB 1SL8A 3DF0B 2EGDA 2NLNA 1K90D 2LLSA 2L4IA 2G2BA 2I94A 2LV7A 2L51A 1PSRA 1RFJA 4P5OE 5KU1A 3MSEB 2JXLA 2M9GA 3SG7A 1DJGA 1CM1A 5PALA 2NCOA 1NCYA 2HF5A 3GK4X 1F70A 1OZSA 1QVIZ 1KQMB 2ISDA 2FCEA 3I5HB 1IGVA 1ALVA 5D69A 1A2XA 4U8DA 2LM5A 1JFKA 4XJKA 3DVMA 3SIAA 4I5LB 1SY9A 1OOJA 3AAKA 1E8AA 1MWNA 1XYDA 2M49B 4CFRA 1M63B 1PK0D 1ZUZA 1KK7Y 2M29A 3EK8A 1ZACA 2KFHA 2O5GA 3SG5A 1IQ3A 1B7TY 1UWOA 5HLVA 2HPSA 3EVVA 4TNCA 1PULA 2MAZA 3D10A 1BR4B 1UHKA 2LP3A 4GUKA 1SCMC 5GQQC 3VRRA 1PALA 1YX7A 1S6IA 1YUSA 1CDLA 5D7FA 2JNFA 1MHOA 2KI4C 3BYAA 3TDIA 1CLBA 3SG2A 1M45A 2B1UA 4DRWA 4FQOA 1JUOA 1SPYA 2KGRA 3I5GB 1JF2A 1Y1UA 1B8LA 1YRUB 4AQIA 1YUUA 1BOCA 2WC8A 1MR8A 1YTZC 2LE9B 4PCWA 2PRUA 3HCMA 1J7OA 5KSZA 2FOTA 1J7PA 3E3RA 1LVCD 2JWWA 2JPTA 1Y1XA 1XFXO 1OQPA 3M0WA 4N5XA 4PDZA 1DVIA 1KQMC 1BG1A 2M1UA 1GGZA 1TTXA 2Q4UA 3I5HC 1KFUL 2LAPA 3LK0A 3NXAA 1J7RA 1Y6WA 1N0YA 2LHIA 3SJSA 3WHTB 3O2PA 1K8UA 2BE4A 2PALA 3DVEA 3FWBA 1KSOA 2K0JA 4GAOA 5CSNA 2MBXA 4AQJA 4M2QA 1SYMA 2HQ8A 4ORCB 1DF0B 2JTTA 1RK9A 1YURA 2TN4A 5HKZA 3NSIA 2F33A 2WNDA 3GK1A 2KFGA 4C0KA 1AJ5A 4GGFA 3OX6A 4I5JA 1LA3A 4PE4A 3RM1A 1S5GY 2LVIA 4OCIA 4BY5A 1A4PA 2AMIA 4OVNF 1DGVA 2M97A 4MZKA 3SIBA 1WLMA 3O4YA 2JQ6A 2IS9A 1WRZA 1DTLA 1YR5A 2K2AA 2MA2A 4HRHA 4YI8A 2H2KA 1G4YR 2A4JA 1S36A 1JF0A 1B8RA 1QV0A 1NSHA 1RECA 1K95A 2NZ0A 3VROA 1TIZA 1WRKA 2KSPA 1R2UA 3KO0A 4YGCB 1KFXL 5G08A 2O60A 1K93D 1XFZO 3BQ3A 1QIVA 3I5FC 1TNWA 1CFPA 3BUXB 1IJ6A 1NPQA 1NX3A 5CSJA 4P2YB 5AFPA 1TN4A 2OTGB 4NQGA 2LCPA 2KQYA 1PVAA 4CIDA 1F55A 1KQVA 4YGDB 1YUTA 2QPTA 2LMTA 5HKYA 2WOSA 1EL4A 2OS8B 2ZKMX 4PHMA 2BCBA 2CNPA 2VRGA 4BY4A 3VGOA 1OMVA 3HX4A 1D1OA 1BMOA 1UUSA 3ICBA 3TUYB 1HQVA 1F54A 2FJUB 1DGUA 2SASA 2I7AA 1IQ5A 4GGNA 4NDCA 4DIRA 3TDUA 3NSLA 3H4SE 3TS5B 2JT3A 3WHUB 3CR4X 2EC6B 2JXCA 2ZFDA 1FF1A 1GGWA 4ORAB 4MVFA 1CFCA 2LVVA 2LC5A 1A03A 4IL1A 3EVUA 4A4CA 1DMOA 1UHIA 1C07A 1VRKA 4MRYA 2BCAA 2LMVA 2KBIA 4I5NB 5B8IB 4R1EA 1B1GA 5DKRA 1CTRA 3AAJA 4XYNA 1YX8A 1A75A 2HQWA 1B9AA 3EKHA 1SKTA 3O78A 2KI6C 1QXPA 2M3WA 5J3XA 2PASA 3BOWA 2R2IA 5F6TA 2OTGC 1SR6B 3BUNB 4M2OA 4M2PA 2L0PA 1LKJA 5KTYA 1LXFC 1PSBA 5ER4X 2KDHA 2MLFC 1IRJA 2NCPA 1DJZA 2GGZA 2MJWB 5IBWA 1XK4C 4JWQA 2L5XB 4PE7A 1GQMA 4USLA 2WCFA 2KYCA 3ZWHA 3JVTB 1SBJA 2KNEA 1H8BA 3EVRA 1RROA 3O6BA 5JJGA 2AAOA 4GPLB 1BF5A 1EG3A 3NSOA 1U5IB 4I5KA 3TS5C 4F0ZB 2LNKA 2PMYA 1X02A 2EC6C 3CTNA 3LK1A 3DF0A 1OZOA 1TCFA 1TNPA 1W7JB 2WCEA 2BL0B 5CSIA 2JULA 3KHEA 2KAVA 1QJTA 3AKBA 1AUIB 2LVKA 4OKHA 1QVIY 3CR5X 1JSAA 3FIAA 2JOJA 1MUXA 1ODBA 3GK2A 5HYDA 1XVJA 4E68A 2WORA 4MSPA 1EH2A 3OX5A 1CM4A 2COLB 4CLNA 1QLKA 1PRWA 1QASA 1G33A 3D0YB 1WDCB
chains in the Genus database with same CATH superfamily
1QS7A 2F3ZA 4QJ5B 1DJHA 2BKHB 4UPGA 1SSEB 1K94A 1CKKA 1MXEA 1F8HA 1YVLA 1ZOTB 3S0EA 1L2OB 2BCXA 1WRLA 2EHBA 2SCPA 2LUCA 4MBEA 3CS1A 3CZ1A 1C7VA 3K1EA 1KK8B 1YVHA 3I5GC 1QX7A 3IQQA 2K7OA 4GFTA 2WCKA 1S6CA 1RWYA 1SRAA 2M7LA 1XFUO 3C1VA 4JQ0D 1TNXA 2JNXA 4OZDA 4F7FA 3Q8IA 2GGMA 1SNLA 2K7DA 1C3ZA 5HLOA 5I2QA 3DD4A 3DVKA 3CR2A 2BBNA 1CLLA 1BODA 2L50A 2K2FA 2BL0C 2BBMA 3I5IB 5I2OA 5K89A 2QACA 2CT9A 1XFWO 2KI6D 1DJWA 2E30A 3CLNA 4N1GA 3VRNA 1CFFA 3CZ2A 2KAXA 1DJYA 2BNXA 2Q91A 1IIOA 2KPHA 1QV1A 4XJKB 3A8RA 1QX2A 2KHNA 3CDNA 1F71A 4ZCVA 1V1FA 3SS3A 1W9ZA 3IF7A 1DJXA 3F45A 1J1EA 1W7IB 1BJFA 5FI7A 1AK8A 2BE6A 2Y4QA 2QEVA 4MZJA 1JC2A 3L4LA 1TWOA 1KK7Z 4MN0A 2KOTA 3BFHA 1L2OC 1A29A 4HSZA 1QTXA 2F2PA 1S26D 1TOPA 1XFVO 2KBMA 2KFFA 1B7TZ 1DF0A 3QMEA 3SG6A 1QLSA 1CMGA 1K96A 4OV2A 4WQ2A 2F3YA 4PHKA 3SS5A 3CGAA 1KK8C 3ZNIA 2JT8A 3FWCA 2GTEA 2JRFA 2LHLA 2F2OA 3DVJA 3PM8A 2JTZA 2K7CA 4YGAA 3RLZA 4JPZB 1SCMB 1EG4A 1JBAA 5CSFA 5FI6A 4KYNA 2I18A 1NCZA 2H61C 1PVBA 2ZRTA 1K9UA 1N2DA 1UURA 1F4QA 1SCVA 2FCDA 4PHJA 1J1DA 3EK7A 4WRIA 1FBVA 4YI9A 3I5IC 2ZNEA 2Y1MA 3PN7B 4NDBA 4QJ4B 1G8IA 2CBLA 2WCJA 4C0LA 2L98A 1QIWA 2H61A 2QEOA 3A4UB 3TDZA 4DUQA 1B4CA 1SMGA 2PSRA 3QRXA 4YBHB 1KWOB 2CTNA 1MF8B 2V53A 3KEVA 5EL2A 4GBAA 1J7QA 1JWDA 5BPJA 5HKWA 3CZTX 4A4BA 4CFQA 1WLZA 3L47A 1F4OA 1B47A 1NP8A 1NWDA 2BECA 3PATA 1RJVA 1IWQA 3OB2B 2OS8C 2DOQA 4FTGA 3BXKA 3K21A 4ZCUA 3BFBA 1R6PA 3TUYC 2KQ6A 1SK6D 2MLEC 1XFYO 1YRTB 3R72A 4L9MA 4CPVA 1OMRA 1NX1A 4HREE 4MEWA 2JC2A 3OHMB 1NCXA 3PALA 3VRPA 1JFJA 3EKJA 3BFAA 1HT9A 1XA5A 3WXAA 1SL7A 1OOFA 3O4XA 1M46A 1LA0A 4DCKA 3R1OA 1CNPA 4YRUA 1XK4A 1BU3A 4IJ7A 2D8NA 1CFDA 1KCYA 3DY9A 2AUCA 1IKUA 4ORBB 4JD9A 1LINA 3D76A 1S5GZ 3GOFA 4GNKB 3S0DA 3TZ1A 4AOMA 3LL8B 1EJ3A 1UHJA 3NSKA 2LUXA 1SW8A 1BT6A 2WCMA 2OPOA 3CZ0A 1Z4HA 3KF9A 3N7HA 5FYXA 1CLMA 2LVJA 1CB1A 2Y1NA 2WCBA 3SG4A 2ZN9A 3FE8A 2MRDA 3PN7C 2F8PA 4HRGA 1CDNA 5DKNA 1OMDA 1AP4A 2P6BB 1IG5A 2K7BA 4DS7A 1OW4A 4C0JA 4PE0A 5ER5A 1KWOC 2M1KB 1KFUS 2I2RE 2ZNDA 1IH0A 2L2EA 1SR6C 2PVBA 2JU0A 1MXLC 5AXIA 1ALWA 3PSRA 5DKQA 2M8UA 2CXJA 1BR1B 2RGIA 1NYAA 3FS7A 2LLUA 1AHRA 4YGBB 1IJ5A 2KGBC 3I5FB 2PQLA 3DYEA 4ICBA 1TRFA 3B6XA 3VRQA 1FW4A 1CDMA 1NX2A 3JTDB 1SL9A 3KPXA 1M39A 3AKAA 3JVTC 1XO5A 