2PALA

Ionic interactions with parvalbumins. crystal structure determination of pike 4.10 parvalbumin in four different ionic environments
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
107
structure length
107
Chain Sequence
SFAGLKDADVAAALAACSAADSFKHKEFFAKVGLASKSLDDVKKAFYVIDQDKSGFIEEDELKLFLQNFSPSARALTDAETKAFLADGDKDGDGMIGVDEFAAMIKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PARVALBUMIN
publication title Ionic interactions with parvalbumins. Crystal structure determination of pike 4.10 parvalbumin in four different ionic environments.
pubmed doi rcsb
source organism Esox lucius
molecule tags Calcium binding protein
total genus 39
structure length 107
sequence length 107
ec nomenclature
pdb deposition date 1990-11-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2palA00
4CFRA 2LUXA 2JU0A 2LLTA 2BKIB 3M0WA 4N1FA 3O4YA 4I5LB 1DMOA 1TCFA 4TNCA 4YGEB 1BF5A 5CSIA 2ZNDA 2GGZA 3NSIA 3AKBA 2I7AA 4BY4A 4MVFA 2L0PA 3GK4X 4DCKA 1K8UA 3I5HB 4YI9A 2K2FA 2VRGA 2L5XB 1AHRA 1G4YR 1HQVA 1B8CA 1N2DA 2H61A 4OKHA 4QJ5B 1QJTA 5HKYA 3I5HC 1TRFA 3LK1A 2JNXA 2NCOA 4PHJA 3LK0A 5DKNA 1WY9A 1VRKA 1C7VA 1G8IA 3CR4X 3MSEB 4MN0A 5FYXA 5D69A 4MRXA 2F33A 1J1DA 3NSKA 1LVCD 3A4UB 5ER4X 2K7CA 3VRRA 4C0JA 1JF0A 2ZNEA 1JUOA 3I5IC 3DF0A 1OMVA 2PVBA 2I18A 4U8DA 2JNFA 4C0KA 1A75A 4IL1A 3ZNIA 5BPJA 1A03A 1EJ3A 2LHLA 2DOQA 1BR1B 1YVLA 2CXJA 4P2YB 2M1UA 1U5IB 1JFJA 1V1FA 2LAPA 4MRYA 3TUYB 3CR2A 1FPWA 1YX7A 2G2BA 5B8IB 3LLEA 1JSAA 4MZJA 1CDPA 1CDLA 4R1EA 1PSBA 1A4PA 5I2LA 1J55A 3CWGA 3EK4A 1NUBA 1KSOA 4PHMA 2E30A 4HSZA 1EG4A 1ALWA 3BUNB 1X02A 2LHIA 3EK7A 2OS8B 2F3YA 1FW4A 3OB1B 4PE1A 1NIWA 2LP2A 4PALA 3HCMA 1IH0A 1WRLA 3CTNA 1S6JA 1CLLA 1XFUO 4MZKA 1B8RA 3SIBA 1EH2A 4AQJA 2KFFA 1BJFA 1KFUL 1KK8B 1QASA 1SR6B 1F4OA 3LCPC 4ORCB 1JFKA 3OP0A 2LMUA 3EKJA 1MWNA 1BODA 1WRZA 1U5IA 2B1UA 1OZOA 3QRXA 2KBMA 2OPOA 4QJ4B 4BY5A 2LVVA 1PRWA 1JC2A 2FCDA 4NDCA 3JVTC 2KAYA 2L98A 2EHBA 4HREE 1OE9B 2JC2A 1ZFSA 2BBNA 1TNPA 2WCBA 3O6BA 1QX2A 1CMGA 1MR8A 2WCFA 1UURA 5AFPA 2I2RE 2MLFC 2L4HA 3EK8A 1XA5A 4MEWA 2LLSA 3KEVA 3TS5B 2CBLA 5K89A 1CM1A 1XFWO 1CTRA 2L51A 2Y4QA 4ZCUA 1UHIA 3WXAA 1DJXA 3OHMB 3E3RA 1UWOA 1TCOB 1OMRA 2BE4A 2L4IA 1PSRA 1XYDA 1DJWA 3I5FC 1CFFA 2LCPA 3TDZA 4YRUA 4FTGA 5AXIA 1E8AA 2CCMA 5CSNA 1ODBA 2HQWA 1CNPA 1K94A 3CS1A 2JULA 1J7OA 1QV0A 1SL7A 1MUXA 1YUUA 4I5KA 1MXEA 2KSPA 1FBVA 1Y1UA 1B47A 1F4QA 1DJGA 2JOJA 2JPTA 2LM5A 2HETA 1IJ5A 2KI6C 1WLMA 1S26D 1S36A 4JQ0D 4AOMA 1J1EA 1Y0VH 1Y6WA 2LMTA 1QXPA 2CTNA 1Q80A 2ZKMX 3GK2A 1AK8A 1ZACA 2LVJA 3OX6A 4PCWA 1UP5A 1KSMA 1NX1A 2Y5IA 1D1OA 1QX7A 1XFYO 2LV7A 2TN4A 3TZ1A 2K7BA 3PSRA 1S6IA 1RECA 1C07A 2ZRTA 2JXCA 1R6PA 3AKAA 1BU3A 2KDHA 1OMDA 1KK7Z 1NPQA 5CSJA 4M2OA 1DGUA 1KQMC 3CLNA 3DVJA 1SPYA 2JXLA 4QJ3B 4GGFC 2KQYA 4I5JA 2AAOA 4JPZB 2JRFA 1XK4A 4HRGA 3SJSA 1ALVA 1BR4B 1M63B 2KOTA 2O60A 4GBAA 1FI5A 2LC5A 3OB2B 2F2PA 3I5IB 2WCEA 4ORBB 5HKZA 5I2OA 4XYNA 1MF8B 3KHEA 1V1GA 2AUCA 1Y1XA 2LE9B 1R2UA 3BUMB 2HF5A 3SG2A 4FQOA 1H4BA 2M9GA 2EC6C 4N1GA 1YVHA 2WNDA 3SG6A 2SASA 1C7WA 5IBWA 1EXRA 1MQ1A 2MRDA 3O78A 2BCXA 5JOLA 1K93D 1SKTA 2I94A 4YGCB 4DUQA 1IQ5A 2BE6A 1LXFC 2FJUB 2OTGC 4GNKB 4WRIA 2JT3A 1SL9A 4N5XA 1M45A 1TNWA 4M2PA 3F45A 1YR5A 2AMIA 1A29A 2BCBA 3RM1A 1NCXA 1LKJA 1FF1A 4OVNF 3D0YB 1IGVA 3NSOA 1GGWA 1KCYA 1M46A 2KAXA 5KU1A 2PMYA 2BKHB 1QS7A 2M7NA 4GPLB 3FWBA 4NDDA 1UUSA 2KI4C 3JTDC 1QLSA 2M49B 1WDCB 1SY9A 2NLNA 2E6WA 1CB1A 3EKHA 3O2PA 2LVIA 3VRNA 1AJ5A 1CDMA 3PLFB 1WDCC 1RJVA 3K21A 1WRKA 1CFPA 1CLBA 2KYFA 1EG3A 2GGMA 1S1EA 3BUWB 1N0YA 2MA2A 1CDNA 1M31A 2D8NA 2F3ZA 2K7OA 1LA0A 2LUCA 4CIDA 1OOJA 4DIRA 1IKUA 2FOTA 1GQMA 2JTTA 3JVTB 3IQQA 1CLMA 1QVIZ 3BUXB 1NCYA 2Q4UA 1QTXA 1QVIY 1RFJA 4ZCVA 4YGBB 4D1EA 1KQVA 1YURA 2LLUA 2MHHA 2KYCA 4PE4A 1UHNA 1SCVA 1DJHA 1UHJA 4YGDB 2Q91A 2LNKA 1FI6A 2BECA 3D0YA 1K96A 1SNLA 2ZRSA 1GGZA 1QIVA 2LVKA 1UHKA 2H2KA 2ZN8A 3KF9A 3I5FB 5DKQA 2M1KB 2MBXA 1G33A 2EGDA 4CLNA 1TNQA 1DF0B 3FIAA 4ORAB 3CGAA 3PN7C 4ETOA 2COLB 2L2EA 4OV2A 4GAOA 1J7PA 1L2OC 1YRTB 2K61A 4I5NB 4PDZA 1RWYA 1QV1A 4CFQA 1XVJA 3I5GC 3A8RA 1AP4A 1YRUB 3NSLA 5HLVA 1JBAA 2QPTA 5HLOA 1KFXS 3BUOB 1NX0A 2KFGA 4MZLA 1QLKA 2IS9A 1YUSA 1PALA 2JWWA 2R2IA 1NYAA 1DJIA 1J7RA 2BBMA 4YBHB 1XFZO 4A4BA 1DT7B 2A4JA 1EL4A 3DVKA 1S6CA 5HKWA 2M0RA 1SMGA 2NCPA 2H61C 2K0JA 1DF0A 1KQMB 2K2AA 4A4CA 1TIZA 2BCAA 1KK7Y 1W7JB 2LANA 1TNXA 2FCEA 2BL0C 4L9MA 1CM4A 1B7TZ 1BT6A 1DGVA 1KFUS 2MAZA 1DVIA 3VRQA 1B7TY 2GV5A 1XFVO 1IG5A 4OCIA 1S5GZ 1GJYA 1XFXO 1NX3A 2KBIA 1A2XA 4XJKB 3C1VA 1SL8A 5I8NA 3DD4A 1OSAA 1BG1A 2EC6B 3KPXA 5GQQC 1NSHA 1QIWA 3TDIA 2PRUA 2JTZA 2L50A 3LL8B 4C0LA 3ICBA 2HQ8A 1Y1AA 2LP3A 1CFDA 2MLEC 1UHHA 3PFVA 2JT0A 4PHNA 2KGRA 2OTGB 1NP8A 3NXAA 4WQ2A 4USLA 2KAVA 1SK6D 1RTP1 3CZTX 5AANA 2M8UA 1IWQA 2JT8A 1NX2A 5PALA 5AERA 4GGFA 4AQIA 2JQ6A 3PM8A 2PALA 2CNPA 3KO0A 3BOWB 4NDBA 2KI4B 1YX8A 2RGIA 2O5GA 3JTDB 3PALA 3PATA 4PE7A 1F71A 1K9UA 4MSPA 1KFXL 2M29A 2M97A 2M7LA 2JZIA 4E68A 1B1GA 4XJKA 1J7QA 2Y1NA 3BQ3A 1K9PA 3ZWHA 2ZN9A 5G08A 4PHKA 1F70A 1K95A 3IQOA 1AVSA 1K90D 3EVRA 2F8PA 1M39A 2KI6D 3H4SE 2ZFDA 4OR9B 3VGOA 5F6TA 3TUYC 1NWDA 5ER5A 2P6BB 4PE0A 1IRJA 1K2HA 4MLWA 1OQPA 1IJ6A 2KHNA 1S3PA 2M3WA 2NZ0A 3VRPA 1B9AA 1DJYA 1PULA 2OS8C 1OZSA 2WC8A 4JWQA 1PVAA 1RK9A 3AAKA 4Q04A 1AUIB 5KTYA 3SG3A 2LMVA 1PVBA 2K7DA 3CR5X 1B8LA 1AJ4A 3BOWA 4DRWA 3WNXB 4DS7A 1LINA 2HPSA 3DVEA 5KSZA 1SCMB 1SW8A 5I2QA 2KGBC 1KK8C 1K9KA 1MHOA 1SR6C 1ZUZA 3PN7B 3FS7A 1SCMC 1L2OB 1TOPA 2PASA 5TNCA 5DKRA 1F55A 1SRAA 1BMOA 1DTLA 1TN4A 3I5GB 5D7FA 2ISDA 1ZMZA 3EVUA 4F0ZB 1QX5B 1TTXA 2PSRA 4YGAA 1L7ZA 2Y1MA 3GK1A 4NQGA 4ICBA 3DVMA 3GOFA 3BYAA 2QACA 1YUTA 2WORA 3OX5A 2K8MB 1MXLC 1YTZC 2F2OA 1F54A 3SG7A 2NXQA 1CFCA 3TS5C 4CPVA 1JF2A 2MJWB 1SBJA 4YI8A 1JWDA 3FWCA 4M2QA 3VROA 3D10A 2KFHA 5CPVA 5CSFA 3SG5A 1N65A 1HT9A 2KQ6A 3HX4A 1WLZA 3RLZA 1BLQA 5J3XA 3SIAA 4P5OE 3WHTB 3SG4A 4GFTA 1QATA 5JJGA 1ZOTB 2CT9A 1H8BA 2WOSA 2G9BA 3AAJA 1XO5A 1SYMA 1LA3A 1PK0D 1RROA 4GUKA 2BL0B 4WQ3A 2SCPA 1XK4C 1CMFA 1NCZA 3IF7A 5AEQA 1IQ3A 3EVVA 3DF0B 3TDUA 1KWOB 1W7IB 1F8HA 1DJZA 4GGNA 3BXKA 2V53A 4MBEA 1B4CA 1A75B 5HYDA 1BOCA 1KWOC 4HRHA 3WHUB 1CKKA 1S5GY 4UPGA 2KNEA
