2PALA

Ionic interactions with parvalbumins. crystal structure determination of pike 4.10 parvalbumin in four different ionic environments
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
107
structure length
107
Chain Sequence
SFAGLKDADVAAALAACSAADSFKHKEFFAKVGLASKSLDDVKKAFYVIDQDKSGFIEEDELKLFLQNFSPSARALTDAETKAFLADGDKDGDGMIGVDEFAAMIKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Ionic interactions with parvalbumins. Crystal structure determination of pike 4.10 parvalbumin in four different ionic environments.
pubmed doi rcsb
source organism Esox lucius
molecule tags Calcium binding protein
molecule keywords PARVALBUMIN
total genus 39
structure length 107
sequence length 107
ec nomenclature
pdb deposition date 1990-11-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2palA00
3PATA 5D69A 5KTYA 5CPVA 4CFRA 1M45A 1PALA 1S6IA 2BE4A 2KSPA 1KCYA 3NSOA 1KFUL 2LUXA 1BODA 2KYFA 1TNWA 2L50A 1H8BA 1MWNA 1N2DA 2FJUB 1TNXA 1CM4A 2KAVA 3VGOA 2HQ8A 1YURA 2MLFC 2M8UA 3BUWB 3HCMA 3BOWA 4USLA 3DVMA 1RTP1 1J1EA 3BYAA 3JTDC 4GUKA 1DMOA 1F70A 1GJYA 1DJYA 3NSKA 4TNCA 1KFUS 1UHIA 1YUSA 1NP8A 4QJ4B 1SPYA 2CT9A 4GAOA 3CR2A 2LVIA 2MJWB 3H4SE 4PALA 4U8DA 4WQ3A 2WCEA 1IGVA 2MLEC 5GQQC 5HLOA 3SG5A 2HF5A 1ALWA 2BE6A 2ZRSA 2GV5A 3BUOB 2KBIA 4MVFA 1YTZC 3DVEA 3JTDB 1S5GZ 4IL1A 5JOLA 2A4JA 1HT9A 1N65A 3DD4A 2LM5A 4GGFC 2Y1NA 4XYNA 1UWOA 4I5NB 3RLZA 4ZCUA 2KBMA 2O5GA 4I5KA 3I5FC 3SG7A 4GPLB 1OSAA 5HKZA 3TUYC 1BR4B 5AEQA 3BUXB 1NSHA 4M2QA 1OZSA 3D0YB 4ZCVA 2KNEA 2ZN9A 4HSZA 4PDZA 1ZFSA 1M31A 4DS7A 3EKHA 2KQ6A 2BCXA 5I2LA 1E8AA 1CLMA 1K96A 5B8IB 1NCXA 2ZRTA 3A4UB 4E68A 3I5FB 2LC5A 1SMGA 1F4OA 2ZNDA 3AKAA 3WNXB 2JNXA 5J3XA 1S1EA 1BU3A 3K21A 2F2PA 5I8NA 1CB1A 2KQYA 4PHKA 1A03A 2M29A 2GGZA 2KGRA 1EJ3A 1M39A 3D10A 2K2FA 1YVLA 4MRXA 3NSIA 1XFYO 3F45A 5KU1A 1DTLA 2BBNA 1JWDA 2F3ZA 3EVUA 1CKKA 1K9PA 2QACA 3KO0A 3I5IC 1K2HA 2IS9A 1CDMA 2TN4A 1K9KA 4GBAA 1ODBA 2HQWA 2K7CA 1WRLA 1JFJA 1WDCB 1PULA 2SASA 2NCPA 2LLUA 1QLKA 2EHBA 3SG4A 1KQVA 1DGVA 1SCMC 5CSJA 1KQMC 1XFWO 3FWCA 5F6TA 2L0PA 4M2PA 2FOTA 4R1EA 1XK4A 2CXJA 1IJ5A 4MSPA 1S5GY 2BCAA 4OCIA 1CDLA 1TRFA 1WDCC 1YUUA 2Y1MA 1F71A 5PALA 1N0YA 5JJGA 1YRUB 3KHEA 1EG4A 1K93D 2O60A 4HRGA 3VROA 1XFVO 1FPWA 4N1GA 3WHUB 5DKRA 1RROA 1NYAA 1IJ6A 3EVVA 1DF0B 1LINA 1YRTB 4NQGA 4AOMA 1UHKA 1QIWA 1QX7A 2JOJA 3LLEA 1KSOA 2FCEA 1QVIY 3EK8A 2EGDA 1OMVA 5TNCA 1MF8B 1JC2A 1FF1A 2JRFA 4ORBB 1KFXL 2KI6D 4XJKB 1NCZA 2LLTA 4ICBA 4OKHA 2AUCA 4QJ5B 4CPVA 3CGAA 4MN0A 3TZ1A 1QS7A 5HKYA 1U5IA 2JTZA 4DRWA 2I18A 1V1FA 1SL7A 4C0LA 5DKNA 1AK8A 1TTXA 4I5LB 4P2YB 1J7QA 1SL8A 2KI6C 4L9MA 1KK7Y 2OS8C 1AUIB 1CFCA 2CBLA 2LMTA 1TCOB 1KFXS 2R2IA 2WCBA 2KDHA 4I5JA 1NX3A 1WY9A 2JULA 2LNKA 4P5OE 3I5HC 1TNQA 1LXFC 4YI9A 3SG2A 1X02A 2L51A 1LVCD 1NX1A 1WLZA 1DVIA 1PRWA 3FS7A 4PE7A 1F4QA 1IG5A 2MAZA 1B47A 3M0WA 4N1FA 1XK4C 1PSBA 3CZTX 2K7OA 5BPJA 2V53A 1AHRA 1NX0A 1GQMA 1ZOTB 2MBXA 2G2BA 1KWOC 2ZFDA 3I5HB 2M0RA 2LHLA 1Y0VH 1Y1UA 5IBWA 1MR8A 5FYXA 2L4IA 2SCPA 4ORCB 2BL0C 1NX2A 1Y1AA 1H4BA 1IQ5A 4BY4A 4PHNA 4ETOA 1IKUA 2M7NA 5AXIA 1C7VA 1CFPA 1PSRA 1B8RA 1AJ4A 2F3YA 3CR5X 2KYCA 3A8RA 1TN4A 4DIRA 2PMYA 1B9AA 1LA3A 3SG6A 1DJWA 4F0ZB 1FBVA 1QLSA 2BL0B 1R6PA 3EVRA 4PCWA 2M7LA 4FQOA 1PVAA 1QX5B 5DKQA 2MHHA 3VRPA 3PN7B 4GGNA 1SY9A 2ZKMX 3FWBA 2JZIA 4PE1A 4C0KA 1YX8A 3GOFA 2KHNA 4M2OA 2K8MB 4CFQA 1V1GA 2L98A 2LAPA 2JTTA 2F33A 1YVHA 4WRIA 4C0JA 2L2EA 2OTGC 2OS8B 4NDDA 1QXPA 5K89A 4CIDA 4D1EA 3OHMB 4HREE 2OPOA 1ZACA 3KF9A 1BR1B 2WOSA 3LK1A 3OX6A 4MBEA 4PE4A 1BF5A 4AQIA 3FIAA 3ZNIA 3AAJA 2F8PA 1BT6A 4GNKB 1SR6C 5HLVA 3RM1A 1JSAA 4YGCB 1WRKA 2FCDA 3ICBA 1IQ3A 1UP5A 2E6WA 1CLBA 1CM1A 3GK1A 2EC6B 1DT7B 1B4CA 2LANA 1CTRA 2I2RE 1TCFA 1WRZA 1FI5A 1SYMA 1ZUZA 1JFKA 2H2KA 2H61C 1LA0A 1SR6B 1XYDA 1B8CA 3I5IB 2HETA 2Q91A 1J1DA 1DJHA 1TOPA 1A4PA 2K7BA 4NDBA 3TDUA 1QIVA 1GGWA 4XJKA 1BOCA 1J7PA 2K2AA 4A4CA 1B7TY 2Y5IA 1RECA 4YRUA 1G33A 1LKJA 3MSEB 3JVTC 2QPTA 5CSFA 2ISDA 1SBJA 3BQ3A 2KAYA 2WNDA 1G4YR 1CFDA 2AMIA 1XVJA 3PN7C 2WCFA 2KAXA 2ZN8A 5AANA 2DOQA 4YGDB 2NCOA 3VRRA 2JT0A 2BKHB 1YR5A 3O2PA 4MZKA 1UHJA 3LK0A 1C07A 1CFFA 1R2UA 1S6JA 2CNPA 2LVJA 1S3PA 1S26D 1SK6D 1W7IB 1J7RA 2NLNA 3DF0A 1D1OA 2NZ0A 2I94A 3IF7A 4YI8A 1CNPA 1B8LA 1DJIA 3AAKA 1SCVA 2M1KB 1K90D 4YGAA 1UUSA 3NXAA 4NDCA 1K95A 3QRXA 2I7AA 2LVVA 3GK2A 2H61A 2WORA 2E30A 3TDIA 1K9UA 5KSZA 1S36A 3AKBA 4MEWA 1A29A 2CCMA 2L5XB 2Q4UA 2WC8A 5D7FA 1SCMB 2M97A 3CTNA 1BJFA 1QJTA 3TDZA 5AERA 5AFPA 1QV0A 1DJGA 1XA5A 1YUTA 2KI4B 4OV2A 4A4BA 1C7WA 2JU0A 1JF2A 1A75B 3TS5C 1DGUA 5ER5A 1B7TZ 2JXCA 4YBHB 4JPZB 1BLQA 1XFUO 4YGBB 1KK7Z 1OQPA 1KWOB 4JQ0D 1IWQA 3GK4X 2LMUA 3SIBA 1EG3A 1RJVA 1QV1A 2KI4C 2G9BA 1CMGA 1L2OB 3LCPC 1NUBA 2NXQA 1AJ5A 3TS5B 3BOWB 1K8UA 3DF0B 1F55A 3LL8B 5CSNA 1CDPA 1Y1XA 2LE9B 2LMVA 3E3RA 2PVBA 1KQMB 3CLNA 1KK8C 2JNFA 3TUYB 3CS1A 4OVNF 2KFGA 1Y6WA 1A75A 4N5XA 1L2OC 1OZOA 4HRHA 1FW4A 2LUCA 2CTNA 3IQQA 3PALA 2JQ6A 3BUMB 1BG1A 3OB2B 1JF0A 1NIWA 1JBAA 4AQJA 1U5IB 2KFFA 1QX2A 1WLMA 1KK8B 1Q80A 4PHJA 2K0JA 2LP3A 1UURA 3EK4A 5ER4X 2MA2A 1NPQA 2AAOA 1S6CA 1F8HA 1AP4A 1MXEA 2JC2A 2JPTA 2LP2A 2M1UA 2OTGB 1QATA 3KPXA 4PE0A 3SIAA 3PFVA 2LVKA 1MXLC 1PVBA 3CWGA 2LCPA 3O78A 1CDNA 1HQVA 3OX5A 1ZMZA 4MZJA 1M46A 2KFHA 4ORAB 2K61A 1DJXA 4GGFA 3PSRA 2MRDA 4BY5A 3SJSA 3WXAA 2JWWA 2KOTA 5I2OA 1K94A 4MLWA 1SNLA 1OMDA 1B1GA 3I5GB 2COLB 3DVJA 2VRGA 1IRJA 1YX7A 1RK9A 3PLFB 1SL9A 1EXRA 1W7JB 1TNPA 1VRKA 1XFXO 3EK7A 4MRYA 3ZWHA 1FI6A 2JT8A 1QVIZ 2KGBC 4OR9B 1AVSA 2GGMA 1L7ZA 3WHTB 1F54A 1OE9B 3KEVA 1ALVA 3I5GC 1MQ1A 5HKWA 1IH0A 1MUXA 1J7OA 1DJZA 4DUQA 2PASA 2BCBA 2D8NA 3VRNA 4YGEB 4QJ3B 4FTGA 1UHHA 3JVTB 1TIZA 1BMOA 2M49B 1SW8A 2JXLA 3OB1B 1JUOA 2L4HA 4GFTA 2F2OA 4Q04A 1EH2A 2M3WA 2M9GA 2PSRA 4JWQA 1CMFA 3HX4A 2BECA 1UHNA 2ZNEA 3PM8A 5I2QA 2B1UA 3BXKA 3O4YA 5CSIA 4WQ2A 3VRQA 2LHIA 2PRUA 3D0YA 2BBMA 3CR4X 1NWDA 1PK0D 2JT3A 1SKTA 1GGZA 4MZLA 1XO5A 3C1VA 1NCYA 1KSMA 4DCKA 2HPSA 3BUNB 1J55A 1EL4A 1CLLA 2LV7A 4UPGA 1DF0A 5HYDA 3OP0A 4PHMA 3SG3A 1QTXA 2RGIA 3DVKA 3IQOA 3NSLA 2LLSA 2Y4QA 2PALA 1RFJA 2EC6C 1OMRA 2BKIB 2K7DA 2P6BB 4CLNA 3O6BA 3EKJA 1OOJA 1A2XA 1MHOA 1G8IA 5G08A 1XFZO 1QASA 1RWYA 1SRAA 1M63B
