2PALA

Ionic interactions with parvalbumins. crystal structure determination of pike 4.10 parvalbumin in four different ionic environments
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
107
structure length
107
Chain Sequence
SFAGLKDADVAAALAACSAADSFKHKEFFAKVGLASKSLDDVKKAFYVIDQDKSGFIEEDELKLFLQNFSPSARALTDAETKAFLADGDKDGDGMIGVDEFAAMIKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Ionic interactions with parvalbumins. Crystal structure determination of pike 4.10 parvalbumin in four different ionic environments.
pubmed doi rcsb
source organism Esox lucius
molecule tags Calcium binding protein
molecule keywords PARVALBUMIN
total genus 39
structure length 107
sequence length 107
ec nomenclature
pdb deposition date 1990-11-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2palA00
1SCVA 2CTNA 3CZTX 3CR5X 2F33A 4JPZB 3DVEA 4I5KA 2LVIA 2BKHB 2G2BA 4ORCB 1TNPA 2JXLA 1MR8A 1YUSA 1CDPA 2LMTA 3PN7B 1SW8A 4TNCA 1KWOC 1N0YA 3SIBA 3H4SE 1RTP1 1V1FA 1B47A 1BMOA 1SMGA 2LHLA 1DJXA 2DOQA 3M0WA 1V1GA 1LXFC 4CFQA 3JVTC 5IBWA 5CSNA 1Y1UA 1ZACA 3DVJA 4PE1A 2LUXA 5DKNA 1RK9A 1MXEA 1QXPA 1FI6A 1LVCD 3D0YB 5AXIA 1LKJA 1QV1A 3PSRA 1Y0VH 2EHBA 1AVSA 3TDZA 2NXQA 2JT8A 4C0LA 3LL8B 2TN4A 4MRYA 1JWDA 3D10A 1EL4A 1LA0A 4ICBA 1FBVA 2WNDA 5B8IB 1DT7B 1B8RA 1NIWA 5PALA 3EVUA 5JOLA 3C1VA 5G08A 4Q04A 1IH0A 1G33A 4M2OA 1KFXS 2CXJA 4A4CA 3BUNB 2WCBA 1YVLA 1J7PA 3DVMA 1MHOA 4MZLA 2KBMA 1B8LA 1NCZA 3IF7A 2M7NA 1M31A 3FWBA 4A4BA 4YI8A 3PFVA 1QVIZ 2BCBA 1F55A 2MLEC 4XJKB 2NCPA 5KU1A 1A4PA 1TNXA 1SNLA 1YUTA 3LK0A 4HSZA 1WLMA 3RM1A 3KHEA 1UURA 2BL0C 3A4UB 3GOFA 4PALA 3ICBA 1UUSA 5HKZA 3VRQA 3EK7A 2KI4C 2LVKA 1RROA 1EG4A 2JWWA 4U8DA 3SIAA 1KQVA 5AFPA 4JQ0D 2FJUB 4QJ5B 3TUYC 1B1GA 3EK8A 1AK8A 2F2PA 1S5GZ 2HQWA 2JPTA 1A2XA 2LUCA 1MWNA 4MRXA 4YBHB 5DKQA 3PALA 4GFTA 1YRUB 1SPYA 1FF1A 2EC6C 1XFUO 1IG5A 1JBAA 1NWDA 4PE4A 4ORAB 2KSPA 4OVNF 2MRDA 2K7OA 4C0JA 5GQQC 2WCEA 1Y1AA 2ZNDA 3RLZA 4NDBA 1X02A 4DUQA 3I5HB 2V53A 1JF2A 5CSIA 4MEWA 1NX3A 1J7QA 5I2OA 1B8CA 4WQ3A 1EJ3A 1RECA 1ZOTB 2E6WA 2F3YA 1CMGA 3WHUB 1TNQA 1KQMB 4OCIA 1UWOA 1TNWA 3IQQA 1EXRA 1QATA 3VRRA 3K21A 1A75B 2MJWB 1YX7A 1J1DA 1AP4A 2K8MB 1OZOA 1LA3A 1K8UA 1L2OC 1S6IA 2M1KB 1WY9A 1QIVA 3JTDC 3OB1B 3BUOB 1BLQA 1C7WA 1DVIA 1PULA 1R2UA 3VRNA 4BY4A 2KGBC 4E68A 1M63B 1MF8B 3BYAA 2ZNEA 2LCPA 1EH2A 4R1EA 3NSLA 4FQOA 1JF0A 2KI6D 3TS5C 1BODA 1R6PA 1KFUS 2ZFDA 4PE0A 