2PALA

Ionic interactions with parvalbumins. crystal structure determination of pike 4.10 parvalbumin in four different ionic environments
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
107
structure length
107
Chain Sequence
SFAGLKDADVAAALAACSAADSFKHKEFFAKVGLASKSLDDVKKAFYVIDQDKSGFIEEDELKLFLQNFSPSARALTDAETKAFLADGDKDGDGMIGVDEFAAMIKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PARVALBUMIN
publication title Ionic interactions with parvalbumins. Crystal structure determination of pike 4.10 parvalbumin in four different ionic environments.
pubmed doi rcsb
source organism Esox lucius
molecule tags Calcium binding protein
total genus 39
structure length 107
sequence length 107
ec nomenclature
pdb deposition date 1990-11-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2palA00
1XO5A 5GQQC 1ZACA 1WLMA 1TNQA 1QLKA 2BCXA 2K8MB 2O60A 4D1EA 5CPVA 2NXQA 1WDCB 4GGFC 2FCDA 2QPTA 4NDDA 4GGFA 4HRHA 1QATA 4IL1A 1KSOA 3PFVA 4PHJA 3C1VA 1B1GA 4MBEA 4MVFA 4NDBA 1SPYA 5JJGA 1CDPA 1NCXA 1CLLA 1L2OB 2E6WA 4PALA 1SMGA 3AAKA 3D0YA 2MA2A 2F33A 2BL0C 3GK1A 1PALA 2R2IA 5AFPA 1V1FA 4CFRA 1M45A 1FW4A 1NX0A 2WOSA 4JWQA 1YX7A 1K93D 1E8AA 3LL8B 1CFFA 1NP8A 1QVIY 1CKKA 1DGUA 2KAXA 3CZTX 2EC6B 1B7TZ 1ZFSA 3LK0A 5DKNA 2K61A 3SJSA 1YUTA 3D10A 2PSRA 4OCIA 2O5GA 1FF1A 1OE9B 1ZOTB 3TZ1A 4MN0A 2K0JA 2M7LA 2LANA 5CSFA 3WHUB 3I5FC 3SG4A 3TUYB 4I5KA 4MRYA 3VRPA 4AOMA 3TS5C 2KBIA 1TNXA 2GGZA 1SR6B 1XFXO 1CDMA 4BY4A 1B4CA 2WCEA 2LHLA 1CM4A 2F2PA 2LLUA 4FQOA 1AJ4A 2VRGA 1CFPA 5CSIA 2L50A 1S5GY 1DJHA 2OS8B 1BR4B 3AKBA 3CS1A 4MLWA 4YI8A 1UHNA 2HQWA 3BXKA 1SL8A 3SG7A 2Q4UA 2K2AA 5I2QA 1BODA 4ZCVA 1SRAA 4HSZA 2KFHA 5CSJA 1MF8B 1OOJA 3EK8A 1NIWA 1ODBA 1UHJA 3I5IC 1AUIB 2KSPA 1G33A 1KSMA 4PHNA 4ORCB 4ZCUA 3VRNA 1KFUL 3NSLA 2JZIA 1UWOA 5KU1A 2CTNA 4DS7A 1UHIA 5I8NA 5KSZA 5HLOA 1QTXA 2PVBA 1OQPA 2MBXA 4XYNA 1L2OC 1OSAA 1KFXS 1CDNA 1KK7Z 1SKTA 1OMDA 3FWBA 3JVTC 1R6PA 2KBMA 2WCFA 2LHIA 3KF9A 2JWWA 1LINA 1YRUB 2H2KA 3OB2B 3WXAA 5HLVA 1YRTB 3E3RA 2L51A 5FYXA 2BCBA 3GK4X 1BJFA 2CCMA 2OPOA 4YGBB 1KK8B 2M49B 1CMGA 3ZNIA 3CWGA 1X02A 2KI4C 4N1FA 3TUYC 1NYAA 3WNXB 4OKHA 1QX5B 2CBLA 1F4QA 2OTGC 3HX4A 3I5FB 2EGDA 1DJYA 4FTGA 1S1EA 1SL9A 3IQQA 2KFGA 1S3PA 1OZOA 1KWOB 1CFDA 1S6JA 1QX7A 1SW8A 1QXPA 5I2OA 2KNEA 1ALVA 4YI9A 2MLEC 5HKWA 1W7IB 1LA0A 1TIZA 4C0LA 1F70A 2GV5A 1B8CA 1UHHA 4MZLA 3LCPC 2K7OA 1CLMA 1IGVA 1K9PA 1JUOA 4P2YB 3I5IB 4DIRA 1QLSA 1F55A 1A4PA 3DVKA 3TDZA 1TOPA 4A4CA 3M0WA 1NX3A 1BU3A 1QV1A 2JT3A 1AHRA 5AEQA 1A03A 2LUXA 2MAZA 1B9AA 1K9KA 3I5GC 3OB1B 1LVCD 1Q80A 2ZRSA 4YGEB 1K96A 4QJ5B 5HKYA 4WQ3A 1S6CA 2JT8A 1AJ5A 3JVTB 2ISDA 1DMOA 1RJVA 1FPWA 1YVHA 2I18A 3GK2A 4M2QA 4N5XA 5CSNA 1Y0VH 1V1GA 2KYCA 1HQVA 1K90D 2M8UA 3IQOA 4MZJA 4WRIA 2L2EA 2P6BB 1PSRA 2NLNA 2K7DA 3DVJA 3NXAA 1RK9A 3BUWB 5AANA 3DF0B 4CLNA 1KK8C 3PM8A 3OX6A 2AUCA 1CMFA 1IH0A 4MEWA 1MWNA 4GPLB 1J1EA 3F45A 4GAOA 4ICBA 1B7TY 1BOCA 5F6TA 1JBAA 1DTLA 2LAPA 2LVVA 3FWCA 4A4BA 1KCYA 2BBMA 3PLFB 2JULA 2KI4B 2JTZA 2AAOA 4JQ0D 1QX2A 1KQVA 1IWQA 2ZFDA 1NWDA 1WY9A 4GUKA 3AKAA 1UUSA 2OTGB 1F54A 1KWOC 1EH2A 1S36A 1NPQA 2TN4A 1IKUA 1QIWA 2JQ6A 1IQ5A 3CR2A 2WNDA 2CT9A 2M3WA 1J7OA 2PALA 1CFCA 4QJ4B 1FI5A 3KHEA 2A4JA 3H4SE 4L9MA 2G2BA 1CLBA 4UPGA 4XJKA 1TTXA 4MSPA 1L7ZA 1CB1A 2KQ6A 1OMVA 1Y6WA 1PULA 3KPXA 1LA3A 1PVBA 2SCPA 2BKHB 2ZRTA 5IBWA 1YVLA 2KGBC 3ZWHA 1F71A 2BCAA 2JXLA 2I7AA 2KAYA 2KHNA 3DD4A 3O6BA 1DT7B 3VRRA 1WLZA 2Y1NA 1AVSA 1KFUS 2BKIB 3BUNB 2MRDA 5AXIA 1A2XA 1N0YA 1TN4A 2LC5A 3QRXA 1J1DA 1MXEA 2WORA 2BBNA 1TCOB 3I5GB 2WCBA 4ETOA 1XK4C 4GGNA 3PATA 2H61C 1BLQA 2E30A 1XK4A 2KYFA 2H61A 2AMIA 1KK7Y 3BUMB 2EHBA 2PRUA 2Y4QA 1J7PA 2HF5A 3NSKA 1ZMZA 3BUOB 5D69A 3CR5X 1BMOA 1K2HA 4M2OA 3DF0A 1GJYA 1PVAA 3KEVA 1DF0B 1XFUO 2B1UA 2K2FA 1IJ5A 1J7RA 3WHTB 1CM1A 1FI6A 2CNPA 2HQ8A 3EVRA 1PSBA 2KQYA 1RTP1 1MHOA 1Y1UA 2LMTA 4N1GA 1EG3A 4ORBB 2KGRA 2LLSA 3I5HC 4PHMA 4YRUA 2MHHA 3OHMB 4WQ2A 1UURA 2K7BA 2NZ0A 3CR4X 3HCMA 1DJZA 1J55A 1F4OA 1QS7A 1GGWA 2ZNEA 1C07A 2PMYA 1A75A 3DVMA 1NSHA 1B8LA 1NUBA 1XFWO 2CXJA 2D8NA 2FOTA 3CTNA 2M1KB 5DKQA 2L4HA 5BPJA 1DVIA 4MZKA 4OVNF 1YUSA 2Y1MA 1GGZA 5J3XA 1OMRA 1NX2A 1QJTA 2M97A 1R2UA 1PK0D 3IF7A 4R1EA 4XJKB 2GGMA 2LP3A 3OP0A 2JNFA 1MQ1A 1S6IA 1XA5A 2HETA 3LK1A 4JPZB 3EK7A 1MUXA 1F8HA 1PRWA 1BG1A 1YR5A 1OZSA 1HT9A 5G08A 2I94A 3OX5A 5I2LA 1XVJA 2M9GA 3PN7C 1G4YR 1N2DA 1D1OA 1W7JB 2M0RA 2LUCA 1TRFA 2KOTA 2BECA 2Q91A 3SG2A 2LVJA 3VROA 2F3YA 2LMVA 4U8DA 1H4BA 1YX8A 2JPTA 3TDUA 2LNKA 1XFVO 2JXCA 1C7VA 4CPVA 1YUUA 5ER5A 3K21A 1EXRA 1JSAA 3ICBA 4OR9B 5TNCA 4DRWA 1EG4A 3A8RA 2K7CA 2ZN9A 1WRKA 1RROA 1QIVA 1DF0A 1DJGA 1C7WA 1DJXA 3TDIA 1EL4A 1RECA 1CDLA 4OV2A 4CFQA 2L98A 1K95A 4TNCA 2HPSA 3BUXB 3JTDC 1N65A 4ORAB 4AQIA 4I5LB 4P5OE 1AP4A 1QVIZ 1IQ3A 3I5HB 5HYDA 4DUQA 4PE1A 1ALWA 4HRGA 2F8PA 2LVIA 4YBHB 2M7NA 1IG5A 1KQMC 2MJWB 2MLFC 2F2OA 3VGOA 2KDHA 4E68A 4YGCB 3NSOA 1Y1AA 2Y5IA 3MSEB 2JNXA 2JC2A 3AAJA 3SG3A 1A75B 4QJ3B 1TNPA 1SY9A 4PE0A 1M63B 2LMUA 1CNPA 1J7QA 4C0JA 4DCKA 4MRXA 4PCWA 2WC8A 2LE9B 1LKJA 3PSRA 2JU0A 2F3ZA 3RLZA 3EK4A 1JF0A 1MXLC 3RM1A 1YTZC 5AERA 1S5GZ 4PE7A 1RFJA 1SCMC 1QASA 4YGDB 2ZKMX 2LM5A 3PALA 1M31A 2JTTA 2ZN8A 1MR8A 1TNWA 2V53A 3LLEA 1H8BA 2KI6D 2NCPA 1B8RA 5ER4X 3O78A 4USLA 3SG6A 1K9UA 4GBAA 3PN7B 1XFYO 2LV7A 1SNLA 3BOWB 5B8IB 1U5IB 5KTYA 4PE4A 1K94A 3SG5A 1VRKA 1WDCC 2JOJA 2FJUB 2RGIA 3O2PA 1NCZA 1SBJA 1IRJA 1K8UA 2M1UA 1CTRA 1M46A 1KFXL 2QACA 4C0KA 3NSIA 1EJ3A 3VRQA 3DVEA 1SK6D 2BE6A 1JF2A 3SIAA 1JWDA 2G9BA 1TCFA 2ZNDA 1S26D 1DGVA 2LLTA 1QV0A 5HKZA 1FBVA 1A29A 1IJ6A 2I2RE 4GFTA 4I5JA 3D0YB 4NQGA 2COLB 1XYDA 3JTDB 3EVVA 4CIDA 2BL0B 1B47A 3KO0A 2FCEA 2EC6C 4Q04A 2BE4A 2LCPA 1LXFC 3EKJA 4PDZA 1GQMA 1UHKA 1KQMB 1WRLA 4NDCA 5D7FA 4I5NB 4BY5A 1JFJA 1DJIA 5K89A 3BQ3A 2KFFA 4HREE 1M39A 3O4YA 2L5XB 3GOFA 4GNKB 1SL7A 1BF5A 2NCOA 5JOLA 2IS9A 2KAVA 1SR6C 4M2PA 3FS7A 5PALA 3EVUA 2LVKA 4F0ZB 1G8IA 1NCYA 2L4IA 3TS5B 4AQJA 1BR1B 5DKRA 1SCVA 1WRZA 2OS8C 1AK8A 2DOQA 2M29A 1RWYA 1DJWA 1UP5A 2KI6C 1Y1XA 3CGAA 3CLNA 3SIBA 2JT0A 1SCMB 1BT6A 2JRFA 2PASA 3EKHA 3BYAA 4PHKA 1NX1A 1YURA 4YGAA 3A4UB 1ZUZA 3BOWA 2SASA 1U5IA 1JC2A 1XFZO 2LP2A 1JFKA 3FIAA 2L0PA 1SYMA
