2PALA

Ionic interactions with parvalbumins. crystal structure determination of pike 4.10 parvalbumin in four different ionic environments
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
107
structure length
107
Chain Sequence
SFAGLKDADVAAALAACSAADSFKHKEFFAKVGLASKSLDDVKKAFYVIDQDKSGFIEEDELKLFLQNFSPSARALTDAETKAFLADGDKDGDGMIGVDEFAAMIKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Ionic interactions with parvalbumins. Crystal structure determination of pike 4.10 parvalbumin in four different ionic environments.
pubmed doi rcsb
source organism Esox lucius
molecule tags Calcium binding protein
molecule keywords PARVALBUMIN
total genus 39
structure length 107
sequence length 107
ec nomenclature
pdb deposition date 1990-11-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2palA00
4AQJA 4YI8A 4A4CA 2FCEA 1QTXA 1NCYA 2MAZA 2R2IA 2WNDA 2WORA 1QX5B 1LKJA 2KI4C 1JBAA 3OX6A 2Q91A 2L2EA 2M1UA 4I5JA 1LXFC 2EHBA 4PHJA 4P2YB 1R2UA 2P6BB 2HETA 2JNXA 3SIAA 1WDCC 3JTDB 3VROA 1CDLA 1Y1UA 1FBVA 1QX2A 1DJXA 4OV2A 1OE9B 4ZCVA 1NWDA 5D7FA 5G08A 1FPWA 2I94A 2JRFA 4YBHB 1N2DA 2BCXA 1SKTA 3TS5C 1DT7B 1F8HA 3FWCA 2EGDA 5AEQA 3OP0A 2H61C 2K61A 2L4IA 4OR9B 3IQQA 1OZSA 2LHLA 4CLNA 4CPVA 1IQ5A 1L7ZA 3OHMB 4C0LA 5AERA 1JF2A 1QIVA 4PE4A 1TCFA 4F0ZB 1M45A 3PM8A 4MVFA 2LANA 2BECA 3VRPA 1PRWA 1QATA 1S26D 1EG4A 1A75B 1MXEA 1EJ3A 1K9KA 1NSHA 1TRFA 1Y1AA 1DJYA 1Y6WA 3WHUB 4NDCA 3FS7A 2WC8A 5D69A 3IQOA 3DD4A 1A29A 1CM1A 1CFCA 1JF0A 5I2LA 1NX3A 1RFJA 1F4QA 1GQMA 5CSIA 5ER5A 1K2HA 1KQMC 1UHHA 1SCMC 1XO5A 2MLFC 3BOWB 1QV0A 1WRZA 1CFDA 3SJSA 1BR1B 1UHNA 2ZNDA 1J7OA 2VRGA 2KI4B 3LK0A 1S6CA 2M29A 3PATA 4GGNA 5GQQC 2WCBA 4C0JA 1SNLA 2QACA 4MBEA 2M97A 5AXIA 1QLSA 1DF0A 1SL9A 1PSRA 2LHIA 1RWYA 3VRNA 5FYXA 1TOPA 3O2PA 4AQIA 2F3YA 1CKKA 1CB1A 1S36A 1QASA 2L51A 3TS5B 5J3XA 1PALA 1PK0D 3GK1A 3MSEB 2LE9B 3KF9A 4WQ3A 1SL8A 1K95A 1BMOA 2ZFDA 1CDMA 4DIRA 1K8UA 1UHKA 1MF8B 2JXLA 1K94A 1NCXA 1C07A 1LVCD 3NSOA 1SL7A 2OS8B 1CNPA 1DJWA 3AKBA 1CLBA 3KHEA 2CXJA 3WNXB 1B7TY 1YVLA 2KAYA 2LP3A 4USLA 1F4OA 1SCVA 3HX4A 1NYAA 2K7OA 1U5IB 3DVMA 3TZ1A 2NXQA 3TDZA 1OMVA 2JPTA 2LM5A 1IJ6A 2JXCA 1KWOC 4L9MA 3I5GC 3DF0A 2DOQA 1NP8A 2LLSA 3SG6A 1QIWA 2HF5A 2BL0B 2LVIA 3RLZA 2SCPA 3EKHA 2E30A 2FOTA 2Y5IA 2D8NA 3I5FB 1PSBA 4P5OE 4HSZA 1OMDA 4DUQA 4QJ3B 4I5LB 2KI6D 4XJKA 1SW8A 2LLTA 1YX7A 1GJYA 1LA0A 1MHOA 1BF5A 2JTZA 4YGBB 1BOCA 2LMTA 1KSOA 2OPOA 1FI6A 4ICBA 2L98A 1LINA 1CMFA 4YGEB 1KFUS 3M0WA 1IWQA 3QRXA 4FTGA 4PALA 2M0RA 1MUXA 1QV1A 1XK4A 4QJ5B 2PRUA 1S6IA 3SG2A 1ZOTB 5AANA 4CIDA 3JTDC 2WCFA 5DKRA 1WRLA 2KQ6A 4DRWA 5KTYA 4GAOA 2K7DA 2GV5A 1KK7Z 1AK8A 1OOJA 2L5XB 3RM1A 1Y1XA 2NZ0A 3ZNIA 1V1GA 5CSNA 1SBJA 2KAVA 2JNFA 2KQYA 2F2PA 1YTZC 3LL8B 1KK8C 1FI5A 2KGBC 1DJIA 1JFKA 5CSFA 4JPZB 5F6TA 5BPJA 3D0YB 2CNPA 1M31A 4JQ0D 5JOLA 2QPTA 2G9BA 1TNWA 1DJHA 2I2RE 2TN4A 4I5KA 1NCZA 3I5HB 1CMGA 1AVSA 2F33A 3EVVA 5K89A 4JWQA 4MZJA 1B8LA 4MN0A 2KGRA 3I5IC 2M7NA 1K9UA 3EK8A 2M9GA 4WRIA 1QS7A 3SIBA 3FWBA 2M1KB 1V1FA 1EL4A 1F71A 1TCOB 1XFUO 2JC2A 3EK7A 3OX5A 2AUCA 1SK6D 2RGIA 1M46A 2MRDA 2OTGB 4HRGA 3TUYB 4PE7A 4CFRA 1OQPA 2GGMA 5HKWA 3PLFB 1HQVA 3PN7C 4TNCA 2Y1MA 1KK8B 1XFVO 2K2AA 4YRUA 1QVIY 2JT3A 2COLB 4HRHA 5ER4X 1VRKA 1DJZA 5HLVA 3CS1A 2ZN8A 4QJ4B 3KPXA 1KFXS 2MA2A 3DVKA 4IL1A 1IH0A 2E6WA 5HLOA 3BUOB 2PALA 1PVBA 4OKHA 2F2OA 3ICBA 3PALA 4C0KA 1M39A 2HPSA 2K7CA 2KOTA 1N65A 1YURA 2LC5A 4GPLB 1BT6A 2KHNA 3PFVA 2LV7A 1HT9A 2MBXA 2FJUB 3BUWB 1QLKA 1UUSA 1DF0B 2MLEC 2BCAA 1UP5A 2O60A 3BYAA 2JQ6A 1L2OB 5CPVA 1C7WA 1CFFA 3LLEA 1YR5A 2ZKMX 4YGCB 1J7PA 4MEWA 1WDCB 3HCMA 1C7VA 1NX1A 1OSAA 2NCOA 2LUXA 1ZACA 4U8DA 4AOMA 2NLNA 1G33A 4OCIA 2BCBA 2K2FA 1KCYA 2AAOA 3D10A 1UWOA 1H4BA 3O78A 2L4HA 2LVJA 1RECA 2M7LA 2JULA 4ORAB 2KI6C 1MR8A 5B8IB 1WLZA 4PHMA 1BG1A 3JVTC 2L50A 4I5NB 4ZCUA 2LMUA 3CTNA 5I8NA 3I5GB 2BL0C 3BUNB 1A03A 2Y4QA 4PDZA 1A75A 1K93D 2AMIA 4M2OA 5DKNA 1QXPA 1JC2A 1SR6B 1R6PA 2H2KA 2KFGA 1K96A 1AJ4A 4XJKB 1Q80A 1H8BA 2BKHB 2LVVA 1NUBA 1W7IB 4PCWA 1S5GY 1MXLC 2ZNEA 1F55A 1GGZA 2PSRA 2JWWA 1CLMA 2BBMA 1J1DA 1UHIA 1JUOA 2KAXA 1YRTB 4OVNF 1WRKA 3VRRA 1TNXA 3EVUA 1MQ1A 3JVTB 1B7TZ 3PSRA 1S3PA 5I2OA 1YRUB 1CLLA 4CFQA 2F8PA 1KQVA 3WXAA 3SG4A 1IG5A 3EVRA 3BUMB 4M2QA 3DVJA 1DTLA 5AFPA 1KFUL 1YUSA 4GBAA 1DMOA 2WOSA 2KBMA 5HKZA 5CSJA 3O6BA 1NPQA 1TNQA 4A4BA 3K21A 3TDIA 3CGAA 2Y1NA 2CBLA 3AKAA 4HREE 5IBWA 2K0JA 2BBNA 1FF1A 1SCMB 4NDBA 2CT9A 3H4SE 2LMVA 3BXKA 2IS9A 2M49B 2MJWB 5JJGA 4PHKA 1TIZA 3BQ3A 5KSZA 1JFJA 3SG5A 1PVAA 1SRAA 4NDDA 1D1OA 3D0YA 1W7JB 4FQOA 4YI9A 2H61A 5HYDA 1J7RA 3KEVA 2G2BA 2KYFA 2KNEA 2M8UA 1K9PA 1TNPA 2KDHA 3SG7A 1BODA 2I18A 2PASA 2Q4UA 3NSIA 2HQ8A 1F70A 2MHHA 2JT0A 2LUCA 1AUIB 1PULA 3CLNA 1DJGA 3CR2A 1QJTA 1KSMA 2WCEA 1NIWA 1SR6C 4MZKA 2BE6A 1QVIZ 3EK4A 4MZLA 1EH2A 3DF0B 3NXAA 1G8IA 1AHRA 4R1EA 1ALVA 1CTRA 1F54A 2PMYA 1JWDA 1OMRA 1XYDA 3TDUA 1CFPA 2KFFA 4M2PA 3KO0A 1WY9A 4N1GA 4GFTA 2BE4A 3EKJA 5I2QA 2ISDA 1JSAA 2SASA 4Q04A 1CM4A 3I5HC 3LK1A 1J7QA 2I7AA 2ZRSA 1NX2A 2KYCA 1XFWO 3NSKA 1RTP1 2LLUA 4N1FA 3GK4X 3GOFA 1B47A 4PHNA 3A8RA 1KWOB 1AJ5A 1B4CA 2KFHA 4N5XA 1KFXL 3NSLA 1A4PA 3O4YA 3ZWHA 1UHJA 3CWGA 2OS8C 1SY9A 2LVKA 2HQWA 3OB1B 3I5FC 1J55A 3LCPC 2NCPA 1RK9A 4YGDB 1S1EA 1EG3A 2EC6C 1CDNA 5HKYA 4BY5A 1B9AA 1BJFA 1DGUA 1RJVA 4BY4A 1ODBA 3I5IB 1M63B 4D1EA 1DVIA 1YUUA 5KU1A 1U5IA 2KBIA 2LCPA 1A2XA 1S6JA 1AP4A 1ALWA 1KK7Y 2CTNA 2V53A 3AAKA 3DVEA 3SG3A 3VGOA 1UURA 1B1GA 3BUXB 1XVJA 2L0PA 1XFZO 1G4YR 4GGFC 4MSPA 1ZMZA 1KQMB 4MLWA 2PVBA 3C1VA 4DCKA 5DKQA 5TNCA 3A4UB 2CCMA 1CDPA 1XFYO 1BR4B 1E8AA 5PALA 1RROA 2LAPA 2ZN9A 1IKUA 3FIAA 1L2OC 1N0YA 1YX8A 2JTTA 4XYNA 1QX7A 2M3WA 2EC6B 1ZFSA 4YGAA 3CR4X 1XA5A 1IRJA 4GUKA 1GGWA 1IGVA 2F3ZA 2K8MB 4GNKB 1DGVA 1TN4A 4UPGA 1X02A 4PE1A 1OZOA 2K7BA 3CR5X 4GGFA 3TUYC 4ETOA 1LA3A 3GK2A 1FW4A 1B8CA 1YUTA 2JOJA 2O5GA 3VRQA 4ORCB 4MRXA 4DS7A 3WHTB 1IJ5A 3BOWA 3F45A 1SPYA 1K90D 3AAJA 1XK4C 2BKIB 4WQ2A 1TTXA 2LNKA 2JZIA 2LP2A 1S5GZ 1EXRA 2ZRTA 1SYMA 1WLMA 1YVHA 3E3RA 1IQ3A 1Y0VH 3OB2B 2KSPA 4E68A 2JU0A 3IF7A 2A4JA 3CZTX 4ORBB 2B1UA 1NX0A 1XFXO 1J1EA 1B8RA 2OTGC 2GGZA 4PE0A 4MRYA 1ZUZA 1SMGA 2JT8A 1MWNA 4NQGA 1BLQA 1BU3A 2FCDA 3PN7B