2LHIA 1BOCA 1K96A 2WC8A 4XJKA 1QV0A 1CM4A 2BE6A 2AMIA 1OOJA 1KK8B 2I94A 1ZUZA 4PHJA 2LM5A 2MHHA 3BOWA 2KAXA 2FCDA 5BPJA 5HYDA 4QJ4B 3CTNA 3DD4A 2COLB 3TS5B 2KOTA 2M3WA 3AAKA 4P2YB 2KGRA 2O5GA 1NCYA 1UHHA 1KSOA 3VGOA 4MZJA 2K61A 4UPGA 2IS9A 3PATA 2OS8C 1YTZC 1IJ6A 1ZMZA 2LMVA 3I5FC 3WHTB 2LV7A 3OHMB 4MN0A 4YGCB 3O4YA 1TRFA 4CFRA 4DCKA 3AAJA 3CGAA 2M9GA 2LLTA 1BT6A 1QVIY 2PASA 4GNKB 2FOTA 1WLZA 1IJ5A 1PRWA 4PHKA 2JOJA 4DIRA 3I5GB 4OKHA 1F54A 1PSBA 4CIDA 1BG1A 2PRUA 1BR1B 1SY9A 1RJVA 4USLA 2JQ6A 5I2LA 2AUCA 2L4HA 4HRHA 1CDNA 2PVBA 3JVTB 2M97A 3CR4X 3HX4A 5I8NA 2CNPA 2L98A 4N5XA 5FYXA 1SRAA 3VRPA 5HLVA 2KI6C 1CB1A 1Q80A 2WCFA 3CLNA 1MXLC 1JSAA 1B7TY 1U5IA 1IRJA 4GUKA 2Q91A 3EK4A 1K93D 1UHJA 1Y1XA 1PK0D 1CDMA 3O6BA 1XFYO 4PHMA 3E3RA 3KF9A 4HREE 2KYFA 1UP5A 2KDHA 1N2DA 2R2IA 1L7ZA 3O78A 4F0ZB 3GK1A 1YUUA 2AAOA 4AOMA 5CSFA 2HF5A 1DF0B 1BJFA 3SG5A 1XK4A 4NDCA 4YGBB 3OB2B 2E30A 1K9UA 1SR6B 1B9AA 2PSRA 2ZN9A 3EKJA 2CBLA 1XK4C 1SL8A 4GBAA 2JC2A 2GGZA 2JTZA 3F45A 2BKIB 1YURA 4PHNA 1YVHA 4N1FA 1YX8A 1RFJA 1OE9B 2I7AA 2JTTA 3NXAA 3OP0A 1S26D 2KYCA 3BOWB 4AQJA 1QTXA 4ZCVA 2Y5IA 4D1EA 2G9BA 4ORBB 1OZSA 1DJGA 1ALVA 1EG3A 4P5OE 1BF5A 5TNCA 2ZRSA 1CFFA 1F70A 2M1UA 3A8RA 1U5IB 1J55A 3TDIA 2LP2A 1ALWA 1SCMB 2MLFC 4OR9B 1XYDA 5ER5A 1WRLA 4GAOA 4I5NB 3AKAA 1RWYA 1QASA 1SK6D 1QS7A 2QACA 1DTLA 3EVRA 2KAYA 1DJYA 2LAPA 3AKBA 4MSPA 4MZKA 1HQVA 5DKRA 2K7BA 1UHNA 3SJSA 1DJZA 1KK7Z 2H61C 4DS7A 3KPXA 3SG2A 5HKWA 1S36A 2L4IA 2JNXA 3BXKA 1D1OA 1K90D 2JULA 1CFPA 4PCWA 2JT0A 2B1UA 1NCXA 1CDLA 1JFJA 2K2AA 2LVVA 4MLWA 4YGDB 2WORA 3JTDB 1YRTB 1XVJA 4AQIA 5KSZA 4I5JA 4YGEB 2M49B 4GGNA 1TCOB 2BE4A 3KO0A 2ZRTA 2K0JA 1DGUA 1KWOB 2OS8B 1TN4A 2CCMA 1DF0A 2KQYA 3OX6A 1H8BA 2BECA 2OTGC 4QJ3B 2MA2A 1FI5A 3BUMB 1AUIB 2KAVA 2NLNA 1XFWO 4HRGA 1M39A 2LNKA 1FPWA 4PE7A 5F6TA 2HQ8A 2Q4UA 1C7VA 1KFUL 1S6JA 1NSHA 2ZKMX 3BUXB 2LLSA 1PVBA 3DF0A 2D8NA 2QPTA 1TOPA 1NPQA 1KQMC 4L9MA 4M2QA 1CKKA 4GGFC 2LLUA 1DJHA 1S3PA 1M46A 1NP8A 1J7RA 1OQPA 1AJ5A 2EC6B 2EGDA 1IQ5A 2ISDA 2JRFA 4WRIA 1AHRA 1QIWA 3ZWHA 1CLLA 1WRZA 1XO5A 4YRUA 1XFZO 1E8AA 2LVJA 2Y1NA 3O2PA 1LINA 1OMDA 4BY5A 2KBIA 3IQOA 1DJIA 2MAZA 1OMVA 3CR2A 5AANA 3TDUA 2JU0A 4JWQA 1KFXL 2FCEA 3TZ1A 2I2RE 2RGIA 2K7DA 1F4OA 5I2QA 1S6CA 2KFFA 2JZIA 3LK1A 3CWGA 2M7LA 4ZCUA 2GGMA 1DMOA 2H2KA 5D69A 1NX0A 1FW4A 4CPVA 3TUYB 1J7OA 1L2OB 3SG6A 1H4BA 2VRGA 3FIAA 2LMUA 3NSKA 1XA5A 1CM1A 2L50A 1PSRA 