chains in the Genus database with same CATH superfamily
1XO5A 5GQQC 1TUJA 1ZACA 1WLMA 1TNQA 1QLKA 2BCXA 2K8MB 2O60A 4D1EA 1W9ZA 5CPVA 2NXQA 1WDCB 4GGFC 3V2LA 2FCDA 2QPTA 4NDDA 3B7AA 4GGFA 4HRHA 1QATA 4IL1A 1KSOA 3PFVA 1XFRA 4PHJA 3C1VA 3S0FA 1B1GA 3B86A 4KYNA 4MBEA 4MVFA 4NDBA 1SPYA 3CYZA 5JJGA 1CDPA 1OW4A 1NCXA 3S0BA 1CLLA 1L2OB 2E6WA 4PALA 1SMGA 3AAKA 3D0YA 2MA2A 2F33A 2BL0C 3GK1A 1PALA 2R2IA 5AFPA 1V1FA 2QDIA 4CFRA 1M45A 1FW4A 1NX0A 2WOSA 4JWQA 1YX7A 1K93D 1E8AA 3LL8B 1CFFA 1NP8A 1QVIY 1CKKA 3UO9A 1DGUA 2KAXA 3CZTX 3K1EA 2EC6B 1B7TZ 1ZFSA 2WC6A 2WCJA 3LK0A 5DKNA 2K61A 3BFHA 3SJSA 1YUTA 3D10A 2PSRA 4OCIA 2O5GA 3D75A 1FF1A 1C3YA 3RZSA 1OE9B 1ZOTB 3TZ1A 4MN0A 2K0JA 2M7LA 2LANA 5CSFA 3WHUB 3I5FC 3SG4A 3TUYB 4I5KA 4MRYA 3VRPA 3QMEA 4AOMA 3TS5C 2KBIA 1TNXA 2GGZA 1SR6B 4INWA 1XFXO 1CDMA 1DC1A 4FQTA 3L4AA 4BY4A 1B4CA 2WCEA 2LHLA 1CM4A 2F2PA 2LLUA 3IVTA 1AJ4A 2VRGA 4FQOA 1CFPA 5CSIA 3S0EA 2L50A 1S5GY 2L2CA 1DJHA 2OS8B 1BR4B 3AKBA 3CS1A 4MLWA 4YI8A 1UHNA 2HQWA 3BXKA 1SL8A 3SG7A 2Q4UA 2K2AA 5I2QA 1BODA 4ZCVA 1SRAA 4HSZA 2KFHA 5CSJA 1MF8B 1OOJA 3EK8A 1NIWA 1ODBA 1UHJA 3I5IC 1AUIB 2KSPA 1G33A 1KSMA 4PHNA 4ORCB 4ZCUA 3VRNA 1KFUL 3NSLA 2JZIA 1QWVA 1UWOA 3OGNA 5KU1A 2CTNA 4DS7A 1UHIA 5I8NA 2WC5A 5KSZA 5HLOA 1QTXA 2PVBA 1OQPA 2MBXA 4XYNA 1L2OC 1OSAA 1KFXS 1CDNA 3DY9A 1KK7Z 4JKTA 2PQLA 1SKTA 1OMDA 3FWBA 3JVTC 1R6PA 2KBMA 2WCFA 2LHIA 3KF9A 2JWWA 2KLEA 1LINA 1YRUB 2H2KA 3OB2B 3WXAA 5HLVA 1YRTB 3B6XA 3E3RA 2L51A 5FYXA 3SS5A 2BCBA 3GK4X 1BJFA 2CCMA 2OPOA 4YGBB 1KK8B 2M49B 1CMGA 3ZNIA 3CWGA 2BNXA 1X02A 2KI4C 4N1FA 3TUYC 1NYAA 3WNXB 1SSEB 4OKHA 1QX5B 2CBLA 1F4QA 2OTGC 3HX4A 3I5FB 5HL1A 1GM0A 2EGDA 1DJYA 4FTGA 5EL2A 1S1EA 1SL9A 3IQQA 2KFGA 1S3PA 1OZOA 1KWOB 1CFDA 1S6JA 1QX7A 1SW8A 1QXPA 5I2OA 2KNEA 1ALVA 4YI9A 2MLEC 1C3ZA 5HKWA 1W7IB 1LA0A 1TIZA 4C0LA 1F70A 2GV5A 2WCMA 3FE8A 1B8CA 3EG5B 2ERBA 1UHHA 1LS8A 1ORGA 4MZLA 2P71A 3L4LA 3LCPC 2K7OA 1CLMA 1IGVA 1K9PA 1JUOA 4P2YB 3I5IB 4DIRA 2BAPA 1QLSA 1F55A 1A4PA 3DVKA 3TDZA 1TOPA 4A4CA 3M0WA 1NX3A 1BU3A 1QV1A 2JT3A 1AHRA 2KPHA 3CABA 3NGVA 2LUXA 5AEQA 1A03A 2MAZA 1B9AA 1K9KA 3I5GC 3OB1B 1LVCD 1Q80A 2ZRSA 4YGEB 1K96A 4QJ5B 5HKYA 4WQ3A 1S6CA 2JT8A 1AJ5A 1DQEA 2JPOA 3JVTB 2ISDA 1DMOA 1RJVA 1FPWA 1YVHA 2I18A 3GK2A 4M2QA 4N5XA 5CSNA 1Y0VH 1V1GA 2KYCA 1HQVA 1K90D 2M8UA 3DYEA 3IQOA 4MZJA 3SS3A 4WRIA 2L2EA 2P6BB 1PSRA 2NLNA 2K7DA 3DVJA 3NXAA 3R72A 1RK9A 3BUWB 5AANA 3UNWA 3DF0B 4CLNA 1KK8C 3PM8A 3OX6A 2AUCA 1CMFA 1IH0A 4MEWA 1MWNA 2K60A 4GPLB 1J1EA 2P70A 3F45A 4GAOA 4ICBA 1B7TY 4IJ7A 1BOCA 5F6TA 1JBAA 1DTLA 2LAPA 2LVVA 3FWCA 4A4BA 5DICA 1KCYA 2BBMA 3PLFB 2JULA 3PM2A 2KI4B 2JTZA 2AAOA 4JQ0D 1QX2A 1KQVA 1IWQA 2ZFDA 1NWDA 1WY9A 2WCKA 3AKAA 1UUSA 2OTGB 4GUKA 1KWOC 4OZDA 1S36A 1EH2A 1NPQA 2TN4A 1IKUA 1QIWA 2JQ6A 3NHTA 1IQ5A 2L5YA 3CR2A 2WNDA 2CT9A 2M3WA 1J7OA 2PALA 1CFCA 2FJYA 4QJ4B 1FI5A 1P28A 3KHEA 2A4JA 3H4SE 4L9MA 2G2BA 1CLBA 4UPGA 4XJKA 1TTXA 4MSPA 1L7ZA 1CB1A 2KQ6A 1OMVA 1Y6WA 1PULA 3KPXA 1LA3A 1PVBA 2SCPA 2BKHB 2ZRTA 5IBWA 1YVLA 2KGBC 3ZWHA 1F71A 2BCAA 2JXLA 2I7AA 2KAYA 2KHNA 3DD4A 3O6BA 1DT7B 3VRRA 1Z2CB 1WLZA 2Y1NA 1AVSA 3O4XA 1KFUS 2BKIB 3BUNB 2MRDA 5AXIA 1A2XA 3D76A 1N0YA 1TN4A 2LC5A 3QRXA 1J1DA 1MXEA 2WORA 2BBNA 1TCOB 3I5GB 2WCBA 4ETOA 1XK4C 4GGNA 3PATA 2H61C 3S0AA 1BLQA 2E30A 1XK4A 2KYFA 2H61A 2AMIA 1KK7Y 3BUMB 2EHBA 2PRUA 2Y4QA 4PT1A 1J7PA 2HF5A 3NSKA 1DEKA 1ZMZA 3BUOB 5D69A 3CR5X 1BMOA 1K2HA 4M2OA 3DF0A 1GJYA 1PVAA 3KEVA 1DF0B 1XFUO 2B1UA 2K2FA 3R1VA 1IJ5A 1J7RA 3WHTB 1CM1A 1FI6A 2CNPA 2HQ8A 3PJIA 3NHIA 3EVRA 1PSBA 2KQYA 1RTP1 1MHOA 1Y1UA 1F54A 2LMTA 3L47A 1EG3A 4N1GA 2KGRA 2LLSA 3I5HC 4ORBB 4PHMA 2MHHA 4YRUA 3OHMB 5I94A 4WQ2A 1OOHA 2WCHA 1UURA 2K7BA 2NZ0A 3CR4X 3HCMA 1DJZA 1J55A 1F4OA 1QS7A 1TUZA 1GGWA 5FI2A 2ZNEA 1C07A 2PMYA 1A75A 2KLDA 3VB1A 3DVMA 1NSHA 1B8LA 1NUBA 1XFWO 2CXJA 2D8NA 2FOTA 3CTNA 2M1KB 5DKQA 2L4HA 5BPJA 1DVIA 4MZKA 4OVNF 1YUSA 2Y1MA 1GGZA 2QEOA 5J3XA 1OMRA 3OBVA 1NX2A 1QJTA 2M97A 1R2UA 1PK0D 3IF7A 4R1EA 4XJKB 2GGMA 2LP3A 3OP0A 2JNFA 1MQ1A 1S6IA 2YGUA 1XA5A 2HETA 3LK1A 4JPZB 3EK7A 1MUXA 1F8HA 1PRWA 2QEVA 1BG1A 1YR5A 1OZSA 1HT9A 5G08A 5FI7A 3B87A 2I94A 3OX5A 5I2LA 1XVJA 2M9GA 3PN7C 1G4YR 1N2DA 1D1OA 1W7JB 2M0RA 2LUCA 1TRFA 2KOTA 2BECA 2Q91A 3SG2A 3B88A 2LVJA 3VROA 2F3YA 2LMVA 4U8DA 1H4BA 1YX8A 2JPTA 3TDUA 2LNKA 1XFVO 2JXCA 3CZ2A 1C7VA 4CPVA 1YUUA 5ER5A 4INXA 3K21A 1EXRA 1JSAA 3ICBA 4OR9B 5TNCA 3R1PA 4DRWA 1EG4A 3A8RA 2K7CA 2ZN9A 1WRKA 1RROA 1QIVA 1DF0A 1DJGA 1C7WA 5FI6A 1DJXA 3TDIA 1EL4A 2H8VA 1RECA 1CDLA 4OV2A 4CFQA 2L98A 1K95A 4TNCA 2HPSA 3BUXB 2GTEA 3JTDC 1N65A 4ORAB 4AQIA 4I5LB 4P5OE 1AP4A 1QVIZ 1IQ3A 3I5HB 5HYDA 3D78A 4DUQA 4PE1A 