chains in the Genus database with same CATH superfamily
3PATA 5D69A 5KTYA 5CPVA 4CFRA 1M45A 5EL2A 1PALA 1S6IA 2BE4A 2KSPA 1KCYA 3NSOA 1KFUL 2LUXA 3R1VA 1BODA 2KYFA 1TNWA 1Z2CB 3QMEA 2L50A 2WCLA 1H8BA 1MWNA 1N2DA 2FJUB 1TNXA 1CM4A 2KAVA 3VGOA 2HQ8A 1YURA 2MLFC 2M8UA 3D77A 3FE9A 3BUWB 3HCMA 3BOWA 4USLA 3DVMA 1RTP1 1J1EA 3BYAA 3JTDC 4GUKA 3DY9A 1DMOA 1F70A 1GJYA 1DJYA 3NSKA 2ERBA 4TNCA 1KFUS 1UHIA 1YUSA 1NP8A 4QJ4B 1SPYA 2CT9A 4GAOA 3CR2A 2LVIA 2MJWB 3H4SE 4PALA 4U8DA 4WQ3A 2WCEA 1IGVA 2MLEC 5GQQC 5HLOA 3SG5A 3S0FA 2HF5A 1ALWA 2BE6A 1GM0A 2ZRSA 2GV5A 3BUOB 2KBIA 4MVFA 1YTZC 3CZ0A 3DVEA 1S5GZ 3JTDB 4IL1A 5JOLA 2A4JA 1HT9A 1N65A 3B88A 1DC1A 3DD4A 2LM5A 4GGFC 2Y1NA 4XYNA 1UWOA 2WC6A 4I5NB 3RLZA 4ZCUA 3D74A 2H8VA 2GTEA 2KBMA 2O5GA 4I5KA 3I5FC 3SG7A 3OGNA 4GPLB 1OSAA 5HKZA 3TUYC 1BR4B 5AEQA 3BUXB 3O4XA 1NSHA 4M2QA 1OZSA 3D0YB 4ZCVA 2KNEA 2ZN9A 4HSZA 4PDZA 1ZFSA 1M31A 4DS7A 3B86A 3EKHA 2KQ6A 2BCXA 5I2LA 1E8AA 1CLMA 1K96A 5B8IB 1NCXA 2ZRTA 3A4UB 4E68A 3I5FB 2LC5A 1SMGA 1F4OA 2ZNDA 3AKAA 3WNXB 1DELA 2JNXA 5J3XA 1S1EA 1BU3A 3K21A 2F2PA 5I8NA 1CB1A 2KQYA 4PHKA 1A03A 1XFRA 2M29A 2GGZA 2KGRA 1EJ3A 1M39A 3D10A 2K2FA 1YVLA 5D3OA 4MRXA 3NSIA 1XFYO 3F45A 5KU1A 1DTLA 2YGUA 2BBNA 1JWDA 2F3ZA 3EVUA 1CKKA 1K9PA 2QACA 3KO0A 3I5IC 1K2HA 2IS9A 1CDMA 3DZTA 2TN4A 1K9KA 4GBAA 1ODBA 2HQWA 2K7CA 1WRLA 2WCMA 1JFJA 1WDCB 1PULA 2SASA 2NCPA 2LLUA 1QLKA 2EHBA 3SG4A 1KQVA 1DGVA 1SCMC 1TUJA 5CSJA 1KQMC 1XFWO 3FWCA 5F6TA 2L0PA 2QEVA 3S0BA 4M2PA 2FOTA 4R1EA 1XK4A 2CXJA 1IJ5A 4MSPA 1S5GY 2BCAA 4OCIA 1CDLA 2P71A 3FE6A 1TRFA 1WDCC 1YUUA 2Y1MA 1F71A 1DQEA 2QEBA 5PALA 1N0YA 5JJGA 1YRUB 3KHEA 1EG4A 1K93D 2O60A 4HRGA 3VROA 1XFVO 1FPWA 4N1GA 1C3YA 3WHUB 5DKRA 1RROA 1NYAA 1IJ6A 3EVVA 3L47A 1DF0B 1LINA 1YRTB 4NQGA 4AOMA 1UHKA 1QIWA 1QX7A 2JOJA 3LLEA 1KSOA 2FCEA 1QVIY 3EK8A 2EGDA 1OMVA 3N7HA 1MF8B 5TNCA 4JD9A 1JC2A 1FF1A 2JRFA 4ORBB 1KFXL 2KI6D 4XJKB 1NCZA 2LLTA 4ICBA 4OKHA 2AUCA 3S0AA 4QJ5B 5FI7A 4CPVA 3CGAA 4MN0A 3TZ1A 1QS7A 5HKYA 1U5IA 2JTZA 4DRWA 2I18A 1V1FA 1SL7A 4C0LA 2L2CA 5DKNA 1AK8A 1TTXA 3UO9A 4I5LB 2PQLA 4P2YB 1SL8A 1J7QA 2KI6C 4L9MA 1KK7Y 2OS8C 1AUIB 1CFCA 2CBLA 2LMTA 1TCOB 1KFXS 2R2IA 2WCBA 1ORGA 2KDHA 3D73A 4I5JA 1NX3A 1WY9A 2JULA 2LNKA 1OOHA 3I5HC 4P5OE 3UNWA 1TNQA 1LXFC 4YI9A 3SG2A 1X02A 2L51A 1LVCD 1NX1A 3SS5A 1WLZA 1DVIA 1PRWA 3FS7A 4PE7A 1F4QA 1IG5A 2MAZA 1B47A 3M0WA 4N1FA 1XK4C 1PSBA 3CZTX 2K7OA 5BPJA 2V53A 1AHRA 1NX0A 1GQMA 1ZOTB 2MBXA 2G2BA 1KWOC 2ZFDA 3I5HB 2M0RA 2LHLA 1Y0VH 1Y1UA 5IBWA 1MR8A 5FYXA 2L4IA 2SCPA 4ORCB 2BL0C 1NX2A 1Y1AA 1H4BA 1IQ5A 3OBVA 4BY4A 4PHNA 4ETOA 1IKUA 2M7NA 5AXIA 1C7VA 1CFPA 1PSRA 1B8RA 1AJ4A 2PYQA 2F3YA 3CR5X 2KYCA 3A8RA 1TN4A 4DIRA 2PMYA 1B9AA 4IJ7A 1LA3A 3SG6A 1DJWA 3PM2A 1FBVA 1QLSA 2BL0B 2WCKA 1R6PA 4F0ZB 3EVRA 4PCWA 2M7LA 3EG5B 4FQOA 1PVAA 4JKTA 1QX5B 5DKQA 2MHHA 3VRPA 3PN7B 4GGNA 1SY9A 1TUZA 3Q8IA 2ZKMX 3FWBA 2JZIA 4PE1A 3B7AA 4C0KA 1YX8A 3GOFA 2KHNA 4M2OA 2K8MB 4CFQA 1V1GA 2L98A 2LAPA 2JTTA 2F33A 1YVHA 4WRIA 4C0JA 2L2EA 1Z4HA 2OTGC 2OS8B 4NDDA 1QXPA 2WC5A 5K89A 4CIDA 4D1EA 3OHMB 4HREE 2OPOA 1ZACA 3KF9A 1BR1B 2WOSA 3LK1A 3OX6A 4MBEA 4PE4A 1BF5A 4AQIA 3FIAA 1SSEB 3ZNIA 3AAJA 2F8PA 1BT6A 3DYEA 1OOGA 4GNKB 1SR6C 2BNXA 2KPHA 5HLVA 3RM1A 1JSAA 4YGCB 1WRKA 2FCDA 3FE8A 3ICBA 1IQ3A 1UP5A 2E6WA 5I94A 1CM1A 1CLBA 3GK1A 2EC6B 1DT7B 1B4CA 2LANA 1CTRA 2I2RE 1TCFA 1WRZA 4FQTA 1FI5A 1SYMA 1ZUZA 1JFKA 2H2KA 2H61C 1LA0A 1SR6B 1XYDA 1B8CA 3I5IB 2HETA 2Q91A 1J1DA 1QWVA 2FJYA 1DJHA 1TOPA 1A4PA 2K7BA 4NDBA 3TDUA 1QIVA 1GGWA 4XJKA 1BOCA 1J7PA 2K2AA 4A4CA 1B7TY 2Y5IA 3R1OA 1RECA 5DICA 4YRUA 1G33A 1LKJA 3MSEB 3JVTC 2QPTA 5CSFA 3CABA 2ISDA 1SBJA 3BQ3A 1C3ZA 2KAYA 2WNDA 1G4YR 1CFDA 2AMIA 1XVJA 3PN7C 1OOIX 1DEKA 2WCJA 2WCFA 2KAXA 2ZN8A 3CYZA 5AANA 3BJHA 2DOQA 4YGDB 3S0GA 2NCOA 3VRRA 2JT0A 2BKHB 1YR5A 3O2PA 4MZKA 1UHJA 2KLDA 3LK0A 1C07A 1CFFA 1R2UA 1S6JA 2CNPA 2LVJA 1S3PA 1S26D 1SK6D 1W7IB 3BFAA 2K60A 1J7RA 2NLNA 3DF0A 1D1OA 2NZ0A 2I94A 3IF7A 4YI8A 2QEHA 1CNPA 1B8LA 3B87A 1DJIA 3AAKA 1SCVA 3CDNA 2M1KB 1K90D 4YGAA 1UUSA 3NXAA 4NDCA 1K95A 3QRXA 2I7AA 2KLEA 2LVVA 3GK2A 2H61A 2WORA 2E30A 3TDIA 1K9UA 5KSZA 1S36A 3AKBA 3L4AA 4MEWA 2L5YA 1A29A 2CCMA 2L5XB 2Q4UA 2WC8A 5D7FA 1OW4A 2BAPA 1SCMB 2M97A 3CTNA 1BJFA 1QJTA 3S0EA 3TDZA 5AERA 5AFPA 1QV0A 1DJGA 1XA5A 1YUTA 2KI4B 4OV2A 4A4BA 2WCHA 1C7WA 2JU0A 3L4LA 1JF2A 1A75B 3TS5C 1DGUA 5ER5A 1B7TZ 2JXCA 4YBHB 4JPZB 5HL1A 3BFHA 1BLQA 1XFUO 4YGBB 1KK7Z 1OQPA 1KWOB 4JQ0D 1IWQA 3GK4X 2LMUA 3R1PA 4INWA 3SIBA 1EG3A 3S0DA 1RJVA 3RZSA 1QV1A 2KI4C 2G9BA 1CMGA 1L2OB 3NHTA 3LCPC 3CZ1A 1NUBA 2NXQA 1AJ5A 3TS5B 3BOWB 1K8UA 3DF0B 1F55A 3LL8B 5CSNA 1CDPA 3D78A 3PJIA 1Y1XA 2LE9B 