1CDPA 2GV5A 1RTP1 1AJ4A 3NGVA 1CMFA 4GGFC 1DJIA 1WY9A 1C7WA 1S3PA 1UP5A 1NX0A 4PALA 2LLTA 1AVSA 1UHHA 3BUMB 1OOGA 2JT0A 1M31A 2E6WA 5CPVA 1Y1AA 1EXRA 2L5YA 4PHNA 1N65A 4OR9B 5AANA 4YGEB 2Y5IA 5HL1A 1NIWA 2NXQA 4ETOA 5AERA 1U5IA 1OSAA 2MHHA 1V1GA 2ERBA 4QJ3B 3SG3A 1H4BA 1UHNA 1TNQA 1FI5A 2LANA 1Y0VH 5AEQA 3VB1A 3LLEA 1A75B 1BLQA 3OP0A 2G9BA 1QX5B 1DT7B 1KFXS 2HETA 1K2HA 3LCPC 1GJYA 1WDCC 1Q80A 4D1EA 3BOWB 1S1EA 1B8CA 1QATA 4WQ3A 2KYFA 1OE9B 1ZMZA 1MQ1A 1L7ZA 2JZIA 1J55A 2BKIB 3CWGA 1K9PA 2ZRSA 1NUBA 3R1VA 2LMUA 4Q04A 3D0YA 1FPWA 2K61A 3PLFB 1S6JA 3IQOA 5I8NA 5TNCA 2CCMA 2K8MB 3JTDC 2M0RA 3B86A 3EK4A 2KAYA 3WNXB 4MRXA 4MZLA 3PFVA 4MLWA 1K9KA 3BUWB 4N1FA 5JOLA 2L4HA 3OB1B 4PE1A 2LP2A 1ZFSA 2KI4B 2M7NA 2WCHA 3BUOB 1FI6A 1KSMA 4NDDA 3PM2A 5I2LA 3B88A 2ZN8A 1TCOB 3D75A 1SL8A 3DF0B 2EGDA 2NLNA 1K90D 1OOHA 2LLSA 2L4IA 2G2BA 2I94A 2LV7A 2L51A 1PSRA 1RFJA 4P5OE 5KU1A 3MSEB 3S0FA 2JXLA 2M9GA 3SG7A 1DJGA 1CM1A 5PALA 2NCOA 1NCYA 2HF5A 2K60A 3GK4X 1F70A 1OZSA 1QVIZ 1KQMB 3S0GA 2ISDA 2FCEA 2KLDA 3I5HB 1IGVA 1ALVA 5D69A 1A2XA 1XFRA 1Z2CB 2LM5A 3D74A 4U8DA 1JFKA 3D73A 4XJKA 3BJHA 3DVMA 3SIAA 4I5LB 1SY9A 1OOJA 3AAKA 1E8AA 1MWNA 1XYDA 2M49B 4CFRA 1M63B 1PK0D 1ZUZA 1KK7Y 2M29A 3EK8A 1TUZA 1ZACA 2KFHA 2O5GA 3SG5A 1IQ3A 1B7TY 1UWOA 5HLVA 2HPSA 3EVVA 4TNCA 1PULA 2MAZA 3D10A 1BR4B 1UHKA 2LP3A 4GUKA 1SCMC 5GQQC 3D78A 1PALA 1YX7A 1S6IA 1YUSA 3VRRA 1CDLA 5D7FA 2JNFA 1MHOA 2KI4C 3BYAA 3TDIA 1CLBA 3SG2A 3S0AA 1M45A 2B1UA 3PJIA 4DRWA 4FQOA 1JUOA 1SPYA 2KGRA 3I5GB 1JF2A 1Y1UA 1B8LA 1YRUB 4AQIA 1YUUA 1BOCA 2WC8A 1MR8A 1YTZC 2LE9B 4PCWA 4INXA 1OOIX 2PRUA 3HCMA 1J7OA 5KSZA 2FOTA 1J7PA 3E3RA 1LVCD 2JWWA 2JPTA 1Y1XA 1XFXO 1OQPA 1C3YA 3M0WA 4N5XA 4PDZA 1DVIA 1KQMC 3EG5B 5FI2A 1BG1A 2M1UA 1GGZA 1TTXA 2Q4UA 3I5HC 1KFUL 2LAPA 3LK0A 3NXAA 2YGUA 1J7RA 1Y6WA 1N0YA 2LHIA 3SJSA 3WHTB 3O2PA 2L2CA 1K8UA 2BE4A 2PALA 3DVEA 3FWBA 1KSOA 2K0JA 4GAOA 4JKTA 5CSNA 2MBXA 4AQJA 4M2QA 1SYMA 2HQ8A 4ORCB 1DF0B 2KLEA 2JTTA 1RK9A 1YURA 2TN4A 2H8VA 5HKZA 3NSIA 2F33A 2WNDA 5DICA 3GK1A 2KFGA 4C0KA 1AJ5A 4GGFA 3OX6A 3OGNA 1LA3A 4I5JA 4PE4A 3RM1A 3CYZA 3FE6A 1S5GY 2LVIA 4OCIA 4BY5A 1A4PA 2AMIA 2QEBA 4OVNF 1DGVA 2FJYA 2M97A 4MZKA 3SIBA 3R1PA 1WLMA 3O4YA 2JQ6A 2IS9A 1WRZA 1DTLA 1YR5A 2K2AA 2MA2A 2P71A 3D77A 4HRHA 4YI8A 4INWA 2H2KA 3UO9A 1G4YR 2A4JA 1S36A 3DZTA 1JF0A 1B8RA 1QV0A 1NSHA 1RECA 1K95A 2NZ0A 3VROA 1TIZA 1WRKA 2KSPA 3S0BA 1R2UA 3KO0A 4YGCB 1KFXL 5G08A 2O60A 1K93D 1XFZO 2BAPA 3V2LA 3BQ3A 1QIVA 3I5FC 2WC5A 3SS4A 1TNWA 1CFPA 3BUXB 1IJ6A 1NPQA 1NX3A 5CSJA 4P2YB 3B87A 5AFPA 1TN4A 2OTGB 4NQGA 2LCPA 1DEKA 2KQYA 1PVAA 4CIDA 1F55A 1KQVA 4YGDB 1YUTA 2QEHA 2QPTA 2LMTA 1GM0A 5HKYA 2JPOA 1EL4A 2OS8B 2WOSA 2ZKMX 4PHMA 2BCBA 2CNPA 2VRGA 4BY4A 3VGOA 1OMVA 3HX4A 1D1OA 1BMOA 1UUSA 3ICBA 3TUYB 1HQVA 1F54A 2FJUB 1DGUA 2SASA 1DELA 2PYQA 2I7AA 1IQ5A 4GGNA 3IVTA 4NDCA 4DIRA 4FQTA 3TDUA 3NSLA 3H4SE 3TS5B 2JT3A 3WHUB 3CR4X 2EC6B 2JXCA 2ZFDA 1FF1A 1GGWA 4ORAB 4MVFA 1CFCA 2LVVA 2LC5A 1A03A 4IL1A 3EVUA 4A4CA 1DMOA 1UHIA 3OBVA 1VRKA 4MRYA 1C07A 2BCAA 3B7AA 2LMVA 2KBIA 4I5NB 5B8IB 4R1EA 1B1GA 5DKRA 1CTRA 3AAJA 4XYNA 1YX8A 1A75A 2HQWA 1QWVA 1B9AA 3EKHA 1P28A 1SKTA 3O78A 2KI6C 2P70A 1LS8A 1QXPA 2M3WA 5J3XA 2PASA 3RZSA 3BOWA 2R2IA 3FE9A 5F6TA 2OTGC 1SR6B 3BUNB 4M2OA 4M2PA 3NHTA 2L0PA 1LKJA 5KTYA 1LXFC 1PSBA 5ER4X 2KDHA 2MLFC 1IRJA 2NCPA 1DJZA 1TUJA 2GGZA 2MJWB 5IBWA 1XK4C 5I94A 4JWQA 2L5XB 4PE7A 1GQMA 4USLA 2WCFA 2KYCA 3ZWHA 3JVTB 1SBJA 2KNEA 3UNWA 1H8BA 3EVRA 1RROA 1DC1A 3O6BA 4PT1A 5JJGA 2AAOA 4GPLB 1BF5A 1EG3A 3NSOA 1U5IB 4I5KA 3TS5C 4F0ZB 2LNKA 2PMYA 1X02A 2EC6C 3CTNA 3LK1A 3DF0A 1OZOA 1TCFA 1TNPA 1W7JB 2QDIA 2WCEA 2BL0B 2WCLA 3NHIA 5CSIA 2JULA 3KHEA 2KAVA 1QJTA 3AKBA 1AUIB 1DQEA 2LVKA 4OKHA 1QVIY 3L4AA 3CR5X 1JSAA 3FIAA 2JOJA 1MUXA 1ODBA 3GK2A 5HYDA 1XVJA 4E68A 2WORA 1T14A 4MSPA 5D3OA 2WC6A 1EH2A 3OX5A 1CM4A 2COLB 4CLNA 1QLKA 1PRWA 1QASA 1G33A 3D0YB 3DXLA 1WDCB 1ORGA 3CABA
chains in the Genus database with same CATH topology
1QS7A 2F3ZA 4QJ5B 1DJHA 2BKHB 4UPGA 1CKKA 1K94A 1F8HA 1MXEA 1YVLA 1ZOTB 1L2OB 2BCXA 1WRLA 2EHBA 2SCPA 2LUCA 4MBEA 3CS1A 1C7VA 1KK8B 1YVHA 3I5GC 1QX7A 3IQQA 2K7OA 4GFTA 1S6CA 1RWYA 1SRAA 2M7LA 1XFUO 3C1VA 4JQ0D 1TNXA 2JNXA 5I2QA 2GGMA 1SNLA 2K7DA 5HLOA 3DD4A 3DVKA 3CR2A 2BBNA 1CLLA 1BODA 2L50A 2K2FA 2BL0C 2BBMA 3I5IB 5I2OA 5K89A 2QACA 2CT9A 1XFWO 2KI6D 1DJWA 2E30A 3CLNA 4N1GA 3VRNA 1CFFA 2KAXA 1DJYA 2Q91A 1QV1A 4XJKB 3A8RA 1QX2A 2KHNA 1F71A 4ZCVA 1V1FA 3IF7A 1DJXA 3F45A 1J1EA 1W7IB 1BJFA 1AK8A 2BE6A 2Y4QA 4MZJA 1JC2A 1KK7Z 4MN0A 2KOTA 1L2OC 1A29A 4HSZA 1QTXA 2F2PA 1S26D 1TOPA 1XFVO 2KBMA 2KFFA 1B7TZ 1DF0A 3SG6A 1QLSA 1CMGA 1K96A 4OV2A 4WQ2A 2F3YA 4PHKA 3CGAA 1KK8C 3ZNIA 2JT8A 3FWCA 2JRFA 2LHLA 2F2OA 3DVJA 3PM8A 2JTZA 2K7CA 4YGAA 3RLZA 4JPZB 1SCMB 1EG4A 1JBAA 5CSFA 2I18A 1NCZA 2H61C 1PVBA 2ZRTA 1K9UA 1N2DA 1UURA 1F4QA 1SCVA 2FCDA 4PHJA 1J1DA 3EK7A 4WRIA 1FBVA 4YI9A 3I5IC 2ZNEA 2Y1MA 3PN7B 4NDBA 4QJ4B 1G8IA 2CBLA 4C0LA 2L98A 1QIWA 2H61A 