1ALWA 4HRGA 2F8PA 2LVIA 3Q8IA 4YBHB 2M7NA 1IG5A 1KQMC 2MJWB 2MLFC 2F2OA 3VGOA 2KDHA 4E68A 4YGCB 3NSOA 1Y1AA 2Y5IA 3MSEB 2JNXA 2JC2A 3AAJA 3SG3A 1A75B 4QJ3B 3CZ0A 1TNPA 1SY9A 3DXLA 4PE0A 1M63B 1OOFA 2LMUA 1CNPA 1J7QA 4C0JA 3BFBA 2PYQA 4MRXA 4PCWA 4DCKA 2WC8A 2LE9B 1LKJA 3PSRA 2JU0A 2F3ZA 3RLZA 3EK4A 1JF0A 1MXLC 3RM1A 1YTZC 5AERA 1S5GZ 4PE7A 3SS4A 2QEHA 1RFJA 1SCMC 1QASA 3CDNA 4YGDB 2ZKMX 2LM5A 3PALA 1M31A 2JTTA 2ZN8A 1MR8A 1TNWA 2V53A 3N7HA 3LLEA 1H8BA 2KI6D 2NCPA 1B8RA 5ER4X 3O78A 4USLA 3SG6A 1K9UA 4GBAA 3PN7B 1XFYO 2LV7A 1SNLA 3BOWB 5B8IB 1U5IB 1TWOA 4PE4A 1K94A 5KTYA 3SG5A 1VRKA 1WDCC 2JOJA 2FJUB 2RGIA 3O2PA 1NCZA 3S0DA 1SBJA 4F7FA 1IRJA 1K8UA 2M1UA 1CTRA 1M46A 1KFXL 3BJHA 2QACA 4C0KA 3NSIA 1EJ3A 3D73A 3VRQA 3DVEA 1SK6D 2BE6A 1T14A 1IIOA 1JF2A 3SIAA 1JWDA 2G9BA 1TCFA 2ZNDA 1S26D 1DGVA 1DELA 2LLTA 1QV0A 5HKZA 1FBVA 3R1OA 1A29A 1IJ6A 2I2RE 4GFTA 4I5JA 3D0YB 3BFAA 4NQGA 2COLB 1XYDA 3JTDB 3EVVA 4CIDA 2BL0B 1B47A 3KO0A 2FCEA 2EC6C 4Q04A 2BE4A 2LCPA 1LXFC 3EKJA 4PDZA 1GQMA 1UHKA 1KQMB 1WRLA 4NDCA 5D3OA 5D7FA 3S0GA 1Z4HA 4I5NB 1OOIX 3D77A 4BY5A 1JFJA 1DJIA 5K89A 3BQ3A 2KFFA 4HREE 1M39A 3O4YA 2L5XB 2WCLA 3GOFA 4GNKB 1SL7A 1BF5A 2NCOA 5JOLA 2IS9A 3D74A 2KAVA 1SR6C 2QEBA 4JD9A 3FE9A 4M2PA 3FS7A 5PALA 3EVUA 2LVKA 4F0ZB 1G8IA 1NCYA 2L4IA 3TS5B 4AQJA 1BR1B 5DKRA 1SCVA 1WRZA 2OS8C 1AK8A 2DOQA 2M29A 1RWYA 1DJWA 1UP5A 2KI6C 1Y1XA 3CGAA 3CLNA 3DZTA 2JT0A 3SIBA 1SCMB 1BT6A 2JRFA 2PASA 3EKHA 3BYAA 4PHKA 1NX1A 1YURA 4YGAA 1OOGA 3A4UB 1ZUZA 3BOWA 3FE6A 2SASA 1U5IA 1JC2A 1XFZO 2LP2A 1JFKA 3CZ1A 2L0PA 3FIAA 1SYMA
chains in the Genus database with same CATH topology
1XO5A 5GQQC 1ZACA 1WLMA 1TNQA 1QLKA 2BCXA 2K8MB 2O60A 4D1EA 5CPVA 2NXQA 1WDCB 4GGFC 2FCDA 2QPTA 4NDDA 4GGFA 4HRHA 1QATA 4IL1A 1KSOA 3PFVA 4PHJA 3C1VA 1B1GA 4MBEA 4MVFA 4NDBA 1SPYA 5JJGA 1CDPA 1NCXA 1CLLA 1L2OB 2E6WA 4PALA 1SMGA 3AAKA 3D0YA 2MA2A 2F33A 2BL0C 3GK1A 1PALA 2R2IA 5AFPA 1V1FA 4CFRA 1M45A 1FW4A 1NX0A 2WOSA 4JWQA 1YX7A 1K93D 1E8AA 3LL8B 1CFFA 1NP8A 1QVIY 1CKKA 1DGUA 2KAXA 3CZTX 2EC6B 1B7TZ 1ZFSA 3LK0A 5DKNA 2K61A 3SJSA 1YUTA 3D10A 2PSRA 4OCIA 2O5GA 1FF1A 1OE9B 1ZOTB 3TZ1A 4MN0A 2K0JA 2M7LA 2LANA 5CSFA 3WHUB 3I5FC 3SG4A 3TUYB 4I5KA 4MRYA 3VRPA 4AOMA 3TS5C 2KBIA 1TNXA 2GGZA 1SR6B 1XFXO 1CDMA 4BY4A 1B4CA 2WCEA 2LHLA 1CM4A 2F2PA 2LLUA 4FQOA 1AJ4A 2VRGA 1CFPA 5CSIA 2L50A 1S5GY 1DJHA 2OS8B 1BR4B 3AKBA 3CS1A 4MLWA 4YI8A 1UHNA 2HQWA 3BXKA 1SL8A 3SG7A 2Q4UA 2K2AA 5I2QA 1BODA 4ZCVA 1SRAA 4HSZA 2KFHA 5CSJA 1MF8B 1OOJA 3EK8A 1NIWA 1ODBA 1UHJA 3I5IC 1AUIB 2KSPA 1G33A 1KSMA 4PHNA 4ORCB 4ZCUA 3VRNA 1KFUL 3NSLA 2JZIA 1UWOA 5KU1A 2CTNA 4DS7A 1UHIA 5I8NA 5KSZA 5HLOA 1QTXA 2PVBA 1OQPA 2MBXA 4XYNA 1L2OC 1OSAA 1KFXS 1CDNA 1KK7Z 1SKTA 1OMDA 3FWBA 3JVTC 1R6PA 2KBMA 2WCFA 2LHIA 3KF9A 2JWWA 1LINA 1YRUB 2H2KA 3OB2B 3WXAA 5HLVA 1YRTB 3E3RA 2L51A 5FYXA 2BCBA 3GK4X 1BJFA 2CCMA 2OPOA 4YGBB 1KK8B 2M49B 1CMGA 3ZNIA 3CWGA 1X02A 2KI4C 4N1FA 3TUYC 1NYAA 3WNXB 4OKHA 1QX5B 2CBLA 1F4QA 2OTGC 3HX4A 3I5FB 2EGDA 1DJYA 4FTGA 1S1EA 1SL9A 3IQQA 2KFGA 1S3PA 1OZOA 1KWOB 1CFDA 1S6JA 1QX7A 1SW8A 1QXPA 5I2OA 2KNEA 1ALVA 4YI9A 2MLEC 5HKWA 1W7IB 1LA0A 1TIZA 4C0LA 1F70A 2GV5A 1B8CA 1UHHA 4MZLA 3LCPC 2K7OA 1CLMA 1IGVA 1K9PA 1JUOA 4P2YB 3I5IB 4DIRA 1QLSA 1F55A 1A4PA 3DVKA 3TDZA 1TOPA 4A4CA 3M0WA 1NX3A 1BU3A 1QV1A 2JT3A 1AHRA 5AEQA 1A03A 2LUXA 2MAZA 1B9AA 1K9KA 3I5GC 3OB1B 1LVCD 1Q80A 2ZRSA 4YGEB 1K96A 4QJ5B 5HKYA 4WQ3A 1S6CA 2JT8A 1AJ5A 3JVTB 2ISDA 1DMOA 1RJVA 1FPWA 1YVHA 2I18A 3GK2A 4M2QA 4N5XA 5CSNA 1Y0VH 1V1GA 2KYCA 1HQVA 1K90D 2M8UA 3IQOA 4MZJA 4WRIA 2L2EA 2P6BB 1PSRA 2NLNA 2K7DA 3DVJA 3NXAA 1RK9A 3BUWB 5AANA 3DF0B 4CLNA 1KK8C 3PM8A 3OX6A 2AUCA 1CMFA 1IH0A 4MEWA 1MWNA 4GPLB 1J1EA 3F45A 4GAOA 4ICBA 1B7TY 1BOCA 5F6TA 1JBAA 1DTLA 2LAPA 2LVVA 3FWCA 4A4BA 1KCYA 2BBMA 3PLFB 2JULA 2KI4B 2JTZA 2AAOA 4JQ0D 1QX2A 1KQVA 1IWQA 2ZFDA 1NWDA 1WY9A 4GUKA 3AKAA 1UUSA 2OTGB 1F54A 1KWOC 1EH2A 1S36A 1NPQA 2TN4A 1IKUA 1QIWA 2JQ6A 1IQ5A 3CR2A 2WNDA 2CT9A 2M3WA 1J7OA 2PALA 1CFCA 4QJ4B 1FI5A 3KHEA 2A4JA 3H4SE 4L9MA 2G2BA 1CLBA 4UPGA 4XJKA 1TTXA 4MSPA 1L7ZA 1CB1A 2KQ6A 1OMVA 1Y6WA 1PULA 3KPXA 1LA3A 1PVBA 2SCPA 2BKHB 2ZRTA 5IBWA 1YVLA 2KGBC 3ZWHA 1F71A 2BCAA 2JXLA 2I7AA 2KAYA 2KHNA 3DD4A 3O6BA 1DT7B 3VRRA 1WLZA 2Y1NA 1AVSA 1KFUS 2BKIB 3BUNB 2MRDA 5AXIA 1A2XA 1N0YA 1TN4A 2LC5A 3QRXA 1J1DA 1MXEA 2WORA 2BBNA 1TCOB 3I5GB 2WCBA 4ETOA 1XK4C 4GGNA 3PATA 2H61C 1BLQA 2E30A 1XK4A 2KYFA 2H61A 2AMIA 1KK7Y 3BUMB 2EHBA 2PRUA 2Y4QA 1J7PA 2HF5A 3NSKA 1ZMZA 3BUOB 5D69A 3CR5X 1BMOA 1K2HA 4M2OA 3DF0A 1GJYA 1PVAA 3KEVA 1DF0B 1XFUO 2B1UA 2K2FA 1IJ5A 1J7RA 3WHTB 1CM1A 1FI6A 2CNPA 2HQ8A 3EVRA 1PSBA 2KQYA 1RTP1 1MHOA 1Y1UA 2LMTA 4N1GA 1EG3A 4ORBB 2KGRA 2LLSA 3I5HC 4PHMA 4YRUA 2MHHA 3OHMB 4WQ2A 1UURA 2K7BA 2NZ0A 3CR4X 3HCMA 1DJZA 1J55A 1F4OA 1QS7A 1GGWA 2ZNEA 1C07A 2PMYA 1A75A 3DVMA 1NSHA 1B8LA 1NUBA 1XFWO 2CXJA 2D8NA 2FOTA 3CTNA 2M1KB 5DKQA 2L4HA 5BPJA 1DVIA 4MZKA 4OVNF 1YUSA 2Y1MA 1GGZA 5J3XA 1OMRA 1NX2A 1QJTA 2M97A 1R2UA 1PK0D 3IF7A 4R1EA 4XJKB 2GGMA 2LP3A 3OP0A 2JNFA 1MQ1A 1S6IA 1XA5A 2HETA 3LK1A 4JPZB 3EK7A 1MUXA 1F8HA 1PRWA 1BG1A 1YR5A 1OZSA 1HT9A 5G08A 2I94A 3OX5A 5I2LA 1XVJA 2M9GA 3PN7C 1G4YR 1N2DA 1D1OA 1W7JB 2M0RA 2LUCA 1TRFA 2KOTA 2BECA 2Q91A 3SG2A 2LVJA 3VROA 2F3YA 2LMVA 4U8DA 1H4BA 1YX8A 2JPTA 3TDUA 2LNKA 1XFVO 2JXCA 1C7VA 4CPVA 1YUUA 5ER5A 3K21A 1EXRA 1JSAA 3ICBA 4OR9B 5TNCA 4DRWA 1EG4A 3A8RA 2K7CA 2ZN9A 1WRKA 