2LMVA 3D76A 3E3RA 2PVBA 1KQMB 3CLNA 1KK8C 2JNFA 3TUYB 4OZDA 3CS1A 4OVNF 2KFGA 3K1EA 1Y6WA 3V2LA 1A75A 4N5XA 1L2OC 1OZOA 4HRHA 1FW4A 2LUCA 2CTNA 3IQQA 3PALA 2JQ6A 3BUMB 3NGVA 3OB2B 1BG1A 1JF0A 1NIWA 1JBAA 4AQJA 1U5IB 2KFFA 1QX2A 1WLMA 1KK8B 1Q80A 4PHJA 3D75A 3DXLA 2K0JA 2LP3A 1UURA 3EK4A 5ER4X 2MA2A 1NPQA 2AAOA 1S6CA 1F8HA 1AP4A 1MXEA 2JC2A 2JPTA 2LP2A 2M1UA 2OTGB 1QATA 3KPXA 4PE0A 3SIAA 3PFVA 2LVKA 1MXLC 1PVBA 3CWGA 2LCPA 3O78A 1CDNA 3IVTA 1HQVA 3OX5A 1ZMZA 4MZJA 1M46A 2KFHA 4ORAB 2K61A 1DJXA 1T14A 4GGFA 3PSRA 2MRDA 5FI6A 4BY5A 3SJSA 3WXAA 1LS8A 5FI2A 2JWWA 2KOTA 5I2OA 1K94A 3NHIA 4MLWA 1SNLA 1OMDA 1B1GA 3I5GB 2COLB 3DVJA 2QEOA 1IRJA 1YX7A 2VRGA 1RK9A 3PLFB 1SL9A 1EXRA 1W7JB 1TNPA 1VRKA 1XFXO 3EK7A 4MRYA 3R72A 3ZWHA 2JT8A 1FI6A 1QVIZ 2KGBC 4KYNA 4OR9B 2QDIA 1AVSA 2GGMA 1L7ZA 3VB1A 3WHTB 3SS4A 4INXA 4F7FA 1F54A 1OE9B 3KEVA 1ALVA 3I5GC 1MQ1A 5HKWA 1IIOA 1IH0A 2JPOA 1MUXA 1J7OA 1DJZA 4DUQA 2PASA 2P70A 2BCBA 2D8NA 3VRNA 4YGEB 1W9ZA 4FTGA 4QJ3B 1UHHA 3JVTB 3BFBA 1TIZA 1BMOA 3SS3A 2M49B 1SW8A 2JXLA 3OB1B 1JUOA 2L4HA 4GFTA 2F2OA 4Q04A 4PT1A 1EH2A 2M3WA 2M9GA 2PSRA 1OOFA 4JWQA 1CMFA 1P28A 3HX4A 2BECA 1UHNA 2ZNEA 3PM8A 5I2QA 2B1UA 3BXKA 3O4YA 5CSIA 3CZ2A 4WQ2A 3VRQA 1TWOA 2LHIA 2PRUA 3D0YA 2BBMA 3CR4X 1NWDA 1PK0D 2JT3A 1SKTA 1GGZA 4MZLA 1XO5A 3C1VA 1NCYA 1KSMA 4DCKA 2HPSA 3BUNB 1J55A 1EL4A 1CLLA 2LV7A 4UPGA 1DF0A 5HYDA 3OP0A 4PHMA 3SG3A 1QTXA 2RGIA 3DVKA 3IQOA 3NSLA 2LLSA 2Y4QA 2PALA 1RFJA 2EC6C 1OMRA 3B6XA 2BKIB 2K7DA 2P6BB 4CLNA 3O6BA 3EKJA 1OOJA 1A2XA 1MHOA 1G8IA 5G08A 1XFZO 1QASA 1RWYA 1SRAA 1M63B
chains in the Genus database with same CATH topology
3PATA 5D69A 5KTYA 5CPVA 4CFRA 1M45A 1PALA 1S6IA 2BE4A 2KSPA 1KCYA 3NSOA 1KFUL 2LUXA 1BODA 2KYFA 1TNWA 2L50A 1H8BA 1MWNA 1N2DA 2FJUB 1TNXA 1CM4A 2KAVA 3VGOA 2HQ8A 1YURA 2MLFC 2M8UA 3BUWB 3HCMA 3BOWA 4USLA 3DVMA 1RTP1 1J1EA 3BYAA 3JTDC 4GUKA 1DMOA 1F70A 1GJYA 1DJYA 3NSKA 4TNCA 1KFUS 1UHIA 1YUSA 1NP8A 4QJ4B 1SPYA 2CT9A 4GAOA 3CR2A 2LVIA 2MJWB 3H4SE 4PALA 4U8DA 4WQ3A 2WCEA 1IGVA 2MLEC 5GQQC 5HLOA 3SG5A 2HF5A 1ALWA 2BE6A 2ZRSA 2GV5A 3BUOB 2KBIA 4MVFA 1YTZC 3DVEA 3JTDB 1S5GZ 4IL1A 5JOLA 2A4JA 1HT9A 1N65A 3DD4A 2LM5A 4GGFC 2Y1NA 4XYNA 1UWOA 4I5NB 3RLZA 4ZCUA 2KBMA 2O5GA 4I5KA 3I5FC 3SG7A 4GPLB 1OSAA 5HKZA 3TUYC 1BR4B 5AEQA 3BUXB 1NSHA 4M2QA 1OZSA 3D0YB 4ZCVA 2KNEA 2ZN9A 4HSZA 4PDZA 1ZFSA 1M31A 4DS7A 3EKHA 2KQ6A 2BCXA 5I2LA 1E8AA 1CLMA 1K96A 5B8IB 1NCXA 2ZRTA 3A4UB 4E68A 3I5FB 2LC5A 1SMGA 1F4OA 2ZNDA 3AKAA 3WNXB 2JNXA 5J3XA 1S1EA 1BU3A 3K21A 2F2PA 5I8NA 1CB1A 2KQYA 4PHKA 1A03A 2M29A 2GGZA 2KGRA 1EJ3A 1M39A 3D10A 2K2FA 1YVLA 4MRXA 3NSIA 1XFYO 3F45A 5KU1A 1DTLA 2BBNA 1JWDA 2F3ZA 3EVUA 1CKKA 1K9PA 2QACA 3KO0A 3I5IC 1K2HA 2IS9A 1CDMA 2TN4A 1K9KA 4GBAA 1ODBA 2HQWA 2K7CA 1WRLA 1JFJA 1WDCB 1PULA 2SASA 2NCPA 2LLUA 1QLKA 2EHBA 3SG4A 1KQVA 1DGVA 1SCMC 5CSJA 1KQMC 1XFWO 3FWCA 5F6TA 2L0PA 4M2PA 2FOTA 4R1EA 1XK4A 2CXJA 1IJ5A 4MSPA 1S5GY 2BCAA 4OCIA 1CDLA 1TRFA 1WDCC 1YUUA 2Y1MA 1F71A 5PALA 1N0YA 5JJGA 1YRUB 3KHEA 1EG4A 1K93D 2O60A 4HRGA 3VROA 1XFVO 1FPWA 4N1GA 3WHUB 5DKRA 1RROA 1NYAA 1IJ6A 3EVVA 1DF0B 1LINA 1YRTB 4NQGA 4AOMA 1UHKA 1QIWA 1QX7A 2JOJA 3LLEA 1KSOA 2FCEA 1QVIY 3EK8A 2EGDA 1OMVA 5TNCA 1MF8B 1JC2A 1FF1A 2JRFA 4ORBB 1KFXL 2KI6D 4XJKB 1NCZA 2LLTA 4ICBA 4OKHA 2AUCA 4QJ5B 4CPVA 3CGAA 4MN0A 3TZ1A 1QS7A 5HKYA 1U5IA 2JTZA 4DRWA 2I18A 1V1FA 1SL7A 4C0LA 5DKNA 1AK8A 1TTXA 4I5LB 4P2YB 1J7QA 1SL8A 2KI6C 4L9MA 1KK7Y 2OS8C 1AUIB 1CFCA 2CBLA 2LMTA 1TCOB 1KFXS 2R2IA 2WCBA 2KDHA 4I5JA 1NX3A 1WY9A 2JULA 2LNKA 4P5OE 3I5HC 1TNQA 1LXFC 4YI9A 3SG2A 1X02A 2L51A 1LVCD 1NX1A 1WLZA 1DVIA 1PRWA 3FS7A 4PE7A 1F4QA 1IG5A 2MAZA 1B47A 3M0WA 4N1FA 1XK4C 1PSBA 3CZTX 2K7OA 5BPJA 2V53A 1AHRA 1NX0A 1GQMA 1ZOTB 2MBXA 2G2BA 1KWOC 2ZFDA 3I5HB 2M0RA 2LHLA 1Y0VH 1Y1UA 5IBWA 1MR8A 5FYXA 2L4IA 2SCPA 4ORCB 2BL0C 1NX2A 1Y1AA 1H4BA 1IQ5A 4BY4A 4PHNA 4ETOA 1IKUA 2M7NA 5AXIA 1C7VA 1CFPA 1PSRA 1B8RA 1AJ4A 2F3YA 3CR5X 2KYCA 3A8RA 1TN4A 4DIRA 2PMYA 1B9AA 1LA3A 3SG6A 1DJWA 4F0ZB 1FBVA 1QLSA 2BL0B 1R6PA 3EVRA 4PCWA 2M7LA 4FQOA 1PVAA 1QX5B 5DKQA 2MHHA 3VRPA 3PN7B 4GGNA 1SY9A 2ZKMX 3FWBA 2JZIA 4PE1A 4C0KA 1YX8A 3GOFA 2KHNA 4M2OA 2K8MB 4CFQA 1V1GA 2L98A 2LAPA 2JTTA 2F33A 1YVHA 4WRIA 4C0JA 2L2EA 2OTGC 2OS8B 4NDDA 1QXPA 5K89A 4CIDA 4D1EA 3OHMB 4HREE 2OPOA 1ZACA 3KF9A 1BR1B 2WOSA 3LK1A 3OX6A 4MBEA 4PE4A 1BF5A 4AQIA 3FIAA 3ZNIA 3AAJA 2F8PA 1BT6A 4GNKB 1SR6C 5HLVA 3RM1A 1JSAA 4YGCB 1WRKA 2FCDA 3ICBA 1IQ3A 1UP5A 2E6WA 1CLBA 1CM1A 3GK1A 2EC6B 1DT7B 1B4CA 2LANA 1CTRA 2I2RE 1TCFA 1WRZA 1FI5A 1SYMA 1ZUZA 1JFKA 2H2KA 2H61C 1LA0A 1SR6B 1XYDA 1B8CA 3I5IB 2HETA 2Q91A 1J1DA 1DJHA 1TOPA 1A4PA 2K7BA 4NDBA 3TDUA 1QIVA 1GGWA 4XJKA 1BOCA 1J7PA 2K2AA 4A4CA 1B7TY 2Y5IA 1RECA 4YRUA 1G33A 1LKJA 3MSEB 3JVTC 2QPTA 5CSFA 2ISDA 1SBJA 3BQ3A 2KAYA 2WNDA 1G4YR 1CFDA 2AMIA 1XVJA 3PN7C 2WCFA 2KAXA 2ZN8A 5AANA 2DOQA 4YGDB 2NCOA 3VRRA 2JT0A 2BKHB 1YR5A 3O2PA 4MZKA 1UHJA 3LK0A 1C07A 1CFFA 1R2UA 1S6JA 2CNPA 2LVJA 1S3PA 1S26D 1SK6D 1W7IB 1J7RA 2NLNA 3DF0A 1D1OA 2NZ0A 2I94A 3IF7A 4YI8A 1CNPA 1B8LA 1DJIA 3AAKA 1SCVA 2M1KB 1K90D 4YGAA 1UUSA 3NXAA 4NDCA 1K95A 3QRXA 2I7AA 2LVVA 3GK2A 2H61A 2WORA 2E30A 3TDIA 1K9UA 5KSZA 1S36A 3AKBA 4MEWA 1A29A 2CCMA 2L5XB 2Q4UA 2WC8A 5D7FA 1SCMB 2M97A 3CTNA 1BJFA 1QJTA 3TDZA 5AERA 5AFPA 1QV0A 1DJGA 1XA5A 1YUTA 2KI4B 4OV2A 4A4BA 1C7WA 2JU0A 1JF2A 1A75B 3TS5C 1DGUA 5ER5A 1B7TZ 2JXCA 4YBHB 4JPZB 1BLQA 1XFUO 4YGBB 