chains in the Genus database with same CATH superfamily
4AQJA 4YI8A 4A4CA 2FCEA 1QTXA 1NCYA 2MAZA 2R2IA 2WNDA 2WORA 4INWA 1QX5B 1LKJA 2KI4C 1JBAA 3OX6A 2Q91A 1TUZA 2L2EA 2M1UA 3K1EA 4I5JA 1LXFC 2EHBA 4PHJA 4P2YB 1R2UA 2P6BB 2HETA 2JNXA 3SIAA 5D3OA 1WDCC 3JTDB 3VROA 1CDLA 1Y1UA 1OOFA 1FBVA 1QX2A 1DJXA 4OV2A 1OE9B 4ZCVA 1NWDA 1OOIX 5D7FA 5G08A 1FPWA 2I94A 2JRFA 4OZDA 1N2DA 2BCXA 1SKTA 4YBHB 3TS5C 1DT7B 1F8HA 3FWCA 2EGDA 5AEQA 3CABA 3OP0A 2H61C 2K61A 2L4IA 4OR9B 3IQQA 1OZSA 2LHLA 3OBVA 3V2LA 4CLNA 1IQ5A 1L7ZA 3OHMB 4C0LA 4CPVA 5AERA 1JF2A 1QIVA 4PE4A 2WC6A 1TCFA 3RZSA 4F0ZB 1M45A 3PM8A 4MVFA 2LANA 2BECA 3VRPA 1PRWA 1QATA 1S26D 1EG4A 1A75B 1MXEA 1EJ3A 1K9KA 1NSHA 1TRFA 1Y1AA 1DJYA 1Y6WA 3WHUB 4NDCA 3FS7A 2WC8A 5D69A 3IQOA 3DD4A 1A29A 1CM1A 1CFCA 1JF0A 5I2LA 1NX3A 1RFJA 1F4QA 1GQMA 5CSIA 5ER5A 3S0GA 1KQMC 1K2HA 1UHHA 1SCMC 1XO5A 2MLFC 3BOWB 1QV0A 1WRZA 3N7HA 2KPHA 1CFDA 3SJSA 1BR1B 1UHNA 2ZNDA 1J7OA 2VRGA 5FI6A 2KI4B 3LK0A 1S6CA 2L5YA 2M29A 3PATA 4GGNA 5GQQC 3SS4A 2WCBA 4C0JA 1SNLA 2QACA 4MBEA 2M97A 5AXIA 1QLSA 1DF0A 1SL9A 1PSRA 2LHIA 3S0EA 1RWYA 3VRNA 5FYXA 1TOPA 3O2PA 4AQIA 2F3YA 2JPOA 1CKKA 1S36A 1CB1A 1QASA 1DC1A 2L51A 3TS5B 3R1VA 5J3XA 1PALA 1PK0D 3GK1A 3MSEB 2LE9B 2YGUA 3KF9A 4WQ3A 1SL8A 3DZTA 3D75A 1IIOA 1K95A 1BMOA 2ZFDA 1CDMA 4DIRA 3D74A 1K8UA 1UHKA 1MF8B 2JXLA 4F7FA 1K94A 1NCXA 1C07A 1LVCD 3NSOA 1SL7A 2OS8B 1CNPA 1DJWA 3AKBA 1CLBA 3KHEA 2CXJA 3WNXB 1B7TY 1YVLA 2KAYA 2LP3A 4USLA 1F4OA 1SCVA 1P28A 2WCLA 1NYAA 2K7OA 3HX4A 3D77A 1U5IB 3DVMA 3TZ1A 2NXQA 3TDZA 1OMVA 2JPTA 2LM5A 1IJ6A 2QEHA 2JXCA 1KWOC 4L9MA 3I5GC 3DF0A 2DOQA 1NP8A 2LLSA 3SG6A 1QIWA 2HF5A 3PJIA 2BL0B 2LVIA 3RLZA 2SCPA 3EKHA 2E30A 2FOTA 2Y5IA 2D8NA 3I5FB 1PSBA 1SSEB 3L47A 4P5OE 4HSZA 1OMDA 4DUQA 4QJ3B 3QMEA 2BNXA 1XFRA 2KI6D 4I5LB 1SW8A 2LLTA 4XJKA 3S0DA 1YX7A 1GJYA 1LA0A 1MHOA 1BF5A 2JTZA 4YGBB 4JD9A 1BOCA 2LMTA 1KSOA 2OPOA 1FI6A 4ICBA 2L98A 1LINA 1CMFA 4YGEB 1KFUS 3FE8A 1IWQA 3M0WA 3QRXA 4FTGA 2M0RA 1OW4A 4PALA 1MUXA 1QV1A 3D76A 1XK4A 3SS3A 2PRUA 1S6IA 3SG2A 4QJ5B 4FQTA 1ZOTB 5I94A 3S0FA 2FJYA 5AANA 4CIDA 5FI7A 3JTDC 2WCFA 5DKRA 1WRLA 2KQ6A 4DRWA 5KTYA 4GAOA 2K7DA 2GV5A 1W9ZA 1KK7Z 1AK8A 1OOJA 2L5XB 3RM1A 3DY9A 1Y1XA 2NZ0A 3ZNIA 1V1GA 5CSNA 1SBJA 2KAVA 2JNFA 2KQYA 2F2PA 1YTZC 3LL8B 1KK8C 1FI5A 2KGBC 1DJIA 1JFKA 5CSFA 4JPZB 5F6TA 5BPJA 3D0YB 2CNPA 1M31A 2L2CA 4JQ0D 5JOLA 2QPTA 1Z4HA 2G9BA 1TNWA 1DJHA 2I2RE 2TN4A 4I5KA 1NCZA 3I5HB 1CMGA 1AVSA 2F33A 3EVVA 5K89A 4JWQA 4MZJA 1B8LA 4MN0A 2KGRA 2QEVA 3I5IC 2M7NA 1K9UA 3NGVA 3EK8A 1DQEA 2M9GA 4WRIA 1QS7A 3SIBA 3FWBA 2M1KB 1V1FA 1EL4A 1F71A 1TCOB 1XFUO 2JC2A 2PQLA 3EK7A 3OX5A 4IJ7A 2AUCA 1SK6D 2RGIA 1M46A 2MRDA 2OTGB 4HRGA 3B88A 3TUYB 3OGNA 3PM2A 4PE7A 4CFRA 1ORGA 4INXA 1OQPA 2GGMA 5HKWA 3PLFB 1HQVA 3PN7C 4TNCA 2Y1MA 1KK8B 1XFVO 2K2AA 4YRUA 1QVIY 2JT3A 2COLB 4HRHA 5ER4X 1VRKA 1DJZA 5HLVA 3CS1A 2ZN8A 4QJ4B 3CZ0A 3KPXA 1KFXS 2MA2A 3DVKA 3R1OA 4IL1A 2E6WA 5HLOA 1IH0A 3BUOB 3FE6A 2PALA 1PVBA 4OKHA 2F2OA 3ICBA 3PALA 4C0KA 3L4LA 3L4AA 1M39A 2HPSA 2K7CA 1TUJA 1N65A 1YURA 2KOTA 2LC5A 1BT6A 2KHNA 3PFVA 4GPLB 3SS5A 2LV7A 1HT9A 2MBXA 2FJUB 2WCJA 3BUWB 1QLKA 1UUSA 3B87A 1T14A 1DF0B 2MLEC 2BCAA 1UP5A 2O60A 3BYAA 1DEKA 2JQ6A 1L2OB 5CPVA 1C7WA 1CFFA 4KYNA 3LLEA 1YR5A 2ZKMX 4YGCB 1J7PA 4MEWA 1WDCB 3HCMA 1C7VA 1NX1A 1OSAA 2NCOA 2LUXA 1ZACA 4U8DA 3CYZA 3B6XA 4AOMA 2NLNA 1G33A 1OOHA 2BCBA 2K2FA 4OCIA 1KCYA 2AAOA 2PYQA 3D10A 1UWOA 1H4BA 3O78A 2L4HA 2LVJA 1TWOA 1RECA 2P70A 3CZ1A 3NHIA 2JULA 2M7LA 4ORAB 2KI6C 1MR8A 2WCHA 5B8IB 1WLZA 4PHMA 1BG1A 3JVTC 2L50A 4I5NB 4ZCUA 2LMUA 3CTNA 5I8NA 3I5GB 2BL0C 3BUNB 1A03A 2Y4QA 4PDZA 1A75A 1K93D 2AMIA 4M2OA 5DKNA 1QXPA 3Q8IA 1JC2A 1SR6B 1R6PA 2BAPA 2H2KA 2KFGA 1K96A 1AJ4A 4XJKB 1Q80A 1H8BA 2BKHB 2LVVA 2H8VA 1NUBA 1W7IB 4PCWA 1S5GY 3VB1A 1MXLC 2ZNEA 1F55A 1C3YA 1GGZA 2PSRA 2JWWA 1CLMA 2BBMA 1J1DA 1UHIA 3BJHA 1JUOA 2KAXA 1YRTB 3UO9A 4OVNF 5FI2A 1WRKA 3VRRA 1TNXA 3EVUA 1MQ1A 5EL2A 3JVTB 1B7TZ 3PSRA 1S3PA 5I2OA 1YRUB 3DXLA 1CLLA 4CFQA 2F8PA 1KQVA 3WXAA 3SG4A 1IG5A 3EVRA 3BUMB 3B86A 3DVJA 1DTLA 4M2QA 4PT1A 5AFPA 1KFUL 1YUSA 4GBAA 1DMOA 2WOSA 2KBMA 5HKZA 2KLEA 2QDIA 3O4XA 3EG5B 5CSJA 3O6BA 1NPQA 1TNQA 4A4BA 3K21A 1LS8A 1Z2CB 3DYEA 3TDIA 3CGAA 2Y1NA 2CBLA 3AKAA 4HREE 5IBWA 2K0JA 2BBNA 1FF1A 1SCMB 4NDBA 2CT9A 3H4SE 2LMVA 3BXKA 2IS9A 2M49B 2MJWB 3S0BA 5JJGA 4PHKA 1TIZA 3BQ3A 5KSZA 1JFJA 3SG5A 1PVAA 1SRAA 4NDDA 1D1OA 3D0YA 2K60A 1W7JB 4FQOA 4YI9A 2H61A 5HYDA 1J7RA 3KEVA 2G2BA 2KYFA 2KNEA 2M8UA 1K9PA 1TNPA 2KDHA 3SG7A 1BODA 2I18A 2PASA 2Q4UA 3NSIA 2HQ8A 1F70A 2MHHA 2JT0A 2LUCA 1AUIB 2GTEA 1PULA 3D78A 3CLNA 1DJGA 3CR2A 5HL1A 1C3ZA 3FE9A 1QJTA 1KSMA 2KLDA 2WCEA 