1RROA 1QIVA 1DF0A 1DJGA 1C7WA 1DJXA 3TDIA 1EL4A 1RECA 1CDLA 4OV2A 4CFQA 2L98A 1K95A 4TNCA 2HPSA 3BUXB 3JTDC 1N65A 4ORAB 4AQIA 4I5LB 4P5OE 1AP4A 1QVIZ 1IQ3A 3I5HB 5HYDA 4DUQA 4PE1A 1ALWA 4HRGA 2F8PA 2LVIA 4YBHB 2M7NA 1IG5A 1KQMC 2MJWB 2MLFC 2F2OA 3VGOA 2KDHA 4E68A 4YGCB 3NSOA 1Y1AA 2Y5IA 3MSEB 2JNXA 2JC2A 3AAJA 3SG3A 1A75B 4QJ3B 1TNPA 1SY9A 4PE0A 1M63B 2LMUA 1CNPA 1J7QA 4C0JA 4DCKA 4MRXA 4PCWA 2WC8A 2LE9B 1LKJA 3PSRA 2JU0A 2F3ZA 3RLZA 3EK4A 1JF0A 1MXLC 3RM1A 1YTZC 5AERA 1S5GZ 4PE7A 1RFJA 1SCMC 1QASA 4YGDB 2ZKMX 2LM5A 3PALA 1M31A 2JTTA 2ZN8A 1MR8A 1TNWA 2V53A 3LLEA 1H8BA 2KI6D 2NCPA 1B8RA 5ER4X 3O78A 4USLA 3SG6A 1K9UA 4GBAA 3PN7B 1XFYO 2LV7A 1SNLA 3BOWB 5B8IB 1U5IB 5KTYA 4PE4A 1K94A 3SG5A 1VRKA 1WDCC 2JOJA 2FJUB 2RGIA 3O2PA 1NCZA 1SBJA 1IRJA 1K8UA 2M1UA 1CTRA 1M46A 1KFXL 2QACA 4C0KA 3NSIA 1EJ3A 3VRQA 3DVEA 1SK6D 2BE6A 1JF2A 3SIAA 1JWDA 2G9BA 1TCFA 2ZNDA 1S26D 1DGVA 2LLTA 1QV0A 5HKZA 1FBVA 1A29A 1IJ6A 2I2RE 4GFTA 4I5JA 3D0YB 4NQGA 2COLB 1XYDA 3JTDB 3EVVA 4CIDA 2BL0B 1B47A 3KO0A 2FCEA 2EC6C 4Q04A 2BE4A 2LCPA 1LXFC 3EKJA 4PDZA 1GQMA 1UHKA 1KQMB 1WRLA 4NDCA 5D7FA 4I5NB 4BY5A 1JFJA 1DJIA 5K89A 3BQ3A 2KFFA 4HREE 1M39A 3O4YA 2L5XB 3GOFA 4GNKB 1SL7A 1BF5A 2NCOA 5JOLA 2IS9A 2KAVA 1SR6C 4M2PA 3FS7A 5PALA 3EVUA 2LVKA 4F0ZB 1G8IA 1NCYA 2L4IA 3TS5B 4AQJA 1BR1B 5DKRA 1SCVA 1WRZA 2OS8C 1AK8A 2DOQA 2M29A 1RWYA 1DJWA 1UP5A 2KI6C 1Y1XA 3CGAA 3CLNA 3SIBA 2JT0A 1SCMB 1BT6A 2JRFA 2PASA 3EKHA 3BYAA 4PHKA 1NX1A 1YURA 4YGAA 3A4UB 1ZUZA 3BOWA 2SASA 1U5IA 1JC2A 1XFZO 2LP2A 1JFKA 3FIAA 2L0PA 1SYMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XO5 A;  5GQQ C;  1ZAC A;  1WLM A;  1TNQ A;  1QLK A;  2BCX A;  2K8M B;  2O60 A;  4D1E A;  5CPV A;  2NXQ A;  1WDC B;  4GGF C;  2FCD A;  2QPT A;  4NDD A;  4GGF A;  4HRH A;  1QAT A;  4IL1 A;  1KSO A;  3PFV A;  4PHJ A;  3C1V A;  1B1G A;  4MBE A;  4MVF A;  4NDB A;  1SPY A;  5JJG A;  1CDP A;  1NCX A;  1CLL A;  1L2O B;  2E6W A;  4PAL A;  1SMG A;  3AAK A;  3D0Y A;  2MA2 A;  2F33 A;  2BL0 C;  3GK1 A;  1PAL A;  2R2I A;  5AFP A;  1V1F A;  4CFR A;  1M45 A;  1FW4 A;  1NX0 A;  2WOS A;  4JWQ A;  1YX7 A;  1K93 D;  1E8A A;  3LL8 B;  1CFF A;  1NP8 A;  1QVI Y;  1CKK A;  1DGU A;  2KAX A;  3CZT X;  2EC6 B;  1B7T Z;  1ZFS A;  3LK0 A;  5DKN A;  2K61 A;  3SJS A;  1YUT A;  3D10 A;  2PSR A;  4OCI A;  2O5G A;  1FF1 A;  1OE9 B;  1ZOT B;  3TZ1 A;  4MN0 A;  2K0J A;  2M7L A;  2LAN A;  5CSF A;  3WHU B;  3I5F C;  3SG4 A;  3TUY B;  4I5K A;  4MRY A;  3VRP A;  4AOM A;  3TS5 C;  2KBI A;  1TNX A;  2GGZ A;  1SR6 B;  1XFX O;  1CDM A;  4BY4 A;  1B4C A;  2WCE A;  2LHL A;  1CM4 A;  2F2P A;  2LLU A;  4FQO A;  1AJ4 A;  2VRG A;  1CFP A;  5CSI A;  2L50 A;  1S5G Y;  1DJH A;  2OS8 B;  1BR4 B;  3AKB A;  3CS1 A;  4MLW A;  4YI8 A;  1UHN A;  2HQW A;  3BXK A;  1SL8 A;  3SG7 A;  2Q4U A;  2K2A A;  5I2Q A;  1BOD A;  4ZCV A;  1SRA A;  4HSZ A;  2KFH A;  5CSJ A;  1MF8 B;  1OOJ A;  3EK8 A;  1NIW A;  1ODB A;  1UHJ A;  3I5I C;  1AUI B;  2KSP A;  1G33 A;  1KSM A;  4PHN A;  4ORC B;  4ZCU A;  3VRN A;  1KFU L;  3NSL A;  2JZI A;  1UWO A;  5KU1 A;  2CTN A;  4DS7 A;  1UHI A;  5I8N A;  5KSZ A;  5HLO A;  1QTX A;  2PVB A;  1OQP A;  2MBX A;  4XYN A;  1L2O C;  1OSA A;  1KFX S;  1CDN A;  1KK7 Z;  1SKT A;  1OMD A;  3FWB A;  3JVT C;  1R6P A;  2KBM A;  2WCF A;  2LHI A;  3KF9 A;  2JWW A;  1LIN A;  1YRU B;  2H2K A;  3OB2 B;  3WXA A;  5HLV A;  1YRT B;  3E3R A;  2L51 A;  5FYX A;  2BCB A;  3GK4 X;  1BJF A;  2CCM A;  2OPO A;  4YGB B;  1KK8 B;  2M49 B;  1CMG A;  3ZNI A;  3CWG A;  1X02 A;  2KI4 C;  4N1F A;  3TUY C;  1NYA A;  3WNX B;  4OKH A;  1QX5 B;  2CBL A;  1F4Q A;  2OTG C;  3HX4 A;  3I5F B;  2EGD A;  1DJY A;  4FTG A;  1S1E A;  1SL9 A;  3IQQ A;  2KFG A;  1S3P A;  1OZO A;  1KWO B;  1CFD A;  1S6J A;  1QX7 A;  1SW8 A;  1QXP A;  5I2O A;  2KNE A;  1ALV A;  4YI9 A;  2MLE C;  5HKW A;  1W7I B;  1LA0 A;  1TIZ A;  4C0L A;  1F70 A;  2GV5 A;  1B8C A;  1UHH A;  4MZL A;  3LCP C;  2K7O A;  1CLM A;  1IGV A;  1K9P A;  1JUO A;  4P2Y B;  3I5I B;  4DIR A;  1QLS A;  1F55 A;  1A4P A;  3DVK A;  3TDZ A;  1TOP A;  4A4C A;  3M0W A;  1NX3 A;  1BU3 A;  1QV1 A;  2JT3 A;  1AHR A;  5AEQ A;  1A03 A;  2LUX A;  2MAZ A;  1B9A A;  1K9K A;  3I5G C;  3OB1 B;  1LVC D;  1Q80 A;  2ZRS A;  4YGE B;  1K96 A;  4QJ5 B;  5HKY A;  4WQ3 A;  1S6C A;  2JT8 A;  1AJ5 A;  3JVT B;  2ISD A;  1DMO A;  1RJV A;  1FPW A;  1YVH A;  2I18 A;  3GK2 A;  4M2Q A;  4N5X A;  5CSN A;  1Y0V H;  1V1G A;  2KYC A;  1HQV A;  1K90 D;  2M8U A;  3IQO A;  4MZJ A;  4WRI A;  2L2E A;  2P6B B;  1PSR A;  2NLN A;  2K7D A;  3DVJ A;  3NXA A;  1RK9 A;  3BUW B;  5AAN A;  3DF0 B;  4CLN A;  1KK8 C;  3PM8 A;  3OX6 A;  2AUC A;  1CMF A;  1IH0 A;  4MEW A;  1MWN A;  4GPL B;  1J1E A;  3F45 A;  4GAO A;  4ICB A;  1B7T Y;  1BOC A;  5F6T A;  1JBA A;  1DTL A;  2LAP A;  2LVV A;  3FWC A;  4A4B A;  1KCY A;  2BBM A;  3PLF B;  2JUL A;  2KI4 B;  2JTZ A;  2AAO A;  4JQ0 D;  1QX2 A;  1KQV A;  1IWQ A;  2ZFD A;  1NWD A;  1WY9 A;  4GUK A;  3AKA A;  1UUS A;  2OTG B;  1F54 A;  1KWO C;  1EH2 A;  1S36 A;  1NPQ A;  2TN4 A;  1IKU A;  1QIW A;  2JQ6 A;  1IQ5 A;  3CR2 A;  2WND A;  2CT9 A;  2M3W A;  1J7O A;  2PAL A;  1CFC A;  4QJ4 B;  1FI5 A;  3KHE A;  2A4J A;  3H4S E;  4L9M A;  2G2B A;  1CLB A;  4UPG A;  4XJK A;  1TTX A;  4MSP A;  1L7Z A;  1CB1 A;  2KQ6 A;  1OMV A;  1Y6W A;  1PUL A;  3KPX A;  1LA3 A;  1PVB A;  2SCP A;  2BKH B;  2ZRT A;  5IBW A;  1YVL A;  2KGB C;  