3A4UB 3TDZA 4DUQA 1B4CA 1SMGA 2PSRA 3QRXA 4YBHB 1KWOB 2CTNA 1MF8B 2V53A 3KEVA 4GBAA 1J7QA 1JWDA 5BPJA 5HKWA 3CZTX 4A4BA 4CFQA 1WLZA 1F4OA 1B47A 1NP8A 1NWDA 2BECA 3PATA 1RJVA 1IWQA 3OB2B 2OS8C 2DOQA 4FTGA 3BXKA 3K21A 4ZCUA 1R6PA 3TUYC 2KQ6A 1SK6D 2MLEC 1XFYO 1YRTB 4CPVA 4L9MA 1OMRA 1NX1A 4HREE 4MEWA 2JC2A 3OHMB 1NCXA 3PALA 3VRPA 1JFJA 3EKJA 1HT9A 1XA5A 3WXAA 1SL7A 1M46A 1LA0A 4DCKA 1CNPA 4YRUA 1XK4A 1BU3A 2D8NA 1CFDA 1KCYA 1IKUA 2AUCA 4ORBB 1LINA 1S5GZ 3GOFA 4GNKB 3TZ1A 4AOMA 3LL8B 1EJ3A 1UHJA 3NSKA 2LUXA 1SW8A 1BT6A 2OPOA 3KF9A 5FYXA 1CLMA 2LVJA 1CB1A 2Y1NA 2WCBA 3SG4A 2ZN9A 2MRDA 3PN7C 2F8PA 4HRGA 1CDNA 5DKNA 1OMDA 1AP4A 2P6BB 1IG5A 2K7BA 4DS7A 4C0JA 4PE0A 5ER5A 1KWOC 2M1KB 1KFUS 2I2RE 2ZNDA 1IH0A 2L2EA 1SR6C 2PVBA 2JU0A 1MXLC 5AXIA 1ALWA 3PSRA 5DKQA 2M8UA 2CXJA 1BR1B 2RGIA 1NYAA 3FS7A 2LLUA 1AHRA 4YGBB 1IJ5A 2KGBC 3I5FB 4ICBA 1TRFA 3VRQA 1FW4A 1CDMA 1NX2A 3JTDB 1SL9A 3KPXA 1M39A 3AKAA 3JVTC 1XO5A 1CDPA 2GV5A 1RTP1 1AJ4A 1CMFA 4GGFC 1DJIA 1WY9A 1C7WA 1S3PA 1UP5A 1NX0A 4PALA 2LLTA 1AVSA 1UHHA 3BUMB 2JT0A 1M31A 2E6WA 5CPVA 1Y1AA 1EXRA 4PHNA 1N65A 4OR9B 5AANA 4YGEB 2Y5IA 1NIWA 2NXQA 4ETOA 5AERA 1U5IA 1OSAA 2MHHA 1V1GA 4QJ3B 3SG3A 1H4BA 1UHNA 1TNQA 1FI5A 2LANA 1Y0VH 5AEQA 1BLQA 3LLEA 1A75B 3OP0A 2G9BA 1QX5B 1DT7B 1KFXS 2HETA 1K2HA 3LCPC 1GJYA 1WDCC 1Q80A 4D1EA 3BOWB 1S1EA 1B8CA 1QATA 4WQ3A 2KYFA 1OE9B 1ZMZA 1MQ1A 1L7ZA 2JZIA 1J55A 2BKIB 3CWGA 1K9PA 2ZRSA 1NUBA 2LMUA 4Q04A 3D0YA 1FPWA 2K61A 3PLFB 1S6JA 3IQOA 5I8NA 5TNCA 2CCMA 2K8MB 3JTDC 2M0RA 3EK4A 2KAYA 3WNXB 4MRXA 4MZLA 3PFVA 4MLWA 1K9KA 3BUWB 4N1FA 5JOLA 2L4HA 3OB1B 4PE1A 2LP2A 1ZFSA 2KI4B 2M7NA 3BUOB 1FI6A 1KSMA 4NDDA 5I2LA 2ZN8A 1TCOB 1SL8A 3DF0B 2EGDA 2NLNA 1K90D 2LLSA 2L4IA 2G2BA 2I94A 2LV7A 2L51A 1PSRA 1RFJA 4P5OE 5KU1A 3MSEB 2JXLA 2M9GA 3SG7A 1DJGA 1CM1A 5PALA 2NCOA 1NCYA 2HF5A 3GK4X 1F70A 1OZSA 1QVIZ 1KQMB 2ISDA 2FCEA 3I5HB 1IGVA 1ALVA 5D69A 1A2XA 4U8DA 2LM5A 1JFKA 4XJKA 3DVMA 3SIAA 4I5LB 1SY9A 1OOJA 3AAKA 1E8AA 1MWNA 1XYDA 2M49B 4CFRA 1M63B 1PK0D 1ZUZA 1KK7Y 2M29A 3EK8A 1ZACA 2KFHA 2O5GA 3SG5A 1IQ3A 1B7TY 1UWOA 5HLVA 2HPSA 3EVVA 4TNCA 1PULA 2MAZA 3D10A 1BR4B 1UHKA 2LP3A 4GUKA 1SCMC 5GQQC 3VRRA 1PALA 1YX7A 1S6IA 1YUSA 1CDLA 5D7FA 2JNFA 1MHOA 2KI4C 3BYAA 3TDIA 1CLBA 3SG2A 1M45A 2B1UA 4DRWA 4FQOA 1JUOA 1SPYA 2KGRA 3I5GB 1JF2A 1Y1UA 1B8LA 1YRUB 4AQIA 1YUUA 1BOCA 2WC8A 1MR8A 1YTZC 2LE9B 4PCWA 2PRUA 3HCMA 1J7OA 5KSZA 2FOTA 1J7PA 3E3RA 1LVCD 2JWWA 2JPTA 1Y1XA 1XFXO 1OQPA 3M0WA 4N5XA 4PDZA 1DVIA 1KQMC 1BG1A 2M1UA 1GGZA 1TTXA 2Q4UA 3I5HC 1KFUL 2LAPA 3LK0A 3NXAA 1J7RA 1Y6WA 1N0YA 2LHIA 3SJSA 3WHTB 3O2PA 1K8UA 2BE4A 2PALA 3DVEA 3FWBA 1KSOA 2K0JA 4GAOA 5CSNA 2MBXA 4AQJA 4M2QA 1SYMA 2HQ8A 4ORCB 1DF0B 2JTTA 1RK9A 1YURA 2TN4A 5HKZA 3NSIA 2F33A 2WNDA 3GK1A 2KFGA 4C0KA 1AJ5A 4GGFA 3OX6A 4I5JA 1LA3A 4PE4A 3RM1A 1S5GY 2LVIA 4OCIA 4BY5A 1A4PA 2AMIA 4OVNF 1DGVA 2M97A 4MZKA 3SIBA 1WLMA 3O4YA 2JQ6A 2IS9A 1WRZA 1DTLA 1YR5A 2K2AA 2MA2A 4HRHA 4YI8A 2H2KA 1G4YR 2A4JA 1S36A 1JF0A 1B8RA 1QV0A 1NSHA 1RECA 1K95A 2NZ0A 3VROA 1TIZA 1WRKA 2KSPA 1R2UA 3KO0A 4YGCB 1KFXL 5G08A 2O60A 1K93D 1XFZO 3BQ3A 1QIVA 3I5FC 1TNWA 1CFPA 3BUXB 1IJ6A 1NPQA 1NX3A 5CSJA 4P2YB 5AFPA 1TN4A 2OTGB 4NQGA 2LCPA 2KQYA 1PVAA 4CIDA 1F55A 1KQVA 4YGDB 1YUTA 2QPTA 2LMTA 5HKYA 2WOSA 1EL4A 2OS8B 2ZKMX 4PHMA 2BCBA 2CNPA 2VRGA 4BY4A 3VGOA 1OMVA 3HX4A 1D1OA 1BMOA 1UUSA 3ICBA 3TUYB 1HQVA 1F54A 2FJUB 1DGUA 2SASA 2I7AA 1IQ5A 4GGNA 4NDCA 4DIRA 3TDUA 3NSLA 3H4SE 3TS5B 2JT3A 3WHUB 3CR4X 2EC6B 2JXCA 2ZFDA 1FF1A 1GGWA 4ORAB 4MVFA 1CFCA 2LVVA 2LC5A 1A03A 4IL1A 3EVUA 4A4CA 1DMOA 1UHIA 1C07A 1VRKA 4MRYA 2BCAA 2LMVA 2KBIA 4I5NB 5B8IB 4R1EA 1B1GA 5DKRA 1CTRA 3AAJA 4XYNA 1YX8A 1A75A 2HQWA 1B9AA 3EKHA 1SKTA 3O78A 2KI6C 1QXPA 2M3WA 5J3XA 2PASA 3BOWA 2R2IA 5F6TA 2OTGC 1SR6B 3BUNB 4M2OA 4M2PA 2L0PA 1LKJA 5KTYA 1LXFC 1PSBA 5ER4X 2KDHA 2MLFC 1IRJA 2NCPA 1DJZA 2GGZA 2MJWB 5IBWA 1XK4C 4JWQA 2L5XB 4PE7A 1GQMA 4USLA 2WCFA 2KYCA 3ZWHA 3JVTB 1SBJA 2KNEA 1H8BA 3EVRA 1RROA 3O6BA 5JJGA 2AAOA 4GPLB 1BF5A 1EG3A 3NSOA 1U5IB 4I5KA 3TS5C 4F0ZB 2LNKA 2PMYA 1X02A 2EC6C 3CTNA 3LK1A 3DF0A 1OZOA 1TCFA 1TNPA 1W7JB 2WCEA 2BL0B 5CSIA 2JULA 3KHEA 2KAVA 1QJTA 3AKBA 1AUIB 2LVKA 4OKHA 1QVIY 3CR5X 1JSAA 3FIAA 2JOJA 1MUXA 1ODBA 3GK2A 5HYDA 1XVJA 4E68A 2WORA 4MSPA 1EH2A 3OX5A 1CM4A 2COLB 4CLNA 1QLKA 1PRWA 1QASA 1G33A 3D0YB 1WDCB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QS7 A;  2F3Z A;  4QJ5 B;  1DJH A;  2BKH B;  4UPG A;  1CKK A;  1K94 A;  1F8H A;  1MXE A;  1YVL A;  1ZOT B;  1L2O B;  2BCX A;  1WRL A;  2EHB A;  2SCP A;  2LUC A;  4MBE A;  3CS1 A;  1C7V A;  1KK8 B;  1YVH A;  3I5G C;  1QX7 A;  3IQQ A;  2K7O A;  4GFT A;  1S6C A;  1RWY A;  1SRA A;  2M7L A;  1XFU O;  3C1V A;  4JQ0 D;  1TNX A;  2JNX A;  5I2Q A;  2GGM A;  1SNL A;  2K7D A;  5HLO A;  3DD4 A;  3DVK A;  3CR2 A;  2BBN A;  1CLL A;  1BOD A;  2L50 A;  2K2F A;  2BL0 C;  2BBM A;  3I5I B;  5I2O A;  5K89 A;  2QAC A;  2CT9 A;  1XFW O;  2KI6 D;  1DJW A;  2E30 A;  3CLN