1NIWA 1SR6C 4MZKA 2BE6A 1QVIZ 3EK4A 4MZLA 1EH2A 3DF0B 3NHTA 3NXAA 1G8IA 1AHRA 4R1EA 1ALVA 3IVTA 1CTRA 1F54A 2PMYA 1JWDA 1OMRA 1XYDA 3TDUA 1CFPA 2KFFA 4M2PA 3KO0A 1WY9A 4N1GA 4GFTA 2BE4A 3EKJA 5I2QA 2ISDA 1JSAA 2SASA 4Q04A 1CM4A 3D73A 3I5HC 3LK1A 1J7QA 2I7AA 2ZRSA 1NX2A 2KYCA 1XFWO 3NSKA 1RTP1 2LLUA 4N1FA 3GK4X 3GOFA 1B47A 3BFAA 1OOGA 4PHNA 3A8RA 1KWOB 2ERBA 1AJ5A 1B4CA 2KFHA 4N5XA 1KFXL 3NSLA 1A4PA 3O4YA 3R1PA 3ZWHA 1UHJA 3CWGA 2OS8C 1SY9A 2LVKA 2HQWA 3OB1B 3I5FC 1J55A 3LCPC 2NCPA 1RK9A 4YGDB 1S1EA 1EG3A 2EC6C 1CDNA 5HKYA 4BY5A 1B9AA 1BJFA 1DGUA 1RJVA 2WCKA 1ODBA 4BY4A 3I5IB 1M63B 4D1EA 1DVIA 1YUUA 5KU1A 1U5IA 2KBIA 5DICA 2LCPA 1A2XA 1S6JA 1AP4A 1ALWA 1KK7Y 2CTNA 2V53A 3AAKA 1DELA 3DVEA 3SG3A 3VGOA 1UURA 1B1GA 3BUXB 1XVJA 2L0PA 3BFBA 1XFZO 1G4YR 4GGFC 4MSPA 3BFHA 1ZMZA 1KQMB 4MLWA 2PVBA 3C1VA 4DCKA 5DKQA 3R72A 5TNCA 3A4UB 2CCMA 1CDPA 1XFYO 1BR4B 1E8AA 5PALA 1RROA 2LAPA 2ZN9A 1IKUA 3FIAA 1L2OC 1N0YA 1YX8A 2QEBA 2JTTA 4XYNA 3S0AA 1QX7A 2M3WA 2EC6B 1ZFSA 4YGAA 3CR4X 1XA5A 1IRJA 4GUKA 4JKTA 1GGWA 1IGVA 2F3ZA 2K8MB 4GNKB 1DGVA 1TN4A 4UPGA 1X02A 4PE1A 1OZOA 2K7BA 3CR5X 4GGFA 3TUYC 2QEOA 4ETOA 1LA3A 3GK2A 1FW4A 1B8CA 1YUTA 2JOJA 2O5GA 3VRQA 4ORCB 4MRXA 4DS7A 3CDNA 1IJ5A 3BOWA 3WHTB 3F45A 1SPYA 1K90D 3AAJA 1XK4C 2BKIB 4WQ2A 2WC5A 1TTXA 2LNKA 1GM0A 2WCMA 2JZIA 2LP2A 1S5GZ 1EXRA 1QWVA 2ZRTA 1SYMA 1WLMA 1YVHA 3E3RA 1IQ3A 3CZ2A 1Y0VH 3OB2B 2KSPA 4E68A 2JU0A 3IF7A 2A4JA 3CZTX 4ORBB 2B1UA 1NX0A 1XFXO 1J1EA 2P71A 3B7AA 1B8RA 2OTGC 2GGZA 4PE0A 3UNWA 4MRYA 1ZUZA 1SMGA 2JT8A 1MWNA 4NQGA 1BLQA 1BU3A 2FCDA 3PN7B
chains in the Genus database with same CATH topology
4AQJA 4YI8A 4A4CA 2FCEA 1QTXA 1NCYA 2MAZA 2R2IA 2WNDA 2WORA 1QX5B 1LKJA 2KI4C 1JBAA 3OX6A 2Q91A 2L2EA 2M1UA 4I5JA 1LXFC 2EHBA 4PHJA 4P2YB 1R2UA 2P6BB 2HETA 2JNXA 3SIAA 1WDCC 3JTDB 3VROA 1CDLA 1Y1UA 1FBVA 1QX2A 1DJXA 4OV2A 1OE9B 4ZCVA 1NWDA 5D7FA 5G08A 1FPWA 2I94A 2JRFA 4YBHB 1N2DA 2BCXA 1SKTA 3TS5C 1DT7B 1F8HA 3FWCA 2EGDA 5AEQA 3OP0A 2H61C 2K61A 2L4IA 4OR9B 3IQQA 1OZSA 2LHLA 4CLNA 4CPVA 1IQ5A 1L7ZA 3OHMB 4C0LA 5AERA 1JF2A 1QIVA 4PE4A 1TCFA 4F0ZB 1M45A 3PM8A 4MVFA 2LANA 2BECA 3VRPA 1PRWA 1QATA 1S26D 1EG4A 1A75B 1MXEA 1EJ3A 1K9KA 1NSHA 1TRFA 1Y1AA 1DJYA 1Y6WA 3WHUB 4NDCA 3FS7A 2WC8A 5D69A 3IQOA 3DD4A 1A29A 1CM1A 1CFCA 1JF0A 5I2LA 1NX3A 1RFJA 1F4QA 1GQMA 5CSIA 5ER5A 1K2HA 1KQMC 1UHHA 1SCMC 1XO5A 2MLFC 3BOWB 1QV0A 1WRZA 1CFDA 3SJSA 1BR1B 1UHNA 2ZNDA 1J7OA 2VRGA 2KI4B 3LK0A 1S6CA 2M29A 3PATA 4GGNA 5GQQC 2WCBA 4C0JA 1SNLA 2QACA 4MBEA 2M97A 5AXIA 1QLSA 1DF0A 1SL9A 1PSRA 2LHIA 1RWYA 3VRNA 5FYXA 1TOPA 3O2PA 4AQIA 2F3YA 1CKKA 1CB1A 1S36A 1QASA 2L51A 3TS5B 5J3XA 1PALA 1PK0D 3GK1A 3MSEB 2LE9B 3KF9A 4WQ3A 1SL8A 1K95A 1BMOA 2ZFDA 1CDMA 4DIRA 1K8UA 1UHKA 1MF8B 2JXLA 1K94A 1NCXA 1C07A 1LVCD 3NSOA 1SL7A 2OS8B 1CNPA 1DJWA 3AKBA 1CLBA 3KHEA 2CXJA 3WNXB 1B7TY 1YVLA 2KAYA 2LP3A 4USLA 1F4OA 1SCVA 3HX4A 1NYAA 2K7OA 1U5IB 3DVMA 3TZ1A 2NXQA 3TDZA 1OMVA 2JPTA 2LM5A 1IJ6A 2JXCA 1KWOC 4L9MA 3I5GC 3DF0A 2DOQA 1NP8A 2LLSA 3SG6A 1QIWA 2HF5A 2BL0B 2LVIA 3RLZA 2SCPA 3EKHA 2E30A 2FOTA 2Y5IA 2D8NA 3I5FB 1PSBA 4P5OE 4HSZA 1OMDA 4DUQA 4QJ3B 4I5LB 2KI6D 4XJKA 1SW8A 2LLTA 1YX7A 1GJYA 1LA0A 1MHOA 1BF5A 2JTZA 4YGBB 1BOCA 2LMTA 1KSOA 2OPOA 1FI6A 4ICBA 2L98A 1LINA 1CMFA 4YGEB 1KFUS 3M0WA 1IWQA 3QRXA 4FTGA 4PALA 2M0RA 1MUXA 1QV1A 1XK4A 4QJ5B 2PRUA 1S6IA 3SG2A 1ZOTB 5AANA 4CIDA 3JTDC 2WCFA 5DKRA 1WRLA 2KQ6A 4DRWA 5KTYA 4GAOA 2K7DA 2GV5A 1KK7Z 1AK8A 1OOJA 2L5XB 3RM1A 1Y1XA 2NZ0A 3ZNIA 1V1GA 5CSNA 1SBJA 2KAVA 2JNFA 2KQYA 2F2PA 1YTZC 3LL8B 1KK8C 1FI5A 2KGBC 1DJIA 1JFKA 5CSFA 4JPZB 5F6TA 5BPJA 3D0YB 2CNPA 1M31A 4JQ0D 5JOLA 2QPTA 2G9BA 1TNWA 1DJHA 2I2RE 2TN4A 4I5KA 1NCZA 3I5HB 1CMGA 1AVSA 2F33A 3EVVA 5K89A 4JWQA 4MZJA 1B8LA 4MN0A 2KGRA 3I5IC 2M7NA 1K9UA 3EK8A 2M9GA 4WRIA 1QS7A 3SIBA 3FWBA 2M1KB 1V1FA 1EL4A 1F71A 1TCOB 1XFUO 2JC2A 3EK7A 3OX5A 2AUCA 1SK6D 2RGIA 1M46A 2MRDA 2OTGB 4HRGA 3TUYB 4PE7A 4CFRA 1OQPA 2GGMA 5HKWA 3PLFB 1HQVA 3PN7C 4TNCA 2Y1MA 1KK8B 1XFVO 2K2AA 4YRUA 1QVIY 2JT3A 2COLB 4HRHA 5ER4X 1VRKA 1DJZA 5HLVA 3CS1A 2ZN8A 4QJ4B 3KPXA 1KFXS 2MA2A 3DVKA 4IL1A 1IH0A 2E6WA 5HLOA 3BUOB 2PALA 1PVBA 4OKHA 2F2OA 3ICBA 3PALA 4C0KA 1M39A 2HPSA 2K7CA 2KOTA 1N65A 1YURA 2LC5A 4GPLB 1BT6A 2KHNA 3PFVA 2LV7A 1HT9A 2MBXA 2FJUB 3BUWB 1QLKA 1UUSA 1DF0B 2MLEC 2BCAA 1UP5A 2O60A 3BYAA 2JQ6A 1L2OB 5CPVA 1C7WA 1CFFA 3LLEA 1YR5A 2ZKMX 4YGCB 1J7PA 4MEWA 1WDCB 3HCMA 1C7VA 1NX1A 1OSAA 2NCOA 2LUXA 1ZACA 4U8DA 4AOMA 2NLNA 1G33A 4OCIA 2BCBA 2K2FA 1KCYA 2AAOA 3D10A 1UWOA 1H4BA 3O78A 2L4HA 2LVJA 1RECA 2M7LA 2JULA 4ORAB 2KI6C 1MR8A 5B8IB 1WLZA 4PHMA 1BG1A 3JVTC 2L50A 4I5NB 4ZCUA 2LMUA 3CTNA 5I8NA 3I5GB 2BL0C 3BUNB 1A03A 2Y4QA 4PDZA 1A75A 1K93D 2AMIA 4M2OA 5DKNA 1QXPA 1JC2A 1SR6B 1R6PA 2H2KA 2KFGA 1K96A 1AJ4A 4XJKB 1Q80A 1H8BA 2BKHB 2LVVA 1NUBA 1W7IB 4PCWA 1S5GY 1MXLC 2ZNEA 1F55A 1GGZA 2PSRA 2JWWA 1CLMA 2BBMA 1J1DA 1UHIA 1JUOA 2KAXA 1YRTB 4OVNF 1WRKA 3VRRA 1TNXA 3EVUA 1MQ1A 3JVTB 1B7TZ 3PSRA 1S3PA 5I2OA 1YRUB 1CLLA 4CFQA 2F8PA 1KQVA 3WXAA 3SG4A 1IG5A 3EVRA 3BUMB 4M2QA 3DVJA 1DTLA 5AFPA 1KFUL 1YUSA 4GBAA 1DMOA 2WOSA 2KBMA 5HKZA 5CSJA 3O6BA 1NPQA 1TNQA 4A4BA 3K21A 3TDIA 3CGAA 2Y1NA 2CBLA 3AKAA 4HREE 5IBWA 2K0JA 2BBNA 1FF1A 1SCMB 4NDBA 2CT9A 3H4SE 2LMVA 3BXKA 2IS9A 2M49B 2MJWB 5JJGA 4PHKA 1TIZA 3BQ3A 5KSZA 1JFJA 3SG5A 1PVAA 1SRAA 4NDDA 1D1OA 3D0YA 1W7JB 4FQOA 4YI9A 2H61A 5HYDA 1J7RA 3KEVA 2G2BA 2KYFA 2KNEA 2M8UA 