3ZWH A;  1F71 A;  2BCA A;  2JXL A;  2I7A A;  2KAY A;  2KHN A;  3DD4 A;  3O6B A;  1DT7 B;  3VRR A;  1WLZ A;  2Y1N A;  1AVS A;  1KFU S;  2BKI B;  3BUN B;  2MRD A;  5AXI A;  1A2X A;  1N0Y A;  1TN4 A;  2LC5 A;  3QRX A;  1J1D A;  1MXE A;  2WOR A;  2BBN A;  1TCO B;  3I5G B;  2WCB A;  4ETO A;  1XK4 C;  4GGN A;  3PAT A;  2H61 C;  1BLQ A;  2E30 A;  1XK4 A;  2KYF A;  2H61 A;  2AMI A;  1KK7 Y;  3BUM B;  2EHB A;  2PRU A;  2Y4Q A;  1J7P A;  2HF5 A;  3NSK A;  1ZMZ A;  3BUO B;  5D69 A;  3CR5 X;  1BMO A;  1K2H A;  4M2O A;  3DF0 A;  1GJY A;  1PVA A;  3KEV A;  1DF0 B;  1XFU O;  2B1U A;  2K2F A;  1IJ5 A;  1J7R A;  3WHT B;  1CM1 A;  1FI6 A;  2CNP A;  2HQ8 A;  3EVR A;  1PSB A;  2KQY A;  1RTP 1;  1MHO A;  1Y1U A;  2LMT A;  4N1G A;  1EG3 A;  4ORB B;  2KGR A;  2LLS A;  3I5H C;  4PHM A;  4YRU A;  2MHH A;  3OHM B;  4WQ2 A;  1UUR A;  2K7B A;  2NZ0 A;  3CR4 X;  3HCM A;  1DJZ A;  1J55 A;  1F4O A;  1QS7 A;  1GGW A;  2ZNE A;  1C07 A;  2PMY A;  1A75 A;  3DVM A;  1NSH A;  1B8L A;  1NUB A;  1XFW O;  2CXJ A;  2D8N A;  2FOT A;  3CTN A;  2M1K B;  5DKQ A;  2L4H A;  5BPJ A;  1DVI A;  4MZK A;  4OVN F;  1YUS A;  2Y1M A;  1GGZ A;  5J3X A;  1OMR A;  1NX2 A;  1QJT A;  2M97 A;  1R2U A;  1PK0 D;  3IF7 A;  4R1E A;  4XJK B;  2GGM A;  2LP3 A;  3OP0 A;  2JNF A;  1MQ1 A;  1S6I A;  1XA5 A;  2HET A;  3LK1 A;  4JPZ B;  3EK7 A;  1MUX A;  1F8H A;  1PRW A;  1BG1 A;  1YR5 A;  1OZS A;  1HT9 A;  5G08 A;  2I94 A;  3OX5 A;  5I2L A;  1XVJ A;  2M9G A;  3PN7 C;  1G4Y R;  1N2D A;  1D1O A;  1W7J B;  2M0R A;  2LUC A;  1TRF A;  2KOT A;  2BEC A;  2Q91 A;  3SG2 A;  2LVJ A;  3VRO A;  2F3Y A;  2LMV A;  4U8D A;  1H4B A;  1YX8 A;  2JPT A;  3TDU A;  2LNK A;  1XFV O;  2JXC A;  1C7V A;  4CPV A;  1YUU A;  5ER5 A;  3K21 A;  1EXR A;  1JSA A;  3ICB A;  4OR9 B;  5TNC A;  4DRW A;  1EG4 A;  3A8R A;  2K7C A;  2ZN9 A;  1WRK A;  1RRO A;  1QIV A;  1DF0 A;  1DJG A;  1C7W A;  1DJX A;  3TDI A;  1EL4 A;  1REC A;  1CDL A;  4OV2 A;  4CFQ A;  2L98 A;  1K95 A;  4TNC A;  2HPS A;  3BUX B;  3JTD C;  1N65 A;  4ORA B;  4AQI A;  4I5L B;  4P5O E;  1AP4 A;  1QVI Z;  1IQ3 A;  3I5H B;  5HYD A;  4DUQ A;  4PE1 A;  1ALW A;  4HRG A;  2F8P A;  2LVI A;  4YBH B;  2M7N A;  1IG5 A;  1KQM C;  2MJW B;  2MLF C;  2F2O A;  3VGO A;  2KDH A;  4E68 A;  4YGC B;  3NSO A;  1Y1A A;  2Y5I A;  3MSE B;  2JNX A;  2JC2 A;  3AAJ A;  3SG3 A;  1A75 B;  4QJ3 B;  1TNP A;  1SY9 A;  4PE0 A;  1M63 B;  2LMU A;  1CNP A;  1J7Q A;  4C0J A;  4DCK A;  4MRX A;  4PCW A;  2WC8 A;  2LE9 B;  1LKJ A;  3PSR A;  2JU0 A;  2F3Z A;  3RLZ A;  3EK4 A;  1JF0 A;  1MXL C;  3RM1 A;  1YTZ C;  5AER A;  1S5G Z;  4PE7 A;  1RFJ A;  1SCM C;  1QAS A;  4YGD B;  2ZKM X;  2LM5 A;  3PAL A;  1M31 A;  2JTT A;  2ZN8 A;  1MR8 A;  1TNW A;  2V53 A;  3LLE A;  1H8B A;  2KI6 D;  2NCP A;  1B8R A;  5ER4 X;  3O78 A;  4USL A;  3SG6 A;  1K9U A;  4GBA A;  3PN7 B;  1XFY O;  2LV7 A;  1SNL A;  3BOW B;  5B8I B;  1U5I B;  5KTY A;  4PE4 A;  1K94 A;  3SG5 A;  1VRK A;  1WDC C;  2JOJ A;  2FJU B;  2RGI A;  3O2P A;  1NCZ A;  1SBJ A;  1IRJ A;  1K8U A;  2M1U A;  1CTR A;  1M46 A;  1KFX L;  2QAC A;  4C0K A;  3NSI A;  1EJ3 A;  3VRQ A;  3DVE A;  1SK6 D;  2BE6 A;  1JF2 A;  3SIA A;  1JWD A;  2G9B A;  1TCF A;  2ZND A;  1S26 D;  1DGV A;  2LLT A;  1QV0 A;  5HKZ A;  1FBV A;  1A29 A;  1IJ6 A;  2I2R E;  4GFT A;  4I5J A;  3D0Y B;  4NQG A;  2COL B;  1XYD A;  3JTD B;  3EVV A;  4CID A;  2BL0 B;  1B47 A;  3KO0 A;  2FCE A;  2EC6 C;  4Q04 A;  2BE4 A;  2LCP A;  1LXF C;  3EKJ A;  4PDZ A;  1GQM A;  1UHK A;  1KQM B;  1WRL A;  4NDC A;  5D7F A;  4I5N B;  4BY5 A;  1JFJ A;  1DJI A;  5K89 A;  3BQ3 A;  2KFF A;  4HRE E;  1M39 A;  3O4Y A;  2L5X B;  3GOF A;  4GNK B;  1SL7 A;  1BF5 A;  2NCO A;  5JOL A;  2IS9 A;  2KAV A;  1SR6 C;  4M2P A;  3FS7 A;  5PAL A;  3EVU A;  2LVK A;  4F0Z B;  1G8I A;  1NCY A;  2L4I A;  3TS5 B;  4AQJ A;  1BR1 B;  5DKR A;  1SCV A;  1WRZ A;  2OS8 C;  1AK8 A;  2DOQ A;  2M29 A;  1RWY A;  1DJW A;  1UP5 A;  2KI6 C;  1Y1X A;  3CGA A;  3CLN A;  3SIB A;  2JT0 A;  1SCM B;  1BT6 A;  2JRF A;  2PAS A;  3EKH A;  3BYA A;  4PHK A;  1NX1 A;  1YUR A;  4YGA A;  3A4U B;  1ZUZ A;  3BOW A;  2SAS A;  1U5I A;  1JC2 A;  1XFZ O;  2LP2 A;  1JFK A;  3FIA A;  2L0P A;  1SYM A; 
#chains in the Genus database with same CATH topology
 1XO5 A;  5GQQ C;  1TUJ A;  1ZAC A;  1WLM A;  1TNQ A;  1QLK A;  2BCX A;  2K8M B;  2O60 A;  4D1E A;  1W9Z A;  5CPV A;  2NXQ A;  1WDC B;  4GGF C;  3V2L A;  2FCD A;  2QPT A;  4NDD A;  3B7A A;  4GGF A;  4HRH A;  1QAT A;  4IL1 A;  1KSO A;  3PFV A;  1XFR A;  4PHJ A;  3C1V A;  3S0F A;  1B1G A;  3B86 A;  4KYN A;  4MBE A;  4MVF A;  4NDB A;  1SPY A;  3CYZ A;  5JJG A;  1CDP A;  1OW4 A;  1NCX A;  3S0B A;  1CLL A;  1L2O B;  2E6W A;  4PAL A;  1SMG A;  3AAK A;  3D0Y A;  2MA2 A;  2F33 A;  2BL0 C;  3GK1 A;  1PAL A;  2R2I A;  5AFP A;  1V1F A;  2QDI A;  4CFR A;  1M45 A;  1FW4 A;  1NX0 A;  2WOS A;  4JWQ A;  1YX7 A;  1K93 D;  1E8A A;  3LL8 B;  1CFF A;  1NP8 A;  1QVI Y;  1CKK A;  3UO9 A;  1DGU A;  2KAX A;  3CZT X;  3K1E A;  2EC6 B;  1B7T Z;  1ZFS A;  2WC6 A;  2WCJ A;  3LK0 A;  5DKN A;  2K61 A;  3BFH A;  3SJS A;  1YUT A;  3D10 A;  2PSR A;  4OCI A;  2O5G A;  3D75 A;  1FF1 A;  1C3Y A;  3RZS A;  1OE9 B;  1ZOT B;  3TZ1 A;  4MN0 A;  2K0J A;  2M7L A;  2LAN A;  5CSF A;  3WHU B;  3I5F C;  3SG4 A;  3TUY B;  4I5K A;  4MRY A;  3VRP A;  3QME A;  4AOM A;  3TS5 C;  2KBI A;  1TNX A;  2GGZ A;  1SR6 B;  4INW A;  1XFX O;  1CDM