1KK7Z 1OQPA 1KWOB 4JQ0D 1IWQA 3GK4X 2LMUA 3SIBA 1EG3A 1RJVA 1QV1A 2KI4C 2G9BA 1CMGA 1L2OB 3LCPC 1NUBA 2NXQA 1AJ5A 3TS5B 3BOWB 1K8UA 3DF0B 1F55A 3LL8B 5CSNA 1CDPA 1Y1XA 2LE9B 2LMVA 3E3RA 2PVBA 1KQMB 3CLNA 1KK8C 2JNFA 3TUYB 3CS1A 4OVNF 2KFGA 1Y6WA 1A75A 4N5XA 1L2OC 1OZOA 4HRHA 1FW4A 2LUCA 2CTNA 3IQQA 3PALA 2JQ6A 3BUMB 1BG1A 3OB2B 1JF0A 1NIWA 1JBAA 4AQJA 1U5IB 2KFFA 1QX2A 1WLMA 1KK8B 1Q80A 4PHJA 2K0JA 2LP3A 1UURA 3EK4A 5ER4X 2MA2A 1NPQA 2AAOA 1S6CA 1F8HA 1AP4A 1MXEA 2JC2A 2JPTA 2LP2A 2M1UA 2OTGB 1QATA 3KPXA 4PE0A 3SIAA 3PFVA 2LVKA 1MXLC 1PVBA 3CWGA 2LCPA 3O78A 1CDNA 1HQVA 3OX5A 1ZMZA 4MZJA 1M46A 2KFHA 4ORAB 2K61A 1DJXA 4GGFA 3PSRA 2MRDA 4BY5A 3SJSA 3WXAA 2JWWA 2KOTA 5I2OA 1K94A 4MLWA 1SNLA 1OMDA 1B1GA 3I5GB 2COLB 3DVJA 2VRGA 1IRJA 1YX7A 1RK9A 3PLFB 1SL9A 1EXRA 1W7JB 1TNPA 1VRKA 1XFXO 3EK7A 4MRYA 3ZWHA 1FI6A 2JT8A 1QVIZ 2KGBC 4OR9B 1AVSA 2GGMA 1L7ZA 3WHTB 1F54A 1OE9B 3KEVA 1ALVA 3I5GC 1MQ1A 5HKWA 1IH0A 1MUXA 1J7OA 1DJZA 4DUQA 2PASA 2BCBA 2D8NA 3VRNA 4YGEB 4QJ3B 4FTGA 1UHHA 3JVTB 1TIZA 1BMOA 2M49B 1SW8A 2JXLA 3OB1B 1JUOA 2L4HA 4GFTA 2F2OA 4Q04A 1EH2A 2M3WA 2M9GA 2PSRA 4JWQA 1CMFA 3HX4A 2BECA 1UHNA 2ZNEA 3PM8A 5I2QA 2B1UA 3BXKA 3O4YA 5CSIA 4WQ2A 3VRQA 2LHIA 2PRUA 3D0YA 2BBMA 3CR4X 1NWDA 1PK0D 2JT3A 1SKTA 1GGZA 4MZLA 1XO5A 3C1VA 1NCYA 1KSMA 4DCKA 2HPSA 3BUNB 1J55A 1EL4A 1CLLA 2LV7A 4UPGA 1DF0A 5HYDA 3OP0A 4PHMA 3SG3A 1QTXA 2RGIA 3DVKA 3IQOA 3NSLA 2LLSA 2Y4QA 2PALA 1RFJA 2EC6C 1OMRA 2BKIB 2K7DA 2P6BB 4CLNA 3O6BA 3EKJA 1OOJA 1A2XA 1MHOA 1G8IA 5G08A 1XFZO 1QASA 1RWYA 1SRAA 1M63B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PAT A;  5D69 A;  5KTY A;  5CPV A;  4CFR A;  1M45 A;  1PAL A;  1S6I A;  2BE4 A;  2KSP A;  1KCY A;  3NSO A;  1KFU L;  2LUX A;  1BOD A;  2KYF A;  1TNW A;  2L50 A;  1H8B A;  1MWN A;  1N2D A;  2FJU B;  1TNX A;  1CM4 A;  2KAV A;  3VGO A;  2HQ8 A;  1YUR A;  2MLF C;  2M8U A;  3BUW B;  3HCM A;  3BOW A;  4USL A;  3DVM A;  1RTP 1;  1J1E A;  3BYA A;  3JTD C;  4GUK A;  1DMO A;  1F70 A;  1GJY A;  1DJY A;  3NSK A;  4TNC A;  1KFU S;  1UHI A;  1YUS A;  1NP8 A;  4QJ4 B;  1SPY A;  2CT9 A;  4GAO A;  3CR2 A;  2LVI A;  2MJW B;  3H4S E;  4PAL A;  4U8D A;  4WQ3 A;  2WCE A;  1IGV A;  2MLE C;  5GQQ C;  5HLO A;  3SG5 A;  2HF5 A;  1ALW A;  2BE6 A;  2ZRS A;  2GV5 A;  3BUO B;  2KBI A;  4MVF A;  1YTZ C;  3DVE A;  3JTD B;  1S5G Z;  4IL1 A;  5JOL A;  2A4J A;  1HT9 A;  1N65 A;  3DD4 A;  2LM5 A;  4GGF C;  2Y1N A;  4XYN A;  1UWO A;  4I5N B;  3RLZ A;  4ZCU A;  2KBM A;  2O5G A;  4I5K A;  3I5F C;  3SG7 A;  4GPL B;  1OSA A;  5HKZ A;  3TUY C;  1BR4 B;  5AEQ A;  3BUX B;  1NSH A;  4M2Q A;  1OZS A;  3D0Y B;  4ZCV A;  2KNE A;  2ZN9 A;  4HSZ A;  4PDZ A;  1ZFS A;  1M31 A;  4DS7 A;  3EKH A;  2KQ6 A;  2BCX A;  5I2L A;  1E8A A;  1CLM A;  1K96 A;  5B8I B;  1NCX A;  2ZRT A;  3A4U B;  4E68 A;  3I5F B;  2LC5 A;  1SMG A;  1F4O A;  2ZND A;  3AKA A;  3WNX B;  2JNX A;  5J3X A;  1S1E A;  1BU3 A;  3K21 A;  2F2P A;  5I8N A;  1CB1 A;  2KQY A;  4PHK A;  1A03 A;  2M29 A;  2GGZ A;  2KGR A;  1EJ3 A;  1M39 A;  3D10 A;  2K2F A;  1YVL A;  4MRX A;  3NSI A;  1XFY O;  3F45 A;  5KU1 A;  1DTL A;  2BBN A;  1JWD A;  2F3Z A;  3EVU A;  1CKK A;  1K9P A;  2QAC A;  3KO0 A;  3I5I C;  1K2H A;  2IS9 A;  1CDM A;  2TN4 A;  1K9K A;  4GBA A;  1ODB A;  2HQW A;  2K7C A;  1WRL A;  1JFJ A;  1WDC B;  1PUL A;  2SAS A;  2NCP A;  2LLU A;  1QLK A;  2EHB A;  3SG4 A;  1KQV A;  1DGV A;  1SCM C;  5CSJ A;  1KQM C;  1XFW O;  3FWC A;  5F6T A;  2L0P A;  4M2P A;  2FOT A;  4R1E A;  1XK4 A;  2CXJ A;  1IJ5 A;  4MSP A;  1S5G Y;  2BCA A;  4OCI A;  1CDL A;  1TRF A;  1WDC C;  1YUU A;  2Y1M A;  1F71 A;  5PAL A;  1N0Y A;  5JJG A;  1YRU B;  3KHE A;  1EG4 A;  1K93 D;  2O60 A;  4HRG A;  3VRO A;  1XFV O;  1FPW A;  4N1G A;  3WHU B;  5DKR A;  1RRO A;  1NYA A;  1IJ6 A;  3EVV A;  1DF0 B;  1LIN A;  1YRT B;  4NQG A;  4AOM A;  1UHK A;  1QIW A;  1QX7 A;  2JOJ A;  3LLE A;  1KSO A;  2FCE A;  1QVI Y;  3EK8 A;  2EGD A;  1OMV A;  5TNC A;  1MF8 B;  1JC2 A;  1FF1 A;  2JRF A;  4ORB B;  1KFX L;  2KI6 D;  4XJK B;  1NCZ A;  2LLT A;  4ICB A;  4OKH A;  2AUC A;  4QJ5 B;  4CPV A;  3CGA A;  4MN0 A;  3TZ1 A;  1QS7 A;  5HKY A;  1U5I A;  2JTZ A;  4DRW A;  2I18 A;  1V1F A;  1SL7 A;  4C0L A;  5DKN A;  1AK8 A;  1TTX A;  4I5L B;  4P2Y B;  1J7Q A;  1SL8 A;  2KI6 C;  4L9M A;  1KK7 Y;  2OS8 C;  1AUI B;  1CFC A;  2CBL A;  2LMT A;  1TCO B;  1KFX S;  2R2I A;  2WCB A;  2KDH A;  4I5J A;  1NX3 A;  1WY9 A;  2JUL A;  2LNK A;  4P5O E;  3I5H C;  1TNQ A;  1LXF C;  4YI9 A;  3SG2 A;  1X02 A;  2L51 A;  1LVC D;  1NX1 A;  1WLZ A;  1DVI A;  1PRW A;  3FS7 A;  4PE7 A;  1F4Q A;  1IG5 A;  2MAZ A;  1B47 A;  3M0W A;  4N1F A;  1XK4 C;  1PSB A;  3CZT X;  2K7O A;  5BPJ A;  2V53 A;  1AHR A;  1NX0 A;  1GQM A;  1ZOT B;  2MBX A;  2G2B A;  1KWO C;  2ZFD A;  3I5H B;  2M0R A;  2LHL A;  1Y0V H;  1Y1U A;  5IBW A;  1MR8 A;  5FYX A;  2L4I A;  2SCP A;  4ORC B;  2BL0 C;  1NX2 A;  1Y1A A;  1H4B A;  1IQ5 A;  4BY4 A;  4PHN A;  4ETO A;  1IKU A;  2M7N A;  5AXI A;  1C7V A;  1CFP A;  1PSR A;  1B8R A;  1AJ4 A;  2F3Y A;  3CR5 X;  2KYC A;  3A8R A;  1TN4 A;  4DIR A;  2PMY A;  1B9A A;  1LA3 A;  3SG6 A;  1DJW A;  4F0Z B;  1FBV A;  1QLS A;  2BL0 B;  1R6P A;  3EVR A;  4PCW A;  2M7L A;  4FQO A;  1PVA A;  1QX5 B;  5DKQ A;  2MHH A;  3VRP A;  3PN7 B;  4GGN A;  1SY9 A;  2ZKM X;  3FWB A;  2JZI A;  4PE1 A;  4C0K A;  1YX8 A;  3GOF A;  2KHN A;  4M2O A;  2K8M B;  4CFQ A;  