1K9PA 1TNPA 2KDHA 3SG7A 1BODA 2I18A 2PASA 2Q4UA 3NSIA 2HQ8A 1F70A 2MHHA 2JT0A 2LUCA 1AUIB 1PULA 3CLNA 1DJGA 3CR2A 1QJTA 1KSMA 2WCEA 1NIWA 1SR6C 4MZKA 2BE6A 1QVIZ 3EK4A 4MZLA 1EH2A 3DF0B 3NXAA 1G8IA 1AHRA 4R1EA 1ALVA 1CTRA 1F54A 2PMYA 1JWDA 1OMRA 1XYDA 3TDUA 1CFPA 2KFFA 4M2PA 3KO0A 1WY9A 4N1GA 4GFTA 2BE4A 3EKJA 5I2QA 2ISDA 1JSAA 2SASA 4Q04A 1CM4A 3I5HC 3LK1A 1J7QA 2I7AA 2ZRSA 1NX2A 2KYCA 1XFWO 3NSKA 1RTP1 2LLUA 4N1FA 3GK4X 3GOFA 1B47A 4PHNA 3A8RA 1KWOB 1AJ5A 1B4CA 2KFHA 4N5XA 1KFXL 3NSLA 1A4PA 3O4YA 3ZWHA 1UHJA 3CWGA 2OS8C 1SY9A 2LVKA 2HQWA 3OB1B 3I5FC 1J55A 3LCPC 2NCPA 1RK9A 4YGDB 1S1EA 1EG3A 2EC6C 1CDNA 5HKYA 4BY5A 1B9AA 1BJFA 1DGUA 1RJVA 4BY4A 1ODBA 3I5IB 1M63B 4D1EA 1DVIA 1YUUA 5KU1A 1U5IA 2KBIA 2LCPA 1A2XA 1S6JA 1AP4A 1ALWA 1KK7Y 2CTNA 2V53A 3AAKA 3DVEA 3SG3A 3VGOA 1UURA 1B1GA 3BUXB 1XVJA 2L0PA 1XFZO 1G4YR 4GGFC 4MSPA 1ZMZA 1KQMB 4MLWA 2PVBA 3C1VA 4DCKA 5DKQA 5TNCA 3A4UB 2CCMA 1CDPA 1XFYO 1BR4B 1E8AA 5PALA 1RROA 2LAPA 2ZN9A 1IKUA 3FIAA 1L2OC 1N0YA 1YX8A 2JTTA 4XYNA 1QX7A 2M3WA 2EC6B 1ZFSA 4YGAA 3CR4X 1XA5A 1IRJA 4GUKA 1GGWA 1IGVA 2F3ZA 2K8MB 4GNKB 1DGVA 1TN4A 4UPGA 1X02A 4PE1A 1OZOA 2K7BA 3CR5X 4GGFA 3TUYC 4ETOA 1LA3A 3GK2A 1FW4A 1B8CA 1YUTA 2JOJA 2O5GA 3VRQA 4ORCB 4MRXA 4DS7A 3WHTB 1IJ5A 3BOWA 3F45A 1SPYA 1K90D 3AAJA 1XK4C 2BKIB 4WQ2A 1TTXA 2LNKA 2JZIA 2LP2A 1S5GZ 1EXRA 2ZRTA 1SYMA 1WLMA 1YVHA 3E3RA 1IQ3A 1Y0VH 3OB2B 2KSPA 4E68A 2JU0A 3IF7A 2A4JA 3CZTX 4ORBB 2B1UA 1NX0A 1XFXO 1J1EA 1B8RA 2OTGC 2GGZA 4PE0A 4MRYA 1ZUZA 1SMGA 2JT8A 1MWNA 4NQGA 1BLQA 1BU3A 2FCDA 3PN7B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4AQJ A;  4YI8 A;  4A4C A;  2FCE A;  1QTX A;  1NCY A;  2MAZ A;  2R2I A;  2WND A;  2WOR A;  1QX5 B;  1LKJ A;  2KI4 C;  1JBA A;  3OX6 A;  2Q91 A;  2L2E A;  2M1U A;  4I5J A;  1LXF C;  2EHB A;  4PHJ A;  4P2Y B;  1R2U A;  2P6B B;  2HET A;  2JNX A;  3SIA A;  1WDC C;  3JTD B;  3VRO A;  1CDL A;  1Y1U A;  1FBV A;  1QX2 A;  1DJX A;  4OV2 A;  1OE9 B;  4ZCV A;  1NWD A;  5D7F A;  5G08 A;  1FPW A;  2I94 A;  2JRF A;  4YBH B;  1N2D A;  2BCX A;  1SKT A;  3TS5 C;  1DT7 B;  1F8H A;  3FWC A;  2EGD A;  5AEQ A;  3OP0 A;  2H61 C;  2K61 A;  2L4I A;  4OR9 B;  3IQQ A;  1OZS A;  2LHL A;  4CLN A;  4CPV A;  1IQ5 A;  1L7Z A;  3OHM B;  4C0L A;  5AER A;  1JF2 A;  1QIV A;  4PE4 A;  1TCF A;  4F0Z B;  1M45 A;  3PM8 A;  4MVF A;  2LAN A;  2BEC A;  3VRP A;  1PRW A;  1QAT A;  1S26 D;  1EG4 A;  1A75 B;  1MXE A;  1EJ3 A;  1K9K A;  1NSH A;  1TRF A;  1Y1A A;  1DJY A;  1Y6W A;  3WHU B;  4NDC A;  3FS7 A;  2WC8 A;  5D69 A;  3IQO A;  3DD4 A;  1A29 A;  1CM1 A;  1CFC A;  1JF0 A;  5I2L A;  1NX3 A;  1RFJ A;  1F4Q A;  1GQM A;  5CSI A;  5ER5 A;  1K2H A;  1KQM C;  1UHH A;  1SCM C;  1XO5 A;  2MLF C;  3BOW B;  1QV0 A;  1WRZ A;  1CFD A;  3SJS A;  1BR1 B;  1UHN A;  2ZND A;  1J7O A;  2VRG A;  2KI4 B;  3LK0 A;  1S6C A;  2M29 A;  3PAT A;  4GGN A;  5GQQ C;  2WCB A;  4C0J A;  1SNL A;  2QAC A;  4MBE A;  2M97 A;  5AXI A;  1QLS A;  1DF0 A;  1SL9 A;  1PSR A;  2LHI A;  1RWY A;  3VRN A;  5FYX A;  1TOP A;  3O2P A;  4AQI A;  2F3Y A;  1CKK A;  1CB1 A;  1S36 A;  1QAS A;  2L51 A;  3TS5 B;  5J3X A;  1PAL A;  1PK0 D;  3GK1 A;  3MSE B;  2LE9 B;  3KF9 A;  4WQ3 A;  1SL8 A;  1K95 A;  1BMO A;  2ZFD A;  1CDM A;  4DIR A;  1K8U A;  1UHK A;  1MF8 B;  2JXL A;  1K94 A;  1NCX A;  1C07 A;  1LVC D;  3NSO A;  1SL7 A;  2OS8 B;  1CNP A;  1DJW A;  3AKB A;  1CLB A;  3KHE A;  2CXJ A;  3WNX B;  1B7T Y;  1YVL A;  2KAY A;  2LP3 A;  4USL A;  1F4O A;  1SCV A;  3HX4 A;  1NYA A;  2K7O A;  1U5I B;  3DVM A;  3TZ1 A;  2NXQ A;  3TDZ A;  1OMV A;  2JPT A;  2LM5 A;  1IJ6 A;  2JXC A;  1KWO C;  4L9M A;  3I5G C;  3DF0 A;  2DOQ A;  1NP8 A;  2LLS A;  3SG6 A;  1QIW A;  2HF5 A;  2BL0 B;  2LVI A;  3RLZ A;  2SCP A;  3EKH A;  2E30 A;  2FOT A;  2Y5I A;  2D8N A;  3I5F B;  1PSB A;  4P5O E;  4HSZ A;  1OMD A;  4DUQ A;  4QJ3 B;  4I5L B;  2KI6 D;  4XJK A;  1SW8 A;  2LLT A;  1YX7 A;  1GJY A;  1LA0 A;  1MHO A;  1BF5 A;  2JTZ A;  4YGB B;  1BOC A;  2LMT A;  1KSO A;  2OPO A;  1FI6 A;  4ICB A;  2L98 A;  1LIN A;  1CMF A;  4YGE B;  1KFU S;  3M0W A;  1IWQ A;  3QRX A;  4FTG A;  4PAL A;  2M0R A;  1MUX A;  1QV1 A;  1XK4 A;  4QJ5 B;  2PRU A;  1S6I A;  3SG2 A;  1ZOT B;  5AAN A;  4CID A;  3JTD C;  2WCF A;  5DKR A;  1WRL A;  2KQ6 A;  4DRW A;  5KTY A;  4GAO A;  2K7D A;  2GV5 A;  1KK7 Z;  1AK8 A;  1OOJ A;  2L5X B;  3RM1 A;  1Y1X A;  2NZ0 A;  3ZNI A;  1V1G A;  5CSN A;  1SBJ A;  2KAV A;  2JNF A;  2KQY A;  2F2P A;  1YTZ C;  3LL8 B;  1KK8 C;  1FI5 A;  2KGB C;  1DJI A;  1JFK A;  5CSF A;  4JPZ B;  5F6T A;  5BPJ A;  3D0Y B;  2CNP A;  1M31 A;  4JQ0 D;  5JOL A;  2QPT A;  2G9B A;  1TNW A;  1DJH A;  2I2R E;  2TN4 A;  4I5K A;  1NCZ A;  3I5H B;  1CMG A;  1AVS A;  2F33 A;  3EVV A;  5K89 A;  4JWQ A;  4MZJ A;  1B8L A;  4MN0 A;  2KGR A;  3I5I C;  2M7N A;  1K9U A;  3EK8 A;  2M9G A;  4WRI A;  1QS7 A;  3SIB A;  3FWB A;  2M1K B;  1V1F A;  1EL4 A;  1F71 A;  1TCO B;  1XFU O;  2JC2 A;  3EK7 A;  3OX5 A;  2AUC A;  1SK6 D;  2RGI A;  1M46 A;  2MRD A;  2OTG B;  4HRG A;  3TUY B;  4PE7 A;  4CFR A;  1OQP A;  2GGM A;  5HKW A;  3PLF B;  1HQV A;  3PN7 C;  4TNC A;  2Y1M A;  1KK8 B;  1XFV O;  2K2A A;  4YRU A;  1QVI Y;  2JT3 A;  2COL B;  4HRH A;  5ER4 X;  1VRK A;  1DJZ A;  5HLV A;  3CS1 A;  2ZN8 A;  4QJ4 B;  3KPX A;  1KFX S;  2MA2 A;  3DVK A;  4IL1 A;  1IH0 A;  2E6W A;  5HLO A;  3BUO B;  2PAL A;  1PVB A;  4OKH A;  2F2O A;  3ICB A;  3PAL A;  4C0K A;  1M39 A;  2HPS A;  2K7C A;  2KOT A;  1N65 A;  1YUR A;  2LC5 A;  4GPL B;  1BT6 A;  2KHN A;  3PFV A;  2LV7 A;  1HT9 A;  2MBX A;  2FJU B;  3BUW B;  1QLK A;  1UUS A;  1DF0 B;  2MLE C;  2BCA A;  1UP5 A;  2O60 A;  3BYA A;  2JQ6 A;  1L2O B;  5CPV A;  1C7W A;  1CFF A;  3LLE A;  1YR5 A;  2ZKM X;  4YGC B;  1J7P A;  4MEW A;  1WDC B;  3HCM A;  1C7V A;  1NX1 A;  1OSA A;  2NCO A;  2LUX A;  1ZAC A;  4U8D A;  4AOM A;  2NLN A;  1G33 A;  4OCI A;  2BCB A;  2K2F A;  1KCY A;  2AAO A;  3D10 A;  1UWO A;  1H4B A;  3O78 A;  2L4H A;  2LVJ A;  1REC A;  2M7L A;  2JUL A;  4ORA B;  2KI6 C;  1MR8 A;  5B8I B;  1WLZ A;  4PHM A;  1BG1 A;  3JVT C;  2L50 A;  4I5N B;  4ZCU A;  2LMU A;  3CTN A;  5I8N A;  3I5G B;  2BL0 C;  3BUN B;  1A03 A;  2Y4Q A;  4PDZ A;  1A75 A;  1K93 D;  2AMI A;  4M2O A;  5DKN A;  1QXP A;  1JC2 A;  1SR6 B;  1R6P A;  2H2K A;  2KFG A;  1K96 A;  1AJ4 A;  4XJK B;  1Q80 A;  1H8B A;  2BKH B;  2LVV A;  1NUB A;  1W7I B;  4PCW A;  1S5G Y;  1MXL C;  2ZNE A;  1F55 A;  1GGZ A;  2PSR A;  2JWW A;  1CLM A;  2BBM A;  1J1D A;  1UHI A;  1JUO A;  2KAX A;  1YRT B;  4OVN F;  1WRK A;  3VRR A;  1TNX A;  3EVU A;  1MQ1 A;  3JVT B;  1B7T Z;  3PSR A;  1S3P A;  5I2O A;  1YRU B;  1CLL A;  4CFQ A;  2F8P A;  1KQV A;  3WXA A;  3SG4 A;  1IG5 A;  3EVR A;  3BUM B;  4M2Q A;  3DVJ A;  1DTL A;  5AFP A;  1KFU L;  1YUS A;  4GBA A;  1DMO A;  2WOS A;  2KBM A;  5HKZ A;  5CSJ A;  3O6B A;  1NPQ A;  1TNQ A;  4A4B A;  3K21 A;  3TDI A;  3CGA A;  2Y1N A;  2CBL A;  3AKA A;  4HRE E;  5IBW A;  2K0J A;  2BBN A;  1FF1 A;  1SCM B;  4NDB A;  2CT9 A;  3H4S E;  2LMV A;  3BXK A;  2IS9 A;  2M49 B;  2MJW B;  5JJG A;  4PHK A;  1TIZ A;  3BQ3 A;  5KSZ A;  1JFJ A;  3SG5 A;  1PVA A;  1SRA A;  4NDD A;  1D1O A;  3D0Y A;  1W7J B;  4FQO A;  4YI9 A;  2H61 A;  5HYD A;  1J7R A;  3KEV A;  2G2B A;  2KYF A;  2KNE A;  2M8U A;  1K9P A;  1TNP A;  2KDH A;  3SG7 A;  1BOD A;  2I18 A;  2PAS A;  2Q4U A;  3NSI A;  2HQ8 A;  1F70 A;  2MHH A;  2JT0 A;  2LUC A;  1AUI B;  1PUL A;  3CLN A;  1DJG A;  3CR2 A;  1QJT A;  1KSM A;  2WCE A;  1NIW A;  1SR6 C;  4MZK A;  2BE6 A;  1QVI Z;  3EK4 A;  4MZL A;  1EH2 A;  3DF0 B;  3NXA A;  1G8I A;  1AHR A;  4R1E A;  1ALV A;  1CTR A;  1F54 A;  2PMY A;  1JWD A;  1OMR A;  1XYD A;  3TDU A;  1CFP A;  2KFF A;  4M2P A;  3KO0 A;  1WY9 A;  4N1G A;  4GFT A;  2BE4 A;  3EKJ A;  5I2Q A;  2ISD A;  1JSA A;  2SAS A;  4Q04 A;  1CM4 A;  3I5H C;  3LK1 A;  1J7Q A;  2I7A A;  2ZRS A;  1NX2 A;  2KYC A;  1XFW O;  3NSK A;  1RTP 1;  2LLU A;  4N1F A;  3GK4 X;  3GOF A;  1B47 A;  4PHN A;  3A8R A;  1KWO B;  1AJ5 A;  1B4C A;  2KFH A;  4N5X A;  1KFX L;  3NSL A;  1A4P A;  3O4Y A;  3ZWH A;  1UHJ A;  3CWG A;  2OS8 C;  1SY9 A;  2LVK A;  2HQW A;  3OB1 B;  3I5F C;  1J55 A;  3LCP C;  2NCP A;  1RK9 A;  4YGD B;  1S1E A;  1EG3 A;  2EC6 C;  1CDN A;  5HKY A;  4BY5 A;  1B9A A;  1BJF A;  1DGU A;  1RJV A;  4BY4 A;  1ODB A;  3I5I B;  1M63 B;  4D1E A;  1DVI A;  1YUU A;  5KU1 A;  1U5I A;  2KBI A;  2LCP A;  1A2X A;  1S6J A;  1AP4 A;  1ALW A;  1KK7 Y;  2CTN A;  2V53 A;  3AAK A;  3DVE A;  3SG3 A;  3VGO A;  1UUR A;  1B1G A;  3BUX B;  1XVJ A;  2L0P A;  1XFZ O;  1G4Y R;  4GGF C;  4MSP A;  1ZMZ A;  1KQM B;  4MLW A;  2PVB A;  3C1V A;  4DCK A;  5DKQ A;  5TNC A;  3A4U B;  2CCM A;  1CDP A;  1XFY O;  1BR4 B;  1E8A A;  5PAL A;  1RRO A;  2LAP A;  2ZN9 A;  1IKU A;  3FIA A;  1L2O C;  1N0Y A;  1YX8 A;  2JTT A;  4XYN A;  1QX7 A;  2M3W A;  2EC6 B;  1ZFS A;  4YGA A;  3CR4 X;  1XA5 A;  1IRJ A;  4GUK A;  1GGW A;  1IGV A;  2F3Z A;  2K8M B;  4GNK B;  1DGV A;  1TN4 A;  4UPG A;  1X02 A;  4PE1 A;  1OZO A;  2K7B A;  3CR5 X;  4GGF A;  3TUY C;  4ETO A;  1LA3 A;  3GK2 A;  1FW4 A;  1B8C A;  1YUT A;  2JOJ A;  2O5G A;  3VRQ A;  4ORC B;  4MRX A;  4DS7 A;  3WHT B;  1IJ5 A;  3BOW A;  3F45 A;  1SPY A;  1K90 D;  3AAJ A;  1XK4 C;  2BKI B;  4WQ2 A;  1TTX A;  2LNK A;  2JZI A;  2LP2 A;  1S5G Z;  1EXR A;  2ZRT A;  1SYM A;  1WLM A;  1YVH A;  3E3R A;  1IQ3 A;  1Y0V H;  3OB2 B;  2KSP A;  4E68 A;  2JU0 A;  3IF7 A;  2A4J A;  3CZT X;  4ORB B;  2B1U A;  1NX0 A;  1XFX O;  1J1E A;  1B8R A;  2OTG C;  2GGZ A;  4PE0 A;  4MRY A;  1ZUZ A;  1SMG A;  2JT8 A;  1MWN A;  4NQG A;  1BLQ A;  1BU3 A;  2FCD A;  3PN7 B; 
#chains in the Genus database with same CATH topology
 4AQJ A;  4YI8 A;  4A4C A;  2FCE A;  1QTX A;  1NCY A;  2MAZ A;  2R2I A;  2WND A;  2WOR A;  4INW A;  1QX5 B;  1LKJ A;  2KI4 C;  1JBA A;  3OX6 A;  2Q91 A;  1TUZ A;  2L2E A;  2M1U A;  3K1E A;  4I5J A;  1LXF C;  2EHB A;  4PHJ A;  4P2Y B;  1R2U A;  2P6B B;  2HET A;  2JNX A;  3SIA A;  5D3O A;  1WDC C;  3JTD B;  3VRO A;  1CDL A;  1Y1U A;  1OOF A;  1FBV A;  1QX2 A;  1DJX A;  4OV2 A;  1OE9 B;  4ZCV A;  1NWD A;  1OOI X;  5D7F A;  5G08 A;  1FPW A;  2I94 A;  2JRF A;  4OZD A;  1N2D A;  2BCX A;  1SKT A;  4YBH B;  3TS5 C;  1DT7 B;  1F8H A;  3FWC A;  2EGD A;  5AEQ A;  3CAB A;  3OP0 A;  2H61 C;  2K61 A;  2L4I A;  4OR9 B;  3IQQ A;  1OZS A;  2LHL A;  3OBV A;  3V2L A;  4CLN A;  1IQ5 A;  1L7Z A;  3OHM B;  4C0L A;  4CPV A;  5AER A;  1JF2 A;  1QIV A;  4PE4 A;  2WC6 A;  1TCF A;  3RZS A;  4F0Z B;  1M45 A;  3PM8 A;  4MVF A;  2LAN A;  2BEC A;  3VRP A;  1PRW A;  1QAT A;  1S26 D;  1EG4 A;  1A75 B;  1MXE A;  1EJ3 A;  1K9K A;  1NSH A;  1TRF A;  1Y1A A;  1DJY A;  1Y6W A;  3WHU B;  4NDC A;  3FS7 A;  2WC8 A;  5D69 A;  3IQO A;  3DD4 A;  1A29 A;  1CM1 A;  1CFC A;  1JF0 A;  5I2L A;  1NX3 A;  1RFJ A;  1F4Q A;  1GQM A;  5CSI