A;  1DC1 A;  4FQT A;  3L4A A;  4BY4 A;  1B4C A;  2WCE A;  2LHL A;  1CM4 A;  2F2P A;  2LLU A;  3IVT A;  1AJ4 A;  2VRG A;  4FQO A;  1CFP A;  5CSI A;  3S0E A;  2L50 A;  1S5G Y;  2L2C A;  1DJH A;  2OS8 B;  1BR4 B;  3AKB A;  3CS1 A;  4MLW A;  4YI8 A;  1UHN A;  2HQW A;  3BXK A;  1SL8 A;  3SG7 A;  2Q4U A;  2K2A A;  5I2Q A;  1BOD A;  4ZCV A;  1SRA A;  4HSZ A;  2KFH A;  5CSJ A;  1MF8 B;  1OOJ A;  3EK8 A;  1NIW A;  1ODB A;  1UHJ A;  3I5I C;  1AUI B;  2KSP A;  1G33 A;  1KSM A;  4PHN A;  4ORC B;  4ZCU A;  3VRN A;  1KFU L;  3NSL A;  2JZI A;  1QWV A;  1UWO A;  3OGN A;  5KU1 A;  2CTN A;  4DS7 A;  1UHI A;  5I8N A;  2WC5 A;  5KSZ A;  5HLO A;  1QTX A;  2PVB A;  1OQP A;  2MBX A;  4XYN A;  1L2O C;  1OSA A;  1KFX S;  1CDN A;  3DY9 A;  1KK7 Z;  4JKT A;  2PQL A;  1SKT A;  1OMD A;  3FWB A;  3JVT C;  1R6P A;  2KBM A;  2WCF A;  2LHI A;  3KF9 A;  2JWW A;  2KLE A;  1LIN A;  1YRU B;  2H2K A;  3OB2 B;  3WXA A;  5HLV A;  1YRT B;  3B6X A;  3E3R A;  2L51 A;  5FYX A;  3SS5 A;  2BCB A;  3GK4 X;  1BJF A;  2CCM A;  2OPO A;  4YGB B;  1KK8 B;  2M49 B;  1CMG A;  3ZNI A;  3CWG A;  2BNX A;  1X02 A;  2KI4 C;  4N1F A;  3TUY C;  1NYA A;  3WNX B;  1SSE B;  4OKH A;  1QX5 B;  2CBL A;  1F4Q A;  2OTG C;  3HX4 A;  3I5F B;  5HL1 A;  1GM0 A;  2EGD A;  1DJY A;  4FTG A;  5EL2 A;  1S1E A;  1SL9 A;  3IQQ A;  2KFG A;  1S3P A;  1OZO A;  1KWO B;  1CFD A;  1S6J A;  1QX7 A;  1SW8 A;  1QXP A;  5I2O A;  2KNE A;  1ALV A;  4YI9 A;  2MLE C;  1C3Z A;  5HKW A;  1W7I B;  1LA0 A;  1TIZ A;  4C0L A;  1F70 A;  2GV5 A;  2WCM A;  3FE8 A;  1B8C A;  3EG5 B;  2ERB A;  1UHH A;  1LS8 A;  1ORG A;  4MZL A;  2P71 A;  3L4L A;  3LCP C;  2K7O A;  1CLM A;  1IGV A;  1K9P A;  1JUO A;  4P2Y B;  3I5I B;  4DIR A;  2BAP A;  1QLS A;  1F55 A;  1A4P A;  3DVK A;  3TDZ A;  1TOP A;  4A4C A;  3M0W A;  1NX3 A;  1BU3 A;  1QV1 A;  2JT3 A;  1AHR A;  2KPH A;  3CAB A;  3NGV A;  2LUX A;  5AEQ A;  1A03 A;  2MAZ A;  1B9A A;  1K9K A;  3I5G C;  3OB1 B;  1LVC D;  1Q80 A;  2ZRS A;  4YGE B;  1K96 A;  4QJ5 B;  5HKY A;  4WQ3 A;  1S6C A;  2JT8 A;  1AJ5 A;  1DQE A;  2JPO A;  3JVT B;  2ISD A;  1DMO A;  1RJV A;  1FPW A;  1YVH A;  2I18 A;  3GK2 A;  4M2Q A;  4N5X A;  5CSN A;  1Y0V H;  1V1G A;  2KYC A;  1HQV A;  1K90 D;  2M8U A;  3DYE A;  3IQO A;  4MZJ A;  3SS3 A;  4WRI A;  2L2E A;  2P6B B;  1PSR A;  2NLN A;  2K7D A;  3DVJ A;  3NXA A;  3R72 A;  1RK9 A;  3BUW B;  5AAN A;  3UNW A;  3DF0 B;  4CLN A;  1KK8 C;  3PM8 A;  3OX6 A;  2AUC A;  1CMF A;  1IH0 A;  4MEW A;  1MWN A;  2K60 A;  4GPL B;  1J1E A;  2P70 A;  3F45 A;  4GAO A;  4ICB A;  1B7T Y;  4IJ7 A;  1BOC A;  5F6T A;  1JBA A;  1DTL A;  2LAP A;  2LVV A;  3FWC A;  4A4B A;  5DIC A;  1KCY A;  2BBM A;  3PLF B;  2JUL A;  3PM2 A;  2KI4 B;  2JTZ A;  2AAO A;  4JQ0 D;  1QX2 A;  1KQV A;  1IWQ A;  2ZFD A;  1NWD A;  1WY9 A;  2WCK A;  3AKA A;  1UUS A;  2OTG B;  4GUK A;  1KWO C;  4OZD A;  1S36 A;  1EH2 A;  1NPQ A;  2TN4 A;  1IKU A;  1QIW A;  2JQ6 A;  3NHT A;  1IQ5 A;  2L5Y A;  3CR2 A;  2WND A;  2CT9 A;  2M3W A;  1J7O A;  2PAL A;  1CFC A;  2FJY A;  4QJ4 B;  1FI5 A;  1P28 A;  3KHE A;  2A4J A;  3H4S E;  4L9M A;  2G2B A;  1CLB A;  4UPG A;  4XJK A;  1TTX A;  4MSP A;  1L7Z A;  1CB1 A;  2KQ6 A;  1OMV A;  1Y6W A;  1PUL A;  3KPX A;  1LA3 A;  1PVB A;  2SCP A;  2BKH B;  2ZRT A;  5IBW A;  1YVL A;  2KGB C;  3ZWH A;  1F71 A;  2BCA A;  2JXL A;  2I7A A;  2KAY A;  2KHN A;  3DD4 A;  3O6B A;  1DT7 B;  3VRR A;  1Z2C B;  1WLZ A;  2Y1N A;  1AVS A;  3O4X A;  1KFU S;  2BKI B;  3BUN B;  2MRD A;  5AXI A;  1A2X A;  3D76 A;  1N0Y A;  1TN4 A;  2LC5 A;  3QRX A;  1J1D A;  1MXE A;  2WOR A;  2BBN A;  1TCO B;  3I5G B;  2WCB A;  4ETO A;  1XK4 C;  4GGN A;  3PAT A;  2H61 C;  3S0A A;  1BLQ A;  2E30 A;  1XK4 A;  2KYF A;  2H61 A;  2AMI A;  1KK7 Y;  3BUM B;  2EHB A;  2PRU A;  2Y4Q A;  4PT1 A;  1J7P A;  2HF5 A;  3NSK A;  1DEK A;  1ZMZ A;  3BUO B;  5D69 A;  3CR5 X;  1BMO A;  1K2H A;  4M2O A;  3DF0 A;  1GJY A;  1PVA A;  3KEV A;  1DF0 B;  1XFU O;  2B1U A;  2K2F A;  3R1V A;  1IJ5 A;  1J7R A;  3WHT B;  1CM1 A;  1FI6 A;  2CNP A;  2HQ8 A;  3PJI A;  3NHI A;  3EVR A;  1PSB A;  2KQY A;  1RTP 1;  1MHO A;  1Y1U A;  1F54 A;  2LMT A;  3L47 A;  1EG3 A;  4N1G A;  2KGR A;  2LLS A;  3I5H C;  4ORB B;  4PHM A;  2MHH A;  4YRU A;  3OHM B;  5I94 A;  4WQ2 A;  1OOH A;  2WCH A;  1UUR A;  2K7B A;  2NZ0 A;  3CR4 X;  3HCM A;  1DJZ A;  1J55 A;  1F4O A;  1QS7 A;  1TUZ A;  1GGW A;  5FI2 A;  2ZNE A;  1C07 A;  2PMY A;  1A75 A;  2KLD A;  3VB1 A;  3DVM A;  1NSH A;  1B8L A;  1NUB A;  1XFW O;  2CXJ A;  2D8N A;  2FOT A;  3CTN A;  2M1K B;  5DKQ A;  2L4H A;  5BPJ A;  1DVI A;  4MZK A;  4OVN F;  1YUS A;  2Y1M A;  1GGZ A;  2QEO A;  5J3X A;  1OMR A;  3OBV A;  1NX2 A;  1QJT A;  2M97 A;  1R2U A;  1PK0 D;  3IF7 A;  4R1E A;  4XJK B;  2GGM A;  2LP3 A;  3OP0 A;  2JNF A;  1MQ1 A;  1S6I A;  2YGU A;  1XA5 A;  2HET A;  3LK1 A;  4JPZ B;  3EK7 A;  1MUX A;  1F8H A;  1PRW A;  2QEV A;  1BG1 A;  1YR5 A;  1OZS A;  1HT9 A;  5G08 A;  5FI7 A;  3B87 A;  2I94 A;  3OX5 A;  5I2L A;  1XVJ A;  2M9G A;  3PN7 C;  1G4Y R;  1N2D A;  1D1O A;  1W7J B;  2M0R A;  2LUC A;  1TRF A;  2KOT A;  2BEC A;  2Q91 A;  3SG2 A;  3B88 A;  2LVJ A;  3VRO A;  2F3Y A;  2LMV A;  4U8D A;  1H4B A;  1YX8 A;  2JPT A;  3TDU A;  2LNK A;  1XFV O;  2JXC A;  3CZ2 A;  1C7V A;  4CPV A;  1YUU A;  5ER5 A;  4INX A;  3K21 A;  1EXR A;  1JSA A;  3ICB A;  4OR9 B;  5TNC A;  3R1P A;  4DRW A;  1EG4 A;  3A8R A;  2K7C A;  2ZN9 