1V1G A;  2L98 A;  2LAP A;  2JTT A;  2F33 A;  1YVH A;  4WRI A;  4C0J A;  2L2E A;  2OTG C;  2OS8 B;  4NDD A;  1QXP A;  5K89 A;  4CID A;  4D1E A;  3OHM B;  4HRE E;  2OPO A;  1ZAC A;  3KF9 A;  1BR1 B;  2WOS A;  3LK1 A;  3OX6 A;  4MBE A;  4PE4 A;  1BF5 A;  4AQI A;  3FIA A;  3ZNI A;  3AAJ A;  2F8P A;  1BT6 A;  4GNK B;  1SR6 C;  5HLV A;  3RM1 A;  1JSA A;  4YGC B;  1WRK A;  2FCD A;  3ICB A;  1IQ3 A;  1UP5 A;  2E6W A;  1CLB A;  1CM1 A;  3GK1 A;  2EC6 B;  1DT7 B;  1B4C A;  2LAN A;  1CTR A;  2I2R E;  1TCF A;  1WRZ A;  1FI5 A;  1SYM A;  1ZUZ A;  1JFK A;  2H2K A;  2H61 C;  1LA0 A;  1SR6 B;  1XYD A;  1B8C A;  3I5I B;  2HET A;  2Q91 A;  1J1D A;  1DJH A;  1TOP A;  1A4P A;  2K7B A;  4NDB A;  3TDU A;  1QIV A;  1GGW A;  4XJK A;  1BOC A;  1J7P A;  2K2A A;  4A4C A;  1B7T Y;  2Y5I A;  1REC A;  4YRU A;  1G33 A;  1LKJ A;  3MSE B;  3JVT C;  2QPT A;  5CSF A;  2ISD A;  1SBJ A;  3BQ3 A;  2KAY A;  2WND A;  1G4Y R;  1CFD A;  2AMI A;  1XVJ A;  3PN7 C;  2WCF A;  2KAX A;  2ZN8 A;  5AAN A;  2DOQ A;  4YGD B;  2NCO A;  3VRR A;  2JT0 A;  2BKH B;  1YR5 A;  3O2P A;  4MZK A;  1UHJ A;  3LK0 A;  1C07 A;  1CFF A;  1R2U A;  1S6J A;  2CNP A;  2LVJ A;  1S3P A;  1S26 D;  1SK6 D;  1W7I B;  1J7R A;  2NLN A;  3DF0 A;  1D1O A;  2NZ0 A;  2I94 A;  3IF7 A;  4YI8 A;  1CNP A;  1B8L A;  1DJI A;  3AAK A;  1SCV A;  2M1K B;  1K90 D;  4YGA A;  1UUS A;  3NXA A;  4NDC A;  1K95 A;  3QRX A;  2I7A A;  2LVV A;  3GK2 A;  2H61 A;  2WOR A;  2E30 A;  3TDI A;  1K9U A;  5KSZ A;  1S36 A;  3AKB A;  4MEW A;  1A29 A;  2CCM A;  2L5X B;  2Q4U A;  2WC8 A;  5D7F A;  1SCM B;  2M97 A;  3CTN A;  1BJF A;  1QJT A;  3TDZ A;  5AER A;  5AFP A;  1QV0 A;  1DJG A;  1XA5 A;  1YUT A;  2KI4 B;  4OV2 A;  4A4B A;  1C7W A;  2JU0 A;  1JF2 A;  1A75 B;  3TS5 C;  1DGU A;  5ER5 A;  1B7T Z;  2JXC A;  4YBH B;  4JPZ B;  1BLQ A;  1XFU O;  4YGB B;  1KK7 Z;  1OQP A;  1KWO B;  4JQ0 D;  1IWQ A;  3GK4 X;  2LMU A;  3SIB A;  1EG3 A;  1RJV A;  1QV1 A;  2KI4 C;  2G9B A;  1CMG A;  1L2O B;  3LCP C;  1NUB A;  2NXQ A;  1AJ5 A;  3TS5 B;  3BOW B;  1K8U A;  3DF0 B;  1F55 A;  3LL8 B;  5CSN A;  1CDP A;  1Y1X A;  2LE9 B;  2LMV A;  3E3R A;  2PVB A;  1KQM B;  3CLN A;  1KK8 C;  2JNF A;  3TUY B;  3CS1 A;  4OVN F;  2KFG A;  1Y6W A;  1A75 A;  4N5X A;  1L2O C;  1OZO A;  4HRH A;  1FW4 A;  2LUC A;  2CTN A;  3IQQ A;  3PAL A;  2JQ6 A;  3BUM B;  1BG1 A;  3OB2 B;  1JF0 A;  1NIW A;  1JBA A;  4AQJ A;  1U5I B;  2KFF A;  1QX2 A;  1WLM A;  1KK8 B;  1Q80 A;  4PHJ A;  2K0J A;  2LP3 A;  1UUR A;  3EK4 A;  5ER4 X;  2MA2 A;  1NPQ A;  2AAO A;  1S6C A;  1F8H A;  1AP4 A;  1MXE A;  2JC2 A;  2JPT A;  2LP2 A;  2M1U A;  2OTG B;  1QAT A;  3KPX A;  4PE0 A;  3SIA A;  3PFV A;  2LVK A;  1MXL C;  1PVB A;  3CWG A;  2LCP A;  3O78 A;  1CDN A;  1HQV A;  3OX5 A;  1ZMZ A;  4MZJ A;  1M46 A;  2KFH A;  4ORA B;  2K61 A;  1DJX A;  4GGF A;  3PSR A;  2MRD A;  4BY5 A;  3SJS A;  3WXA A;  2JWW A;  2KOT A;  5I2O A;  1K94 A;  4MLW A;  1SNL A;  1OMD A;  1B1G A;  3I5G B;  2COL B;  3DVJ A;  2VRG A;  1IRJ A;  1YX7 A;  1RK9 A;  3PLF B;  1SL9 A;  1EXR A;  1W7J B;  1TNP A;  1VRK A;  1XFX O;  3EK7 A;  4MRY A;  3ZWH A;  1FI6 A;  2JT8 A;  1QVI Z;  2KGB C;  4OR9 B;  1AVS A;  2GGM A;  1L7Z A;  3WHT B;  1F54 A;  1OE9 B;  3KEV A;  1ALV A;  3I5G C;  1MQ1 A;  5HKW A;  1IH0 A;  1MUX A;  1J7O A;  1DJZ A;  4DUQ A;  2PAS A;  2BCB A;  2D8N A;  3VRN A;  4YGE B;  4QJ3 B;  4FTG A;  1UHH A;  3JVT B;  1TIZ A;  1BMO A;  2M49 B;  1SW8 A;  2JXL A;  3OB1 B;  1JUO A;  2L4H A;  4GFT A;  2F2O A;  4Q04 A;  1EH2 A;  2M3W A;  2M9G A;  2PSR A;  4JWQ A;  1CMF A;  3HX4 A;  2BEC A;  1UHN A;  2ZNE A;  3PM8 A;  5I2Q A;  2B1U A;  3BXK A;  3O4Y A;  5CSI A;  4WQ2 A;  3VRQ A;  2LHI A;  2PRU A;  3D0Y A;  2BBM A;  3CR4 X;  1NWD A;  1PK0 D;  2JT3 A;  1SKT A;  1GGZ A;  4MZL A;  1XO5 A;  3C1V A;  1NCY A;  1KSM A;  4DCK A;  2HPS A;  3BUN B;  1J55 A;  1EL4 A;  1CLL A;  2LV7 A;  4UPG A;  1DF0 A;  5HYD A;  3OP0 A;  4PHM A;  3SG3 A;  1QTX A;  2RGI A;  3DVK A;  3IQO A;  3NSL A;  2LLS A;  2Y4Q A;  2PAL A;  1RFJ A;  2EC6 C;  1OMR A;  2BKI B;  2K7D A;  2P6B B;  4CLN A;  3O6B A;  3EKJ A;  1OOJ A;  1A2X A;  1MHO A;  1G8I A;  5G08 A;  1XFZ O;  1QAS A;  1RWY A;  1SRA A;  1M63 B; 
#chains in the Genus database with same CATH topology
 3PAT A;  5D69 A;  5KTY A;  5CPV A;  4CFR A;  1M45 A;  5EL2 A;  1PAL A;  1S6I A;  2BE4 A;  2KSP A;  1KCY A;  3NSO A;  1KFU L;  2LUX A;  3R1V A;  1BOD A;  2KYF A;  1TNW A;  1Z2C B;  3QME A;  2L50 A;  2WCL A;  1H8B A;  1MWN A;  1N2D A;  2FJU B;  1TNX A;  1CM4 A;  2KAV A;  3VGO A;  2HQ8 A;  1YUR A;  2MLF C;  2M8U A;  3D77 A;  3FE9 A;  3BUW B;  3HCM A;  3BOW A;  4USL A;  3DVM A;  1RTP 1;  1J1E A;  3BYA A;  3JTD C;  4GUK A;  3DY9 A;  1DMO A;  1F70 A;  1GJY A;  1DJY A;  3NSK A;  2ERB A;  4TNC A;  1KFU S;  1UHI A;  1YUS A;  1NP8 A;  4QJ4 B;  1SPY A;  2CT9 A;  4GAO A;  3CR2 A;  2LVI A;  2MJW B;  3H4S E;  4PAL A;  4U8D A;  4WQ3 A;  2WCE A;  1IGV A;  2MLE C;  5GQQ C;  5HLO A;  3SG5 A;  3S0F A;  2HF5 A;  1ALW A;  2BE6 A;  1GM0 A;  2ZRS A;  2GV5 A;  3BUO B;  2KBI A;  4MVF A;  1YTZ C;  3CZ0 A;  3DVE A;  1S5G Z;  3JTD B;  4IL1 A;  5JOL A;  2A4J A;  1HT9 A;  1N65 A;  3B88 A;  1DC1 A;  3DD4 A;  2LM5 A;  4GGF C;  2Y1N A;  4XYN A;  1UWO A;  2WC6 A;  4I5N B;  3RLZ A;  4ZCU A;  3D74 A;  2H8V A;  2GTE A;  2KBM A;  2O5G A;  4I5K A;  3I5F C;  3SG7 A;  3OGN A;  4GPL B;  1OSA A;  5HKZ A;  3TUY C;  1BR4 B;  5AEQ A;  3BUX B;  3O4X A;  1NSH A;  4M2Q A;  1OZS A;  3D0Y B;  4ZCV A;  2KNE A;  2ZN9 A;  4HSZ A;  4PDZ A;  1ZFS A;  1M31 A;  4DS7 A;  3B86 A;  3EKH A;  2KQ6 A;  2BCX A;  5I2L A;  1E8A A;  1CLM A;  1K96 A;  5B8I B;  1NCX A;  2ZRT A;  3A4U B;  4E68 A;  3I5F B;  2LC5 A;  1SMG A;  1F4O A;  2ZND A;  3AKA A;  3WNX B;  1DEL A;  2JNX A;  5J3X A;  1S1E A;  1BU3 A;  3K21 A;  2F2P A;  5I8N A;  1CB1 A;  2KQY A;  4PHK A;  1A03 A;  1XFR A;  2M29 A;  2GGZ A;  2KGR A;  1EJ3 A;  1M39 A;  3D10 A;  2K2F A;  1YVL A;  5D3O A;  4MRX A;  3NSI A;  1XFY O;  3F45 A;  5KU1 A;  1DTL A;  2YGU A;  2BBN A;  1JWD A;  2F3Z A;  3EVU A;  1CKK A;  1K9P A;  2QAC A;  3KO0 A;  3I5I C;  1K2H A;  2IS9 A;  1CDM A;  3DZT A;  2TN4 A;  1K9K A;  4GBA A;  1ODB A;  2HQW A;  2K7C A;  1WRL A;  2WCM A;  1JFJ A;  1WDC B;  1PUL A;  2SAS A;  2NCP A;  2LLU A;  1QLK A;  2EHB A;  3SG4 A;  1KQV A;  1DGV A;  1SCM C;  1TUJ A;  5CSJ A;  1KQM C;  1XFW O;  3FWC A;  5F6T A;  2L0P A;  2QEV A;  3S0B A;  4M2P A;  2FOT A;  4R1E A;  1XK4 A;  2CXJ A;  1IJ5 A;  4MSP A;  1S5G Y;  2BCA A;  4OCI A;  1CDL A;  2P71 A;  3FE6 A;  1TRF A;  1WDC C;  1YUU A;  2Y1M A;  1F71 A;  1DQE A;  2QEB A;  5PAL A;  1N0Y A;  5JJG A;  1YRU B;  3KHE A;  1EG4 A;  1K93 D;  2O60 A;  4HRG A;  3VRO A;  1XFV O;  1FPW A;  4N1G A;  1C3Y A;  3WHU B;  5DKR A;  1RRO A;  1NYA A;  1IJ6 A;  3EVV A;  3L47 A;  1DF0 B;  1LIN A;  1YRT B;  4NQG A;  4AOM A;  1UHK A;  1QIW A;  1QX7 A;  2JOJ A;  3LLE A;  1KSO A;  2FCE A;  1QVI Y;  3EK8 A;  2EGD A;  1OMV A;  3N7H A;  1MF8 B;  5TNC A;  4JD9 A;  1JC2 A;  1FF1 A;  2JRF A;  4ORB B;  1KFX L;  2KI6 D;  4XJK B;  1NCZ A;  2LLT A;  4ICB A;  4OKH A;  2AUC A;  3S0A A;  4QJ5 B;  5FI7 A;  4CPV A;  3CGA A;  4MN0 A;  3TZ1 A;  1QS7 A;  5HKY A;  1U5I A;  2JTZ A;  4DRW A;  2I18 A;  1V1F A;  1SL7 A;  4C0L A;  2L2C A;  5DKN A;  1AK8 A;  1TTX A;  3UO9 A;  4I5L B;  2PQL A;  4P2Y B;  1SL8 A;  1J7Q A;  2KI6 C;  4L9M A;  1KK7 Y;  2OS8 C;  1AUI B;  1CFC A;  2CBL A;  2LMT A;  1TCO B;  1KFX S;  2R2I A;  2WCB A;  1ORG A;  2KDH A;  3D73 A;  4I5J A;  1NX3 A;  1WY9 A;  2JUL A;  2LNK A;  1OOH A;  3I5H C;  4P5O E;  3UNW A;  1TNQ A;  1LXF C;  4YI9 A;  3SG2 A;  1X02 A;  2L51 A;  1LVC D;  1NX1 A;  3SS5 A;  1WLZ A;  1DVI A;  1PRW A;  3FS7 A;  4PE7 A;  1F4Q A;  1IG5 A;  2MAZ A;  1B47 A;  3M0W A;  4N1F A;  1XK4 C;  1PSB A;  3CZT X;  2K7O A;  5BPJ A;  2V53 A;  1AHR A;  1NX0 A;  1GQM A;  1ZOT B;  2MBX A;  2G2B A;  1KWO C;  2ZFD A;  3I5H B;  2M0R A;  2LHL A;  1Y0V H;  1Y1U A;  5IBW A;  1MR8 A;  5FYX A;  2L4I A;  2SCP A;  4ORC B;  2BL0 C;  1NX2 A;  1Y1A A;  1H4B A;  1IQ5 A;  3OBV A;  4BY4 A;  4PHN A;  4ETO A;  1IKU A;  2M7N A;  5AXI A;  1C7V A;  1CFP A;  1PSR A;  1B8R A;  1AJ4 A;  2PYQ A;  2F3Y A;  3CR5 X;  2KYC A;  3A8R A;  1TN4 A;  4DIR A;  2PMY A;  1B9A A;  4IJ7 A;  1LA3 A;  3SG6 A;  1DJW A;  3PM2 A;  1FBV A;  1QLS A;  2BL0 B;  2WCK A;  1R6P A;  4F0Z B;  3EVR A;  4PCW A;  2M7L A;  3EG5 B;  4FQO A;  1PVA A;  4JKT A;  1QX5 B;  5DKQ A;  2MHH A;  3VRP A;  3PN7 B;  4GGN A;  1SY9 A;  1TUZ A;  3Q8I A;  2ZKM X;  3FWB A;  2JZI A;  4PE1 A;  3B7A A;  4C0K A;  1YX8 A;  3GOF A;  2KHN A;  4M2O A;  2K8M B;  4CFQ A;  1V1G A;  2L98 A;  2LAP A;  2JTT A;  2F33 A;  1YVH A;  4WRI A;  4C0J A;  2L2E A;  1Z4H A;  2OTG C;  2OS8 B;  4NDD A;  1QXP A;  2WC5 A;  5K89 A;  4CID A;  4D1E A;  3OHM B;  4HRE E;  2OPO A;  1ZAC A;  3KF9 A;  1BR1 B;  2WOS A;  3LK1 A;  3OX6 A;  4MBE A;  4PE4 A;  1BF5 A;  4AQI A;  3FIA A;  1SSE B;  3ZNI A;  3AAJ A;  2F8P A;  1BT6 A;  3DYE A;  1OOG A;  4GNK B;  1SR6 C;  2BNX A;  2KPH A;  5HLV A;  3RM1 A;  1JSA A;  4YGC B;  1WRK A;  2FCD A;  3FE8 A;  3ICB A;  1IQ3 A;  1UP5 A;  2E6W A;  5I94 A;  1CM1 A;  1CLB A;  3GK1 A;  2EC6 B;  1DT7 B;  1B4C A;  2LAN A;  1CTR A;  2I2R E;  1TCF A;  1WRZ A;  4FQT A;  1FI5 A;  1SYM A;  1ZUZ A;  1JFK A;  2H2K A;  2H61 C;  1LA0 A;  1SR6 B;  1XYD A;  1B8C A;  3I5I B;  2HET A;  2Q91 A;  1J1D A;  1QWV A;  2FJY A;  1DJH A;  1TOP A;  1A4P A;  2K7B A;  4NDB A;  3TDU A;  1QIV A;  1GGW A;  4XJK A;  1BOC A;  1J7P A;  2K2A A;  4A4C A;  1B7T Y;  2Y5I A;  3R1O A;  1REC A;  5DIC A;  4YRU A;  1G33 A;  1LKJ A;  3MSE B;  3JVT C;  2QPT A;  5CSF A;  3CAB A;  2ISD A;  1SBJ A;  3BQ3 A;  1C3Z A;  2KAY A;  2WND A;  1G4Y R;  1CFD A;  2AMI A;  1XVJ A;  3PN7 C;  1OOI X;  1DEK A;  2WCJ A;  2WCF A;  2KAX A;  2ZN8 A;  3CYZ A;  5AAN A;  3BJH A;  2DOQ A;  4YGD B;  3S0G A;  2NCO A;  3VRR A;  2JT0 A;  2BKH B;  1YR5 A;  3O2P A;  4MZK A;  1UHJ A;  2KLD A;  3LK0 A;  1C07 A;  1CFF A;  1R2U A;  1S6J A;  2CNP A;  2LVJ A;  1S3P A;  1S26 D;  1SK6 D;  1W7I B;  3BFA A;  2K60 A;  1J7R A;  2NLN A;  3DF0 A;  1D1O A;  2NZ0 A;  2I94 A;  3IF7 A;  4YI8 A;  2QEH A;  1CNP A;  1B8L A;  3B87 A;  1DJI A;  3AAK A;  1SCV A;  3CDN A;  2M1K B;  1K90 D;  4YGA A;  1UUS A;  3NXA A;  4NDC A;  1K95 A;  3QRX A;  2I7A A;  2KLE A;  2LVV A;  3GK2 A;  2H61 A;  2WOR A;  2E30 A;  3TDI A;  1K9U A;  5KSZ A;  1S36 A;  3AKB A;  3L4A A;  4MEW A;  2L5Y A;  1A29 A;  2CCM A;  2L5X B;  2Q4U A;  2WC8 A;  5D7F A;  1OW4 A;  2BAP A;  1SCM B;  2M97 A;  3CTN A;  1BJF A;  1QJT A;  3S0E A;  3TDZ A;  5AER A;  5AFP A;  1QV0 A;  1DJG A;  1XA5 A;  1YUT A;  2KI4 B;  4OV2 A;  4A4B A;  2WCH A;  1C7W A;  2JU0 A;  3L4L A;  1JF2 A;  1A75 B;  3TS5 C;  1DGU A;  5ER5 A;  1B7T Z;  2JXC A;  4YBH B;  4JPZ B;  5HL1 A;  3BFH A;  1BLQ A;  1XFU O;  4YGB B;  1KK7 Z;  1OQP