A;  4N1G A;  3VRN A;  1CFF A;  2KAX A;  1DJY A;  2Q91 A;  1QV1 A;  4XJK B;  3A8R A;  1QX2 A;  2KHN A;  1F71 A;  4ZCV A;  1V1F A;  3IF7 A;  1DJX A;  3F45 A;  1J1E A;  1W7I B;  1BJF A;  1AK8 A;  2BE6 A;  2Y4Q A;  4MZJ A;  1JC2 A;  1KK7 Z;  4MN0 A;  2KOT A;  1L2O C;  1A29 A;  4HSZ A;  1QTX A;  2F2P A;  1S26 D;  1TOP A;  1XFV O;  2KBM A;  2KFF A;  1B7T Z;  1DF0 A;  3SG6 A;  1QLS A;  1CMG A;  1K96 A;  4OV2 A;  4WQ2 A;  2F3Y A;  4PHK A;  3CGA A;  1KK8 C;  3ZNI A;  2JT8 A;  3FWC A;  2JRF A;  2LHL A;  2F2O A;  3DVJ A;  3PM8 A;  2JTZ A;  2K7C A;  4YGA A;  3RLZ A;  4JPZ B;  1SCM B;  1EG4 A;  1JBA A;  5CSF A;  2I18 A;  1NCZ A;  2H61 C;  1PVB A;  2ZRT A;  1K9U A;  1N2D A;  1UUR A;  1F4Q A;  1SCV A;  2FCD A;  4PHJ A;  1J1D A;  3EK7 A;  4WRI A;  1FBV A;  4YI9 A;  3I5I C;  2ZNE A;  2Y1M A;  3PN7 B;  4NDB A;  4QJ4 B;  1G8I A;  2CBL A;  4C0L A;  2L98 A;  1QIW A;  2H61 A;  3A4U B;  3TDZ A;  4DUQ A;  1B4C A;  1SMG A;  2PSR A;  3QRX A;  4YBH B;  1KWO B;  2CTN A;  1MF8 B;  2V53 A;  3KEV A;  4GBA A;  1J7Q A;  1JWD A;  5BPJ A;  5HKW A;  3CZT X;  4A4B A;  4CFQ A;  1WLZ A;  1F4O A;  1B47 A;  1NP8 A;  1NWD A;  2BEC A;  3PAT A;  1RJV A;  1IWQ A;  3OB2 B;  2OS8 C;  2DOQ A;  4FTG A;  3BXK A;  3K21 A;  4ZCU A;  1R6P A;  3TUY C;  2KQ6 A;  1SK6 D;  2MLE C;  1XFY O;  1YRT B;  4CPV A;  4L9M A;  1OMR A;  1NX1 A;  4HRE E;  4MEW A;  2JC2 A;  3OHM B;  1NCX A;  3PAL A;  3VRP A;  1JFJ A;  3EKJ A;  1HT9 A;  1XA5 A;  3WXA A;  1SL7 A;  1M46 A;  1LA0 A;  4DCK A;  1CNP A;  4YRU A;  1XK4 A;  1BU3 A;  2D8N A;  1CFD A;  1KCY A;  1IKU A;  2AUC A;  4ORB B;  1LIN A;  1S5G Z;  3GOF A;  4GNK B;  3TZ1 A;  4AOM A;  3LL8 B;  1EJ3 A;  1UHJ A;  3NSK A;  2LUX A;  1SW8 A;  1BT6 A;  2OPO A;  3KF9 A;  5FYX A;  1CLM A;  2LVJ A;  1CB1 A;  2Y1N A;  2WCB A;  3SG4 A;  2ZN9 A;  2MRD A;  3PN7 C;  2F8P A;  4HRG A;  1CDN A;  5DKN A;  1OMD A;  1AP4 A;  2P6B B;  1IG5 A;  2K7B A;  4DS7 A;  4C0J A;  4PE0 A;  5ER5 A;  1KWO C;  2M1K B;  1KFU S;  2I2R E;  2ZND A;  1IH0 A;  2L2E A;  1SR6 C;  2PVB A;  2JU0 A;  1MXL C;  5AXI A;  1ALW A;  3PSR A;  5DKQ A;  2M8U A;  2CXJ A;  1BR1 B;  2RGI A;  1NYA A;  3FS7 A;  2LLU A;  1AHR A;  4YGB B;  1IJ5 A;  2KGB C;  3I5F B;  4ICB A;  1TRF A;  3VRQ A;  1FW4 A;  1CDM A;  1NX2 A;  3JTD B;  1SL9 A;  3KPX A;  1M39 A;  3AKA A;  3JVT C;  1XO5 A;  1CDP A;  2GV5 A;  1RTP 1;  1AJ4 A;  1CMF A;  4GGF C;  1DJI A;  1WY9 A;  1C7W A;  1S3P A;  1UP5 A;  1NX0 A;  4PAL A;  2LLT A;  1AVS A;  1UHH A;  3BUM B;  2JT0 A;  1M31 A;  2E6W A;  5CPV A;  1Y1A A;  1EXR A;  4PHN A;  1N65 A;  4OR9 B;  5AAN A;  4YGE B;  2Y5I A;  1NIW A;  2NXQ A;  4ETO A;  5AER A;  1U5I A;  1OSA A;  2MHH A;  1V1G A;  4QJ3 B;  3SG3 A;  1H4B A;  1UHN A;  1TNQ A;  1FI5 A;  2LAN A;  1Y0V H;  5AEQ A;  1BLQ A;  3LLE A;  1A75 B;  3OP0 A;  2G9B A;  1QX5 B;  1DT7 B;  1KFX S;  2HET A;  1K2H A;  3LCP C;  1GJY A;  1WDC C;  1Q80 A;  4D1E A;  3BOW B;  1S1E A;  1B8C A;  1QAT A;  4WQ3 A;  2KYF A;  1OE9 B;  1ZMZ A;  1MQ1 A;  1L7Z A;  2JZI A;  1J55 A;  2BKI B;  3CWG A;  1K9P A;  2ZRS A;  1NUB A;  2LMU A;  4Q04 A;  3D0Y A;  1FPW A;  2K61 A;  3PLF B;  1S6J A;  3IQO A;  5I8N A;  5TNC A;  2CCM A;  2K8M B;  3JTD C;  2M0R A;  3EK4 A;  2KAY A;  3WNX B;  4MRX A;  4MZL A;  3PFV A;  4MLW A;  1K9K A;  3BUW B;  4N1F A;  5JOL A;  2L4H A;  3OB1 B;  4PE1 A;  2LP2 A;  1ZFS A;  2KI4 B;  2M7N A;  3BUO B;  1FI6 A;  1KSM A;  4NDD A;  5I2L A;  2ZN8 A;  1TCO B;  1SL8 A;  3DF0 B;  2EGD A;  2NLN A;  1K90 D;  2LLS A;  2L4I A;  2G2B A;  2I94 A;  2LV7 A;  2L51 A;  1PSR A;  1RFJ A;  4P5O E;  5KU1 A;  3MSE B;  2JXL A;  2M9G A;  3SG7 A;  1DJG A;  1CM1 A;  5PAL A;  2NCO A;  1NCY A;  2HF5 A;  3GK4 X;  1F70 A;  1OZS A;  1QVI Z;  1KQM B;  2ISD A;  2FCE A;  3I5H B;  1IGV A;  1ALV A;  5D69 A;  1A2X A;  4U8D A;  2LM5 A;  1JFK A;  4XJK A;  3DVM A;  3SIA A;  4I5L B;  1SY9 A;  1OOJ A;  3AAK A;  1E8A A;  1MWN A;  1XYD A;  2M49 B;  4CFR A;  1M63 B;  1PK0 D;  1ZUZ A;  1KK7 Y;  2M29 A;  3EK8 A;  1ZAC A;  2KFH A;  2O5G A;  3SG5 A;  1IQ3 A;  1B7T Y;  1UWO A;  5HLV A;  2HPS A;  3EVV A;  4TNC A;  1PUL A;  2MAZ A;  3D10 A;  1BR4 B;  1UHK A;  2LP3 A;  4GUK A;  1SCM C;  5GQQ C;  3VRR A;  1PAL A;  1YX7 A;  1S6I A;  1YUS A;  1CDL A;  5D7F A;  2JNF A;  1MHO A;  2KI4 C;  3BYA A;  3TDI A;  1CLB A;  3SG2 A;  1M45 A;  2B1U A;  4DRW A;  4FQO A;  1JUO A;  1SPY A;  2KGR A;  3I5G B;  1JF2 A;  1Y1U A;  1B8L A;  1YRU B;  4AQI A;  1YUU A;  1BOC A;  2WC8 A;  1MR8 A;  1YTZ C;  2LE9 B;  4PCW A;  2PRU A;  3HCM A;  1J7O A;  5KSZ A;  2FOT A;  1J7P A;  3E3R A;  1LVC D;  2JWW A;  2JPT A;  1Y1X A;  1XFX O;  1OQP A;  3M0W A;  4N5X A;  4PDZ A;  1DVI A;  1KQM C;  1BG1 A;  2M1U A;  1GGZ A;  1TTX A;  2Q4U A;  3I5H C;  1KFU L;  2LAP A;  3LK0 A;  3NXA A;  1J7R A;  1Y6W A;  1N0Y A;  2LHI A;  3SJS A;  3WHT B;  3O2P A;  1K8U A;  2BE4 A;  2PAL A;  3DVE A;  3FWB A;  1KSO A;  2K0J A;  4GAO A;  5CSN A;  2MBX A;  4AQJ A;  4M2Q A;  1SYM A;  2HQ8 A;  4ORC B;  1DF0 