A;  1WRK A;  1RRO A;  1QIV A;  1DF0 A;  1DJG A;  1C7W A;  5FI6 A;  1DJX A;  3TDI A;  1EL4 A;  2H8V A;  1REC A;  1CDL A;  4OV2 A;  4CFQ A;  2L98 A;  1K95 A;  4TNC A;  2HPS A;  3BUX B;  2GTE A;  3JTD C;  1N65 A;  4ORA B;  4AQI A;  4I5L B;  4P5O E;  1AP4 A;  1QVI Z;  1IQ3 A;  3I5H B;  5HYD A;  3D78 A;  4DUQ A;  4PE1 A;  1ALW A;  4HRG A;  2F8P A;  2LVI A;  3Q8I A;  4YBH B;  2M7N A;  1IG5 A;  1KQM C;  2MJW B;  2MLF C;  2F2O A;  3VGO A;  2KDH A;  4E68 A;  4YGC B;  3NSO A;  1Y1A A;  2Y5I A;  3MSE B;  2JNX A;  2JC2 A;  3AAJ A;  3SG3 A;  1A75 B;  4QJ3 B;  3CZ0 A;  1TNP A;  1SY9 A;  3DXL A;  4PE0 A;  1M63 B;  1OOF A;  2LMU A;  1CNP A;  1J7Q A;  4C0J A;  3BFB A;  2PYQ A;  4MRX A;  4PCW A;  4DCK A;  2WC8 A;  2LE9 B;  1LKJ A;  3PSR A;  2JU0 A;  2F3Z A;  3RLZ A;  3EK4 A;  1JF0 A;  1MXL C;  3RM1 A;  1YTZ C;  5AER A;  1S5G Z;  4PE7 A;  3SS4 A;  2QEH A;  1RFJ A;  1SCM C;  1QAS A;  3CDN A;  4YGD B;  2ZKM X;  2LM5 A;  3PAL A;  1M31 A;  2JTT A;  2ZN8 A;  1MR8 A;  1TNW A;  2V53 A;  3N7H A;  3LLE A;  1H8B A;  2KI6 D;  2NCP A;  1B8R A;  5ER4 X;  3O78 A;  4USL A;  3SG6 A;  1K9U A;  4GBA A;  3PN7 B;  1XFY O;  2LV7 A;  1SNL A;  3BOW B;  5B8I B;  1U5I B;  1TWO A;  4PE4 A;  1K94 A;  5KTY A;  3SG5 A;  1VRK A;  1WDC C;  2JOJ A;  2FJU B;  2RGI A;  3O2P A;  1NCZ A;  3S0D A;  1SBJ A;  4F7F A;  1IRJ A;  1K8U A;  2M1U A;  1CTR A;  1M46 A;  1KFX L;  3BJH A;  2QAC A;  4C0K A;  3NSI A;  1EJ3 A;  3D73 A;  3VRQ A;  3DVE A;  1SK6 D;  2BE6 A;  1T14 A;  1IIO A;  1JF2 A;  3SIA A;  1JWD A;  2G9B A;  1TCF A;  2ZND A;  1S26 D;  1DGV A;  1DEL A;  2LLT A;  1QV0 A;  5HKZ A;  1FBV A;  3R1O A;  1A29 A;  1IJ6 A;  2I2R E;  4GFT A;  4I5J A;  3D0Y B;  3BFA A;  4NQG A;  2COL B;  1XYD A;  3JTD B;  3EVV A;  4CID A;  2BL0 B;  1B47 A;  3KO0 A;  2FCE A;  2EC6 C;  4Q04 A;  2BE4 A;  2LCP A;  1LXF C;  3EKJ A;  4PDZ A;  1GQM A;  1UHK A;  1KQM B;  1WRL A;  4NDC A;  5D3O A;  5D7F A;  3S0G A;  1Z4H A;  4I5N B;  1OOI X;  3D77 A;  4BY5 A;  1JFJ A;  1DJI A;  5K89 A;  3BQ3 A;  2KFF A;  4HRE E;  1M39 A;  3O4Y A;  2L5X B;  2WCL A;  3GOF A;  4GNK B;  1SL7 A;  1BF5 A;  2NCO A;  5JOL A;  2IS9 A;  3D74 A;  2KAV A;  1SR6 C;  2QEB A;  4JD9 A;  3FE9 A;  4M2P A;  3FS7 A;  5PAL A;  3EVU A;  2LVK A;  4F0Z B;  1G8I A;  1NCY A;  2L4I A;  3TS5 B;  4AQJ A;  1BR1 B;  5DKR A;  1SCV A;  1WRZ A;  2OS8 C;  1AK8 A;  2DOQ A;  2M29 A;  1RWY A;  1DJW A;  1UP5 A;  2KI6 C;  1Y1X A;  3CGA A;  3CLN A;  3DZT A;  2JT0 A;  3SIB A;  1SCM B;  1BT6 A;  2JRF A;  2PAS A;  3EKH A;  3BYA A;  4PHK A;  1NX1 A;  1YUR A;  4YGA A;  1OOG A;  3A4U B;  1ZUZ A;  3BOW A;  3FE6 A;  2SAS A;  1U5I A;  1JC2 A;  1XFZ O;  2LP2 A;  1JFK A;  3CZ1 A;  2L0P A;  3FIA A;  1SYM A; 
#chains in the Genus database with same CATH homology
 1XO5 A;  5GQQ C;  1ZAC A;  1WLM A;  1TNQ A;  1QLK A;  2BCX A;  2K8M B;  2O60 A;  4D1E A;  5CPV A;  2NXQ A;  1WDC B;  4GGF C;  2FCD A;  2QPT A;  4NDD A;  4GGF A;  4HRH A;  1QAT A;  4IL1 A;  1KSO A;  3PFV A;  4PHJ A;  3C1V A;  1B1G A;  4MBE A;  4MVF A;  4NDB A;  1SPY A;  5JJG A;  1CDP A;  1NCX A;  1CLL A;  1L2O B;  2E6W A;  4PAL A;  1SMG A;  3AAK A;  3D0Y A;  2MA2 A;  2F33 A;  2BL0 C;  3GK1 A;  1PAL A;  2R2I A;  5AFP A;  1V1F A;  4CFR A;  1M45 A;  1FW4 A;  1NX0 A;  2WOS A;  4JWQ A;  1YX7 A;  1K93 D;  1E8A A;  3LL8 B;  1CFF A;  1NP8 A;  1QVI Y;  1CKK A;  1DGU A;  2KAX A;  3CZT X;  2EC6 B;  1B7T Z;  1ZFS A;  3LK0 A;  5DKN A;  2K61 A;  3SJS A;  1YUT A;  3D10 A;  2PSR A;  4OCI A;  2O5G A;  1FF1 A;  1OE9 B;  1ZOT B;  3TZ1 A;  4MN0 A;  2K0J A;  2M7L A;  2LAN A;  5CSF A;  3WHU B;  3I5F C;  3SG4 A;  3TUY B;  4I5K A;  4MRY A;  3VRP A;  4AOM A;  3TS5 C;  2KBI A;  1TNX A;  2GGZ A;  1SR6 B;  1XFX O;  1CDM A;  4BY4 A;  1B4C A;  2WCE A;  2LHL A;  1CM4 A;  2F2P A;  2LLU A;  4FQO A;  1AJ4 A;  2VRG A;  1CFP A;  5CSI A;  2L50 A;  1S5G Y;  1DJH A;  2OS8 B;  1BR4 B;  3AKB A;  3CS1 A;  4MLW A;  4YI8 A;  1UHN A;  2HQW A;  3BXK A;  1SL8 A;  3SG7 A;  2Q4U A;  2K2A A;  5I2Q A;  1BOD A;  4ZCV A;  1SRA A;  4HSZ A;  2KFH A;  5CSJ A;  1MF8 B;  1OOJ A;  3EK8 A;  1NIW A;  1ODB A;  1UHJ A;  3I5I C;  1AUI B;  2KSP A;  1G33 A;  1KSM A;  4PHN A;  4ORC B;  4ZCU A;  3VRN A;  1KFU L;  3NSL A;  2JZI A;  1UWO A;  5KU1 A;  2CTN A;  4DS7 A;  1UHI A;  5I8N A;  5KSZ A;  5HLO A;  1QTX A;  2PVB A;  1OQP A;  2MBX A;  4XYN A;  1L2O C;  1OSA A;  1KFX S;  1CDN A;  1KK7 Z;  1SKT A;  1OMD A;  3FWB A;  3JVT C;  1R6P A;  2KBM A;  2WCF A;  2LHI A;  3KF9 A;  2JWW A;  1LIN A;  1YRU B;  2H2K A;  3OB2 B;  3WXA A;  5HLV A;  1YRT B;  3E3R A;  2L51 A;  5FYX A;  2BCB A;  3GK4 X;  1BJF A;  2CCM A;  2OPO A;  4YGB B;  1KK8 B;  2M49 B;  1CMG A;  3ZNI A;  3CWG A;  1X02 A;  2KI4 C;  4N1F A;  3TUY C;  1NYA A;  3WNX B;  4OKH A;  1QX5 B;  2CBL A;  1F4Q A;  2OTG C;  3HX4 A;  3I5F B;  2EGD A;  1DJY A;  4FTG A;  1S1E A;  1SL9 A;  3IQQ A;  2KFG A;  1S3P A;  1OZO A;  1KWO B;  1CFD A;  1S6J A;  1QX7 A;  1SW8 A;  1QXP A;  5I2O A;  2KNE A;  1ALV A;  4YI9 A;  2MLE C;  5HKW A;  1W7I B;  1LA0 A;  1TIZ A;  4C0L A;  1F70 A;  2GV5 A;  1B8C A;  1UHH A;  4MZL A;  3LCP C;  2K7O A;  1CLM A;  1IGV A;  1K9P A;  1JUO A;  4P2Y B;  3I5I B;  4DIR A;  1QLS A;  1F55 A;  1A4P A;  3DVK A;  3TDZ A;  1TOP A;  4A4C A;  3M0W A;  1NX3 A;  1BU3 A;  1QV1 A;  2JT3 A;  1AHR A;  5AEQ A;  1A03 A;  2LUX A;  2MAZ A;  1B9A A;  1K9K A;  3I5G C;  3OB1 B;  1LVC D;  1Q80 A;  2ZRS A;  4YGE B;  