chains in the Genus database with same CATH superfamily
4CFRA 2LUXA 2JU0A 2LLTA 2BKIB 3M0WA 4N1FA 3O4YA 4I5LB 1DMOA 1TCFA 4TNCA 4YGEB 1BF5A 5CSIA 2ZNDA 2GGZA 3NSIA 3AKBA 2I7AA 3K1EA 4BY4A 4MVFA 2L0PA 3GK4X 4DCKA 1K8UA 3I5HB 4OZDA 4YI9A 2K2FA 2VRGA 3FE9A 2L5XB 1AHRA 1G4YR 1HQVA 1B8CA 1N2DA 2H61A 4OKHA 4QJ5B 1QJTA 5HKYA 3I5HC 1TRFA 1P28A 3LK1A 2JNXA 2NCOA 4PHJA 3LK0A 5DKNA 1LS8A 1VRKA 1WY9A 1C7VA 3S0FA 1G8IA 3CR4X 3MSEB 4MN0A 5FYXA 3CZ2A 5D69A 4MRXA 2F33A 1J1DA 3NSKA 1LVCD 3A4UB 3D76A 2K7CA 5ER4X 3VRRA 4C0JA 1JF0A 2ZNEA 1JUOA 3I5IC 3NHIA 3DF0A 1OMVA 2PVBA 2I18A 4U8DA 1OOHA 2JNFA 3D77A 4C0KA 1A75A 4IL1A 3ZNIA 5BPJA 3CDNA 1A03A 1EJ3A 2LHLA 2DOQA 1BR1B 1YVLA 2CXJA 4P2YB 2M1UA 1U5IB 1JFJA 1V1FA 2LAPA 4FQTA 4MRYA 3TUYB 3CR2A 1ORGA 1FPWA 1YX7A 2G2BA 5B8IB 3LLEA 1JSAA 4MZJA 1CDPA 1CDLA 4R1EA 1PSBA 1A4PA 5I2LA 1J55A 3CWGA 3EK4A 1NUBA 1KSOA 4PHMA 2E30A 1Z2CB 4HSZA 1EG4A 1ALWA 3DY9A 3BUNB 1X02A 2LHIA 3EK7A 2OS8B 2F3YA 1FW4A 3OB1B 4PE1A 1NIWA 2LP2A 4PALA 3HCMA 1IH0A 1WRLA 4PT1A 3CTNA 1S6JA 1CLLA 1XFUO 4MZKA 1B8RA 3SIBA 1EH2A 1GM0A 4AQJA 2KFFA 1BJFA 1DQEA 1KFUL 3BFBA 1KK8B 1QASA 1SR6B 1F4OA 3LCPC 4ORCB 1XFRA 3PM2A 1JFKA 3OP0A 2LMUA 3EKJA 1MWNA 1BODA 1WRZA 1U5IA 2B1UA 1OZOA 3QRXA 2KBMA 2OPOA 4QJ4B 4BY5A 2LVVA 1PRWA 2QEBA 2FCDA 3S0BA 1JC2A 4NDCA 3JVTC 2KAYA 2P71A 2L98A 2EHBA 4HREE 1OE9B 2JC2A 1TUZA 1ZFSA 2BBNA 1TNPA 2WCBA 3O6BA 1QX2A 1CMGA 1MR8A 2WCFA 1UURA 5AFPA 2I2RE 2MLFC 2L4HA 3EK8A 1XA5A 4MEWA 2LLSA 3KEVA 3TS5B 2CBLA 5K89A 1CM1A 1XFWO 1CTRA 2L51A 2Y4QA 4ZCUA 1UHIA 3WXAA 1DJXA 3OHMB 4JD9A 3E3RA 1UWOA 1TCOB 1OMRA 2BE4A 2L4IA 1PSRA 1XYDA 1DJWA 3CZ1A 3I5FC 1CFFA 2LCPA 3TDZA 4YRUA 3UNWA 4FTGA 1Z4HA 5AXIA 1E8AA 2L5YA 2CCMA 2BNXA 5CSNA 1ODBA 2HQWA 1CNPA 1K94A 5FI6A 3CS1A 2JULA 1J7OA 1QV0A 1SL7A 1MUXA 1YUUA 4I5KA 1MXEA 2GTEA 2KSPA 1FBVA 1Y1UA 1B47A 1F4QA 1DJGA 2JOJA 2JPTA 2LM5A 1SSEB 2HETA 1IJ5A 2KI6C 1WLMA 1S26D 1S36A 2WC6A 4JQ0D 4AOMA 4F7FA 1J1EA 1Y0VH 2QDIA 1Y6WA 1TWOA 2LMTA 1C3YA 1QXPA 2CTNA 1Q80A 2ZKMX 3GK2A 1AK8A 1ZACA 2LVJA 3OX6A 4PCWA 1UP5A 1KSMA 1T14A 1NX1A 2Y5IA 1D1OA 1QX7A 1XFYO 2LV7A 2TN4A 3TZ1A 2K7BA 3PSRA 1S6IA 1RECA 3S0DA 1C07A 2ZRTA 2ERBA 2JXCA 1R6PA 3AKAA 1BU3A 2KDHA 3NGVA 1OMDA 3BFHA 1KK7Z 1NPQA 5CSJA 4M2OA 1DELA 1DGUA 1KQMC 3CLNA 3DVJA 1SPYA 3VB1A 2JXLA 4QJ3B 4GGFC 3BJHA 2YGUA 2KQYA 1TUJA 3L4AA 4I5JA 2AAOA 4JPZB 3B87A 2JRFA 3NHTA 1XK4A 4HRGA 3SJSA 1ALVA 1BR4B 1M63B 2KOTA 2O60A 3FE6A 4GBAA 1FI5A 2LC5A 3OB2B 2F2PA 3I5IB 2WCEA 4ORBB 2QEHA 4INWA 5HKZA 5I2OA 2KPHA 3S0GA 4XYNA 1MF8B 3KHEA 1V1GA 2AUCA 1Y1XA 2LE9B 1R2UA 3BUMB 2HF5A 3DZTA 3QMEA 3SG2A 4FQOA 1H4BA 2M9GA 2EC6C 4N1GA 1YVHA 2WNDA 3SG6A 2JPOA 2SASA 1C7WA 5IBWA 1EXRA 1MQ1A 2MRDA 3O78A 2BCXA 5JOLA 1K93D 1OW4A 1SKTA 2I94A 5I94A 3R72A 3D74A 1IQ5A 1LXFC 2BE6A 2FJUB 2OTGC 4GNKB 4WRIA 4YGCB 2JT3A 1SL9A 3L47A 4N5XA 2PYQA 1M45A 2QEVA 1TNWA 4M2PA 3F45A 1YR5A 2AMIA 1A29A 2BCBA 3RM1A 1NCXA 1LKJA 1FF1A 4OVNF 3D0YB 1IGVA 2K60A 3NSOA 3CABA 1GGWA 1KCYA 1M46A 2KAXA 5KU1A 2PMYA 5HL1A 2BKHB 1QS7A 2M7NA 4GPLB 3FWBA 4NDDA 1UUSA 2KI4C 3JTDC 2QEOA 1QLSA 2M49B 1WDCB 1SY9A 2NLNA 2E6WA 1CB1A 1DC1A 3B7AA 3EKHA 3O2PA 2LVIA 3VRNA 1AJ5A 1CDMA 3PLFB 1WDCC 1RJVA 3B6XA 1WRKA 3K21A 1CFPA 2KYFA 1QWVA 1EG3A 2GGMA 1CLBA 1S1EA 3BUWB 1N0YA 2MA2A 1CDNA 1M31A 2D8NA 2F3ZA 2K7OA 1LA0A 2LUCA 5FI2A 1OOJA 4CIDA 4DIRA 1IKUA 2FOTA 1GQMA 2JTTA 3JVTB 3IQQA 1CLMA 1QVIZ 3BUXB 1NCYA 2Q4UA 3DYEA 1QTXA 4IJ7A 3D75A 1QVIY 1RFJA 2WCLA 2PQLA 4YGBB 4ZCVA 4D1EA 1KQVA 1YURA 2LLUA 2MHHA 2KYCA 3EG5B 1UHNA 4PE4A 1SCVA 1DJHA 1DEKA 1UHJA 4YGDB 2Q91A 2LNKA 4INXA 1FI6A 2BECA 3D0YA 1K96A 1SNLA 2ZRSA 1GGZA 1QIVA 2LVKA 1UHKA 2H2KA 2ZN8A 3KF9A 3I5FB 5DKQA 2M1KB 2MBXA 1G33A 2WCMA 5D3OA 2EGDA 4CLNA 1TNQA 1DF0B 3FIAA 4ORAB 3CGAA 3PN7C 4ETOA 2COLB 2L2EA 4OV2A 3BFAA 4GAOA 1J7PA 1L2OC 1YRTB 2K61A 4I5NB 4PDZA 1RWYA 1QV1A 4CFQA 1XVJA 3I5GC 3A8RA 1AP4A 1YRUB 3NSLA 5HLVA 1JBAA 2QPTA 2WC5A 5HLOA 1KFXS 3BUOB 4KYNA 1NX0A 2KFGA 4MZLA 1QLKA 2IS9A 1YUSA 1PALA 2JWWA 3O4XA 3S0AA 2R2IA 1NYAA 3FE8A 1OOGA 3S0EA 3L4LA 1DJIA 1J7RA 2BBMA 4YBHB 1XFZO 4A4BA 1DT7B 2A4JA 1EL4A 3DVKA 5DICA 1OOIX 1S6CA 5HKWA 2M0RA 1SMGA 3CZ0A 2NCPA 2H61C 3D78A 2K0JA 1DF0A 1KQMB 3OGNA 2K2AA 4A4CA 1TIZA 3D73A 2BCAA 1KK7Y 1W7JB 2LANA 1TNXA 2FCEA 2BL0C 4L9MA 1CM4A 5FI7A 1B7TZ 1BT6A 1DGVA 1KFUS 2MAZA 1DVIA 3VRQA 1B7TY 2GV5A 1XFVO 2WCHA 1IG5A 4OCIA 1S5GZ 1GJYA 1XFXO 1NX3A 2KBIA 1A2XA 4XJKB 3C1VA 1SL8A 5I8NA 3DD4A 1OSAA 1BG1A 2EC6B 3KPXA 5GQQC 1NSHA 1QIWA 3TDIA 2PRUA 2JTZA 2L50A 2P70A 3LL8B 4C0LA 3ICBA 2HQ8A 1Y1AA 2LP3A 1CFDA 2MLEC 1UHHA 3PFVA 2JT0A 4PHNA 3OBVA 3SS4A 2KGRA 2OTGB 1NP8A 3NXAA 4WQ2A 4USLA 2KAVA 1SK6D 1RTP1 3CZTX 5AANA 2M8UA 1IWQA 