B;  2JTT A;  1RK9 A;  1YUR A;  2TN4 A;  5HKZ A;  3NSI A;  2F33 A;  2WND A;  3GK1 A;  2KFG A;  4C0K A;  1AJ5 A;  4GGF A;  3OX6 A;  4I5J A;  1LA3 A;  4PE4 A;  3RM1 A;  1S5G Y;  2LVI A;  4OCI A;  4BY5 A;  1A4P A;  2AMI A;  4OVN F;  1DGV A;  2M97 A;  4MZK A;  3SIB A;  1WLM A;  3O4Y A;  2JQ6 A;  2IS9 A;  1WRZ A;  1DTL A;  1YR5 A;  2K2A A;  2MA2 A;  4HRH A;  4YI8 A;  2H2K A;  1G4Y R;  2A4J A;  1S36 A;  1JF0 A;  1B8R A;  1QV0 A;  1NSH A;  1REC A;  1K95 A;  2NZ0 A;  3VRO A;  1TIZ A;  1WRK A;  2KSP A;  1R2U A;  3KO0 A;  4YGC B;  1KFX L;  5G08 A;  2O60 A;  1K93 D;  1XFZ O;  3BQ3 A;  1QIV A;  3I5F C;  1TNW A;  1CFP A;  3BUX B;  1IJ6 A;  1NPQ A;  1NX3 A;  5CSJ A;  4P2Y B;  5AFP A;  1TN4 A;  2OTG B;  4NQG A;  2LCP A;  2KQY A;  1PVA A;  4CID A;  1F55 A;  1KQV A;  4YGD B;  1YUT A;  2QPT A;  2LMT A;  5HKY A;  2WOS A;  1EL4 A;  2OS8 B;  2ZKM X;  4PHM A;  2BCB A;  2CNP A;  2VRG A;  4BY4 A;  3VGO A;  1OMV A;  3HX4 A;  1D1O A;  1BMO A;  1UUS A;  3ICB A;  3TUY B;  1HQV A;  1F54 A;  2FJU B;  1DGU A;  2SAS A;  2I7A A;  1IQ5 A;  4GGN A;  4NDC A;  4DIR A;  3TDU A;  3NSL A;  3H4S E;  3TS5 B;  2JT3 A;  3WHU B;  3CR4 X;  2EC6 B;  2JXC A;  2ZFD A;  1FF1 A;  1GGW A;  4ORA B;  4MVF A;  1CFC A;  2LVV A;  2LC5 A;  1A03 A;  4IL1 A;  3EVU A;  4A4C A;  1DMO A;  1UHI A;  1C07 A;  1VRK A;  4MRY A;  2BCA A;  2LMV A;  2KBI A;  4I5N B;  5B8I B;  4R1E A;  1B1G A;  5DKR A;  1CTR A;  3AAJ A;  4XYN A;  1YX8 A;  1A75 A;  2HQW A;  1B9A A;  3EKH A;  1SKT A;  3O78 A;  2KI6 C;  1QXP A;  2M3W A;  5J3X A;  2PAS A;  3BOW A;  2R2I A;  5F6T A;  2OTG C;  1SR6 B;  3BUN B;  4M2O A;  4M2P A;  2L0P A;  1LKJ A;  5KTY A;  1LXF C;  1PSB A;  5ER4 X;  2KDH A;  2MLF C;  1IRJ A;  2NCP A;  1DJZ A;  2GGZ A;  2MJW B;  5IBW A;  1XK4 C;  4JWQ A;  2L5X B;  4PE7 A;  1GQM A;  4USL A;  2WCF A;  2KYC A;  3ZWH A;  3JVT B;  1SBJ A;  2KNE A;  1H8B A;  3EVR A;  1RRO A;  3O6B A;  5JJG A;  2AAO A;  4GPL B;  1BF5 A;  1EG3 A;  3NSO A;  1U5I B;  4I5K A;  3TS5 C;  4F0Z B;  2LNK A;  2PMY A;  1X02 A;  2EC6 C;  3CTN A;  3LK1 A;  3DF0 A;  1OZO A;  1TCF A;  1TNP A;  1W7J B;  2WCE A;  2BL0 B;  5CSI A;  2JUL A;  3KHE A;  2KAV A;  1QJT A;  3AKB A;  1AUI B;  2LVK A;  4OKH A;  1QVI Y;  3CR5 X;  1JSA A;  3FIA A;  2JOJ A;  1MUX A;  1ODB A;  3GK2 A;  5HYD A;  1XVJ A;  4E68 A;  2WOR A;  4MSP A;  1EH2 A;  3OX5 A;  1CM4 A;  2COL B;  4CLN A;  1QLK A;  1PRW A;  1QAS A;  1G33 A;  3D0Y B;  1WDC B; 
#chains in the Genus database with same CATH topology
 1QS7 A;  2F3Z A;  4QJ5 B;  1DJH A;  2BKH B;  4UPG A;  1SSE B;  1K94 A;  1CKK A;  1MXE A;  1F8H A;  1YVL A;  1ZOT B;  3S0E A;  1L2O B;  2BCX A;  1WRL A;  2EHB A;  2SCP A;  2LUC A;  4MBE A;  3CS1 A;  3CZ1 A;  1C7V A;  3K1E A;  1KK8 B;  1YVH A;  3I5G C;  1QX7 A;  3IQQ A;  2K7O A;  4GFT A;  2WCK A;  1S6C A;  1RWY A;  1SRA A;  2M7L A;  1XFU O;  3C1V A;  4JQ0 D;  1TNX A;  2JNX A;  4OZD A;  4F7F A;  3Q8I A;  2GGM A;  1SNL A;  2K7D A;  1C3Z A;  5HLO A;  5I2Q A;  3DD4 A;  3DVK A;  3CR2 A;  2BBN A;  1CLL A;  1BOD A;  2L50 A;  2K2F A;  2BL0 C;  2BBM A;  3I5I B;  5I2O A;  5K89 A;  2QAC A;  2CT9 A;  1XFW O;  2KI6 D;  1DJW A;  2E30 A;  3CLN A;  4N1G A;  3VRN A;  1CFF A;  3CZ2 A;  2KAX A;  1DJY A;  2BNX A;  2Q91 A;  1IIO A;  2KPH A;  1QV1 A;  4XJK B;  3A8R A;  1QX2 A;  2KHN A;  3CDN A;  1F71 A;  4ZCV A;  1V1F A;  3SS3 A;  1W9Z A;  3IF7 A;  1DJX A;  3F45 A;  1J1E A;  1W7I B;  1BJF A;  5FI7 A;  1AK8 A;  2BE6 A;  2Y4Q A;  2QEV A;  4MZJ A;  1JC2 A;  3L4L A;  1TWO A;  1KK7 Z;  4MN0 A;  2KOT A;  3BFH A;  1L2O C;  1A29 A;  4HSZ A;  1QTX A;  2F2P A;  1S26 D;  1TOP A;  1XFV O;  2KBM A;  2KFF A;  1B7T Z;  1DF0 A;  3QME A;  3SG6 A;  1QLS A;  1CMG A;  1K96 A;  4OV2 A;  4WQ2 A;  2F3Y A;  4PHK A;  3SS5 A;  3CGA A;  1KK8 C;  3ZNI A;  2JT8 A;  3FWC A;  2GTE A;  2JRF A;  2LHL A;  2F2O A;  3DVJ A;  3PM8 A;  2JTZ A;  2K7C A;  4YGA A;  3RLZ A;  4JPZ B;  1SCM B;  1EG4 A;  1JBA A;  5CSF A;  5FI6 A;  4KYN A;  2I18 A;  1NCZ A;  2H61 C;  1PVB A;  2ZRT A;  1K9U A;  1N2D A;  1UUR A;  1F4Q A;  1SCV A;  2FCD A;  4PHJ A;  1J1D A;  3EK7 A;  4WRI A;  1FBV A;  4YI9 A;  3I5I C;  2ZNE A;  2Y1M A;  3PN7 B;  4NDB A;  4QJ4 B;  1G8I A;  2CBL A;  2WCJ A;  4C0L A;  2L98 A;  1QIW A;  2H61 A;  2QEO A;  3A4U B;  3TDZ A;  4DUQ A;  1B4C A;  1SMG A;  2PSR A;  3QRX A;  4YBH B;  1KWO B;  2CTN A;  1MF8 B;  2V53 A;  3KEV A;  5EL2 A;  4GBA A;  1J7Q A;  1JWD A;  5BPJ A;  5HKW A;  3CZT X;  4A4B A;  4CFQ A;  1WLZ A;  3L47 A;  1F4O A;  1B47 A;  1NP8 A;  1NWD A;  2BEC A;  3PAT A;  1RJV A;  1IWQ A;  3OB2 B;  2OS8 C;  2DOQ A;  4FTG A;  3BXK A;  3K21 A;  4ZCU A;  3BFB A;  1R6P A;  3TUY C;  2KQ6 A;  1SK6 D;  2MLE C;  1XFY O;  1YRT B;  3R72 A;  4L9M A;  4CPV A;  1OMR A;  1NX1 A;  4HRE E;  4MEW A;  2JC2 A;  3OHM B;  1NCX A;  3PAL A;  3VRP A;  1JFJ A;  3EKJ A;  3BFA A;  1HT9 A;  1XA5 A;  3WXA A;  1SL7 A;  1OOF A;  3O4X A;  1M46 A;  1LA0 A;  4DCK A;  3R1O A;  1CNP A;  4YRU A;  1XK4 A;  1BU3 A;  4IJ7 