3NSOA 4M2PA 1XFVO 2BBNA 2H61A 5HLOA 3BUWB 4XYNA 2NCOA 1CFDA 1UHKA 1QX7A 4FTGA 2M0RA 1G8IA 1ODBA 2KQ6A 4GPLB 1B7TZ 1WRKA 2K2FA 2O60A 1QLKA 1IQ3A 1OMRA 1G4YR 4IL1A 2BL0B 2BCXA 3EKHA 5JJGA 3QRXA 1TIZA 1SKTA 2NZ0A 3FS7A 2KFHA 1GGZA 2OPOA 4NQGA 3ZNIA 1YR5A 1WDCB 1DGVA 1KSMA 1NUBA 1GQMA 1K9PA 2OTGB 3PM8A 4GGFA 2KI4B 3MSEB 1OSAA 2F2OA 2L5XB 2L0PA 3PN7C 5CPVA 1CTRA 3GK4X 5ER4X 2PALA 3EVVA 2P6BB 1KCYA 2M29A 1BU3A 3BQ3A 3I5FB 3KEVA 3SG3A 1CFCA 1TTXA 1VRKA 1Y6WA 1SL7A 1PALA 1SYMA 1SBJA 4YGAA 2L51A 1W7JB 2A4JA 5HKYA 4WQ2A 1DJWA 1TCFA 2LC5A 4NDDA 3WXAA 4MVFA 5K89A 3OX5A 2JT3A 3D0YA 2MBXA 1NYAA 3SG4A 4DRWA 1IWQA 3SG7A 2CT9A 2Y1MA 3GK2A 4OV2A 1AJ4A 5CSJA 1SR6C 1SCMC 4CLNA 1W7IB 1K9KA 1QLSA 5KTYA 1IKUA 2BBMA 3WNXB 1A75A 2L2EA 3CS1A 4YI9A 1J1EA 1S5GY 3LLEA 1A29A 1CLMA 1S1EA 2PMYA 1F8HA 3HCMA 4ETOA 1B4CA 4PDZA 1SL9A 3VROA 2F8PA 3PLFB 3NSIA 1MUXA 2SASA 2ZN8A 1UHIA 3LCPC 1BR4B 2JNFA 3I5IB 1QX2A 1CMFA 4C0KA 1M45A 1CLBA 2M8UA 1CNPA 3I5HC 1K95A 1QJTA 1WDCC 1PVAA 4MBEA 5AEQA 3FWCA 1JFKA 1HT9A 1KK8C 2I18A 1K94A 2F3ZA 1A03A 1GGWA 3DF0B 5J3XA 1N65A 3I5GC 1F71A 2KFGA 4N1GA 1K2HA 2BCAA 2K7CA 2LE9B 2KHNA 1XFXO 3DVKA 2LANA 5D7FA 2GV5A 1QX5B 1NX1A 2Y4QA 2HPSA 2LP3A 1KK7Y 3I5IC 1IGVA 1C07A 1MQ1A 1ZFSA 2SCPA 1JUOA 1JC2A 2KNEA 1GJYA 1NX2A 1F4QA 5AERA 2WOSA 2HETA 2JXCA 4I5LB
chains in the Genus database with same CATH superfamily
3L4LA 1SCVA 2CTNA 3CZTX 3CR5X 2F33A 4JPZB 3DVEA 3BFHA 2LVIA 4I5KA 2BKHB 5FI2A 2G2BA 4ORCB 1TNPA 2JXLA 1MR8A 1YUSA 1CDPA 2LMTA 3PN7B 1SW8A 4TNCA 1KWOC 1N0YA 3SIBA 3H4SE 1RTP1 1V1FA 1B47A 1BMOA 1SMGA 2LHLA 1DJXA 2DOQA 3M0WA 3FE6A 1V1GA 2QEOA 1LXFC 4CFQA 3JVTC 5IBWA 5CSNA 1Y1UA 1ZACA 3DVJA 4PE1A 2LUXA 5DKNA 1RK9A 3B88A 1MXEA 1QXPA 1FI6A 1LVCD 3D0YB 5AXIA 1LKJA 1QV1A 3PSRA 1Y0VH 3S0EA 2EHBA 1AVSA 3TDZA 2NXQA 2QDIA 2JT8A 4C0LA 3S0GA 3LL8B 2TN4A 4MRYA 3UO9A 1JWDA 3D10A 1EL4A 1LA0A 4ICBA 1FBVA 2QEHA 2WNDA 5B8IB 1DT7B 1B8RA 1NIWA 5PALA 3D74A 3EVUA 5JOLA 3C1VA 5G08A 4Q04A 5DICA 1IH0A 1G33A 4M2OA 1KFXS 2CXJA 4A4CA 3BUNB 2WCBA 1YVLA 1J7PA 3D73A 3DVMA 1MHOA 4MZLA 3SS5A 2KBMA 1B8LA 1NCZA 3IF7A 2M7NA 1M31A 4PT1A 3FWBA 4A4BA 4YI8A 3PFVA 1QVIZ 2BCBA 1F55A 2MLEC 2ERBA 4XJKB 2NCPA 3OGNA 1A4PA 3PM2A 5KU1A 1TNXA 1SNLA 3R1OA 1YUTA 3LK0A 4HSZA 1WLMA 3RM1A 3KHEA 1UURA 2BL0C 3A4UB 3GOFA 4PALA 1OOGA 3ICBA 1UUSA 3B87A 5HKZA 3VRQA 3EK7A 2KI4C 2LVKA 1RROA 1EG4A 2JWWA 3FE8A 4U8DA 3SIAA 1KQVA 5AFPA 4JQ0D 2FJUB 2P71A 