2JT8A 1NX2A 5PALA 5AERA 4GGFA 4AQIA 2JQ6A 3CYZA 3PM8A 2PALA 2CNPA 3KO0A 3R1VA 3BOWB 4NDBA 2KI4B 3V2LA 1YX8A 2RGIA 2O5GA 3JTDB 3PALA 3PATA 4PE7A 1F71A 1K9UA 4MSPA 1KFXL 2M29A 2M97A 2M7LA 2JZIA 4E68A 1B1GA 4XJKA 1J7QA 2Y1NA 3BQ3A 3R1PA 1K9PA 3ZWHA 2ZN9A 5G08A 4PHKA 1F70A 1K95A 3IQOA 1AVSA 1K90D 3B86A 3EVRA 2F8PA 3UO9A 1M39A 2KI6D 3H4SE 2ZFDA 4OR9B 2H8VA 5F6TA 3VGOA 1NWDA 5ER5A 3TUYC 2P6BB 1W9ZA 4PE0A 1IRJA 1K2HA 4MLWA 1OQPA 1IJ6A 2KHNA 1S3PA 4DUQA 2M3WA 2NZ0A 4JKTA 3VRPA 1B9AA 1DJYA 1PULA 2OS8C 2KLDA 1OZSA 2WC8A 4JWQA 1PVAA 1RK9A 3AAKA 4Q04A 1AUIB 3PJIA 3SG3A 5KTYA 2LMVA 1PVBA 2K7DA 3CR5X 1B8LA 1AJ4A 3BOWA 4DRWA 3WNXB 4DS7A 1LINA 2HPSA 1OOFA 3DVEA 1SCMB 1SW8A 5KSZA 5I2QA 2KGBC 1KK8C 3SS3A 1K9KA 1MHOA 1SR6C 3SS5A 1ZUZA 3IVTA 3PN7B 3FS7A 3R1OA 1SCMC 2WCJA 2KLEA 1IIOA 1L2OB 1TOPA 2PASA 5TNCA 5DKRA 1F55A 1SRAA 1BMOA 1DTLA 1TN4A 3I5GB 5D7FA 2ISDA 1ZMZA 3EVUA 4F0ZB 1QX5B 1TTXA 2PSRA 3DXLA 1L7ZA 2Y1MA 3GK1A 4YGAA 4NQGA 4ICBA 3DVMA 3Q8IA 5EL2A 3GOFA 3BYAA 2BAPA 2QACA 1YUTA 2WORA 3OX5A 2K8MB 1MXLC 1YTZC 2F2OA 2FJYA 1F54A 3SG7A 2NXQA 1CFCA 3TS5C 4CPVA 1JF2A 2MJWB 1SBJA 4YI8A 1JWDA 3FWCA 4M2QA 3VROA 3D10A 2KFHA 5CPVA 3B88A 5CSFA 3SG5A 1N65A 1HT9A 2KQ6A 3HX4A 1WLZA 3RLZA 1BLQA 5J3XA 3SIAA 2WCKA 4P5OE 3SG4A 4GFTA 3WHTB 1QATA 5JJGA 1ZOTB 2CT9A 1H8BA 2WOSA 2G9BA 3AAJA 1XO5A 1SYMA 1LA3A 1PK0D 1RROA 4GUKA 2BL0B 4WQ3A 2SCPA 1XK4C 1CMFA 1NCZA 3IF7A 5AEQA 1IQ3A 3EVVA 3DF0B 3TDUA 1KWOB 1W7IB 1F8HA 1DJZA 2L2CA 4GGNA 3BXKA 2V53A 3N7HA 4MBEA 1A75B 1B4CA 1C3ZA 5HYDA 1BOCA 1KWOC 4HRHA 3WHUB 1CKKA 1S5GY 4UPGA 3RZSA 2KNEA
chains in the Genus database with same CATH topology
4CFRA 2LUXA 2JU0A 2LLTA 2BKIB 3M0WA 4N1FA 3O4YA 4I5LB 1DMOA 1TCFA 4TNCA 4YGEB 1BF5A 5CSIA 2ZNDA 2GGZA 3NSIA 3AKBA 2I7AA 4BY4A 4MVFA 2L0PA 3GK4X 4DCKA 1K8UA 3I5HB 4YI9A 2K2FA 2VRGA 2L5XB 1AHRA 1G4YR 1HQVA 1B8CA 1N2DA 2H61A 4OKHA 4QJ5B 1QJTA 5HKYA 3I5HC 1TRFA 3LK1A 2JNXA 2NCOA 4PHJA 3LK0A 5DKNA 1WY9A 1VRKA 1C7VA 1G8IA 3CR4X 3MSEB 4MN0A 5FYXA 5D69A 4MRXA 2F33A 1J1DA 3NSKA 1LVCD 3A4UB 5ER4X 2K7CA 3VRRA 4C0JA 1JF0A 2ZNEA 1JUOA 3I5IC 3DF0A 1OMVA 2PVBA 2I18A 4U8DA 2JNFA 4C0KA 1A75A 4IL1A 3ZNIA 5BPJA 1A03A 1EJ3A 2LHLA 2DOQA 1BR1B 1YVLA 2CXJA 4P2YB 2M1UA 1U5IB 1JFJA 1V1FA 2LAPA 4MRYA 3TUYB 3CR2A 1FPWA 1YX7A 2G2BA 5B8IB 3LLEA 1JSAA 4MZJA 1CDPA 1CDLA 4R1EA 1PSBA 1A4PA 5I2LA 1J55A 3CWGA 3EK4A 1NUBA 1KSOA 4PHMA 2E30A 4HSZA 1EG4A 1ALWA 3BUNB 1X02A 2LHIA 3EK7A 2OS8B 2F3YA 1FW4A 3OB1B 4PE1A 1NIWA 2LP2A 4PALA 3HCMA 1IH0A 1WRLA 3CTNA 1S6JA 1CLLA 1XFUO 4MZKA 1B8RA 3SIBA 1EH2A 4AQJA 2KFFA 1BJFA 1KFUL 1KK8B 1QASA 1SR6B 1F4OA 3LCPC 4ORCB 1JFKA 3OP0A 2LMUA 3EKJA 1MWNA 1BODA 1WRZA 1U5IA 2B1UA 1OZOA 3QRXA 2KBMA 2OPOA 4QJ4B 4BY5A 2LVVA 1PRWA 1JC2A 2FCDA 4NDCA 3JVTC 2KAYA 2L98A 2EHBA 4HREE 1OE9B 2JC2A 1ZFSA 2BBNA 1TNPA 2WCBA 3O6BA 1QX2A 1CMGA 1MR8A 2WCFA 1UURA 5AFPA 2I2RE 2MLFC 2L4HA 3EK8A 1XA5A 4MEWA 2LLSA 3KEVA 3TS5B 2CBLA 5K89A 1CM1A 1XFWO 1CTRA 2L51A 2Y4QA 4ZCUA 1UHIA 3WXAA 1DJXA 3OHMB 3E3RA 1UWOA 1TCOB 1OMRA 2BE4A 2L4IA 1PSRA 1XYDA 1DJWA 3I5FC 1CFFA 2LCPA 3TDZA 4YRUA 4FTGA 5AXIA 1E8AA 2CCMA 5CSNA 1ODBA 2HQWA 1CNPA 1K94A 3CS1A 2JULA 1J7OA 1QV0A 1SL7A 1MUXA 1YUUA 4I5KA 1MXEA 2KSPA 1FBVA 1Y1UA 1B47A 1F4QA 1DJGA 2JOJA 2JPTA 2LM5A 2HETA 1IJ5A 2KI6C 1WLMA 1S26D 1S36A 4JQ0D 4AOMA 1J1EA 1Y0VH 1Y6WA 2LMTA 1QXPA 2CTNA 1Q80A 2ZKMX 3GK2A 1AK8A 1ZACA 2LVJA 3OX6A 4PCWA 1UP5A 1KSMA 1NX1A 2Y5IA 1D1OA 1QX7A 1XFYO 2LV7A 2TN4A 3TZ1A 2K7BA 3PSRA 1S6IA 1RECA 1C07A 2ZRTA 2JXCA 1R6PA 3AKAA 1BU3A 2KDHA 1OMDA 1KK7Z 1NPQA 5CSJA 4M2OA 1DGUA 1KQMC 3CLNA 3DVJA 1SPYA 2JXLA 4QJ3B 4GGFC 2KQYA 4I5JA 2AAOA 4JPZB 2JRFA 1XK4A 4HRGA 3SJSA 1ALVA 1BR4B 1M63B 2KOTA 2O60A 4GBAA 1FI5A 2LC5A 3OB2B 2F2PA 3I5IB 2WCEA 4ORBB 5HKZA 5I2OA 4XYNA 1MF8B 3KHEA 1V1GA 2AUCA 1Y1XA 2LE9B 1R2UA 3BUMB 2HF5A 3SG2A 4FQOA 1H4BA 2M9GA 2EC6C 4N1GA 1YVHA 2WNDA 3SG6A 2SASA 1C7WA 5IBWA 1EXRA 1MQ1A 2MRDA 3O78A 2BCXA 5JOLA 1K93D 1SKTA 2I94A 4YGCB 4DUQA 1IQ5A 2BE6A 1LXFC 2FJUB 2OTGC 4GNKB 4WRIA 2JT3A 1SL9A 4N5XA 1M45A 1TNWA 4M2PA 3F45A 1YR5A 2AMIA 1A29A 2BCBA 3RM1A 1NCXA 1LKJA 1FF1A 4OVNF 3D0YB 1IGVA 3NSOA 1GGWA 1KCYA 1M46A 2KAXA 5KU1A 2PMYA 2BKHB 1QS7A 2M7NA 4GPLB 3FWBA 4NDDA 1UUSA 2KI4C 3JTDC 1QLSA 2M49B 1WDCB 1SY9A 2NLNA 2E6WA 1CB1A 3EKHA 3O2PA 2LVIA 3VRNA 1AJ5A 1CDMA 3PLFB 1WDCC 1RJVA 3K21A 1WRKA 1CFPA 1CLBA 2KYFA 1EG3A 2GGMA 1S1EA 3BUWB 1N0YA 2MA2A 1CDNA 1M31A 2D8NA 2F3ZA 2K7OA 1LA0A 2LUCA 4CIDA 1OOJA 4DIRA 1IKUA 2FOTA 1GQMA 2JTTA 3JVTB 3IQQA 1CLMA 1QVIZ 3BUXB 1NCYA 2Q4UA 1QTXA 1QVIY 1RFJA 4ZCVA 4YGBB 4D1EA 1KQVA 1YURA 2LLUA 2MHHA 2KYCA 4PE4A 1UHNA 1SCVA 1DJHA 1UHJA 4YGDB 2Q91A 2LNKA 1FI6A 2BECA 3D0YA 1K96A 1SNLA 2ZRSA 1GGZA 1QIVA 2LVKA 1UHKA 2H2KA 2ZN8A 3KF9A 3I5FB 5DKQA 2M1KB 2MBXA 1G33A 2EGDA 4CLNA 1TNQA 1DF0B 3FIAA 4ORAB 3CGAA 3PN7C 4ETOA 2COLB 2L2EA 4OV2A 4GAOA 1J7PA 1L2OC 1YRTB 2K61A 4I5NB 4PDZA 1RWYA 1QV1A 4CFQA 1XVJA 3I5GC 3A8RA 1AP4A 1YRUB 3NSLA 5HLVA 1JBAA 2QPTA 5HLOA 1KFXS 3BUOB 1NX0A 2KFGA 4MZLA 1QLKA 2IS9A 1YUSA 1PALA 2JWWA 2R2IA 1NYAA 1DJIA 1J7RA 2BBMA 4YBHB 1XFZO 4A4BA 1DT7B 2A4JA 1EL4A 3DVKA 1S6CA 5HKWA 2M0RA 1SMGA 2NCPA 2H61C 2K0JA 1DF0A 1KQMB 2K2AA 4A4CA 1TIZA 2BCAA 1KK7Y 1W7JB 2LANA 1TNXA 2FCEA 2BL0C 4L9MA 1CM4A 1B7TZ 1BT6A 1DGVA 1KFUS 2MAZA 1DVIA 3VRQA 1B7TY 2GV5A 1XFVO 1IG5A 4OCIA 1S5GZ 1GJYA 1XFXO 1NX3A 2KBIA 1A2XA 4XJKB 3C1VA 1SL8A 5I8NA 3DD4A 1OSAA 1BG1A 2EC6B 3KPXA 5GQQC 1NSHA 1QIWA 3TDIA 2PRUA 