A;  2D8N A;  1CFD A;  1KCY A;  3DY9 A;  2AUC A;  1IKU A;  4ORB B;  4JD9 A;  1LIN A;  3D76 A;  1S5G Z;  3GOF A;  4GNK B;  3S0D A;  3TZ1 A;  4AOM A;  3LL8 B;  1EJ3 A;  1UHJ A;  3NSK A;  2LUX A;  1SW8 A;  1BT6 A;  2WCM A;  2OPO A;  3CZ0 A;  1Z4H A;  3KF9 A;  3N7H A;  5FYX A;  1CLM A;  2LVJ A;  1CB1 A;  2Y1N A;  2WCB A;  3SG4 A;  2ZN9 A;  3FE8 A;  2MRD A;  3PN7 C;  2F8P A;  4HRG A;  1CDN A;  5DKN A;  1OMD A;  1AP4 A;  2P6B B;  1IG5 A;  2K7B A;  4DS7 A;  1OW4 A;  4C0J A;  4PE0 A;  5ER5 A;  1KWO C;  2M1K B;  1KFU S;  2I2R E;  2ZND A;  1IH0 A;  2L2E A;  1SR6 C;  2PVB A;  2JU0 A;  1MXL C;  5AXI A;  1ALW A;  3PSR A;  5DKQ A;  2M8U A;  2CXJ A;  1BR1 B;  2RGI A;  1NYA A;  3FS7 A;  2LLU A;  1AHR A;  4YGB B;  1IJ5 A;  2KGB C;  3I5F B;  2PQL A;  3DYE A;  4ICB A;  1TRF A;  3B6X A;  3VRQ A;  1FW4 A;  1CDM A;  1NX2 A;  3JTD B;  1SL9 A;  3KPX A;  1M39 A;  3AKA A;  3JVT C;  1XO5 A;  1CDP A;  2GV5 A;  1RTP 1;  1AJ4 A;  3NGV A;  1CMF A;  4GGF C;  1DJI A;  1WY9 A;  1C7W A;  1S3P A;  1UP5 A;  1NX0 A;  4PAL A;  2LLT A;  1AVS A;  1UHH A;  3BUM B;  1OOG A;  2JT0 A;  1M31 A;  2E6W A;  5CPV A;  1Y1A A;  1EXR A;  2L5Y A;  4PHN A;  1N65 A;  4OR9 B;  5AAN A;  4YGE B;  2Y5I A;  5HL1 A;  1NIW A;  2NXQ A;  4ETO A;  5AER A;  1U5I A;  1OSA A;  2MHH A;  1V1G A;  2ERB A;  4QJ3 B;  3SG3 A;  1H4B A;  1UHN A;  1TNQ A;  1FI5 A;  2LAN A;  1Y0V H;  5AEQ A;  3VB1 A;  3LLE A;  1A75 B;  1BLQ A;  3OP0 A;  2G9B A;  1QX5 B;  1DT7 B;  1KFX S;  2HET A;  1K2H A;  3LCP C;  1GJY A;  1WDC C;  1Q80 A;  4D1E A;  3BOW B;  1S1E A;  1B8C A;  1QAT A;  4WQ3 A;  2KYF A;  1OE9 B;  1ZMZ A;  1MQ1 A;  1L7Z A;  2JZI A;  1J55 A;  2BKI B;  3CWG A;  1K9P A;  2ZRS A;  1NUB A;  3R1V A;  2LMU A;  4Q04 A;  3D0Y A;  1FPW A;  2K61 A;  3PLF B;  1S6J A;  3IQO A;  5I8N A;  5TNC A;  2CCM A;  2K8M B;  3JTD C;  2M0R A;  3B86 A;  3EK4 A;  2KAY A;  3WNX B;  4MRX A;  4MZL A;  3PFV A;  4MLW A;  1K9K A;  3BUW B;  4N1F A;  5JOL A;  2L4H A;  3OB1 B;  4PE1 A;  2LP2 A;  1ZFS A;  2KI4 B;  2M7N A;  2WCH A;  3BUO B;  1FI6 A;  1KSM A;  4NDD A;  3PM2 A;  5I2L A;  3B88 A;  2ZN8 A;  1TCO B;  3D75 A;  1SL8 A;  3DF0 B;  2EGD A;  2NLN A;  1K90 D;  1OOH A;  2LLS A;  2L4I A;  2G2B A;  2I94 A;  2LV7 A;  2L51 A;  1PSR A;  1RFJ A;  4P5O E;  5KU1 A;  3MSE B;  3S0F A;  2JXL A;  2M9G A;  3SG7 A;  1DJG A;  1CM1 A;  5PAL A;  2NCO A;  1NCY A;  2HF5 A;  2K60 A;  3GK4 X;  1F70 A;  1OZS A;  1QVI Z;  1KQM B;  3S0G A;  2ISD A;  2FCE A;  2KLD A;  3I5H B;  1IGV A;  1ALV A;  5D69 A;  1A2X A;  1XFR A;  1Z2C B;  2LM5 A;  3D74 A;  4U8D A;  1JFK A;  3D73 A;  4XJK A;  3BJH A;  3DVM A;  3SIA A;  4I5L B;  1SY9 A;  1OOJ A;  3AAK A;  1E8A A;  1MWN A;  1XYD A;  2M49 B;  4CFR A;  1M63 B;  1PK0 D;  1ZUZ A;  1KK7 Y;  2M29 A;  3EK8 A;  1TUZ A;  1ZAC A;  2KFH A;  2O5G A;  3SG5 A;  1IQ3 A;  1B7T Y;  1UWO A;  5HLV A;  2HPS A;  3EVV A;  4TNC A;  1PUL A;  2MAZ A;  3D10 A;  1BR4 B;  1UHK A;  2LP3 A;  4GUK A;  1SCM C;  5GQQ C;  3D78 A;  1PAL A;  1YX7 A;  1S6I A;  1YUS A;  3VRR A;  1CDL A;  5D7F A;  2JNF A;  1MHO A;  2KI4 C;  3BYA A;  3TDI A;  1CLB A;  3SG2 A;  3S0A A;  1M45 A;  2B1U A;  3PJI A;  4DRW A;  4FQO A;  1JUO A;  1SPY A;  2KGR A;  3I5G B;  1JF2 A;  1Y1U A;  1B8L A;  1YRU B;  4AQI A;  1YUU A;  1BOC A;  2WC8 A;  1MR8 A;  1YTZ C;  2LE9 B;  4PCW A;  4INX A;  1OOI X;  2PRU A;  3HCM A;  1J7O A;  5KSZ A;  2FOT A;  1J7P A;  3E3R A;  1LVC D;  2JWW A;  2JPT A;  1Y1X A;  1XFX O;  1OQP A;  1C3Y A;  3M0W A;  4N5X A;  4PDZ A;  1DVI A;  1KQM C;  3EG5 B;  5FI2 A;  1BG1 A;  2M1U A;  1GGZ A;  1TTX A;  2Q4U A;  3I5H C;  1KFU L;  2LAP A;  3LK0 A;  3NXA A;  2YGU A;  1J7R A;  1Y6W A;  1N0Y A;  2LHI A;  3SJS A;  3WHT B;  3O2P A;  2L2C A;  1K8U A;  2BE4 A;  2PAL A;  3DVE A;  3FWB A;  1KSO A;  2K0J A;  4GAO A;  4JKT A;  5CSN A;  2MBX A;  4AQJ A;  4M2Q A;  1SYM A;  2HQ8 A;  4ORC B;  1DF0 B;  2KLE A;  2JTT A;  1RK9 A;  1YUR A;  2TN4 A;  2H8V A;  5HKZ A;  3NSI A;  2F33 A;  2WND A;  5DIC A;  3GK1 A;  2KFG A;  4C0K A;  1AJ5 A;  4GGF A;  3OX6 A;  3OGN A;  1LA3 A;  4I5J A;  4PE4 A;  3RM1 A;  3CYZ A;  3FE6 A;  1S5G Y;  2LVI A;  4OCI A;  4BY5 A;  1A4P A;  2AMI A;  2QEB A;  4OVN F;  1DGV A;  2FJY A;  2M97 A;  4MZK A;  3SIB A;  3R1P A;  1WLM A;  3O4Y A;  2JQ6 A;  2IS9 A;  1WRZ A;  1DTL A;  1YR5 A;  2K2A A;  2MA2 A;  2P71 A;  3D77 A;  4HRH A;  4YI8 A;  4INW A;  2H2K A;  3UO9 A;  1G4Y R;  2A4J A;  1S36 A;  3DZT A;  1JF0 A;  1B8R A;  1QV0 A;  1NSH A;  1REC A;  1K95 A;  2NZ0 A;  3VRO A;  1TIZ A;  1WRK A;  2KSP A;  3S0B A;  1R2U A;  3KO0 A;  4YGC B;  1KFX L;  5G08 A;  2O60 A;  1K93 D;  1XFZ O;  2BAP A;  3V2L A;  3BQ3 A;  1QIV A;  3I5F C;  2WC5 A;  3SS4 A;  1TNW A;  1CFP A;  3BUX B;  1IJ6 A;  1NPQ A;  1NX3 A;  5CSJ A;  4P2Y B;  3B87 A;  5AFP A;  1TN4 A;  2OTG B;  4NQG A;  2LCP A;  1DEK A;  2KQY A;  1PVA A;  4CID A;  1F55 A;  1KQV A;  4YGD B;  1YUT A;  2QEH A;  2QPT A;  2LMT A;  1GM0 A;  5HKY A;  2JPO A;  1EL4 A;  2OS8 B;  2WOS A;  2ZKM X;  