A;  5ER5 A;  3S0G A;  1KQM C;  1K2H A;  1UHH A;  1SCM C;  1XO5 A;  2MLF C;  3BOW B;  1QV0 A;  1WRZ A;  3N7H A;  2KPH A;  1CFD A;  3SJS A;  1BR1 B;  1UHN A;  2ZND A;  1J7O A;  2VRG A;  5FI6 A;  2KI4 B;  3LK0 A;  1S6C A;  2L5Y A;  2M29 A;  3PAT A;  4GGN A;  5GQQ C;  3SS4 A;  2WCB A;  4C0J A;  1SNL A;  2QAC A;  4MBE A;  2M97 A;  5AXI A;  1QLS A;  1DF0 A;  1SL9 A;  1PSR A;  2LHI A;  3S0E A;  1RWY A;  3VRN A;  5FYX A;  1TOP A;  3O2P A;  4AQI A;  2F3Y A;  2JPO A;  1CKK A;  1S36 A;  1CB1 A;  1QAS A;  1DC1 A;  2L51 A;  3TS5 B;  3R1V A;  5J3X A;  1PAL A;  1PK0 D;  3GK1 A;  3MSE B;  2LE9 B;  2YGU A;  3KF9 A;  4WQ3 A;  1SL8 A;  3DZT A;  3D75 A;  1IIO A;  1K95 A;  1BMO A;  2ZFD A;  1CDM A;  4DIR A;  3D74 A;  1K8U A;  1UHK A;  1MF8 B;  2JXL A;  4F7F A;  1K94 A;  1NCX A;  1C07 A;  1LVC D;  3NSO A;  1SL7 A;  2OS8 B;  1CNP A;  1DJW A;  3AKB A;  1CLB A;  3KHE A;  2CXJ A;  3WNX B;  1B7T Y;  1YVL A;  2KAY A;  2LP3 A;  4USL A;  1F4O A;  1SCV A;  1P28 A;  2WCL A;  1NYA A;  2K7O A;  3HX4 A;  3D77 A;  1U5I B;  3DVM A;  3TZ1 A;  2NXQ A;  3TDZ A;  1OMV A;  2JPT A;  2LM5 A;  1IJ6 A;  2QEH A;  2JXC A;  1KWO C;  4L9M A;  3I5G C;  3DF0 A;  2DOQ A;  1NP8 A;  2LLS A;  3SG6 A;  1QIW A;  2HF5 A;  3PJI A;  2BL0 B;  2LVI A;  3RLZ A;  2SCP A;  3EKH A;  2E30 A;  2FOT A;  2Y5I A;  2D8N A;  3I5F B;  1PSB A;  1SSE B;  3L47 A;  4P5O E;  4HSZ A;  1OMD A;  4DUQ A;  4QJ3 B;  3QME A;  2BNX A;  1XFR A;  2KI6 D;  4I5L B;  1SW8 A;  2LLT A;  4XJK A;  3S0D A;  1YX7 A;  1GJY A;  1LA0 A;  1MHO A;  1BF5 A;  2JTZ A;  4YGB B;  4JD9 A;  1BOC A;  2LMT A;  1KSO A;  2OPO A;  1FI6 A;  4ICB A;  2L98 A;  1LIN A;  1CMF A;  4YGE B;  1KFU S;  3FE8 A;  1IWQ A;  3M0W A;  3QRX A;  4FTG A;  2M0R A;  1OW4 A;  4PAL A;  1MUX A;  1QV1 A;  3D76 A;  1XK4 A;  3SS3 A;  2PRU A;  1S6I A;  3SG2 A;  4QJ5 B;  4FQT A;  1ZOT B;  5I94 A;  3S0F A;  2FJY A;  5AAN A;  4CID A;  5FI7 A;  3JTD C;  2WCF A;  5DKR A;  1WRL A;  2KQ6 A;  4DRW A;  5KTY A;  4GAO A;  2K7D A;  2GV5 A;  1W9Z A;  1KK7 Z;  1AK8 A;  1OOJ A;  2L5X B;  3RM1 A;  3DY9 A;  1Y1X A;  2NZ0 A;  3ZNI A;  1V1G A;  5CSN A;  1SBJ A;  2KAV A;  2JNF A;  2KQY A;  2F2P A;  1YTZ C;  3LL8 B;  1KK8 C;  1FI5 A;  2KGB C;  1DJI A;  1JFK A;  5CSF A;  4JPZ B;  5F6T A;  5BPJ A;  3D0Y B;  2CNP A;  1M31 A;  2L2C A;  4JQ0 D;  5JOL A;  2QPT A;  1Z4H A;  2G9B A;  1TNW A;  1DJH A;  2I2R E;  2TN4 A;  4I5K A;  1NCZ A;  3I5H B;  1CMG A;  1AVS A;  2F33 A;  3EVV A;  5K89 A;  4JWQ A;  4MZJ A;  1B8L A;  4MN0 A;  2KGR A;  2QEV A;  3I5I C;  2M7N A;  1K9U A;  3NGV A;  3EK8 A;  1DQE A;  2M9G A;  4WRI A;  1QS7 A;  3SIB A;  3FWB A;  2M1K B;  1V1F A;  1EL4 A;  1F71 A;  1TCO B;  1XFU O;  2JC2 A;  2PQL A;  3EK7 A;  3OX5 A;  4IJ7 A;  2AUC A;  1SK6 D;  2RGI A;  1M46 A;  2MRD A;  2OTG B;  4HRG A;  3B88 A;  3TUY B;  3OGN A;  3PM2 A;  4PE7 A;  4CFR A;  1ORG A;  4INX A;  1OQP A;  2GGM A;  5HKW A;  3PLF B;  1HQV A;  3PN7 C;  4TNC A;  2Y1M A;  1KK8 B;  1XFV O;  2K2A A;  4YRU A;  1QVI Y;  2JT3 A;  2COL B;  4HRH A;  5ER4 X;  1VRK A;  1DJZ A;  5HLV A;  3CS1 A;  2ZN8 A;  4QJ4 B;  3CZ0 A;  3KPX A;  1KFX S;  2MA2 A;  3DVK A;  3R1O A;  4IL1 A;  2E6W A;  5HLO A;  1IH0 A;  3BUO B;  3FE6 A;  2PAL A;  1PVB A;  4OKH A;  2F2O A;  3ICB A;  3PAL A;  4C0K A;  3L4L A;  3L4A A;  1M39 A;  2HPS A;  2K7C A;  1TUJ A;  1N65 A;  1YUR A;  2KOT A;  2LC5 A;  1BT6 A;  2KHN A;  3PFV A;  4GPL B;  3SS5 A;  2LV7 A;  1HT9 A;  2MBX A;  2FJU B;  2WCJ A;  3BUW B;  1QLK A;  1UUS A;  3B87 A;  1T14 A;  1DF0 B;  2MLE C;  2BCA A;  1UP5 A;  2O60 A;  3BYA A;  1DEK A;  2JQ6 A;  1L2O B;  5CPV A;  1C7W A;  1CFF A;  4KYN A;  3LLE A;  1YR5 A;  2ZKM X;  4YGC B;  1J7P A;  4MEW A;  1WDC B;  3HCM A;  1C7V A;  1NX1 A;  1OSA A;  2NCO A;  2LUX A;  1ZAC A;  4U8D A;  3CYZ A;  3B6X A;  4AOM A;  2NLN A;  1G33 A;  1OOH A;  2BCB A;  2K2F A;  4OCI A;  1KCY A;  2AAO A;  2PYQ A;  3D10 A;  1UWO A;  1H4B A;  3O78 A;  2L4H A;  2LVJ A;  1TWO A;  1REC A;  2P70 A;  3CZ1 A;  3NHI A;  2JUL A;  2M7L A;  4ORA B;  2KI6 C;  1MR8 A;  2WCH A;  5B8I B;  1WLZ A;  4PHM A;  1BG1 A;  3JVT C;  2L50 A;  4I5N B;  4ZCU A;  2LMU A;  3CTN A;  5I8N A;  3I5G B;  2BL0 C;  3BUN B;  1A03 A;  2Y4Q A;  4PDZ A;  1A75 A;  1K93 D;  2AMI A;  4M2O A;  5DKN A;  1QXP A;  3Q8I A;  1JC2 A;  1SR6 B;  1R6P A;  2BAP A;  2H2K A;  2KFG A;  1K96 A;  1AJ4 A;  4XJK B;  1Q80 A;  1H8B A;  2BKH B;  2LVV A;  2H8V A;  1NUB A;  1W7I B;  4PCW A;  1S5G Y;  3VB1 A;  1MXL C;  2ZNE A;  1F55 A;  1C3Y A;  1GGZ A;  2PSR A;  2JWW A;  1CLM A;  2BBM A;  1J1D A;  1UHI A;  3BJH A;  1JUO A;  2KAX A;  1YRT B;  3UO9 A;  4OVN F;  5FI2 A;  1WRK A;  3VRR A;  1TNX A;  3EVU A;  1MQ1 A;  5EL2 A;  3JVT B;  1B7T Z;  3PSR A;  1S3P A;  5I2O A;  1YRU B;  3DXL A;  1CLL A;  4CFQ A;  2F8P A;  1KQV A;  3WXA A;  3SG4 A;  1IG5 A;  3EVR A;  3BUM B;  3B86 A;  3DVJ A;  1DTL A;  4M2Q A;  4PT1 A;  5AFP A;  1KFU L;  1YUS A;  4GBA A;  1DMO A;  2WOS A;  2KBM A;  5HKZ A;  2KLE A;  2QDI A;  3O4X A;  3EG5 B;  5CSJ A;  3O6B A;  1NPQ A;  1TNQ A;  4A4B A;  3K21 A;  1LS8 A;  1Z2C B;  3DYE A;  3TDI A;  3CGA A;  2Y1N A;  2CBL A;  3AKA A;  4HRE E;  5IBW A;  2K0J A;  2BBN A;  1FF1 A;  1SCM B;  4NDB A;  2CT9 A;  3H4S E;  2LMV A;  3BXK A;  2IS9 A;  2M49 B;  2MJW B;  3S0B A;  5JJG A;  4PHK A;  1TIZ A;  3BQ3 A;  5KSZ A;  1JFJ A;  3SG5 A;  1PVA A;  1SRA A;  4NDD A;  1D1O A;  3D0Y A;  2K60 A;  1W7J B;  4FQO A;  4YI9 A;  2H61 