2JTZA 2L50A 3LL8B 4C0LA 3ICBA 2HQ8A 1Y1AA 2LP3A 1CFDA 2MLEC 1UHHA 3PFVA 2JT0A 4PHNA 2KGRA 2OTGB 1NP8A 3NXAA 4WQ2A 4USLA 2KAVA 1SK6D 1RTP1 3CZTX 5AANA 2M8UA 1IWQA 2JT8A 1NX2A 5PALA 5AERA 4GGFA 4AQIA 2JQ6A 3PM8A 2PALA 2CNPA 3KO0A 3BOWB 4NDBA 2KI4B 1YX8A 2RGIA 2O5GA 3JTDB 3PALA 3PATA 4PE7A 1F71A 1K9UA 4MSPA 1KFXL 2M29A 2M97A 2M7LA 2JZIA 4E68A 1B1GA 4XJKA 1J7QA 2Y1NA 3BQ3A 1K9PA 3ZWHA 2ZN9A 5G08A 4PHKA 1F70A 1K95A 3IQOA 1AVSA 1K90D 3EVRA 2F8PA 1M39A 2KI6D 3H4SE 2ZFDA 4OR9B 3VGOA 5F6TA 3TUYC 1NWDA 5ER5A 2P6BB 4PE0A 1IRJA 1K2HA 4MLWA 1OQPA 1IJ6A 2KHNA 1S3PA 2M3WA 2NZ0A 3VRPA 1B9AA 1DJYA 1PULA 2OS8C 1OZSA 2WC8A 4JWQA 1PVAA 1RK9A 3AAKA 4Q04A 1AUIB 5KTYA 3SG3A 2LMVA 1PVBA 2K7DA 3CR5X 1B8LA 1AJ4A 3BOWA 4DRWA 3WNXB 4DS7A 1LINA 2HPSA 3DVEA 5KSZA 1SCMB 1SW8A 5I2QA 2KGBC 1KK8C 1K9KA 1MHOA 1SR6C 1ZUZA 3PN7B 3FS7A 1SCMC 1L2OB 1TOPA 2PASA 5TNCA 5DKRA 1F55A 1SRAA 1BMOA 1DTLA 1TN4A 3I5GB 5D7FA 2ISDA 1ZMZA 3EVUA 4F0ZB 1QX5B 1TTXA 2PSRA 4YGAA 1L7ZA 2Y1MA 3GK1A 4NQGA 4ICBA 3DVMA 3GOFA 3BYAA 2QACA 1YUTA 2WORA 3OX5A 2K8MB 1MXLC 1YTZC 2F2OA 1F54A 3SG7A 2NXQA 1CFCA 3TS5C 4CPVA 1JF2A 2MJWB 1SBJA 4YI8A 1JWDA 3FWCA 4M2QA 3VROA 3D10A 2KFHA 5CPVA 5CSFA 3SG5A 1N65A 1HT9A 2KQ6A 3HX4A 1WLZA 3RLZA 1BLQA 5J3XA 3SIAA 4P5OE 3WHTB 3SG4A 4GFTA 1QATA 5JJGA 1ZOTB 2CT9A 1H8BA 2WOSA 2G9BA 3AAJA 1XO5A 1SYMA 1LA3A 1PK0D 1RROA 4GUKA 2BL0B 4WQ3A 2SCPA 1XK4C 1CMFA 1NCZA 3IF7A 5AEQA 1IQ3A 3EVVA 3DF0B 3TDUA 1KWOB 1W7IB 1F8HA 1DJZA 4GGNA 3BXKA 2V53A 4MBEA 1B4CA 1A75B 5HYDA 1BOCA 1KWOC 4HRHA 3WHUB 1CKKA 1S5GY 4UPGA 2KNEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CFR A;  2LUX A;  2JU0 A;  2LLT A;  2BKI B;  3M0W A;  4N1F A;  3O4Y A;  4I5L B;  1DMO A;  1TCF A;  4TNC A;  4YGE B;  1BF5 A;  5CSI A;  2ZND A;  2GGZ A;  3NSI A;  3AKB A;  2I7A A;  4BY4 A;  4MVF A;  2L0P A;  3GK4 X;  4DCK A;  1K8U A;  3I5H B;  4YI9 A;  2K2F A;  2VRG A;  2L5X B;  1AHR A;  1G4Y R;  1HQV A;  1B8C A;  1N2D A;  2H61 A;  4OKH A;  4QJ5 B;  1QJT A;  5HKY A;  3I5H C;  1TRF A;  3LK1 A;  2JNX A;  2NCO A;  4PHJ A;  3LK0 A;  5DKN A;  1WY9 A;  1VRK A;  1C7V A;  1G8I A;  3CR4 X;  3MSE B;  4MN0 A;  5FYX A;  5D69 A;  4MRX A;  2F33 A;  1J1D A;  3NSK A;  1LVC D;  3A4U B;  5ER4 X;  2K7C A;  3VRR A;  4C0J A;  1JF0 A;  2ZNE A;  1JUO A;  3I5I C;  3DF0 A;  1OMV A;  2PVB A;  2I18 A;  4U8D A;  2JNF A;  4C0K A;  1A75 A;  4IL1 A;  3ZNI A;  5BPJ A;  1A03 A;  1EJ3 A;  2LHL A;  2DOQ A;  1BR1 B;  1YVL A;  2CXJ A;  4P2Y B;  2M1U A;  1U5I B;  1JFJ A;  1V1F A;  2LAP A;  4MRY A;  3TUY B;  3CR2 A;  1FPW A;  1YX7 A;  2G2B A;  5B8I B;  3LLE A;  1JSA A;  4MZJ A;  1CDP A;  1CDL A;  4R1E A;  1PSB A;  1A4P A;  5I2L A;  1J55 A;  3CWG A;  3EK4 A;  1NUB A;  1KSO A;  4PHM A;  2E30 A;  4HSZ A;  1EG4 A;  1ALW A;  3BUN B;  1X02 A;  2LHI A;  3EK7 A;  2OS8 B;  2F3Y A;  1FW4 A;  3OB1 B;  4PE1 A;  1NIW A;  2LP2 A;  4PAL A;  3HCM A;  1IH0 A;  1WRL A;  3CTN A;  1S6J A;  1CLL A;  1XFU O;  4MZK A;  1B8R A;  3SIB A;  1EH2 A;  4AQJ A;  2KFF A;  1BJF A;  1KFU L;  1KK8 B;  1QAS A;  1SR6 B;  1F4O A;  3LCP C;  4ORC B;  1JFK A;  3OP0 A;  2LMU A;  3EKJ A;  1MWN A;  1BOD A;  1WRZ A;  1U5I A;  2B1U A;  1OZO A;  3QRX A;  2KBM A;  2OPO A;  4QJ4 B;  4BY5 A;  2LVV A;  1PRW A;  1JC2 A;  2FCD A;  4NDC A;  3JVT C;  2KAY A;  2L98 A;  2EHB A;  4HRE E;  1OE9 B;  2JC2 A;  1ZFS A;  2BBN A;  1TNP A;  2WCB A;  3O6B A;  1QX2 A;  1CMG A;  1MR8 A;  2WCF A;  1UUR A;  5AFP A;  2I2R E;  2MLF C;  2L4H A;  3EK8 A;  1XA5 A;  4MEW A;  2LLS A;  3KEV A;  3TS5 B;  2CBL A;  5K89 A;  1CM1 A;  1XFW O;  1CTR A;  2L51 A;  2Y4Q A;  4ZCU A;  1UHI A;  3WXA A;  1DJX A;  3OHM B;  3E3R A;  1UWO A;  1TCO B;  1OMR A;  2BE4 A;  2L4I A;  1PSR A;  1XYD A;  1DJW A;  3I5F C;  1CFF A;  2LCP A;  3TDZ A;  4YRU A;  4FTG A;  5AXI A;  1E8A A;  2CCM A;  5CSN A;  1ODB A;  2HQW A;  1CNP A;  1K94 A;  3CS1 A;  2JUL A;  1J7O A;  1QV0 A;  1SL7 A;  1MUX A;  1YUU A;  4I5K A;  1MXE A;  2KSP A;  1FBV A;  1Y1U A;  1B47 A;  1F4Q A;  1DJG A;  2JOJ A;  2JPT A;  2LM5 A;  2HET A;  1IJ5 A;  2KI6 C;  1WLM A;  1S26 D;  1S36 A;  4JQ0 D;  4AOM A;  1J1E A;  1Y0V H;  1Y6W A;  2LMT A;  1QXP A;  2CTN A;  1Q80 A;  2ZKM X;  3GK2 A;  1AK8 A;  1ZAC A;  2LVJ A;  3OX6 A;  4PCW A;  1UP5 A;  1KSM A;  1NX1 A;  2Y5I A;  1D1O A;  1QX7 A;  1XFY O;  2LV7 A;  2TN4 A;  3TZ1 A;  2K7B A;  3PSR A;  1S6I A;  1REC A;  1C07 A;  2ZRT A;  2JXC A;  1R6P A;  3AKA A;  1BU3 A;  2KDH A;  1OMD A;  1KK7 Z;  1NPQ A;  5CSJ A;  4M2O A;  1DGU A;  1KQM C;  3CLN A;  3DVJ A;  1SPY A;  2JXL A;  4QJ3 B;  4GGF C;  2KQY A;  4I5J A;  2AAO A;  4JPZ B;  2JRF A;  1XK4 A;  4HRG A;  3SJS A;  1ALV A;  1BR4 B;  1M63 B;  2KOT A;  2O60 A;  4GBA A;  1FI5 A;  2LC5 A;  3OB2 B;  2F2P A;  3I5I B;  2WCE A;  4ORB B;  5HKZ A;  5I2O A;  4XYN A;  1MF8 B;  3KHE A;  1V1G A;  2AUC A;  1Y1X A;  2LE9 B;  1R2U A;  3BUM B;  2HF5 A;  3SG2 A;  4FQO A;  1H4B A;  2M9G A;  2EC6 C;  4N1G A;  1YVH A;  2WND A;  3SG6 A;  2SAS A;  1C7W A;  5IBW A;  1EXR A;  1MQ1 A;  2MRD A;  3O78 A;  2BCX A;  5JOL A;  1K93 D;  1SKT A;  2I94 A;  4YGC B;  4DUQ A;  1IQ5 A;  2BE6 A;  1LXF C;  2FJU B;  2OTG C;  4GNK B;  4WRI A;  2JT3 A;  1SL9 A;  4N5X A;  1M45 A;  1TNW A;  4M2P A;  3F45 A;  1YR5 A;  2AMI A;  1A29 A;  2BCB A;  3RM1 A;  1NCX A;  1LKJ A;  1FF1 A;  4OVN F;  3D0Y B;  1IGV A;  3NSO A;  1GGW A;  1KCY A;  1M46 A;  2KAX A;  5KU1 A;  2PMY A;  2BKH B;  1QS7 A;  2M7N A;  4GPL B;  