A;  1KWO B;  4JQ0 D;  1IWQ A;  3GK4 X;  2LMU A;  3R1P A;  4INW A;  3SIB A;  1EG3 A;  3S0D A;  1RJV A;  3RZS A;  1QV1 A;  2KI4 C;  2G9B A;  1CMG A;  1L2O B;  3NHT A;  3LCP C;  3CZ1 A;  1NUB A;  2NXQ A;  1AJ5 A;  3TS5 B;  3BOW B;  1K8U A;  3DF0 B;  1F55 A;  3LL8 B;  5CSN A;  1CDP A;  3D78 A;  3PJI A;  1Y1X A;  2LE9 B;  2LMV A;  3D76 A;  3E3R A;  2PVB A;  1KQM B;  3CLN A;  1KK8 C;  2JNF A;  3TUY B;  4OZD A;  3CS1 A;  4OVN F;  2KFG A;  3K1E A;  1Y6W A;  3V2L A;  1A75 A;  4N5X A;  1L2O C;  1OZO A;  4HRH A;  1FW4 A;  2LUC A;  2CTN A;  3IQQ A;  3PAL A;  2JQ6 A;  3BUM B;  3NGV A;  3OB2 B;  1BG1 A;  1JF0 A;  1NIW A;  1JBA A;  4AQJ A;  1U5I B;  2KFF A;  1QX2 A;  1WLM A;  1KK8 B;  1Q80 A;  4PHJ A;  3D75 A;  3DXL A;  2K0J A;  2LP3 A;  1UUR A;  3EK4 A;  5ER4 X;  2MA2 A;  1NPQ A;  2AAO A;  1S6C A;  1F8H A;  1AP4 A;  1MXE A;  2JC2 A;  2JPT A;  2LP2 A;  2M1U A;  2OTG B;  1QAT A;  3KPX A;  4PE0 A;  3SIA A;  3PFV A;  2LVK A;  1MXL C;  1PVB A;  3CWG A;  2LCP A;  3O78 A;  1CDN A;  3IVT A;  1HQV A;  3OX5 A;  1ZMZ A;  4MZJ A;  1M46 A;  2KFH A;  4ORA B;  2K61 A;  1DJX A;  1T14 A;  4GGF A;  3PSR A;  2MRD A;  5FI6 A;  4BY5 A;  3SJS A;  3WXA A;  1LS8 A;  5FI2 A;  2JWW A;  2KOT A;  5I2O A;  1K94 A;  3NHI A;  4MLW A;  1SNL A;  1OMD A;  1B1G A;  3I5G B;  2COL B;  3DVJ A;  2QEO A;  1IRJ A;  1YX7 A;  2VRG A;  1RK9 A;  3PLF B;  1SL9 A;  1EXR A;  1W7J B;  1TNP A;  1VRK A;  1XFX O;  3EK7 A;  4MRY A;  3R72 A;  3ZWH A;  2JT8 A;  1FI6 A;  1QVI Z;  2KGB C;  4KYN A;  4OR9 B;  2QDI A;  1AVS A;  2GGM A;  1L7Z A;  3VB1 A;  3WHT B;  3SS4 A;  4INX A;  4F7F A;  1F54 A;  1OE9 B;  3KEV A;  1ALV A;  3I5G C;  1MQ1 A;  5HKW A;  1IIO A;  1IH0 A;  2JPO A;  1MUX A;  1J7O A;  1DJZ A;  4DUQ A;  2PAS A;  2P70 A;  2BCB A;  2D8N A;  3VRN A;  4YGE B;  1W9Z A;  4FTG A;  4QJ3 B;  1UHH A;  3JVT B;  3BFB A;  1TIZ A;  1BMO A;  3SS3 A;  2M49 B;  1SW8 A;  2JXL A;  3OB1 B;  1JUO A;  2L4H A;  4GFT A;  2F2O A;  4Q04 A;  4PT1 A;  1EH2 A;  2M3W A;  2M9G A;  2PSR A;  1OOF A;  4JWQ A;  1CMF A;  1P28 A;  3HX4 A;  2BEC A;  1UHN A;  2ZNE A;  3PM8 A;  5I2Q A;  2B1U A;  3BXK A;  3O4Y A;  5CSI A;  3CZ2 A;  4WQ2 A;  3VRQ A;  1TWO A;  2LHI A;  2PRU A;  3D0Y A;  2BBM A;  3CR4 X;  1NWD A;  1PK0 D;  2JT3 A;  1SKT A;  1GGZ A;  4MZL A;  1XO5 A;  3C1V A;  1NCY A;  1KSM A;  4DCK A;  2HPS A;  3BUN B;  1J55 A;  1EL4 A;  1CLL A;  2LV7 A;  4UPG A;  1DF0 A;  5HYD A;  3OP0 A;  4PHM A;  3SG3 A;  1QTX A;  2RGI A;  3DVK A;  3IQO A;  3NSL A;  2LLS A;  2Y4Q A;  2PAL A;  1RFJ A;  2EC6 C;  1OMR A;  3B6X A;  2BKI B;  2K7D A;  2P6B B;  4CLN A;  3O6B A;  3EKJ A;  1OOJ A;  1A2X A;  1MHO A;  1G8I A;  5G08 A;  1XFZ O;  1QAS A;  1RWY A;  1SRA A;  1M63 B; 
#chains in the Genus database with same CATH homology
 3PAT A;  5D69 A;  5KTY A;  5CPV A;  4CFR A;  1M45 A;  1PAL A;  1S6I A;  2BE4 A;  2KSP A;  1KCY A;  3NSO A;  1KFU L;  2LUX A;  1BOD A;  2KYF A;  1TNW A;  2L50 A;  1H8B A;  1MWN A;  1N2D A;  2FJU B;  1TNX A;  1CM4 A;  2KAV A;  3VGO A;  2HQ8 A;  1YUR A;  2MLF C;  2M8U A;  3BUW B;  3HCM A;  3BOW A;  4USL A;  3DVM A;  1RTP 1;  1J1E A;  3BYA A;  3JTD C;  4GUK A;  1DMO A;  1F70 A;  1GJY A;  1DJY A;  3NSK A;  4TNC A;  1KFU S;  1UHI A;  1YUS A;  1NP8 A;  4QJ4 B;  1SPY A;  2CT9 A;  4GAO A;  3CR2 A;  2LVI A;  2MJW B;  3H4S E;  4PAL A;  4U8D A;  4WQ3 A;  2WCE A;  1IGV A;  2MLE C;  5GQQ C;  5HLO A;  3SG5 A;  2HF5 A;  1ALW A;  2BE6 A;  2ZRS A;  2GV5 A;  3BUO B;  2KBI A;  4MVF A;  1YTZ C;  3DVE A;  3JTD B;  1S5G Z;  4IL1 A;  5JOL A;  2A4J A;  1HT9 A;  1N65 A;  3DD4 A;  2LM5 A;  4GGF C;  2Y1N A;  4XYN A;  1UWO A;  4I5N B;  3RLZ A;  4ZCU A;  2KBM A;  2O5G A;  4I5K A;  3I5F C;  3SG7 A;  4GPL B;  1OSA A;  5HKZ A;  3TUY C;  1BR4 B;  5AEQ A;  3BUX B;  1NSH A;  4M2Q A;  1OZS A;  3D0Y B;  4ZCV A;  2KNE A;  2ZN9 A;  4HSZ A;  4PDZ A;  1ZFS A;  1M31 A;  4DS7 A;  3EKH A;  2KQ6 A;  2BCX A;  5I2L A;  1E8A A;  1CLM A;  1K96 A;  5B8I B;  1NCX A;  2ZRT A;  3A4U B;  4E68 A;  3I5F B;  2LC5 A;  1SMG A;  1F4O A;  2ZND A;  3AKA A;  3WNX B;  2JNX A;  5J3X A;  1S1E A;  1BU3 A;  3K21 A;  2F2P A;  5I8N A;  1CB1 A;  2KQY A;  4PHK A;  1A03 A;  2M29 A;  2GGZ A;  2KGR A;  1EJ3 A;  1M39 A;  3D10 A;  2K2F A;  1YVL A;  4MRX A;  3NSI A;  1XFY O;  3F45 A;  5KU1 A;  1DTL A;  2BBN A;  1JWD A;  2F3Z A;  3EVU A;  1CKK A;  1K9P A;  2QAC A;  3KO0 A;  3I5I C;  1K2H A;  2IS9 A;  1CDM A;  2TN4 A;  1K9K A;  4GBA A;  1ODB A;  2HQW A;  2K7C A;  1WRL A;  1JFJ A;  1WDC B;  1PUL A;  2SAS A;  2NCP A;  2LLU A;  1QLK A;  2EHB A;  3SG4 A;  1KQV A;  1DGV A;  1SCM C;  5CSJ A;  1KQM C;  1XFW O;  3FWC A;  5F6T A;  2L0P A;  4M2P A;  2FOT A;  4R1E A;  1XK4 A;  2CXJ A;  1IJ5 A;  4MSP A;  1S5G Y;  2BCA A;  4OCI A;  1CDL A;  1TRF A;  1WDC C;  1YUU A;  2Y1M A;  1F71 A;  5PAL A;  1N0Y A;  5JJG A;  1YRU B;  3KHE A;  1EG4 A;  1K93 D;  2O60 A;  4HRG A;  3VRO A;  1XFV O;  1FPW A;  4N1G A;  3WHU B;  5DKR A;  1RRO A;  1NYA A;  1IJ6 A;  3EVV A;  1DF0 B;  1LIN A;  1YRT B;  4NQG A;  4AOM A;  1UHK A;  1QIW A;  1QX7 A;  2JOJ A;  3LLE A;  1KSO A;  2FCE A;  1QVI Y;  3EK8 A;  2EGD A;  1OMV A;  5TNC A;  1MF8 B;  1JC2 A;  1FF1 A;  2JRF A;  4ORB B;  1KFX L;  2KI6 D;  4XJK B;  1NCZ A;  2LLT A;  4ICB A;  4OKH A;  2AUC A;  4QJ5 B;  4CPV A;  3CGA A;  4MN0 A;  3TZ1 A;  1QS7 A;  5HKY A;  1U5I A;  2JTZ A;  4DRW A;  2I18 A;  1V1F A;  1SL7 A;  4C0L A;  5DKN A;  1AK8 A;  1TTX A;  