4QJ5B 3TUYC 3EK8A 3NHTA 2F2PA 1AK8A 1B1GA 1S5GZ 2HQWA 2JPTA 2WCJA 1A2XA 2LUCA 3R72A 1MWNA 3D78A 4MRXA 4YBHB 5DKQA 3PALA 4GFTA 1YRUB 1SPYA 1FF1A 2EC6C 1XFUO 1IG5A 1JBAA 2WC5A 1NWDA 4PE4A 4ORAB 2KSPA 3DY9A 4OVNF 2MRDA 1C3YA 2K7OA 4C0JA 5GQQC 2WCEA 1Y1AA 2ZNDA 3RLZA 4NDBA 4IJ7A 1X02A 4DUQA 3I5HB 2V53A 1JF2A 5CSIA 4MEWA 1NX3A 1J7QA 1DC1A 5I2OA 1B8CA 4WQ3A 3CZ1A 1EJ3A 1RECA 1ZOTB 2E6WA 2F3YA 1CMGA 3WHUB 1P28A 1KQMB 1TNQA 4OCIA 1TUZA 1UWOA 1TNWA 3IQQA 1EXRA 1QATA 3NGVA 3K21A 3VRRA 1A75B 2MJWB 1YX7A 3K1EA 1J1DA 1AP4A 2K8MB 1OZOA 1DQEA 1K8UA 1L2OC 1LA3A 1S6IA 1WY9A 1QIVA 2M1KB 3JTDC 3BUOB 3OB1B 1BLQA 1C7WA 3S0BA 1DVIA 1PULA 1R2UA 3VRNA 4BY4A 2KGBC 4E68A 1M63B 1MF8B 3BYAA 1Z4HA 2ZNEA 2LCPA 5FI7A 1ORGA 1EH2A 2BNXA 4R1EA 3NSLA 4INWA 4FQOA 1JF0A 2KI6D 4KYNA 3TS5C 1BODA 1R6PA 1KFUS 3BJHA 2ZFDA 4PE0A 2LHIA 1BOCA 1K96A 2WC8A 4XJKA 1QV0A 1CM4A 2BE6A 2AMIA 1OOJA 2I94A 2QEVA 1ZUZA 4PHJA 2LM5A 3SS3A 2MHHA 3BOWA 2KAXA 2FCDA 3BFAA 5BPJA 5HYDA 4QJ4B 3CTNA 3DD4A 2COLB 3TS5B 2KOTA 2M3WA 3AAKA 4P2YB 2KGRA 2O5GA 1NCYA 1UHHA 1KSOA 3VGOA 4MZJA 2K61A 4UPGA 1W9ZA 2IS9A 3PATA 2OS8C 1YTZC 1IJ6A 1ZMZA 2LMVA 3I5FC 3WHTB 1QWVA 2LV7A 3OHMB 4MN0A 4YGCB 3O4YA 1TRFA 4CFRA 4DCKA 3AAJA 3CGAA 2M9GA 3FE9A 2LLTA 3R1PA 1BT6A 1QVIY 2PASA 4GNKB 2FOTA 1WLZA 1IJ5A 1PRWA 4PHKA 2JOJA 4DIRA 3I5GB 4OKHA 3D76A 1F54A 1Z2CB 1PSBA 4CIDA 1BG1A 2PRUA 1BR1B 1SY9A 2WCLA 1RJVA 4USLA 2JQ6A 3L4AA 5I2LA 2AUCA 2L4HA 4HRHA 1CDNA 2JPOA 2PVBA 4F7FA 3JVTB 2M97A 3CR4X 3DZTA 3HX4A 5I8NA 2CNPA 2L98A 4N5XA 4OZDA 1OW4A 3Q8IA 5FYXA 1SRAA 2WCMA 3VRPA 2KLDA 4JKTA 5HLVA 2KI6C 1CB1A 1Q80A 2WCFA 3CLNA 1MXLC 1JSAA 1B7TY 1U5IA 1IRJA 3B7AA 4GUKA 2Q91A 3EK4A 1K93D 1UHJA 1Y1XA 1PK0D 1CDMA 2QEBA 1XFYO 3O6BA 4PHMA 3E3RA 3KF9A 4HREE 5D3OA 2KYFA 1UP5A 2KDHA 1LS8A 1N2DA 2R2IA 1L7ZA 3O78A 4F0ZB 3GK1A 1YUUA 2AAOA 4AOMA 5CSFA 2HF5A 1DF0B 1BJFA 3SG5A 1XK4A 4NDCA 4YGBB 2L5YA 3OB2B 2E30A 1K9UA 1SR6B 1B9AA 2PSRA 2ZN9A 3CABA 3EKJA 2CBLA 1XK4C 1SL8A 4GBAA 2JC2A 2GGZA 2JTZA 3F45A 2BKIB 1YURA 4PHNA 1YVHA 4N1FA 1YX8A 1DEKA 1RFJA 1OE9B 2I7AA 2JTTA 3NXAA 2WCKA 3OP0A 1S26D 2KYCA 3BOWB 4AQJA 1QTXA 4ZCVA 2Y5IA 4D1EA 2G9BA 4ORBB 1OZSA 1DJGA 1ALVA 1EG3A 1OOHA 4P5OE 5TNCA 1BF5A 2P70A 2ZRSA 1CFFA 1F70A 1TWOA 2M1UA 3A8RA 1U5IB 2L2CA 1J55A 3TDIA 2LP2A 1ALWA 1SCMB 2MLFC 4OR9B 1XYDA 5ER5A 1WRLA 4GAOA 4I5NB 3AKAA 1RWYA 1QASA 1SK6D 1QS7A 2QACA 1DTLA 3EVRA 2KAYA 1DJYA 2LAPA 3AKBA 4FQTA 4MSPA 