3FWB A;  4NDD A;  1UUS A;  2KI4 C;  3JTD C;  1QLS A;  2M49 B;  1WDC B;  1SY9 A;  2NLN A;  2E6W A;  1CB1 A;  3EKH A;  3O2P A;  2LVI A;  3VRN A;  1AJ5 A;  1CDM A;  3PLF B;  1WDC C;  1RJV A;  3K21 A;  1WRK A;  1CFP A;  1CLB A;  2KYF A;  1EG3 A;  2GGM A;  1S1E A;  3BUW B;  1N0Y A;  2MA2 A;  1CDN A;  1M31 A;  2D8N A;  2F3Z A;  2K7O A;  1LA0 A;  2LUC A;  4CID A;  1OOJ A;  4DIR A;  1IKU A;  2FOT A;  1GQM A;  2JTT A;  3JVT B;  3IQQ A;  1CLM A;  1QVI Z;  3BUX B;  1NCY A;  2Q4U A;  1QTX A;  1QVI Y;  1RFJ A;  4ZCV A;  4YGB B;  4D1E A;  1KQV A;  1YUR A;  2LLU A;  2MHH A;  2KYC A;  4PE4 A;  1UHN A;  1SCV A;  1DJH A;  1UHJ A;  4YGD B;  2Q91 A;  2LNK A;  1FI6 A;  2BEC A;  3D0Y A;  1K96 A;  1SNL A;  2ZRS A;  1GGZ A;  1QIV A;  2LVK A;  1UHK A;  2H2K A;  2ZN8 A;  3KF9 A;  3I5F B;  5DKQ A;  2M1K B;  2MBX A;  1G33 A;  2EGD A;  4CLN A;  1TNQ A;  1DF0 B;  3FIA A;  4ORA B;  3CGA A;  3PN7 C;  4ETO A;  2COL B;  2L2E A;  4OV2 A;  4GAO A;  1J7P A;  1L2O C;  1YRT B;  2K61 A;  4I5N B;  4PDZ A;  1RWY A;  1QV1 A;  4CFQ A;  1XVJ A;  3I5G C;  3A8R A;  1AP4 A;  1YRU B;  3NSL A;  5HLV A;  1JBA A;  2QPT A;  5HLO A;  1KFX S;  3BUO B;  1NX0 A;  2KFG A;  4MZL A;  1QLK A;  2IS9 A;  1YUS A;  1PAL A;  2JWW A;  2R2I A;  1NYA A;  1DJI A;  1J7R A;  2BBM A;  4YBH B;  1XFZ O;  4A4B A;  1DT7 B;  2A4J A;  1EL4 A;  3DVK A;  1S6C A;  5HKW A;  2M0R A;  1SMG A;  2NCP A;  2H61 C;  2K0J A;  1DF0 A;  1KQM B;  2K2A A;  4A4C A;  1TIZ A;  2BCA A;  1KK7 Y;  1W7J B;  2LAN A;  1TNX A;  2FCE A;  2BL0 C;  4L9M A;  1CM4 A;  1B7T Z;  1BT6 A;  1DGV A;  1KFU S;  2MAZ A;  1DVI A;  3VRQ A;  1B7T Y;  2GV5 A;  1XFV O;  1IG5 A;  4OCI A;  1S5G Z;  1GJY A;  1XFX O;  1NX3 A;  2KBI A;  1A2X A;  4XJK B;  3C1V A;  1SL8 A;  5I8N A;  3DD4 A;  1OSA A;  1BG1 A;  2EC6 B;  3KPX A;  5GQQ C;  1NSH A;  1QIW A;  3TDI A;  2PRU A;  2JTZ A;  2L50 A;  3LL8 B;  4C0L A;  3ICB A;  2HQ8 A;  1Y1A A;  2LP3 A;  1CFD A;  2MLE C;  1UHH A;  3PFV A;  2JT0 A;  4PHN A;  2KGR A;  2OTG B;  1NP8 A;  3NXA A;  4WQ2 A;  4USL A;  2KAV A;  1SK6 D;  1RTP 1;  3CZT X;  5AAN A;  2M8U A;  1IWQ A;  2JT8 A;  1NX2 A;  5PAL A;  5AER A;  4GGF A;  4AQI A;  2JQ6 A;  3PM8 A;  2PAL A;  2CNP A;  3KO0 A;  3BOW B;  4NDB A;  2KI4 B;  1YX8 A;  2RGI A;  2O5G A;  3JTD B;  3PAL A;  3PAT A;  4PE7 A;  1F71 A;  1K9U A;  4MSP A;  1KFX L;  2M29 A;  2M97 A;  2M7L A;  2JZI A;  4E68 A;  1B1G A;  4XJK A;  1J7Q A;  2Y1N A;  3BQ3 A;  1K9P A;  3ZWH A;  2ZN9 A;  5G08 A;  4PHK A;  1F70 A;  1K95 A;  3IQO A;  1AVS A;  1K90 D;  3EVR A;  2F8P A;  1M39 A;  2KI6 D;  3H4S E;  2ZFD A;  4OR9 B;  3VGO A;  5F6T A;  3TUY C;  1NWD A;  5ER5 A;  2P6B B;  4PE0 A;  1IRJ A;  1K2H A;  4MLW A;  1OQP A;  1IJ6 A;  2KHN A;  1S3P A;  2M3W A;  2NZ0 A;  3VRP A;  1B9A A;  1DJY A;  1PUL A;  2OS8 C;  1OZS A;  2WC8 A;  4JWQ A;  1PVA A;  1RK9 A;  3AAK A;  4Q04 A;  1AUI B;  5KTY A;  3SG3 A;  2LMV A;  1PVB A;  2K7D A;  3CR5 X;  1B8L A;  1AJ4 A;  3BOW A;  4DRW A;  3WNX B;  4DS7 A;  1LIN A;  2HPS A;  3DVE A;  5KSZ A;  1SCM B;  1SW8 A;  5I2Q A;  2KGB C;  1KK8 C;  1K9K A;  1MHO A;  1SR6 C;  1ZUZ A;  3PN7 B;  3FS7 A;  1SCM C;  1L2O B;  1TOP A;  2PAS A;  5TNC A;  5DKR A;  1F55 A;  1SRA A;  1BMO A;  1DTL A;  1TN4 A;  3I5G B;  5D7F A;  2ISD A;  1ZMZ A;  3EVU A;  4F0Z B;  1QX5 B;  1TTX A;  2PSR A;  4YGA A;  1L7Z A;  2Y1M A;  3GK1 A;  4NQG A;  4ICB A;  3DVM A;  3GOF A;  3BYA A;  2QAC A;  1YUT A;  2WOR A;  3OX5 A;  2K8M B;  1MXL C;  1YTZ C;  2F2O A;  1F54 A;  3SG7 A;  2NXQ A;  1CFC A;  3TS5 C;  4CPV A;  1JF2 A;  2MJW B;  1SBJ A;  4YI8 A;  1JWD A;  3FWC A;  4M2Q A;  3VRO A;  3D10 A;  2KFH A;  5CPV A;  5CSF A;  3SG5 A;  1N65 A;  1HT9 A;  2KQ6 A;  3HX4 A;  1WLZ A;  3RLZ A;  1BLQ A;  5J3X A;  3SIA A;  4P5O E;  3WHT B;  3SG4 A;  4GFT A;  1QAT A;  5JJG A;  1ZOT B;  2CT9 A;  1H8B A;  2WOS A;  2G9B A;  3AAJ A;  1XO5 A;  1SYM A;  1LA3 A;  1PK0 D;  1RRO A;  4GUK A;  2BL0 B;  4WQ3 A;  2SCP A;  1XK4 C;  1CMF A;  1NCZ A;  3IF7 A;  5AEQ A;  1IQ3 A;  3EVV A;  3DF0 B;  3TDU A;  1KWO B;  1W7I B;  1F8H A;  1DJZ A;  4GGN A;  3BXK A;  2V53 A;  4MBE A;  1B4C A;  1A75 B;  5HYD A;  1BOC A;  1KWO C;  4HRH A;  3WHU B;  1CKK A;  1S5G Y;  4UPG A;  2KNE A; 
#chains in the Genus database with same CATH topology
 4CFR A;  2LUX A;  2JU0 A;  2LLT A;  2BKI B;  3M0W A;  4N1F A;  3O4Y A;  4I5L B;  1DMO A;  1TCF A;  4TNC A;  4YGE B;  1BF5 A;  5CSI A;  2ZND A;  2GGZ A;  3NSI A;  3AKB A;  2I7A A;  3K1E A;  4BY4 A;  4MVF A;  2L0P A;  3GK4 X;  4DCK A;  1K8U A;  3I5H B;  4OZD A;  4YI9 A;  2K2F A;  2VRG A;  3FE9 A;  2L5X B;  1AHR A;  1G4Y R;  1HQV A;  1B8C A;  1N2D A;  2H61 A;  4OKH A;  4QJ5 B;  1QJT A;  5HKY A;  3I5H C;  1TRF A;  1P28 A;  3LK1 A;  2JNX A;  2NCO A;  4PHJ A;  3LK0 A;  5DKN A;  1LS8 A;  1VRK A;  1WY9 A;  1C7V A;  3S0F A;  1G8I A;  3CR4 X;  3MSE B;  4MN0 A;  5FYX A;  3CZ2 A;  5D69 A;  4MRX A;  2F33 A;  1J1D A;  3NSK A;  1LVC D;  3A4U B;  3D76 A;  2K7C A;  5ER4 X;  3VRR A;  4C0J A;  1JF0 A;  2ZNE A;  1JUO A;  3I5I C;  3NHI A;  3DF0 A;  1OMV A;  2PVB A;  2I18 A;  4U8D A;  1OOH A;  2JNF A;  3D77 A;  4C0K A;  1A75 A;  4IL1 A;  3ZNI A;  5BPJ A;  3CDN A;  1A03 A;  1EJ3 A;  2LHL A;  2DOQ A;  1BR1 B;  1YVL A;  2CXJ A;  4P2Y B;  2M1U A;  1U5I B;  1JFJ A;  1V1F A;  2LAP A;  4FQT A;  4MRY A;  3TUY B;  3CR2 A;  1ORG A;  1FPW A;  1YX7 A;  2G2B A;  5B8I B;  3LLE A;  1JSA A;  4MZJ A;  1CDP A;  1CDL A;  4R1E