1K96 A;  4QJ5 B;  5HKY A;  4WQ3 A;  1S6C A;  2JT8 A;  1AJ5 A;  3JVT B;  2ISD A;  1DMO A;  1RJV A;  1FPW A;  1YVH A;  2I18 A;  3GK2 A;  4M2Q A;  4N5X A;  5CSN A;  1Y0V H;  1V1G A;  2KYC A;  1HQV A;  1K90 D;  2M8U A;  3IQO A;  4MZJ A;  4WRI A;  2L2E A;  2P6B B;  1PSR A;  2NLN A;  2K7D A;  3DVJ A;  3NXA A;  1RK9 A;  3BUW B;  5AAN A;  3DF0 B;  4CLN A;  1KK8 C;  3PM8 A;  3OX6 A;  2AUC A;  1CMF A;  1IH0 A;  4MEW A;  1MWN A;  4GPL B;  1J1E A;  3F45 A;  4GAO A;  4ICB A;  1B7T Y;  1BOC A;  5F6T A;  1JBA A;  1DTL A;  2LAP A;  2LVV A;  3FWC A;  4A4B A;  1KCY A;  2BBM A;  3PLF B;  2JUL A;  2KI4 B;  2JTZ A;  2AAO A;  4JQ0 D;  1QX2 A;  1KQV A;  1IWQ A;  2ZFD A;  1NWD A;  1WY9 A;  4GUK A;  3AKA A;  1UUS A;  2OTG B;  1F54 A;  1KWO C;  1EH2 A;  1S36 A;  1NPQ A;  2TN4 A;  1IKU A;  1QIW A;  2JQ6 A;  1IQ5 A;  3CR2 A;  2WND A;  2CT9 A;  2M3W A;  1J7O A;  2PAL A;  1CFC A;  4QJ4 B;  1FI5 A;  3KHE A;  2A4J A;  3H4S E;  4L9M A;  2G2B A;  1CLB A;  4UPG A;  4XJK A;  1TTX A;  4MSP A;  1L7Z A;  1CB1 A;  2KQ6 A;  1OMV A;  1Y6W A;  1PUL A;  3KPX A;  1LA3 A;  1PVB A;  2SCP A;  2BKH B;  2ZRT A;  5IBW A;  1YVL A;  2KGB C;  3ZWH A;  1F71 A;  2BCA A;  2JXL A;  2I7A A;  2KAY A;  2KHN A;  3DD4 A;  3O6B A;  1DT7 B;  3VRR A;  1WLZ A;  2Y1N A;  1AVS A;  1KFU S;  2BKI B;  3BUN B;  2MRD A;  5AXI A;  1A2X A;  1N0Y A;  1TN4 A;  2LC5 A;  3QRX A;  1J1D A;  1MXE A;  2WOR A;  2BBN A;  1TCO B;  3I5G B;  2WCB A;  4ETO A;  1XK4 C;  4GGN A;  3PAT A;  2H61 C;  1BLQ A;  2E30 A;  1XK4 A;  2KYF A;  2H61 A;  2AMI A;  1KK7 Y;  3BUM B;  2EHB A;  2PRU A;  2Y4Q A;  1J7P A;  2HF5 A;  3NSK A;  1ZMZ A;  3BUO B;  5D69 A;  3CR5 X;  1BMO A;  1K2H A;  4M2O A;  3DF0 A;  1GJY A;  1PVA A;  3KEV A;  1DF0 B;  1XFU O;  2B1U A;  2K2F A;  1IJ5 A;  1J7R A;  3WHT B;  1CM1 A;  1FI6 A;  2CNP A;  2HQ8 A;  3EVR A;  1PSB A;  2KQY A;  1RTP 1;  1MHO A;  1Y1U A;  2LMT A;  4N1G A;  1EG3 A;  4ORB B;  2KGR A;  2LLS A;  3I5H C;  4PHM A;  4YRU A;  2MHH A;  3OHM B;  4WQ2 A;  1UUR A;  2K7B A;  2NZ0 A;  3CR4 X;  3HCM A;  1DJZ A;  1J55 A;  1F4O A;  1QS7 A;  1GGW A;  2ZNE A;  1C07 A;  2PMY A;  1A75 A;  3DVM A;  1NSH A;  1B8L A;  1NUB A;  1XFW O;  2CXJ A;  2D8N A;  2FOT A;  3CTN A;  2M1K B;  5DKQ A;  2L4H A;  5BPJ A;  1DVI A;  4MZK A;  4OVN F;  1YUS A;  2Y1M A;  1GGZ A;  5J3X A;  1OMR A;  1NX2 A;  1QJT A;  2M97 A;  1R2U A;  1PK0 D;  3IF7 A;  4R1E A;  4XJK B;  2GGM A;  2LP3 A;  3OP0 A;  2JNF A;  1MQ1 A;  1S6I A;  1XA5 A;  2HET A;  3LK1 A;  4JPZ B;  3EK7 A;  1MUX A;  1F8H A;  1PRW A;  1BG1 A;  1YR5 A;  1OZS A;  1HT9 A;  5G08 A;  2I94 A;  3OX5 A;  5I2L A;  1XVJ A;  2M9G A;  3PN7 C;  1G4Y R;  1N2D A;  1D1O A;  1W7J B;  2M0R A;  2LUC A;  1TRF A;  2KOT A;  2BEC A;  2Q91 A;  3SG2 A;  2LVJ A;  3VRO A;  2F3Y A;  2LMV A;  4U8D A;  1H4B A;  1YX8 A;  2JPT A;  3TDU A;  2LNK A;  1XFV O;  2JXC A;  1C7V A;  4CPV A;  1YUU A;  5ER5 A;  3K21 A;  1EXR A;  1JSA A;  3ICB A;  4OR9 B;  5TNC A;  4DRW A;  1EG4 A;  3A8R A;  2K7C A;  2ZN9 A;  1WRK A;  1RRO A;  1QIV A;  1DF0 A;  1DJG A;  1C7W A;  1DJX A;  3TDI A;  1EL4 A;  1REC A;  1CDL A;  4OV2 A;  4CFQ A;  2L98 A;  1K95 A;  4TNC A;  2HPS A;  3BUX B;  3JTD C;  1N65 A;  4ORA B;  4AQI A;  4I5L B;  4P5O E;  1AP4 A;  1QVI Z;  1IQ3 A;  3I5H B;  5HYD A;  4DUQ A;  4PE1 A;  1ALW A;  4HRG A;  2F8P A;  2LVI A;  4YBH B;  2M7N A;  1IG5 A;  1KQM C;  2MJW B;  2MLF C;  2F2O A;  3VGO A;  2KDH A;  4E68 A;  4YGC B;  3NSO A;  1Y1A A;  2Y5I A;  3MSE B;  2JNX A;  2JC2 A;  3AAJ A;  3SG3 A;  1A75 B;  4QJ3 B;  1TNP A;  1SY9 A;  4PE0 A;  1M63 B;  2LMU A;  1CNP A;  1J7Q A;  4C0J A;  4DCK A;  4MRX A;  4PCW A;  2WC8 A;  2LE9 B;  1LKJ A;  3PSR A;  2JU0 A;  2F3Z A;  3RLZ A;  3EK4 A;  1JF0 A;  1MXL C;  3RM1 A;  1YTZ C;  5AER A;  1S5G Z;  4PE7 A;  1RFJ A;  1SCM C;  1QAS A;  4YGD B;  2ZKM X;  2LM5 A;  3PAL A;  1M31 A;  2JTT A;  2ZN8 A;  1MR8 A;  1TNW A;  2V53 A;  3LLE A;  1H8B A;  2KI6 D;  2NCP A;  1B8R A;  5ER4 X;  3O78 A;  4USL A;  3SG6 A;  1K9U A;  4GBA A;  3PN7 B;  1XFY O;  2LV7 A;  1SNL A;  3BOW B;  5B8I B;  1U5I B;  5KTY A;  4PE4 A;  1K94 A;  3SG5 A;  1VRK A;  1WDC C;  2JOJ A;  2FJU B;  2RGI A;  3O2P A;  1NCZ A;  1SBJ A;  1IRJ A;  1K8U A;  2M1U A;  1CTR A;  1M46 A;  1KFX L;  2QAC A;  4C0K A;  3NSI A;  1EJ3 A;  3VRQ A;  3DVE A;  1SK6 D;  2BE6 A;  1JF2 A;  3SIA A;  1JWD A;  2G9B A;  1TCF A;  2ZND A;  1S26 D;  1DGV A;  2LLT A;  1QV0 A;  5HKZ A;  1FBV A;  1A29 A;  1IJ6 A;  2I2R E;  4GFT A;  4I5J A;  3D0Y B;  4NQG A;  2COL B;  1XYD A;  3JTD B;  3EVV A;  4CID A;  2BL0 B;  1B47 A;  3KO0 A;  2FCE A;  2EC6 C;  4Q04 A;  2BE4 A;  2LCP A;  1LXF C;  3EKJ A;  4PDZ A;  1GQM A;  1UHK A;  1KQM B;  1WRL A;  4NDC A;  5D7F A;  4I5N B;  4BY5 A;  1JFJ A;  1DJI A;  5K89 A;  3BQ3 A;  2KFF A;  4HRE E;  1M39 A;  3O4Y A;  2L5X B;  3GOF A;  4GNK B;  1SL7 A;  1BF5 A;  2NCO A;  5JOL A;  2IS9 A;  2KAV A;  1SR6 C;  4M2P A;  3FS7 A;  5PAL A;  3EVU A;  2LVK A;  4F0Z B;  1G8I A;  1NCY A;  2L4I A;  3TS5 B;  4AQJ A;  1BR1 B;  5DKR A;  1SCV A;  1WRZ A;  2OS8 C;  1AK8 A;  2DOQ A;  2M29 A;  1RWY A;  1DJW A;  1UP5 A;  2KI6 C;  1Y1X A;  3CGA A;  3CLN A;  3SIB A;  2JT0 A;  1SCM B;  1BT6 A;  2JRF A;  2PAS A;  3EKH A;  3BYA A;  4PHK A;  1NX1 A;  1YUR A;  4YGA A;  3A4U B;  1ZUZ A;  3BOW A;  2SAS A;  1U5I A;  1JC2 A;  1XFZ O;  2LP2 A;  1JFK A;  3FIA A;  2L0P A;  1SYM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...