4MZKA 1HQVA 3VB1A 5DKRA 2K7BA 1UHNA 3SJSA 1DJZA 1KK7Z 2H61C 4DS7A 3KPXA 3SG2A 5HKWA 1S36A 2L4IA 2JNXA 3BXKA 1D1OA 1K90D 2JULA 1CFPA 4PCWA 2JT0A 2B1UA 1NCXA 4INXA 1CDLA 3DXLA 1JFJA 2K2AA 2LVVA 4MLWA 4YGDB 2WORA 3JTDB 1YRTB 1XVJA 2K60A 4AQIA 5KSZA 3B6XA 4I5JA 4YGEB 2M49B 4GGNA 1TCOB 2BE4A 3KO0A 2HETA 1SSEB 2K0JA 1DGUA 2BAPA 2ZRTA 1KWOB 2OS8B 1TN4A 2PYQA 2CCMA 1DF0A 2KQYA 3OX6A 2PQLA 1GM0A 1H8BA 2BECA 3N7HA 2OTGC 3BFBA 3EG5B 2MA2A 4QJ3B 1FI5A 3BUMB 1AUIB 2KAVA 2NLNA 1XFWO 4HRGA 1M39A 2LNKA 3SS4A 1FPWA 4PE7A 5F6TA 2HQ8A 2Q4UA 1C7VA 1C3ZA 1KFUL 1S6JA 1NSHA 2ZKMX 3BUXB 2LLSA 1PVBA 3DF0A 2D8NA 2QPTA 1TOPA 1NPQA 3R1VA 1KQMC 4L9MA 3IVTA 4M2QA 1CKKA 4GGFC 2LLUA 1DJHA 1S3PA 1M46A 1NP8A 1J7RA 1OQPA 3L47A 1AJ5A 2EC6B 2EGDA 2GTEA 3CZ2A 1IQ5A 2ISDA 2KLEA 2JRFA 4WRIA 1AHRA 1QIWA 3ZWHA 1CLLA 1WRZA 1XO5A 4YRUA 1XFZO 1E8AA 2LVJA 2Y1NA 3O2PA 1LINA 1IIOA 1OMDA 4BY5A 2KBIA 3IQOA 1DJIA 2MAZA 1OMVA 3CR2A 5AANA 3TDUA 2JU0A 4JWQA 1KFXL 2FCEA 3TZ1A 2I2RE 2RGIA 2K7DA 1F4OA 5I2QA 1S6CA 2KFFA 2JZIA 3LK1A 3CWGA 2M7LA 4ZCUA 2GGMA 1DMOA 2H2KA 5D69A 1NX0A 1FW4A 4CPVA 3TUYB 3S0FA 1J7OA 1L2OB 3SG6A 1H4BA 2VRGA 4JD9A 3FIAA 2LMUA 3NSKA 1XA5A 1CM1A 2L50A 1PSRA 3NSOA 3NHIA 4M2PA 3CYZA 1XFVO 2BBNA 2H61A 5HLOA 3BUWB 4XYNA 2NCOA 1CFDA 1UHKA 1QX7A 4FTGA 2M0RA 1G8IA 1ODBA 2KQ6A 4GPLB 1B7TZ 1WRKA 2K2FA 2O60A 1QLKA 1IQ3A 1OMRA 1G4YR 4IL1A 2BL0B 5HL1A 2BCXA 3EKHA 5JJGA 3QRXA 1TIZA 1SKTA 2NZ0A 3FS7A 3S0DA 2KFHA 1GGZA 2OPOA 4NQGA 5EL2A 3ZNIA 1YR5A 1WDCB 1DGVA 1OOFA 1KSMA 1NUBA 1GQMA 1K9PA 2H8VA 2OTGB 3PM8A 4GGFA 2KI4B 3MSEB 3CZ0A 1OSAA 2F2OA 2L5XB 2L0PA 3PN7C 5CPVA 1CTRA 1OOIX 3GK4X 2PALA 3EVVA 5ER4X 2P6BB 3D77A 3DYEA 1KCYA 2M29A 1BU3A 3BQ3A 3I5FB 3KEVA 3SG3A 1CFCA 1TTXA 1VRKA 1Y6WA 1SL7A 1PALA 1SYMA 5FI6A 1SBJA 4YGAA 2L51A 1W7JB 2A4JA 5HKYA 4WQ2A 1DJWA 1TCFA 2LC5A 4NDDA 3WXAA 4MVFA 2FJYA 5K89A 1TUJA 3OX5A 2JT3A 3D0YA 2MBXA 5I94A 1NYAA 3SG4A 4DRWA 1IWQA 3SG7A 2CT9A 2Y1MA 3S0AA 3GK2A 4OV2A 1XFRA 1AJ4A 5CSJA 1SR6C 1SCMC 4CLNA 1W7IB 1K9KA 1QLSA 5KTYA 1IKUA 2BBMA 3WNXB 1A75A 2L2EA 3CS1A 4YI9A 1J1EA 1S5GY 3D75A 3LLEA 1A29A 1CLMA 1S1EA 2PMYA 1F8HA 3HCMA 4ETOA 3PJIA 1B4CA 3O4XA 1SL9A 4PDZA 2F8PA 3VROA 3QMEA 3PLFB 3NSIA 1MUXA 2SASA 2ZN8A 1UHIA 3LCPC 1BR4B 2JNFA 3I5IB 1QX2A 1CMFA 4C0KA 1M45A 1CLBA 2M8UA 1CNPA 3I5HC 1K95A 3OBVA 1QJTA 1DELA 2KPHA 1WDCC 1PVAA 4MBEA 5AEQA 3UNWA 3FWCA 1JFKA 1HT9A 1KK8C 3B86A 2I18A 1K94A 2F3ZA 2WC6A 1A03A 1GGWA 3DF0B 5J3XA 1N65A 3I5GC 1F71A 2KFGA 4N1GA 1K2HA 2BCAA 1T14A 2K7CA 2LE9B 2KHNA 1XFXO 3DVKA 2LANA 5D7FA 2GV5A 1QX5B 1NX1A 2Y4QA 2HPSA 2LP3A 1KK7Y 3I5IC 1IGVA 1C07A 1MQ1A 3CDNA 1ZFSA 3V2LA 2SCPA 1JUOA 1JC2A 2KNEA 1GJYA 1NX2A 1F4QA 2YGUA 5AERA 3RZSA 2WOSA 2WCHA 1KK8B 2JXCA 4I5LB