4I5L B;  4P2Y B;  1J7Q A;  1SL8 A;  2KI6 C;  4L9M A;  1KK7 Y;  2OS8 C;  1AUI B;  1CFC A;  2CBL A;  2LMT A;  1TCO B;  1KFX S;  2R2I A;  2WCB A;  2KDH A;  4I5J A;  1NX3 A;  1WY9 A;  2JUL A;  2LNK A;  4P5O E;  3I5H C;  1TNQ A;  1LXF C;  4YI9 A;  3SG2 A;  1X02 A;  2L51 A;  1LVC D;  1NX1 A;  1WLZ A;  1DVI A;  1PRW A;  3FS7 A;  4PE7 A;  1F4Q A;  1IG5 A;  2MAZ A;  1B47 A;  3M0W A;  4N1F A;  1XK4 C;  1PSB A;  3CZT X;  2K7O A;  5BPJ A;  2V53 A;  1AHR A;  1NX0 A;  1GQM A;  1ZOT B;  2MBX A;  2G2B A;  1KWO C;  2ZFD A;  3I5H B;  2M0R A;  2LHL A;  1Y0V H;  1Y1U A;  5IBW A;  1MR8 A;  5FYX A;  2L4I A;  2SCP A;  4ORC B;  2BL0 C;  1NX2 A;  1Y1A A;  1H4B A;  1IQ5 A;  4BY4 A;  4PHN A;  4ETO A;  1IKU A;  2M7N A;  5AXI A;  1C7V A;  1CFP A;  1PSR A;  1B8R A;  1AJ4 A;  2F3Y A;  3CR5 X;  2KYC A;  3A8R A;  1TN4 A;  4DIR A;  2PMY A;  1B9A A;  1LA3 A;  3SG6 A;  1DJW A;  4F0Z B;  1FBV A;  1QLS A;  2BL0 B;  1R6P A;  3EVR A;  4PCW A;  2M7L A;  4FQO A;  1PVA A;  1QX5 B;  5DKQ A;  2MHH A;  3VRP A;  3PN7 B;  4GGN A;  1SY9 A;  2ZKM X;  3FWB A;  2JZI A;  4PE1 A;  4C0K A;  1YX8 A;  3GOF A;  2KHN A;  4M2O A;  2K8M B;  4CFQ A;  1V1G A;  2L98 A;  2LAP A;  2JTT A;  2F33 A;  1YVH A;  4WRI A;  4C0J A;  2L2E A;  2OTG C;  2OS8 B;  4NDD A;  1QXP A;  5K89 A;  4CID A;  4D1E A;  3OHM B;  4HRE E;  2OPO A;  1ZAC A;  3KF9 A;  1BR1 B;  2WOS A;  3LK1 A;  3OX6 A;  4MBE A;  4PE4 A;  1BF5 A;  4AQI A;  3FIA A;  3ZNI A;  3AAJ A;  2F8P A;  1BT6 A;  4GNK B;  1SR6 C;  5HLV A;  3RM1 A;  1JSA A;  4YGC B;  1WRK A;  2FCD A;  3ICB A;  1IQ3 A;  1UP5 A;  2E6W A;  1CLB A;  1CM1 A;  3GK1 A;  2EC6 B;  1DT7 B;  1B4C A;  2LAN A;  1CTR A;  2I2R E;  1TCF A;  1WRZ A;  1FI5 A;  1SYM A;  1ZUZ A;  1JFK A;  2H2K A;  2H61 C;  1LA0 A;  1SR6 B;  1XYD A;  1B8C A;  3I5I B;  2HET A;  2Q91 A;  1J1D A;  1DJH A;  1TOP A;  1A4P A;  2K7B A;  4NDB A;  3TDU A;  1QIV A;  1GGW A;  4XJK A;  1BOC A;  1J7P A;  2K2A A;  4A4C A;  1B7T Y;  2Y5I A;  1REC A;  4YRU A;  1G33 A;  1LKJ A;  3MSE B;  3JVT C;  2QPT A;  5CSF A;  2ISD A;  1SBJ A;  3BQ3 A;  2KAY A;  2WND A;  1G4Y R;  1CFD A;  2AMI A;  1XVJ A;  3PN7 C;  2WCF A;  2KAX A;  2ZN8 A;  5AAN A;  2DOQ A;  4YGD B;  2NCO A;  3VRR A;  2JT0 A;  2BKH B;  1YR5 A;  3O2P A;  4MZK A;  1UHJ A;  3LK0 A;  1C07 A;  1CFF A;  1R2U A;  1S6J A;  2CNP A;  2LVJ A;  1S3P A;  1S26 D;  1SK6 D;  1W7I B;  1J7R A;  2NLN A;  3DF0 A;  1D1O A;  2NZ0 A;  2I94 A;  3IF7 A;  4YI8 A;  1CNP A;  1B8L A;  1DJI A;  3AAK A;  1SCV A;  2M1K B;  1K90 D;  4YGA A;  1UUS A;  3NXA A;  4NDC A;  1K95 A;  3QRX A;  2I7A A;  2LVV A;  3GK2 A;  2H61 A;  2WOR A;  2E30 A;  3TDI A;  1K9U A;  5KSZ A;  1S36 A;  3AKB A;  4MEW A;  1A29 A;  2CCM A;  2L5X B;  2Q4U A;  2WC8 A;  5D7F A;  1SCM B;  2M97 A;  3CTN A;  1BJF A;  1QJT A;  3TDZ A;  5AER A;  5AFP A;  1QV0 A;  1DJG A;  1XA5 A;  1YUT A;  2KI4 B;  4OV2 A;  4A4B A;  1C7W A;  2JU0 A;  1JF2 A;  1A75 B;  3TS5 C;  1DGU A;  5ER5 A;  1B7T Z;  2JXC A;  4YBH B;  4JPZ B;  1BLQ A;  1XFU O;  4YGB B;  1KK7 Z;  1OQP A;  1KWO B;  4JQ0 D;  1IWQ A;  3GK4 X;  2LMU A;  3SIB A;  1EG3 A;  1RJV A;  1QV1 A;  2KI4 C;  2G9B A;  1CMG A;  1L2O B;  3LCP C;  1NUB A;  2NXQ A;  1AJ5 A;  3TS5 B;  3BOW B;  1K8U A;  3DF0 B;  1F55 A;  3LL8 B;  5CSN A;  1CDP A;  1Y1X A;  2LE9 B;  2LMV A;  3E3R A;  2PVB A;  1KQM B;  3CLN A;  1KK8 C;  2JNF A;  3TUY B;  3CS1 A;  4OVN F;  2KFG A;  1Y6W A;  1A75 A;  4N5X A;  1L2O C;  1OZO A;  4HRH A;  1FW4 A;  2LUC A;  2CTN A;  3IQQ A;  3PAL A;  2JQ6 A;  3BUM B;  1BG1 A;  3OB2 B;  1JF0 A;  1NIW A;  1JBA A;  4AQJ A;  1U5I B;  2KFF A;  1QX2 A;  1WLM A;  1KK8 B;  1Q80 A;  4PHJ A;  2K0J A;  2LP3 A;  1UUR A;  3EK4 A;  5ER4 X;  2MA2 A;  1NPQ A;  2AAO A;  1S6C A;  1F8H A;  1AP4 A;  1MXE A;  2JC2 A;  2JPT A;  2LP2 A;  2M1U A;  2OTG B;  1QAT A;  3KPX A;  4PE0 A;  3SIA A;  3PFV A;  2LVK A;  1MXL C;  1PVB A;  3CWG A;  2LCP A;  3O78 A;  1CDN A;  1HQV A;  3OX5 A;  1ZMZ A;  4MZJ A;  1M46 A;  2KFH A;  4ORA B;  2K61 A;  1DJX A;  4GGF A;  3PSR A;  2MRD A;  4BY5 A;  3SJS A;  3WXA A;  2JWW A;  2KOT A;  5I2O A;  1K94 A;  4MLW A;  1SNL A;  1OMD A;  1B1G A;  3I5G B;  2COL B;  3DVJ A;  2VRG A;  1IRJ A;  1YX7 A;  1RK9 A;  3PLF B;  1SL9 A;  1EXR A;  1W7J B;  1TNP A;  1VRK A;  1XFX O;  3EK7 A;  4MRY A;  3ZWH A;  1FI6 A;  2JT8 A;  1QVI Z;  2KGB C;  4OR9 B;  1AVS A;  2GGM A;  1L7Z A;  3WHT B;  1F54 A;  1OE9 B;  3KEV A;  1ALV A;  3I5G C;  1MQ1 A;  5HKW A;  1IH0 A;  1MUX A;  1J7O A;  1DJZ A;  4DUQ A;  2PAS A;  2BCB A;  2D8N A;  3VRN A;  4YGE B;  4QJ3 B;  4FTG A;  1UHH A;  3JVT B;  1TIZ A;  1BMO A;  2M49 B;  1SW8 A;  2JXL A;  3OB1 B;  1JUO A;  2L4H A;  4GFT A;  2F2O A;  4Q04 A;  1EH2 A;  2M3W A;  2M9G A;  2PSR A;  4JWQ A;  1CMF A;  3HX4 A;  2BEC A;  1UHN A;  2ZNE A;  3PM8 A;  5I2Q A;  2B1U A;  3BXK A;  3O4Y A;  5CSI A;  4WQ2 A;  3VRQ A;  2LHI A;  2PRU A;  3D0Y A;  2BBM A;  3CR4 X;  1NWD A;  1PK0 D;  2JT3 A;  1SKT A;  1GGZ A;  4MZL A;  1XO5 A;  3C1V A;  1NCY A;  1KSM A;  4DCK A;  2HPS A;  3BUN B;  1J55 A;  1EL4 A;  1CLL A;  2LV7 A;  4UPG A;  1DF0 A;  5HYD A;  3OP0 A;  4PHM A;  3SG3 A;  1QTX A;  2RGI A;  3DVK A;  3IQO A;  3NSL A;  2LLS A;  2Y4Q A;  2PAL A;  1RFJ A;  2EC6 C;  1OMR A;  2BKI B;  2K7D A;  2P6B B;  4CLN A;  3O6B A;  3EKJ A;  1OOJ A;  1A2X A;  1MHO A;  1G8I A;  5G08 A;  1XFZ O;  1QAS A;  1RWY A;  1SRA A;  1M63 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...