4PHM A;  2BCB A;  2CNP A;  2VRG A;  4BY4 A;  3VGO A;  1OMV A;  3HX4 A;  1D1O A;  1BMO A;  1UUS A;  3ICB A;  3TUY B;  1HQV A;  1F54 A;  2FJU B;  1DGU A;  2SAS A;  1DEL A;  2PYQ A;  2I7A A;  1IQ5 A;  4GGN A;  3IVT A;  4NDC A;  4DIR A;  4FQT A;  3TDU A;  3NSL A;  3H4S E;  3TS5 B;  2JT3 A;  3WHU B;  3CR4 X;  2EC6 B;  2JXC A;  2ZFD A;  1FF1 A;  1GGW A;  4ORA B;  4MVF A;  1CFC A;  2LVV A;  2LC5 A;  1A03 A;  4IL1 A;  3EVU A;  4A4C A;  1DMO A;  1UHI A;  3OBV A;  1VRK A;  4MRY A;  1C07 A;  2BCA A;  3B7A A;  2LMV A;  2KBI A;  4I5N B;  5B8I B;  4R1E A;  1B1G A;  5DKR A;  1CTR A;  3AAJ A;  4XYN A;  1YX8 A;  1A75 A;  2HQW A;  1QWV A;  1B9A A;  3EKH A;  1P28 A;  1SKT A;  3O78 A;  2KI6 C;  2P70 A;  1LS8 A;  1QXP A;  2M3W A;  5J3X A;  2PAS A;  3RZS A;  3BOW A;  2R2I A;  3FE9 A;  5F6T A;  2OTG C;  1SR6 B;  3BUN B;  4M2O A;  4M2P A;  3NHT A;  2L0P A;  1LKJ A;  5KTY A;  1LXF C;  1PSB A;  5ER4 X;  2KDH A;  2MLF C;  1IRJ A;  2NCP A;  1DJZ A;  1TUJ A;  2GGZ A;  2MJW B;  5IBW A;  1XK4 C;  5I94 A;  4JWQ A;  2L5X B;  4PE7 A;  1GQM A;  4USL A;  2WCF A;  2KYC A;  3ZWH A;  3JVT B;  1SBJ A;  2KNE A;  3UNW A;  1H8B A;  3EVR A;  1RRO A;  1DC1 A;  3O6B A;  4PT1 A;  5JJG A;  2AAO A;  4GPL B;  1BF5 A;  1EG3 A;  3NSO A;  1U5I B;  4I5K A;  3TS5 C;  4F0Z B;  2LNK A;  2PMY A;  1X02 A;  2EC6 C;  3CTN A;  3LK1 A;  3DF0 A;  1OZO A;  1TCF A;  1TNP A;  1W7J B;  2QDI A;  2WCE A;  2BL0 B;  2WCL A;  3NHI A;  5CSI A;  2JUL A;  3KHE A;  2KAV A;  1QJT A;  3AKB A;  1AUI B;  1DQE A;  2LVK A;  4OKH A;  1QVI Y;  3L4A A;  3CR5 X;  1JSA A;  3FIA A;  2JOJ A;  1MUX A;  1ODB A;  3GK2 A;  5HYD A;  1XVJ A;  4E68 A;  2WOR A;  1T14 A;  4MSP A;  5D3O A;  2WC6 A;  1EH2 A;  3OX5 A;  1CM4 A;  2COL B;  4CLN A;  1QLK A;  1PRW A;  1QAS A;  1G33 A;  3D0Y B;  3DXL A;  1WDC B;  1ORG A;  3CAB A; 
#chains in the Genus database with same CATH homology
 1QS7 A;  2F3Z A;  4QJ5 B;  1DJH A;  2BKH B;  4UPG A;  1CKK A;  1K94 A;  1F8H A;  1MXE A;  1YVL A;  1ZOT B;  1L2O B;  2BCX A;  1WRL A;  2EHB A;  2SCP A;  2LUC A;  4MBE A;  3CS1 A;  1C7V A;  1KK8 B;  1YVH A;  3I5G C;  1QX7 A;  3IQQ A;  2K7O A;  4GFT A;  1S6C A;  1RWY A;  1SRA A;  2M7L A;  1XFU O;  3C1V A;  4JQ0 D;  1TNX A;  2JNX A;  5I2Q A;  2GGM A;  1SNL A;  2K7D A;  5HLO A;  3DD4 A;  3DVK A;  3CR2 A;  2BBN A;  1CLL A;  1BOD A;  2L50 A;  2K2F A;  2BL0 C;  2BBM A;  3I5I B;  5I2O A;  5K89 A;  2QAC A;  2CT9 A;  1XFW O;  2KI6 D;  1DJW A;  2E30 A;  3CLN A;  4N1G A;  3VRN A;  1CFF A;  2KAX A;  1DJY A;  2Q91 A;  1QV1 A;  4XJK B;  3A8R A;  1QX2 A;  2KHN A;  1F71 A;  4ZCV A;  1V1F A;  3IF7 A;  1DJX A;  3F45 A;  1J1E A;  1W7I B;  1BJF A;  1AK8 A;  2BE6 A;  2Y4Q A;  4MZJ A;  1JC2 A;  1KK7 Z;  4MN0 A;  2KOT A;  1L2O C;  1A29 A;  4HSZ A;  1QTX A;  2F2P A;  1S26 D;  1TOP A;  1XFV O;  2KBM A;  2KFF A;  1B7T Z;  1DF0 A;  3SG6 A;  1QLS A;  1CMG A;  1K96 A;  4OV2 A;  4WQ2 A;  2F3Y A;  4PHK A;  3CGA A;  1KK8 C;  3ZNI A;  2JT8 A;  3FWC A;  2JRF A;  2LHL A;  2F2O A;  3DVJ A;  3PM8 A;  2JTZ A;  2K7C A;  4YGA A;  3RLZ A;  4JPZ B;  1SCM B;  1EG4 A;  1JBA A;  5CSF A;  2I18 A;  1NCZ A;  2H61 C;  1PVB A;  2ZRT A;  1K9U A;  1N2D A;  1UUR A;  1F4Q A;  1SCV A;  2FCD A;  4PHJ A;  1J1D A;  3EK7 A;  4WRI A;  1FBV A;  4YI9 A;  3I5I C;  2ZNE A;  2Y1M A;  3PN7 B;  4NDB A;  4QJ4 B;  1G8I A;  2CBL A;  4C0L A;  2L98 A;  1QIW A;  2H61 A;  3A4U B;  3TDZ A;  4DUQ A;  1B4C A;  1SMG A;  2PSR A;  3QRX A;  4YBH B;  1KWO B;  2CTN A;  1MF8 B;  2V53 A;  3KEV A;  4GBA A;  1J7Q A;  1JWD A;  5BPJ A;  5HKW A;  3CZT X;  4A4B A;  4CFQ A;  1WLZ A;  1F4O A;  1B47 A;  1NP8 A;  1NWD A;  2BEC A;  3PAT A;  1RJV A;  1IWQ A;  3OB2 B;  2OS8 C;  2DOQ A;  4FTG A;  3BXK A;  3K21 A;  4ZCU A;  1R6P A;  3TUY C;  2KQ6 A;  1SK6 D;  2MLE C;  1XFY O;  1YRT B;  4CPV A;  4L9M A;  1OMR A;  1NX1 A;  4HRE E;  4MEW A;  2JC2 A;  3OHM B;  1NCX A;  3PAL A;  3VRP A;  1JFJ A;  3EKJ A;  1HT9 A;  1XA5 A;  3WXA A;  1SL7 A;  1M46 A;  1LA0 A;  4DCK A;  1CNP A;  4YRU A;  1XK4 A;  1BU3 A;  2D8N A;  1CFD A;  1KCY A;  1IKU A;  2AUC A;  4ORB B;  1LIN A;  1S5G Z;  3GOF A;  4GNK B;  3TZ1 A;  4AOM A;  3LL8 B;  1EJ3 A;  1UHJ A;  3NSK A;  2LUX A;  1SW8 A;  1BT6 A;  2OPO A;  3KF9 A;  5FYX A;  1CLM A;  2LVJ A;  1CB1 A;  2Y1N A;  2WCB A;  3SG4 A;  2ZN9 A;  2MRD A;  3PN7 C;  2F8P A;  4HRG A;  1CDN A;  5DKN A;  1OMD A;  1AP4 A;  2P6B B;  1IG5 A;  2K7B A;  4DS7 A;  4C0J A;  4PE0 A;  5ER5 A;  1KWO C;  2M1K B;  1KFU S;  2I2R E;  2ZND A;  1IH0 A;  2L2E A;  1SR6 C;  2PVB A;  2JU0 A;  1MXL C;  5AXI A;  1ALW A;  3PSR A;  5DKQ A;  2M8U A;  2CXJ A;  1BR1 B;  2RGI A;  1NYA A;  3FS7 A;  2LLU A;  1AHR A;  4YGB B;  1IJ5 A;  2KGB C;  3I5F B;  4ICB A;  1TRF A;  3VRQ A;  1FW4 A;  1CDM A;  1NX2 A;  3JTD B;  1SL9 A;  3KPX A;  1M39 A;  3AKA A;  3JVT C;  1XO5 A;  1CDP A;  2GV5 A;  1RTP 1;  1AJ4 A;  1CMF A;  4GGF C;  1DJI A;  1WY9 A;  1C7W A;  1S3P A;  1UP5 A;  1NX0 A;  4PAL A;  2LLT A;  1AVS A;  1UHH A;  3BUM B;  