chains in the Genus database with same CATH topology
1SCVA 2CTNA 3CZTX 3CR5X 2F33A 4JPZB 3DVEA 4I5KA 2LVIA 2BKHB 2G2BA 4ORCB 1TNPA 2JXLA 1MR8A 1YUSA 1CDPA 2LMTA 3PN7B 1SW8A 4TNCA 1KWOC 1N0YA 3SIBA 3H4SE 1RTP1 1V1FA 1B47A 1BMOA 1SMGA 2LHLA 1DJXA 2DOQA 3M0WA 1V1GA 1LXFC 4CFQA 3JVTC 5IBWA 5CSNA 1Y1UA 1ZACA 3DVJA 4PE1A 2LUXA 5DKNA 1RK9A 1MXEA 1QXPA 1FI6A 1LVCD 3D0YB 5AXIA 1LKJA 1QV1A 3PSRA 1Y0VH 2EHBA 1AVSA 3TDZA 2NXQA 2JT8A 4C0LA 3LL8B 2TN4A 4MRYA 1JWDA 3D10A 1EL4A 1LA0A 4ICBA 1FBVA 2WNDA 5B8IB 1DT7B 1B8RA 1NIWA 5PALA 3EVUA 5JOLA 3C1VA 5G08A 4Q04A 1IH0A 1G33A 4M2OA 1KFXS 2CXJA 4A4CA 3BUNB 2WCBA 1YVLA 1J7PA 3DVMA 1MHOA 4MZLA 2KBMA 1B8LA 1NCZA 3IF7A 2M7NA 1M31A 3FWBA 4A4BA 4YI8A 3PFVA 1QVIZ 2BCBA 1F55A 2MLEC 4XJKB 2NCPA 5KU1A 1A4PA 1TNXA 1SNLA 1YUTA 3LK0A 4HSZA 1WLMA 3RM1A 3KHEA 1UURA 2BL0C 3A4UB 3GOFA 4PALA 3ICBA 1UUSA 5HKZA 3VRQA 3EK7A 2KI4C 2LVKA 1RROA 1EG4A 2JWWA 4U8DA 3SIAA 1KQVA 5AFPA 4JQ0D 2FJUB 4QJ5B 3TUYC 1B1GA 3EK8A 1AK8A 2F2PA 1S5GZ 2HQWA 2JPTA 1A2XA 2LUCA 1MWNA 4MRXA 4YBHB 5DKQA 3PALA 4GFTA 1YRUB 1SPYA 1FF1A 2EC6C 1XFUO 1IG5A 1JBAA 1NWDA 4PE4A 4ORAB 2KSPA 4OVNF 2MRDA 2K7OA 4C0JA 5GQQC 2WCEA 1Y1AA 2ZNDA 3RLZA 4NDBA 1X02A 4DUQA 3I5HB 2V53A 1JF2A 5CSIA 4MEWA 1NX3A 1J7QA 5I2OA 1B8CA 4WQ3A 1EJ3A 1RECA 1ZOTB 2E6WA 2F3YA 1CMGA 3WHUB 1TNQA 1KQMB 4OCIA 1UWOA 1TNWA 3IQQA 1EXRA 1QATA 3VRRA 3K21A 1A75B 2MJWB 1YX7A 1J1DA 1AP4A 2K8MB 1OZOA 1LA3A 1K8UA 1L2OC 1S6IA 2M1KB 1WY9A 1QIVA 3JTDC 3OB1B 3BUOB 1BLQA 1C7WA 1DVIA 1PULA 1R2UA 3VRNA 4BY4A 2KGBC 4E68A 1M63B 1MF8B 3BYAA 2ZNEA 2LCPA 1EH2A 4R1EA 3NSLA 4FQOA 1JF0A 2KI6D 3TS5C 1BODA 1R6PA 1KFUS 2ZFDA 4PE0A 2LHIA 1BOCA 1K96A 2WC8A 4XJKA 1QV0A 1CM4A 2BE6A 2AMIA 1OOJA 1KK8B 2I94A 1ZUZA 4PHJA 2LM5A 2MHHA 3BOWA 2KAXA 2FCDA 5BPJA 5HYDA 4QJ4B 3CTNA 3DD4A 2COLB 3TS5B 2KOTA 2M3WA 3AAKA 4P2YB 2KGRA 2O5GA 1NCYA 1UHHA 1KSOA 3VGOA 4MZJA 2K61A 4UPGA 2IS9A 3PATA 2OS8C 1YTZC 1IJ6A 1ZMZA 2LMVA 3I5FC 3WHTB 2LV7A 3OHMB 4MN0A 4YGCB 3O4YA 1TRFA 4CFRA 4DCKA 3AAJA 3CGAA 2M9GA 2LLTA 1BT6A 1QVIY 2PASA 4GNKB 2FOTA 1WLZA 1IJ5A 1PRWA 4PHKA 2JOJA 4DIRA 3I5GB 4OKHA 1F54A 1PSBA 4CIDA 1BG1A 