A;  5HYD A;  1J7R A;  3KEV A;  2G2B A;  2KYF A;  2KNE A;  2M8U A;  1K9P A;  1TNP A;  2KDH A;  3SG7 A;  1BOD A;  2I18 A;  2PAS A;  2Q4U A;  3NSI A;  2HQ8 A;  1F70 A;  2MHH A;  2JT0 A;  2LUC A;  1AUI B;  2GTE A;  1PUL A;  3D78 A;  3CLN A;  1DJG A;  3CR2 A;  5HL1 A;  1C3Z A;  3FE9 A;  1QJT A;  1KSM A;  2KLD A;  2WCE A;  1NIW A;  1SR6 C;  4MZK A;  2BE6 A;  1QVI Z;  3EK4 A;  4MZL A;  1EH2 A;  3DF0 B;  3NHT A;  3NXA A;  1G8I A;  1AHR A;  4R1E A;  1ALV A;  3IVT A;  1CTR A;  1F54 A;  2PMY A;  1JWD A;  1OMR A;  1XYD A;  3TDU A;  1CFP A;  2KFF A;  4M2P A;  3KO0 A;  1WY9 A;  4N1G A;  4GFT A;  2BE4 A;  3EKJ A;  5I2Q A;  2ISD A;  1JSA A;  2SAS A;  4Q04 A;  1CM4 A;  3D73 A;  3I5H C;  3LK1 A;  1J7Q A;  2I7A A;  2ZRS A;  1NX2 A;  2KYC A;  1XFW O;  3NSK A;  1RTP 1;  2LLU A;  4N1F A;  3GK4 X;  3GOF A;  1B47 A;  3BFA A;  1OOG A;  4PHN A;  3A8R A;  1KWO B;  2ERB A;  1AJ5 A;  1B4C A;  2KFH A;  4N5X A;  1KFX L;  3NSL A;  1A4P A;  3O4Y A;  3R1P A;  3ZWH A;  1UHJ A;  3CWG A;  2OS8 C;  1SY9 A;  2LVK A;  2HQW A;  3OB1 B;  3I5F C;  1J55 A;  3LCP C;  2NCP A;  1RK9 A;  4YGD B;  1S1E A;  1EG3 A;  2EC6 C;  1CDN A;  5HKY A;  4BY5 A;  1B9A A;  1BJF A;  1DGU A;  1RJV A;  2WCK A;  1ODB A;  4BY4 A;  3I5I B;  1M63 B;  4D1E A;  1DVI A;  1YUU A;  5KU1 A;  1U5I A;  2KBI A;  5DIC A;  2LCP A;  1A2X A;  1S6J A;  1AP4 A;  1ALW A;  1KK7 Y;  2CTN A;  2V53 A;  3AAK A;  1DEL A;  3DVE A;  3SG3 A;  3VGO A;  1UUR A;  1B1G A;  3BUX B;  1XVJ A;  2L0P A;  3BFB A;  1XFZ O;  1G4Y R;  4GGF C;  4MSP A;  3BFH A;  1ZMZ A;  1KQM B;  4MLW A;  2PVB A;  3C1V A;  4DCK A;  5DKQ A;  3R72 A;  5TNC A;  3A4U B;  2CCM A;  1CDP A;  1XFY O;  1BR4 B;  1E8A A;  5PAL A;  1RRO A;  2LAP A;  2ZN9 A;  1IKU A;  3FIA A;  1L2O C;  1N0Y A;  1YX8 A;  2QEB A;  2JTT A;  4XYN A;  3S0A A;  1QX7 A;  2M3W A;  2EC6 B;  1ZFS A;  4YGA A;  3CR4 X;  1XA5 A;  1IRJ A;  4GUK A;  4JKT A;  1GGW A;  1IGV A;  2F3Z A;  2K8M B;  4GNK B;  1DGV A;  1TN4 A;  4UPG A;  1X02 A;  4PE1 A;  1OZO A;  2K7B A;  3CR5 X;  4GGF A;  3TUY C;  2QEO A;  4ETO A;  1LA3 A;  3GK2 A;  1FW4 A;  1B8C A;  1YUT A;  2JOJ A;  2O5G A;  3VRQ A;  4ORC B;  4MRX A;  4DS7 A;  3CDN A;  1IJ5 A;  3BOW A;  3WHT B;  3F45 A;  1SPY A;  1K90 D;  3AAJ A;  1XK4 C;  2BKI B;  4WQ2 A;  2WC5 A;  1TTX A;  2LNK A;  1GM0 A;  2WCM A;  2JZI A;  2LP2 A;  1S5G Z;  1EXR A;  1QWV A;  2ZRT A;  1SYM A;  1WLM A;  1YVH A;  3E3R A;  1IQ3 A;  3CZ2 A;  1Y0V H;  3OB2 B;  2KSP A;  4E68 A;  2JU0 A;  3IF7 A;  2A4J A;  3CZT X;  4ORB B;  2B1U A;  1NX0 A;  1XFX O;  1J1E A;  2P71 A;  3B7A A;  1B8R A;  2OTG C;  2GGZ A;  4PE0 A;  3UNW A;  4MRY A;  1ZUZ A;  1SMG A;  2JT8 A;  1MWN A;  4NQG A;  1BLQ A;  1BU3 A;  2FCD A;  3PN7 B; 
#chains in the Genus database with same CATH homology
 4AQJ A;  4YI8 A;  4A4C A;  2FCE A;  1QTX A;  1NCY A;  2MAZ A;  2R2I A;  2WND A;  2WOR A;  1QX5 B;  1LKJ A;  2KI4 C;  1JBA A;  3OX6 A;  2Q91 A;  2L2E A;  2M1U A;  4I5J A;  1LXF C;  2EHB A;  4PHJ A;  4P2Y B;  1R2U A;  2P6B B;  2HET A;  2JNX A;  3SIA A;  1WDC C;  3JTD B;  3VRO A;  1CDL A;  1Y1U A;  1FBV A;  1QX2 A;  1DJX A;  4OV2 A;  1OE9 B;  4ZCV A;  1NWD A;  5D7F A;  5G08 A;  1FPW A;  2I94 A;  2JRF A;  4YBH B;  1N2D A;  2BCX A;  1SKT A;  3TS5 C;  1DT7 B;  1F8H A;  3FWC A;  2EGD A;  5AEQ A;  3OP0 A;  2H61 C;  2K61 A;  2L4I A;  4OR9 B;  3IQQ A;  1OZS A;  2LHL A;  4CLN A;  4CPV A;  1IQ5 A;  1L7Z A;  3OHM B;  4C0L A;  5AER A;  1JF2 A;  1QIV A;  4PE4 A;  1TCF A;  4F0Z B;  1M45 A;  3PM8 A;  4MVF A;  2LAN A;  2BEC A;  3VRP A;  1PRW A;  1QAT A;  1S26 D;  1EG4 A;  1A75 B;  1MXE A;  1EJ3 A;  1K9K A;  1NSH A;  1TRF A;  1Y1A A;  1DJY A;  1Y6W A;  3WHU B;  4NDC A;  3FS7 A;  2WC8 A;  5D69 A;  3IQO A;  3DD4 A;  1A29 A;  1CM1 A;  1CFC A;  1JF0 A;  5I2L A;  1NX3 A;  1RFJ A;  1F4Q A;  1GQM A;  5CSI A;  5ER5 A;  1K2H A;  1KQM C;  1UHH A;  1SCM C;  1XO5 A;  2MLF C;  3BOW B;  1QV0 A;  1WRZ A;  1CFD A;  3SJS A;  1BR1 B;  1UHN A;  2ZND A;  1J7O A;  2VRG A;  2KI4 B;  3LK0 A;  1S6C A;  2M29 A;  3PAT A;  4GGN A;  5GQQ C;  2WCB A;  4C0J A;  1SNL A;  2QAC A;  4MBE A;  2M97 A;  5AXI A;  1QLS A;  1DF0 A;  1SL9 A;  1PSR A;  2LHI A;  1RWY A;  3VRN A;  5FYX A;  1TOP A;  3O2P A;  4AQI A;  2F3Y A;  1CKK A;  1CB1 A;  1S36 A;  1QAS A;  2L51 A;  3TS5 B;  5J3X A;  1PAL A;  1PK0 D;  3GK1 A;  3MSE B;  2LE9 B;  3KF9 A;  4WQ3 A;  1SL8 A;  1K95 A;  1BMO A;  2ZFD A;  1CDM A;  4DIR A;  1K8U A;  1UHK A;  1MF8 B;  2JXL A;  1K94 A;  1NCX A;  1C07 A;  1LVC D;  3NSO A;  1SL7 A;  2OS8 B;  1CNP A;  1DJW A;  3AKB A;  1CLB A;  3KHE A;  2CXJ A;  3WNX B;  1B7T Y;  1YVL A;  2KAY A;  2LP3 A;  4USL A;  1F4O A;  1SCV A;  3HX4 A;  1NYA A;  2K7O A;  1U5I B;  3DVM A;  3TZ1 A;  2NXQ A;  3TDZ A;  1OMV A;  2JPT A;  2LM5 A;  1IJ6 A;  2JXC A;  1KWO C;  4L9M A;  3I5G C;  3DF0 A;  2DOQ A;  1NP8 A;  2LLS A;  3SG6 A;  1QIW A;  2HF5 A;  2BL0 B;  2LVI A;  3RLZ A;  2SCP A;  3EKH A;  2E30 A;  2FOT A;  2Y5I A;  2D8N A;  3I5F B;  1PSB A;  4P5O E;  4HSZ A;  1OMD A;  4DUQ A;  4QJ3 B;  4I5L B;  2KI6 D;  4XJK A;  1SW8 A;  2LLT A;  1YX7 A;  1GJY A;  1LA0 A;  1MHO A;  1BF5 A;  2JTZ A;  4YGB B;  1BOC A;  2LMT A;  1KSO A;  2OPO A;  1FI6 A;  4ICB A;  2L98 A;  1LIN A;  1CMF A;  4YGE B;  1KFU S;  3M0W A;  1IWQ A;  3QRX A;  4FTG A;  4PAL A;  2M0R A;  1MUX A;  1QV1 A;  1XK4 A;  4QJ5 B;  2PRU A;  1S6I A;  3SG2 A;  1ZOT B;  5AAN A;  4CID A;  3JTD C;  2WCF A;  5DKR A;  