2JT0 A;  1M31 A;  2E6W A;  5CPV A;  1Y1A A;  1EXR A;  4PHN A;  1N65 A;  4OR9 B;  5AAN A;  4YGE B;  2Y5I A;  1NIW A;  2NXQ A;  4ETO A;  5AER A;  1U5I A;  1OSA A;  2MHH A;  1V1G A;  4QJ3 B;  3SG3 A;  1H4B A;  1UHN A;  1TNQ A;  1FI5 A;  2LAN A;  1Y0V H;  5AEQ A;  1BLQ A;  3LLE A;  1A75 B;  3OP0 A;  2G9B A;  1QX5 B;  1DT7 B;  1KFX S;  2HET A;  1K2H A;  3LCP C;  1GJY A;  1WDC C;  1Q80 A;  4D1E A;  3BOW B;  1S1E A;  1B8C A;  1QAT A;  4WQ3 A;  2KYF A;  1OE9 B;  1ZMZ A;  1MQ1 A;  1L7Z A;  2JZI A;  1J55 A;  2BKI B;  3CWG A;  1K9P A;  2ZRS A;  1NUB A;  2LMU A;  4Q04 A;  3D0Y A;  1FPW A;  2K61 A;  3PLF B;  1S6J A;  3IQO A;  5I8N A;  5TNC A;  2CCM A;  2K8M B;  3JTD C;  2M0R A;  3EK4 A;  2KAY A;  3WNX B;  4MRX A;  4MZL A;  3PFV A;  4MLW A;  1K9K A;  3BUW B;  4N1F A;  5JOL A;  2L4H A;  3OB1 B;  4PE1 A;  2LP2 A;  1ZFS A;  2KI4 B;  2M7N A;  3BUO B;  1FI6 A;  1KSM A;  4NDD A;  5I2L A;  2ZN8 A;  1TCO B;  1SL8 A;  3DF0 B;  2EGD A;  2NLN A;  1K90 D;  2LLS A;  2L4I A;  2G2B A;  2I94 A;  2LV7 A;  2L51 A;  1PSR A;  1RFJ A;  4P5O E;  5KU1 A;  3MSE B;  2JXL A;  2M9G A;  3SG7 A;  1DJG A;  1CM1 A;  5PAL A;  2NCO A;  1NCY A;  2HF5 A;  3GK4 X;  1F70 A;  1OZS A;  1QVI Z;  1KQM B;  2ISD A;  2FCE A;  3I5H B;  1IGV A;  1ALV A;  5D69 A;  1A2X A;  4U8D A;  2LM5 A;  1JFK A;  4XJK A;  3DVM A;  3SIA A;  4I5L B;  1SY9 A;  1OOJ A;  3AAK A;  1E8A A;  1MWN A;  1XYD A;  2M49 B;  4CFR A;  1M63 B;  1PK0 D;  1ZUZ A;  1KK7 Y;  2M29 A;  3EK8 A;  1ZAC A;  2KFH A;  2O5G A;  3SG5 A;  1IQ3 A;  1B7T Y;  1UWO A;  5HLV A;  2HPS A;  3EVV A;  4TNC A;  1PUL A;  2MAZ A;  3D10 A;  1BR4 B;  1UHK A;  2LP3 A;  4GUK A;  1SCM C;  5GQQ C;  3VRR A;  1PAL A;  1YX7 A;  1S6I A;  1YUS A;  1CDL A;  5D7F A;  2JNF A;  1MHO A;  2KI4 C;  3BYA A;  3TDI A;  1CLB A;  3SG2 A;  1M45 A;  2B1U A;  4DRW A;  4FQO A;  1JUO A;  1SPY A;  2KGR A;  3I5G B;  1JF2 A;  1Y1U A;  1B8L A;  1YRU B;  4AQI A;  1YUU A;  1BOC A;  2WC8 A;  1MR8 A;  1YTZ C;  2LE9 B;  4PCW A;  2PRU A;  3HCM A;  1J7O A;  5KSZ A;  2FOT A;  1J7P A;  3E3R A;  1LVC D;  2JWW A;  2JPT A;  1Y1X A;  1XFX O;  1OQP A;  3M0W A;  4N5X A;  4PDZ A;  1DVI A;  1KQM C;  1BG1 A;  2M1U A;  1GGZ A;  1TTX A;  2Q4U A;  3I5H C;  1KFU L;  2LAP A;  3LK0 A;  3NXA A;  1J7R A;  1Y6W A;  1N0Y A;  2LHI A;  3SJS A;  3WHT B;  3O2P A;  1K8U A;  2BE4 A;  2PAL A;  3DVE A;  3FWB A;  1KSO A;  2K0J A;  4GAO A;  5CSN A;  2MBX A;  4AQJ A;  4M2Q A;  1SYM A;  2HQ8 A;  4ORC B;  1DF0 B;  2JTT A;  1RK9 A;  1YUR A;  2TN4 A;  5HKZ A;  3NSI A;  2F33 A;  2WND A;  3GK1 A;  2KFG A;  4C0K A;  1AJ5 A;  4GGF A;  3OX6 A;  4I5J A;  1LA3 A;  4PE4 A;  3RM1 A;  1S5G Y;  2LVI A;  4OCI A;  4BY5 A;  1A4P A;  2AMI A;  4OVN F;  1DGV A;  2M97 A;  4MZK A;  3SIB A;  1WLM A;  3O4Y A;  2JQ6 A;  2IS9 A;  1WRZ A;  1DTL A;  1YR5 A;  2K2A A;  2MA2 A;  4HRH A;  4YI8 A;  2H2K A;  1G4Y R;  2A4J A;  1S36 A;  1JF0 A;  1B8R A;  1QV0 A;  1NSH A;  1REC A;  1K95 A;  2NZ0 A;  3VRO A;  1TIZ A;  1WRK A;  2KSP A;  1R2U A;  3KO0 A;  4YGC B;  1KFX L;  5G08 A;  2O60 A;  1K93 D;  1XFZ O;  3BQ3 A;  1QIV A;  3I5F C;  1TNW A;  1CFP A;  3BUX B;  1IJ6 A;  1NPQ A;  1NX3 A;  5CSJ A;  4P2Y B;  5AFP A;  1TN4 A;  2OTG B;  4NQG A;  2LCP A;  2KQY A;  1PVA A;  4CID A;  1F55 A;  1KQV A;  4YGD B;  1YUT A;  2QPT A;  2LMT A;  5HKY A;  2WOS A;  1EL4 A;  2OS8 B;  2ZKM X;  4PHM A;  2BCB A;  2CNP A;  2VRG A;  4BY4 A;  3VGO A;  1OMV A;  3HX4 A;  1D1O A;  1BMO A;  1UUS A;  3ICB A;  3TUY B;  1HQV A;  1F54 A;  2FJU B;  1DGU A;  2SAS A;  2I7A A;  1IQ5 A;  4GGN A;  4NDC A;  4DIR A;  3TDU A;  3NSL A;  3H4S E;  3TS5 B;  2JT3 A;  3WHU B;  3CR4 X;  2EC6 B;  2JXC A;  2ZFD A;  1FF1 A;  1GGW A;  4ORA B;  4MVF A;  1CFC A;  2LVV A;  2LC5 A;  1A03 A;  4IL1 A;  3EVU A;  4A4C A;  1DMO A;  1UHI A;  1C07 A;  1VRK A;  4MRY A;  2BCA A;  2LMV A;  2KBI A;  4I5N B;  5B8I B;  4R1E A;  1B1G A;  5DKR A;  1CTR A;  3AAJ A;  4XYN A;  1YX8 A;  1A75 A;  2HQW A;  1B9A A;  3EKH A;  1SKT A;  3O78 A;  2KI6 C;  1QXP A;  2M3W A;  5J3X A;  2PAS A;  3BOW A;  2R2I A;  5F6T A;  2OTG C;  1SR6 B;  3BUN B;  4M2O A;  4M2P A;  2L0P A;  1LKJ A;  5KTY A;  1LXF C;  1PSB A;  5ER4 X;  2KDH A;  2MLF C;  1IRJ A;  2NCP A;  1DJZ A;  2GGZ A;  2MJW B;  5IBW A;  1XK4 C;  4JWQ A;  2L5X B;  4PE7 A;  1GQM A;  4USL A;  2WCF A;  2KYC A;  3ZWH A;  3JVT B;  1SBJ A;  2KNE A;  1H8B A;  3EVR A;  1RRO A;  3O6B A;  5JJG A;  2AAO A;  4GPL B;  1BF5 A;  1EG3 A;  3NSO A;  1U5I B;  4I5K A;  3TS5 C;  4F0Z B;  2LNK A;  2PMY A;  1X02 A;  2EC6 C;  3CTN A;  3LK1 A;  3DF0 A;  1OZO A;  1TCF A;  1TNP A;  1W7J B;  2WCE A;  2BL0 B;  5CSI A;  2JUL A;  3KHE A;  2KAV A;  1QJT A;  3AKB A;  1AUI B;  2LVK A;  4OKH A;  1QVI Y;  3CR5 X;  1JSA A;  3FIA A;  2JOJ A;  1MUX A;  1ODB A;  3GK2 A;  5HYD A;  1XVJ A;  4E68 A;  2WOR A;  4MSP A;  1EH2 A;  3OX5 A;  1CM4 A;  2COL B;  4CLN A;  1QLK A;  1PRW A;  1QAS A;  1G33 A;  3D0Y B;  1WDC B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...