2PRUA 1BR1B 1SY9A 1RJVA 4USLA 2JQ6A 5I2LA 2AUCA 2L4HA 4HRHA 1CDNA 2PVBA 3JVTB 2M97A 3CR4X 3HX4A 5I8NA 2CNPA 2L98A 4N5XA 5FYXA 1SRAA 3VRPA 5HLVA 2KI6C 1CB1A 1Q80A 2WCFA 3CLNA 1MXLC 1JSAA 1B7TY 1U5IA 1IRJA 4GUKA 2Q91A 3EK4A 1K93D 1UHJA 1Y1XA 1PK0D 1CDMA 3O6BA 1XFYO 4PHMA 3E3RA 3KF9A 4HREE 2KYFA 1UP5A 2KDHA 1N2DA 2R2IA 1L7ZA 3O78A 4F0ZB 3GK1A 1YUUA 2AAOA 4AOMA 5CSFA 2HF5A 1DF0B 1BJFA 3SG5A 1XK4A 4NDCA 4YGBB 3OB2B 2E30A 1K9UA 1SR6B 1B9AA 2PSRA 2ZN9A 3EKJA 2CBLA 1XK4C 1SL8A 4GBAA 2JC2A 2GGZA 2JTZA 3F45A 2BKIB 1YURA 4PHNA 1YVHA 4N1FA 1YX8A 1RFJA 1OE9B 2I7AA 2JTTA 3NXAA 3OP0A 1S26D 2KYCA 3BOWB 4AQJA 1QTXA 4ZCVA 2Y5IA 4D1EA 2G9BA 4ORBB 1OZSA 1DJGA 1ALVA 1EG3A 4P5OE 1BF5A 5TNCA 2ZRSA 1CFFA 1F70A 2M1UA 3A8RA 1U5IB 1J55A 3TDIA 2LP2A 1ALWA 1SCMB 2MLFC 4OR9B 1XYDA 5ER5A 1WRLA 4GAOA 4I5NB 3AKAA 1RWYA 1QASA 1SK6D 1QS7A 2QACA 1DTLA 3EVRA 2KAYA 1DJYA 2LAPA 3AKBA 4MSPA 4MZKA 1HQVA 5DKRA 2K7BA 1UHNA 3SJSA 1DJZA 1KK7Z 2H61C 4DS7A 3KPXA 3SG2A 5HKWA 1S36A 2L4IA 2JNXA 3BXKA 1D1OA 1K90D 2JULA 1CFPA 4PCWA 2JT0A 2B1UA 1NCXA 1CDLA 1JFJA 2K2AA 2LVVA 4MLWA 4YGDB 2WORA 3JTDB 1YRTB 1XVJA 4AQIA 5KSZA 4I5JA 4YGEB 2M49B 4GGNA 1TCOB 2BE4A 3KO0A 2ZRTA 2K0JA 1DGUA 1KWOB 2OS8B 1TN4A 2CCMA 1DF0A 2KQYA 3OX6A 1H8BA 2BECA 2OTGC 4QJ3B 2MA2A 1FI5A 3BUMB 1AUIB 2KAVA 2NLNA 1XFWO 4HRGA 1M39A 2LNKA 1FPWA 4PE7A 5F6TA 2HQ8A 2Q4UA 1C7VA 1KFUL 1S6JA 1NSHA 2ZKMX 3BUXB 2LLSA 1PVBA 3DF0A 2D8NA 2QPTA 1TOPA 1NPQA 1KQMC 4L9MA 4M2QA 1CKKA 4GGFC 2LLUA 1DJHA 1S3PA 1M46A 1NP8A 1J7RA 1OQPA 1AJ5A 2EC6B 2EGDA 1IQ5A 2ISDA 2JRFA 4WRIA 1AHRA 1QIWA 3ZWHA 1CLLA 1WRZA 1XO5A 4YRUA 1XFZO 1E8AA 2LVJA 2Y1NA 3O2PA 1LINA 1OMDA 4BY5A 2KBIA 3IQOA 1DJIA 2MAZA 1OMVA 3CR2A 5AANA 3TDUA 2JU0A 4JWQA 1KFXL 2FCEA 3TZ1A 2I2RE 2RGIA 2K7DA 1F4OA 5I2QA 1S6CA 2KFFA 2JZIA 3LK1A 3CWGA 2M7LA 4ZCUA 2GGMA 1DMOA 2H2KA 5D69A 1NX0A 1FW4A 4CPVA 3TUYB 1J7OA 1L2OB 3SG6A 1H4BA 2VRGA 3FIAA 2LMUA 3NSKA 1XA5A 1CM1A 2L50A 1PSRA 3NSOA 4M2PA 1XFVO 2BBNA 2H61A 5HLOA 3BUWB 4XYNA 2NCOA 1CFDA 1UHKA 1QX7A 4FTGA 2M0RA 1G8IA 1ODBA 2KQ6A 4GPLB 1B7TZ 1WRKA 2K2FA 2O60A 1QLKA 1IQ3A 1OMRA 1G4YR 4IL1A 2BL0B 2BCXA 3EKHA 5JJGA 3QRXA 1TIZA 1SKTA 2NZ0A 3FS7A 2KFHA 1GGZA 2OPOA 4NQGA 3ZNIA 1YR5A 1WDCB 1DGVA 1KSMA 1NUBA 1GQMA 1K9PA 2OTGB 3PM8A 4GGFA 2KI4B 3MSEB 1OSAA 2F2OA 2L5XB 2L0PA 3PN7C 5CPVA 1CTRA 3GK4X 5ER4X 2PALA 3EVVA 2P6BB 1KCYA 2M29A 1BU3A 3BQ3A 3I5FB 3KEVA 3SG3A 1CFCA 1TTXA 1VRKA 1Y6WA 1SL7A 