1WRL A;  2KQ6 A;  4DRW A;  5KTY A;  4GAO A;  2K7D A;  2GV5 A;  1KK7 Z;  1AK8 A;  1OOJ A;  2L5X B;  3RM1 A;  1Y1X A;  2NZ0 A;  3ZNI A;  1V1G A;  5CSN A;  1SBJ A;  2KAV A;  2JNF A;  2KQY A;  2F2P A;  1YTZ C;  3LL8 B;  1KK8 C;  1FI5 A;  2KGB C;  1DJI A;  1JFK A;  5CSF A;  4JPZ B;  5F6T A;  5BPJ A;  3D0Y B;  2CNP A;  1M31 A;  4JQ0 D;  5JOL A;  2QPT A;  2G9B A;  1TNW A;  1DJH A;  2I2R E;  2TN4 A;  4I5K A;  1NCZ A;  3I5H B;  1CMG A;  1AVS A;  2F33 A;  3EVV A;  5K89 A;  4JWQ A;  4MZJ A;  1B8L A;  4MN0 A;  2KGR A;  3I5I C;  2M7N A;  1K9U A;  3EK8 A;  2M9G A;  4WRI A;  1QS7 A;  3SIB A;  3FWB A;  2M1K B;  1V1F A;  1EL4 A;  1F71 A;  1TCO B;  1XFU O;  2JC2 A;  3EK7 A;  3OX5 A;  2AUC A;  1SK6 D;  2RGI A;  1M46 A;  2MRD A;  2OTG B;  4HRG A;  3TUY B;  4PE7 A;  4CFR A;  1OQP A;  2GGM A;  5HKW A;  3PLF B;  1HQV A;  3PN7 C;  4TNC A;  2Y1M A;  1KK8 B;  1XFV O;  2K2A A;  4YRU A;  1QVI Y;  2JT3 A;  2COL B;  4HRH A;  5ER4 X;  1VRK A;  1DJZ A;  5HLV A;  3CS1 A;  2ZN8 A;  4QJ4 B;  3KPX A;  1KFX S;  2MA2 A;  3DVK A;  4IL1 A;  1IH0 A;  2E6W A;  5HLO A;  3BUO B;  2PAL A;  1PVB A;  4OKH A;  2F2O A;  3ICB A;  3PAL A;  4C0K A;  1M39 A;  2HPS A;  2K7C A;  2KOT A;  1N65 A;  1YUR A;  2LC5 A;  4GPL B;  1BT6 A;  2KHN A;  3PFV A;  2LV7 A;  1HT9 A;  2MBX A;  2FJU B;  3BUW B;  1QLK A;  1UUS A;  1DF0 B;  2MLE C;  2BCA A;  1UP5 A;  2O60 A;  3BYA A;  2JQ6 A;  1L2O B;  5CPV A;  1C7W A;  1CFF A;  3LLE A;  1YR5 A;  2ZKM X;  4YGC B;  1J7P A;  4MEW A;  1WDC B;  3HCM A;  1C7V A;  1NX1 A;  1OSA A;  2NCO A;  2LUX A;  1ZAC A;  4U8D A;  4AOM A;  2NLN A;  1G33 A;  4OCI A;  2BCB A;  2K2F A;  1KCY A;  2AAO A;  3D10 A;  1UWO A;  1H4B A;  3O78 A;  2L4H A;  2LVJ A;  1REC A;  2M7L A;  2JUL A;  4ORA B;  2KI6 C;  1MR8 A;  5B8I B;  1WLZ A;  4PHM A;  1BG1 A;  3JVT C;  2L50 A;  4I5N B;  4ZCU A;  2LMU A;  3CTN A;  5I8N A;  3I5G B;  2BL0 C;  3BUN B;  1A03 A;  2Y4Q A;  4PDZ A;  1A75 A;  1K93 D;  2AMI A;  4M2O A;  5DKN A;  1QXP A;  1JC2 A;  1SR6 B;  1R6P A;  2H2K A;  2KFG A;  1K96 A;  1AJ4 A;  4XJK B;  1Q80 A;  1H8B A;  2BKH B;  2LVV A;  1NUB A;  1W7I B;  4PCW A;  1S5G Y;  1MXL C;  2ZNE A;  1F55 A;  1GGZ A;  2PSR A;  2JWW A;  1CLM A;  2BBM A;  1J1D A;  1UHI A;  1JUO A;  2KAX A;  1YRT B;  4OVN F;  1WRK A;  3VRR A;  1TNX A;  3EVU A;  1MQ1 A;  3JVT B;  1B7T Z;  3PSR A;  1S3P A;  5I2O A;  1YRU B;  1CLL A;  4CFQ A;  2F8P A;  1KQV A;  3WXA A;  3SG4 A;  1IG5 A;  3EVR A;  3BUM B;  4M2Q A;  3DVJ A;  1DTL A;  5AFP A;  1KFU L;  1YUS A;  4GBA A;  1DMO A;  2WOS A;  2KBM A;  5HKZ A;  5CSJ A;  3O6B A;  1NPQ A;  1TNQ A;  4A4B A;  3K21 A;  3TDI A;  3CGA A;  2Y1N A;  2CBL A;  3AKA A;  4HRE E;  5IBW A;  2K0J A;  2BBN A;  1FF1 A;  1SCM B;  4NDB A;  2CT9 A;  3H4S E;  2LMV A;  3BXK A;  2IS9 A;  2M49 B;  2MJW B;  5JJG A;  4PHK A;  1TIZ A;  3BQ3 A;  5KSZ A;  1JFJ A;  3SG5 A;  1PVA A;  1SRA A;  4NDD A;  1D1O A;  3D0Y A;  1W7J B;  4FQO A;  4YI9 A;  2H61 A;  5HYD A;  1J7R A;  3KEV A;  2G2B A;  2KYF A;  2KNE A;  2M8U A;  1K9P A;  1TNP A;  2KDH A;  3SG7 A;  1BOD A;  2I18 A;  2PAS A;  2Q4U A;  3NSI A;  2HQ8 A;  1F70 A;  2MHH A;  2JT0 A;  2LUC A;  1AUI B;  1PUL A;  3CLN A;  1DJG A;  3CR2 A;  1QJT A;  1KSM A;  2WCE A;  1NIW A;  1SR6 C;  4MZK A;  2BE6 A;  1QVI Z;  3EK4 A;  4MZL A;  1EH2 A;  3DF0 B;  3NXA A;  1G8I A;  1AHR A;  4R1E A;  1ALV A;  1CTR A;  1F54 A;  2PMY A;  1JWD A;  1OMR A;  1XYD A;  3TDU A;  1CFP A;  2KFF A;  4M2P A;  3KO0 A;  1WY9 A;  4N1G A;  4GFT A;  2BE4 A;  3EKJ A;  5I2Q A;  2ISD A;  1JSA A;  2SAS A;  4Q04 A;  1CM4 A;  3I5H C;  3LK1 A;  1J7Q A;  2I7A A;  2ZRS A;  1NX2 A;  2KYC A;  1XFW O;  3NSK A;  1RTP 1;  2LLU A;  4N1F A;  3GK4 X;  3GOF A;  1B47 A;  4PHN A;  3A8R A;  1KWO B;  1AJ5 A;  1B4C A;  2KFH A;  4N5X A;  1KFX L;  3NSL A;  1A4P A;  3O4Y A;  3ZWH A;  1UHJ A;  3CWG A;  2OS8 C;  1SY9 A;  2LVK A;  2HQW A;  3OB1 B;  3I5F C;  1J55 A;  3LCP C;  2NCP A;  1RK9 A;  4YGD B;  1S1E A;  1EG3 A;  2EC6 C;  1CDN A;  5HKY A;  4BY5 A;  1B9A A;  1BJF A;  1DGU A;  1RJV A;  4BY4 A;  1ODB A;  3I5I B;  1M63 B;  4D1E A;  1DVI A;  1YUU A;  5KU1 A;  1U5I A;  2KBI A;  2LCP A;  1A2X A;  1S6J A;  1AP4 A;  1ALW A;  1KK7 Y;  2CTN A;  2V53 A;  3AAK A;  3DVE A;  3SG3 A;  3VGO A;  1UUR A;  1B1G A;  3BUX B;  1XVJ A;  2L0P A;  1XFZ O;  1G4Y R;  4GGF C;  4MSP A;  1ZMZ A;  1KQM B;  4MLW A;  2PVB A;  3C1V A;  4DCK A;  5DKQ A;  5TNC A;  3A4U B;  2CCM A;  1CDP A;  1XFY O;  1BR4 B;  1E8A A;  5PAL A;  1RRO A;  2LAP A;  2ZN9 A;  1IKU A;  3FIA A;  1L2O C;  1N0Y A;  1YX8 A;  2JTT A;  4XYN A;  1QX7 A;  2M3W A;  2EC6 B;  1ZFS A;  4YGA A;  3CR4 X;  1XA5 A;  1IRJ A;  4GUK A;  1GGW A;  1IGV A;  2F3Z A;  2K8M B;  4GNK B;  1DGV A;  1TN4 A;  4UPG A;  1X02 A;  4PE1 A;  1OZO A;  2K7B A;  3CR5 X;  4GGF A;  3TUY C;  4ETO A;  1LA3 A;  3GK2 A;  1FW4 A;  1B8C A;  1YUT A;  2JOJ A;  2O5G A;  3VRQ A;  4ORC B;  4MRX A;  4DS7 A;  3WHT B;  1IJ5 A;  3BOW A;  3F45 A;  1SPY A;  1K90 D;  3AAJ A;  1XK4 C;  2BKI B;  4WQ2 A;  1TTX A;  2LNK A;  2JZI A;  2LP2 A;  1S5G Z;  1EXR A;  2ZRT A;  1SYM A;  1WLM A;  1YVH A;  3E3R A;  1IQ3 A;  1Y0V H;  3OB2 B;  2KSP A;  4E68 A;  2JU0 A;  3IF7 A;  2A4J A;  3CZT X;  4ORB B;  2B1U A;  1NX0 A;  1XFX O;  1J1E A;  1B8R A;  2OTG C;  2GGZ A;  4PE0 A;  4MRY A;  1ZUZ A;  1SMG A;  2JT8 A;  1MWN A;  4NQG A;  1BLQ A;  1BU3 A;  2FCD A;  3PN7 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...