A;  1PSB A;  1A4P A;  5I2L A;  1J55 A;  3CWG A;  3EK4 A;  1NUB A;  1KSO A;  4PHM A;  2E30 A;  1Z2C B;  4HSZ A;  1EG4 A;  1ALW A;  3DY9 A;  3BUN B;  1X02 A;  2LHI A;  3EK7 A;  2OS8 B;  2F3Y A;  1FW4 A;  3OB1 B;  4PE1 A;  1NIW A;  2LP2 A;  4PAL A;  3HCM A;  1IH0 A;  1WRL A;  4PT1 A;  3CTN A;  1S6J A;  1CLL A;  1XFU O;  4MZK A;  1B8R A;  3SIB A;  1EH2 A;  1GM0 A;  4AQJ A;  2KFF A;  1BJF A;  1DQE A;  1KFU L;  3BFB A;  1KK8 B;  1QAS A;  1SR6 B;  1F4O A;  3LCP C;  4ORC B;  1XFR A;  3PM2 A;  1JFK A;  3OP0 A;  2LMU A;  3EKJ A;  1MWN A;  1BOD A;  1WRZ A;  1U5I A;  2B1U A;  1OZO A;  3QRX A;  2KBM A;  2OPO A;  4QJ4 B;  4BY5 A;  2LVV A;  1PRW A;  2QEB A;  2FCD A;  3S0B A;  1JC2 A;  4NDC A;  3JVT C;  2KAY A;  2P71 A;  2L98 A;  2EHB A;  4HRE E;  1OE9 B;  2JC2 A;  1TUZ A;  1ZFS A;  2BBN A;  1TNP A;  2WCB A;  3O6B A;  1QX2 A;  1CMG A;  1MR8 A;  2WCF A;  1UUR A;  5AFP A;  2I2R E;  2MLF C;  2L4H A;  3EK8 A;  1XA5 A;  4MEW A;  2LLS A;  3KEV A;  3TS5 B;  2CBL A;  5K89 A;  1CM1 A;  1XFW O;  1CTR A;  2L51 A;  2Y4Q A;  4ZCU A;  1UHI A;  3WXA A;  1DJX A;  3OHM B;  4JD9 A;  3E3R A;  1UWO A;  1TCO B;  1OMR A;  2BE4 A;  2L4I A;  1PSR A;  1XYD A;  1DJW A;  3CZ1 A;  3I5F C;  1CFF A;  2LCP A;  3TDZ A;  4YRU A;  3UNW A;  4FTG A;  1Z4H A;  5AXI A;  1E8A A;  2L5Y A;  2CCM A;  2BNX A;  5CSN A;  1ODB A;  2HQW A;  1CNP A;  1K94 A;  5FI6 A;  3CS1 A;  2JUL A;  1J7O A;  1QV0 A;  1SL7 A;  1MUX A;  1YUU A;  4I5K A;  1MXE A;  2GTE A;  2KSP A;  1FBV A;  1Y1U A;  1B47 A;  1F4Q A;  1DJG A;  2JOJ A;  2JPT A;  2LM5 A;  1SSE B;  2HET A;  1IJ5 A;  2KI6 C;  1WLM A;  1S26 D;  1S36 A;  2WC6 A;  4JQ0 D;  4AOM A;  4F7F A;  1J1E A;  1Y0V H;  2QDI A;  1Y6W A;  1TWO A;  2LMT A;  1C3Y A;  1QXP A;  2CTN A;  1Q80 A;  2ZKM X;  3GK2 A;  1AK8 A;  1ZAC A;  2LVJ A;  3OX6 A;  4PCW A;  1UP5 A;  1KSM A;  1T14 A;  1NX1 A;  2Y5I A;  1D1O A;  1QX7 A;  1XFY O;  2LV7 A;  2TN4 A;  3TZ1 A;  2K7B A;  3PSR A;  1S6I A;  1REC A;  3S0D A;  1C07 A;  2ZRT A;  2ERB A;  2JXC A;  1R6P A;  3AKA A;  1BU3 A;  2KDH A;  3NGV A;  1OMD A;  3BFH A;  1KK7 Z;  1NPQ A;  5CSJ A;  4M2O A;  1DEL A;  1DGU A;  1KQM C;  3CLN A;  3DVJ A;  1SPY A;  3VB1 A;  2JXL A;  4QJ3 B;  4GGF C;  3BJH A;  2YGU A;  2KQY A;  1TUJ A;  3L4A A;  4I5J A;  2AAO A;  4JPZ B;  3B87 A;  2JRF A;  3NHT A;  1XK4 A;  4HRG A;  3SJS A;  1ALV A;  1BR4 B;  1M63 B;  2KOT A;  2O60 A;  3FE6 A;  4GBA A;  1FI5 A;  2LC5 A;  3OB2 B;  2F2P A;  3I5I B;  2WCE A;  4ORB B;  2QEH A;  4INW A;  5HKZ A;  5I2O A;  2KPH A;  3S0G A;  4XYN A;  1MF8 B;  3KHE A;  1V1G A;  2AUC A;  1Y1X A;  2LE9 B;  1R2U A;  3BUM B;  2HF5 A;  3DZT A;  3QME A;  3SG2 A;  4FQO A;  1H4B A;  2M9G A;  2EC6 C;  4N1G A;  1YVH A;  2WND A;  3SG6 A;  2JPO A;  2SAS A;  1C7W A;  5IBW A;  1EXR A;  1MQ1 A;  2MRD A;  3O78 A;  2BCX A;  5JOL A;  1K93 D;  1OW4 A;  1SKT A;  2I94 A;  5I94 A;  3R72 A;  3D74 A;  1IQ5 A;  1LXF C;  2BE6 A;  2FJU B;  2OTG C;  4GNK B;  4WRI A;  4YGC B;  2JT3 A;  1SL9 A;  3L47 A;  4N5X A;  2PYQ A;  1M45 A;  2QEV A;  1TNW A;  4M2P A;  3F45 A;  1YR5 A;  2AMI A;  1A29 A;  2BCB A;  3RM1 A;  1NCX A;  1LKJ A;  1FF1 A;  4OVN F;  3D0Y B;  1IGV A;  2K60 A;  3NSO A;  3CAB A;  1GGW A;  1KCY A;  1M46 A;  2KAX A;  5KU1 A;  2PMY A;  5HL1 A;  2BKH B;  1QS7 A;  2M7N A;  4GPL B;  3FWB A;  4NDD A;  1UUS A;  2KI4 C;  3JTD C;  2QEO A;  1QLS A;  2M49 B;  1WDC B;  1SY9 A;  2NLN A;  2E6W A;  1CB1 A;  1DC1 A;  3B7A A;  3EKH A;  3O2P A;  2LVI A;  3VRN A;  1AJ5 A;  1CDM A;  3PLF B;  1WDC C;  1RJV A;  3B6X A;  1WRK A;  3K21 A;  1CFP A;  2KYF A;  1QWV A;  1EG3 A;  2GGM A;  1CLB A;  1S1E A;  3BUW B;  1N0Y A;  2MA2 A;  1CDN A;  1M31 A;  2D8N A;  2F3Z A;  2K7O A;  1LA0 A;  2LUC A;  5FI2 A;  1OOJ A;  4CID A;  4DIR A;  1IKU A;  2FOT A;  1GQM A;  2JTT A;  3JVT B;  3IQQ A;  1CLM A;  1QVI Z;  3BUX B;  1NCY A;  2Q4U A;  3DYE A;  1QTX A;  4IJ7 A;  3D75 A;  1QVI Y;  1RFJ A;  2WCL A;  2PQL A;  4YGB B;  4ZCV A;  4D1E A;  1KQV A;  1YUR A;  2LLU A;  2MHH A;  2KYC A;  3EG5 B;  1UHN A;  4PE4 A;  1SCV A;  1DJH A;  1DEK A;  1UHJ A;  4YGD B;  2Q91 A;  2LNK A;  4INX A;  1FI6 A;  2BEC A;  3D0Y A;  1K96 A;  1SNL A;  2ZRS A;  1GGZ A;  1QIV A;  2LVK A;  1UHK A;  2H2K A;  2ZN8 A;  3KF9 A;  3I5F B;  5DKQ A;  2M1K B;  2MBX A;  1G33 A;  2WCM A;  5D3O A;  2EGD A;  4CLN A;  1TNQ A;  1DF0 B;  3FIA A;  4ORA B;  3CGA A;  3PN7 C;  4ETO A;  2COL B;  2L2E A;  4OV2 A;  3BFA A;  4GAO A;  1J7P A;  1L2O C;  1YRT B;  2K61 A;  4I5N B;  4PDZ A;  1RWY A;  1QV1 A;  4CFQ A;  1XVJ A;  3I5G C;  3A8R A;  1AP4 A;  1YRU B;  3NSL A;  5HLV A;  1JBA A;  2QPT A;  2WC5 A;  5HLO A;  1KFX S;  3BUO B;  4KYN A;  1NX0 A;  2KFG A;  4MZL A;  1QLK A;  2IS9 A;  1YUS A;  1PAL A;  2JWW A;  3O4X A;  3S0A A;  2R2I A;  1NYA A;  3FE8 A;  1OOG A;  3S0E A;  3L4L A;  1DJI A;  1J7R A;  2BBM A;  4YBH B;  1XFZ O;  4A4B A;  1DT7 B;  2A4J A;  1EL4 A;  3DVK A;  5DIC A;  1OOI X;  1S6C A;  5HKW A;  2M0R A;  1SMG A;  3CZ0 A;  2NCP A;  2H61 C;  3D78 A;  2K0J A;  1DF0 A;  1KQM B;  3OGN A;  2K2A A;  4A4C A;  1TIZ A;  3D73 A;  2BCA A;  1KK7 Y;  1W7J B;  2LAN A;  1TNX A;  2FCE A;  2BL0 C;  4L9M A;  1CM4 A;  5FI7 A;  1B7T Z;  1BT6 A;  1DGV A;  1KFU S;  2MAZ A;  1DVI A;  3VRQ A;  1B7T Y;  2GV5 A;  1XFV O;  2WCH A;  1IG5 A;  4OCI A;  1S5G Z;  1GJY A;  1XFX O;  1NX3 A;  2KBI A;  1A2X A;  4XJK B;  3C1V A;  1SL8 A;  5I8N A;  3DD4 A;  1OSA A;  1BG1 A;  2EC6 B;  3KPX A;  5GQQ C;  1NSH A;  1QIW A;  3TDI A;  2PRU A;  2JTZ A;  2L50 A;  2P70 A;  3LL8 B;  4C0L A;  3ICB A;  2HQ8 A;  1Y1A A;  2LP3 A;  1CFD A;  2MLE C;  1UHH A;  3PFV A;  2JT0 A;  4PHN A;  3OBV A;  3SS4 A;  2KGR A;  2OTG B;  1NP8 A;  3NXA A;  4WQ2 A;  4USL A;  2KAV A;  1SK6 D;  1RTP 1;  3CZT X;  5AAN A;  2M8U A;  1IWQ A;  2JT8 A;  1NX2 A;  5PAL A;  5AER A;  4GGF A;  4AQI A;  2JQ6 A;  3CYZ A;  3PM8 A;  2PAL A;  2CNP A;  3KO0 A;  3R1V A;  3BOW B;  4NDB A;  2KI4 B;  3V2L A;  1YX8 A;  2RGI A;  2O5G A;  3JTD B;  3PAL A;  3PAT A;  4PE7 A;  1F71 A;  1K9U A;  4MSP A;  1KFX L;  2M29 A;  2M97 A;  2M7L A;  2JZI A;  4E68 A;  1B1G A;  4XJK A;  1J7Q A;  2Y1N A;  3BQ3 A;  3R1P A;  1K9P A;  3ZWH A;  2ZN9 A;  5G08 A;  4PHK A;  1F70 A;  1K95 A;  3IQO A;  1AVS A;  1K90 D;  3B86 A;  3EVR A;  2F8P A;  3UO9 A;  1M39 A;  2KI6 D;  3H4S E;  2ZFD A;  4OR9 B;  2H8V A;  5F6T A;  3VGO A;  1NWD A;  5ER5 A;  3TUY C;  2P6B B;  1W9Z A;  4PE0 A;  1IRJ A;  1K2H A;  4MLW A;  1OQP A;  1IJ6 A;  2KHN A;  1S3P A;  4DUQ A;  2M3W A;  2NZ0 A;  4JKT A;  3VRP A;  1B9A A;  1DJY A;  1PUL A;  2OS8 C;  2KLD A;  1OZS A;  2WC8 A;  4JWQ A;  1PVA A;  1RK9 A;  3AAK A;  4Q04 A;  1AUI B;  3PJI A;  3SG3 A;  5KTY A;  2LMV A;  1PVB A;  2K7D A;  3CR5 X;  1B8L A;  1AJ4 A;  3BOW A;  4DRW A;  3WNX B;  4DS7 A;  1LIN A;  2HPS A;  1OOF A;  3DVE A;  1SCM B;  1SW8 A;  5KSZ A;  5I2Q A;  2KGB C;  1KK8 C;  3SS3 A;  1K9K A;  1MHO A;  1SR6 C;  3SS5 A;  1ZUZ A;  3IVT A;  3PN7 B;  3FS7 A;  3R1O A;  1SCM C;  2WCJ A;  2KLE A;  1IIO A;  1L2O B;  1TOP A;  2PAS A;  5TNC A;  5DKR A;  1F55 A;  1SRA A;  1BMO A;  1DTL A;  1TN4 A;  3I5G B;  5D7F A;  2ISD A;  1ZMZ A;  3EVU A;  4F0Z B;  1QX5 B;  1TTX A;  2PSR A;  3DXL A;  1L7Z A;  2Y1M A;  3GK1 A;  4YGA A;  4NQG A;  4ICB A;  3DVM A;  3Q8I A;  5EL2 A;  3GOF A;  3BYA A;  2BAP A;  2QAC A;  1YUT A;  2WOR A;  3OX5 A;  2K8M B;  1MXL C;  1YTZ C;  2F2O A;  2FJY A;  1F54 A;  3SG7 A;  2NXQ A;  1CFC A;  3TS5 C;  4CPV A;  1JF2 A;  2MJW B;  1SBJ A;  4YI8 A;  1JWD A;  3FWC A;  4M2Q A;  3VRO A;  3D10 A;  2KFH A;  5CPV A;  3B88 A;  5CSF A;  3SG5 A;  1N65 A;  1HT9 A;  2KQ6 A;  3HX4 A;  1WLZ A;  3RLZ A;  1BLQ A;  5J3X A;  3SIA A;  2WCK A;  4P5O E;  3SG4 A;  4GFT A;  3WHT B;  1QAT A;  5JJG A;  1ZOT B;  2CT9 A;  1H8B A;  2WOS A;  2G9B A;  3AAJ A;  1XO5 A;  1SYM A;  1LA3 A;  1PK0 D;  1RRO A;  4GUK A;  2BL0 B;  4WQ3 A;  2SCP A;  1XK4 C;  1CMF A;  1NCZ A;  3IF7 A;  5AEQ A;  1IQ3 A;  3EVV A;  3DF0 B;  3TDU A;  1KWO B;  1W7I B;  1F8H A;  1DJZ A;  2L2C A;  4GGN A;  3BXK A;  2V53 A;  3N7H A;  4MBE A;  1A75 B;  1B4C A;  1C3Z A;  5HYD A;  1BOC A;  1KWO C;  4HRH A;  3WHU B;  1CKK A;  1S5G Y;  4UPG A;  3RZS A;  2KNE A; 
#chains in the Genus database with same CATH homology
 4CFR A;  2LUX A;  2JU0 A;  2LLT A;  2BKI B;  3M0W A;  4N1F A;  3O4Y A;  4I5L B;  1DMO A;  1TCF A;  4TNC A;  4YGE B;  1BF5 A;  5CSI A;  2ZND A;  2GGZ A;  3NSI A;  3AKB A;  2I7A A;  4BY4 A;  4MVF A;  2L0P A;  3GK4 X;  4DCK A;  1K8U A;  3I5H B;  4YI9 A;  2K2F A;  2VRG A;  2L5X B;  1AHR A;  1G4Y R;  1HQV A;  1B8C A;  1N2D A;  2H61 A;  4OKH A;  4QJ5 B;  1QJT A;  5HKY A;  3I5H C;  1TRF A;  3LK1 A;  2JNX A;  2NCO A;  4PHJ A;  3LK0 A;  5DKN A;  1WY9 A;  1VRK A;  1C7V A;  1G8I A;  3CR4 X;  3MSE B;  4MN0 A;  5FYX A;  5D69 A;  4MRX A;  2F33 A;  1J1D A;  3NSK A;  1LVC D;  3A4U B;  5ER4 X;  2K7C A;  3VRR A;  4C0J A;  1JF0 A;  2ZNE A;  1JUO A;  3I5I C;  3DF0 A;  1OMV A;  2PVB A;  2I18 A;  4U8D A;  2JNF A;  4C0K A;  1A75 A;  4IL1 A;  3ZNI A;  5BPJ A;  1A03 A;  1EJ3 A;  2LHL A;  2DOQ A;  1BR1 B;  1YVL A;  2CXJ A;  4P2Y B;  2M1U A;  1U5I B;  1JFJ A;  1V1F A;  2LAP A;  4MRY A;  3TUY B;  3CR2 A;  1FPW A;  1YX7 A;  2G2B A;  5B8I B;  3LLE A;  1JSA A;  4MZJ A;  1CDP A;  1CDL A;  4R1E A;  1PSB A;  1A4P A;  5I2L A;  1J55 A;  3CWG A;  3EK4 A;  1NUB A;  1KSO A;  4PHM A;  2E30 A;  4HSZ A;  1EG4 A;  1ALW A;  3BUN B;  1X02 A;  2LHI A;  3EK7 A;  2OS8 B;  2F3Y A;  1FW4 A;  3OB1 B;  4PE1 A;  1NIW A;  2LP2 A;  4PAL A;  3HCM A;  1IH0 A;  1WRL A;  3CTN A;  1S6J A;  1CLL A;  1XFU O;  4MZK A;  1B8R A;  3SIB A;  1EH2 A;  4AQJ A;  2KFF A;  1BJF A;  1KFU L;  1KK8 B;  1QAS A;  1SR6 B;  1F4O A;  3LCP C;  4ORC B;  1JFK A;  3OP0 A;  2LMU A;  3EKJ A;  1MWN A;  1BOD A;  1WRZ A;  1U5I A;  2B1U A;  1OZO A;  3QRX A;  2KBM A;  2OPO A;  4QJ4 B;  4BY5 A;  2LVV A;  1PRW A;  1JC2 A;  2FCD A;  4NDC A;  3JVT C;  2KAY A;  2L98 A;  2EHB A;  4HRE E;  1OE9 B;  2JC2 A;  1ZFS A;  2BBN A;  1TNP A;  2WCB A;  3O6B A;  1QX2 A;  1CMG A;  1MR8 A;  2WCF A;  1UUR A;  5AFP A;  2I2R E;  2MLF C;  2L4H A;  3EK8 A;  1XA5 A;  4MEW A;  2LLS A;  3KEV A;  3TS5 B;  2CBL A;  5K89 A;  1CM1 A;  1XFW O;  1CTR A;  2L51 A;  2Y4Q A;  4ZCU A;  1UHI A;  3WXA A;  1DJX A;  3OHM B;  3E3R A;  1UWO A;  1TCO B;  1OMR A;  2BE4 A;  2L4I A;  1PSR A;  1XYD A;  1DJW A;  3I5F C;  1CFF A;  2LCP A;  3TDZ A;  4YRU A;  4FTG A;  5AXI A;  1E8A A;  2CCM A;  5CSN A;  1ODB A;  2HQW A;  1CNP A;  1K94 A;  3CS1 A;  2JUL A;  1J7O A;  1QV0 A;  1SL7 A;  1MUX A;  1YUU A;  4I5K A;  1MXE A;  2KSP A;  1FBV A;  1Y1U A;  1B47 A;  1F4Q A;  1DJG A;  2JOJ A;  2JPT A;  2LM5 A;  2HET A;  1IJ5 A;  2KI6 C;  1WLM A;  1S26 D;  1S36 A;  4JQ0 D;  4AOM A;  1J1E A;  1Y0V H;  1Y6W A;  2LMT A;  1QXP A;  2CTN A;  1Q80 A;  2ZKM X;  3GK2 A;  1AK8 A;  1ZAC A;  2LVJ A;  3OX6 A;  4PCW A;  1UP5 A;  1KSM A;  1NX1 A;  2Y5I A;  1D1O A;  1QX7 A;  1XFY O;  2LV7 A;  2TN4 A;  3TZ1 A;  2K7B A;  3PSR A;  1S6I A;  1REC A;  1C07 A;  2ZRT A;  2JXC A;  1R6P A;  3AKA A;  1BU3 A;  2KDH A;  1OMD A;  1KK7 Z;  1NPQ A;  5CSJ A;  4M2O A;  1DGU A;  1KQM C;  3CLN A;  3DVJ A;  1SPY A;  2JXL A;  4QJ3 B;  4GGF C;  2KQY A;  4I5J A;  2AAO A;  4JPZ B;  2JRF A;  1XK4 A;  4HRG A;  3SJS A;  1ALV A;  1BR4 B;  1M63 B;  2KOT A;  2O60 A;  4GBA A;  1FI5 A;  2LC5 A;  3OB2 B;  2F2P A;  3I5I B;  2WCE A;  4ORB B;  5HKZ A;  5I2O A;  4XYN A;  1MF8 B;  3KHE A;  1V1G A;  2AUC A;  1Y1X A;  2LE9 B;  1R2U A;  3BUM B;  2HF5 A;  3SG2 A;  4FQO A;  1H4B A;  2M9G A;  2EC6 C;  4N1G A;  1YVH A;  2WND A;  3SG6 A;  2SAS A;  1C7W A;  5IBW A;  1EXR A;  1MQ1 A;  2MRD A;  3O78 A;  2BCX A;  5JOL A;  1K93 D;  1SKT A;  2I94 A;  4YGC B;  4DUQ A;  1IQ5 A;  2BE6 A;  1LXF C;  2FJU B;  2OTG C;  4GNK B;  4WRI A;  2JT3 A;  1SL9 A;  4N5X A;  1M45 A;  1TNW A;  4M2P A;  3F45 A;  1YR5 A;  2AMI A;  1A29 A;  2BCB A;  3RM1 A;  1NCX A;  1LKJ A;  1FF1 A;  4OVN F;  3D0Y B;  1IGV A;  3NSO A;  1GGW A;  1KCY A;  1M46 A;  2KAX A;  5KU1 A;  2PMY A;  2BKH B;  1QS7 A;  2M7N A;  4GPL B;  3FWB A;  4NDD A;  1UUS A;  2KI4 C;  3JTD C;  1QLS A;  2M49 B;  1WDC B;  1SY9 A;  2NLN A;  2E6W A;  1CB1 A;  3EKH A;  3O2P A;  2LVI A;  3VRN A;  1AJ5 A;  1CDM A;  3PLF B;  1WDC C;  1RJV A;  3K21 A;  1WRK A;  1CFP A;  1CLB A;  2KYF A;  1EG3 A;  2GGM A;  1S1E A;  3BUW B;  1N0Y A;  2MA2 A;  1CDN A;  1M31 A;  2D8N A;  2F3Z A;  2K7O A;  1LA0 A;  2LUC A;  4CID A;  1OOJ A;  4DIR A;  1IKU A;  2FOT A;  1GQM A;  2JTT A;  3JVT B;  3IQQ A;  1CLM A;  1QVI Z;  3BUX B;  1NCY A;  2Q4U A;  1QTX A;  1QVI Y;  1RFJ A;  4ZCV A;  4YGB B;  4D1E A;  1KQV A;  1YUR A;  2LLU A;  2MHH A;  2KYC A;  4PE4 A;  1UHN A;  1SCV A;  1DJH A;  1UHJ A;  4YGD B;  2Q91 A;  2LNK A;  1FI6 A;  2BEC A;  3D0Y A;  1K96 A;  1SNL A;  2ZRS A;  1GGZ A;  1QIV A;  2LVK A;  1UHK A;  2H2K A;  2ZN8 A;  3KF9 A;  3I5F B;  5DKQ A;  2M1K B;  2MBX A;  1G33 A;  2EGD A;  4CLN A;  1TNQ A;  1DF0 B;  3FIA A;  4ORA B;  3CGA A;  3PN7 C;  4ETO A;  2COL B;  2L2E A;  4OV2 A;  4GAO A;  1J7P A;  1L2O C;  1YRT B;  2K61 A;  4I5N B;  4PDZ A;  1RWY A;  1QV1 A;  4CFQ A;  1XVJ A;  3I5G C;  3A8R A;  1AP4 A;  1YRU B;  3NSL A;  5HLV A;  1JBA A;  2QPT A;  5HLO A;  1KFX S;  3BUO B;  1NX0 A;  2KFG A;  4MZL A;  1QLK A;  2IS9 A;  1YUS A;  1PAL A;  2JWW A;  2R2I A;  1NYA A;  1DJI A;  1J7R A;  2BBM A;  4YBH B;  1XFZ O;  4A4B A;  1DT7 B;  2A4J A;  1EL4 A;  3DVK A;  1S6C A;  5HKW A;  2M0R A;  1SMG A;  2NCP A;  2H61 C;  2K0J A;  1DF0 A;  1KQM B;  2K2A A;  4A4C A;  1TIZ A;  2BCA A;  1KK7 Y;  1W7J B;  2LAN A;  1TNX A;  2FCE A;  2BL0 C;  4L9M A;  1CM4 A;  1B7T Z;  1BT6 A;  1DGV A;  1KFU S;  2MAZ A;  1DVI A;  3VRQ A;  1B7T Y;  2GV5 A;  1XFV O;  1IG5 A;  4OCI A;  1S5G Z;  1GJY A;  1XFX O;  1NX3 A;  2KBI A;  1A2X A;  4XJK B;  3C1V A;  1SL8 A;  5I8N A;  3DD4 A;  1OSA A;  1BG1 A;  2EC6 B;  3KPX A;  5GQQ C;  1NSH A;  1QIW A;  3TDI A;  2PRU A;  2JTZ A;  2L50 A;  3LL8 B;  4C0L A;  3ICB A;  2HQ8 A;  1Y1A A;  2LP3 A;  1CFD A;  2MLE C;  1UHH A;  3PFV A;  2JT0 A;  4PHN A;  2KGR A;  2OTG B;  1NP8 A;  3NXA A;  4WQ2 A;  4USL A;  2KAV A;  1SK6 D;  1RTP 1;  3CZT X;  5AAN A;  2M8U A;  1IWQ A;  2JT8 A;  1NX2 A;  5PAL A;  5AER A;  4GGF A;  4AQI A;  2JQ6 A;  3PM8 A;  2PAL A;  2CNP A;  3KO0 A;  3BOW B;  4NDB A;  2KI4 B;  1YX8 A;  2RGI A;  2O5G A;  3JTD B;  3PAL A;  3PAT A;  4PE7 A;  1F71 A;  1K9U A;  4MSP A;  1KFX L;  2M29 A;  2M97 A;  2M7L A;  2JZI A;  4E68 A;  1B1G A;  4XJK A;  1J7Q A;  2Y1N A;  3BQ3 A;  1K9P A;  3ZWH A;  2ZN9 A;  5G08 A;  4PHK A;  1F70 A;  1K95 A;  3IQO A;  1AVS A;  1K90 D;  3EVR A;  2F8P A;  1M39 A;  2KI6 D;  3H4S E;  2ZFD A;  4OR9 B;  3VGO A;  5F6T A;  3TUY C;  1NWD A;  5ER5 A;  2P6B B;  4PE0 A;  1IRJ A;  1K2H A;  4MLW A;  1OQP A;  1IJ6 A;  2KHN A;  1S3P A;  2M3W A;  2NZ0 A;  3VRP A;  1B9A A;  1DJY A;  1PUL A;  2OS8 C;  1OZS A;  2WC8 A;  4JWQ A;  1PVA A;  1RK9 A;  3AAK A;  4Q04 A;  1AUI B;  5KTY A;  3SG3 A;  2LMV A;  1PVB A;  2K7D A;  3CR5 X;  1B8L A;  1AJ4 A;  3BOW A;  4DRW A;  3WNX B;  4DS7 A;  1LIN A;  2HPS A;  3DVE A;  5KSZ A;  1SCM B;  1SW8 A;  5I2Q A;  2KGB C;  1KK8 C;  1K9K A;  1MHO A;  1SR6 C;  1ZUZ A;  3PN7 B;  3FS7 A;  1SCM C;  1L2O B;  1TOP A;  2PAS A;  5TNC A;  5DKR A;  1F55 A;  1SRA A;  1BMO A;  1DTL A;  1TN4 A;  3I5G B;  5D7F A;  2ISD A;  1ZMZ A;  3EVU A;  4F0Z B;  1QX5 B;  1TTX A;  2PSR A;  4YGA A;  1L7Z A;  2Y1M A;  3GK1 A;  4NQG A;  4ICB A;  3DVM A;  3GOF A;  3BYA A;  2QAC A;  1YUT A;  2WOR A;  3OX5 A;  2K8M B;  1MXL C;  1YTZ C;  2F2O A;  1F54 A;  3SG7 A;  2NXQ A;  1CFC A;  3TS5 C;  4CPV A;  1JF2 A;  2MJW B;  1SBJ A;  4YI8 A;  1JWD A;  3FWC A;  4M2Q A;  3VRO A;  3D10 A;  2KFH A;  5CPV A;  5CSF A;  3SG5 A;  1N65 A;  1HT9 A;  2KQ6 A;  3HX4 A;  1WLZ A;  3RLZ A;  1BLQ A;  5J3X A;  3SIA A;  4P5O E;  3WHT B;  3SG4 A;  4GFT A;  1QAT A;  5JJG A;  1ZOT B;  2CT9 A;  1H8B A;  2WOS A;  2G9B A;  3AAJ A;  1XO5 A;  1SYM A;  1LA3 A;  1PK0 D;  1RRO A;  4GUK A;  2BL0 B;  4WQ3 A;  2SCP A;  1XK4 C;  1CMF A;  1NCZ A;  3IF7 A;  5AEQ A;  1IQ3 A;  3EVV A;  3DF0 B;  3TDU A;  1KWO B;  1W7I B;  1F8H A;  1DJZ A;  4GGN A;  3BXK A;  2V53 A;  4MBE A;  1B4C A;  1A75 B;  5HYD A;  1BOC A;  1KWO C;  4HRH A;  3WHU B;  1CKK A;  1S5G Y;  4UPG A;  2KNE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...