1PALA 1SYMA 1SBJA 4YGAA 2L51A 1W7JB 2A4JA 5HKYA 4WQ2A 1DJWA 1TCFA 2LC5A 4NDDA 3WXAA 4MVFA 5K89A 3OX5A 2JT3A 3D0YA 2MBXA 1NYAA 3SG4A 4DRWA 1IWQA 3SG7A 2CT9A 2Y1MA 3GK2A 4OV2A 1AJ4A 5CSJA 1SR6C 1SCMC 4CLNA 1W7IB 1K9KA 1QLSA 5KTYA 1IKUA 2BBMA 3WNXB 1A75A 2L2EA 3CS1A 4YI9A 1J1EA 1S5GY 3LLEA 1A29A 1CLMA 1S1EA 2PMYA 1F8HA 3HCMA 4ETOA 1B4CA 4PDZA 1SL9A 3VROA 2F8PA 3PLFB 3NSIA 1MUXA 2SASA 2ZN8A 1UHIA 3LCPC 1BR4B 2JNFA 3I5IB 1QX2A 1CMFA 4C0KA 1M45A 1CLBA 2M8UA 1CNPA 3I5HC 1K95A 1QJTA 1WDCC 1PVAA 4MBEA 5AEQA 3FWCA 1JFKA 1HT9A 1KK8C 2I18A 1K94A 2F3ZA 1A03A 1GGWA 3DF0B 5J3XA 1N65A 3I5GC 1F71A 2KFGA 4N1GA 1K2HA 2BCAA 2K7CA 2LE9B 2KHNA 1XFXO 3DVKA 2LANA 5D7FA 2GV5A 1QX5B 1NX1A 2Y4QA 2HPSA 2LP3A 1KK7Y 3I5IC 1IGVA 1C07A 1MQ1A 1ZFSA 2SCPA 1JUOA 1JC2A 2KNEA 1GJYA 1NX2A 1F4QA 5AERA 2WOSA 2HETA 2JXCA 4I5LB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SCV A;  2CTN A;  3CZT X;  3CR5 X;  2F33 A;  4JPZ B;  3DVE A;  4I5K A;  2LVI A;  2BKH B;  2G2B A;  4ORC B;  1TNP A;  2JXL A;  1MR8 A;  1YUS A;  1CDP A;  2LMT A;  3PN7 B;  1SW8 A;  4TNC A;  1KWO C;  1N0Y A;  3SIB A;  3H4S E;  1RTP 1;  1V1F A;  1B47 A;  1BMO A;  1SMG A;  2LHL A;  1DJX A;  2DOQ A;  3M0W A;  1V1G A;  1LXF C;  4CFQ A;  3JVT C;  5IBW A;  5CSN A;  1Y1U A;  1ZAC A;  3DVJ A;  4PE1 A;  2LUX A;  5DKN A;  1RK9 A;  1MXE A;  1QXP A;  1FI6 A;  1LVC D;  3D0Y B;  5AXI A;  1LKJ A;  1QV1 A;  3PSR A;  1Y0V H;  2EHB A;  1AVS A;  3TDZ A;  2NXQ A;  2JT8 A;  4C0L A;  3LL8 B;  2TN4 A;  4MRY A;  1JWD A;  3D10 A;  1EL4 A;  1LA0 A;  4ICB A;  1FBV A;  2WND A;  5B8I B;  1DT7 B;  1B8R A;  1NIW A;  5PAL A;  3EVU A;  5JOL A;  3C1V A;  5G08 A;  4Q04 A;  1IH0 A;  1G33 A;  4M2O A;  1KFX S;  2CXJ A;  4A4C A;  3BUN B;  2WCB A;  1YVL A;  1J7P A;  3DVM A;  1MHO A;  4MZL A;  2KBM A;  1B8L A;  1NCZ A;  3IF7 A;  2M7N A;  1M31 A;  3FWB A;  4A4B A;  4YI8 A;  3PFV A;  1QVI Z;  2BCB A;  1F55 A;  2MLE C;  4XJK B;  2NCP A;  5KU1 A;  1A4P A;  1TNX A;  1SNL A;  1YUT A;  3LK0 A;  4HSZ A;  1WLM A;  3RM1 A;  3KHE A;  1UUR A;  2BL0 C;  3A4U B;  3GOF A;  4PAL A;  3ICB A;  1UUS A;  5HKZ A;  3VRQ A;  3EK7 A;  2KI4 C;  2LVK A;  1RRO A;  1EG4 A;  2JWW A;  4U8D A;  3SIA A;  1KQV A;  5AFP A;  4JQ0 D;  2FJU B;  4QJ5 B;  3TUY C;  1B1G A;  3EK8 A;  1AK8 A;  2F2P A;  1S5G Z;  2HQW A;  2JPT A;  1A2X A;  2LUC A;  1MWN A;  4MRX A;  4YBH B;  5DKQ A;  3PAL A;  4GFT A;  1YRU B;  1SPY A;  1FF1 A;  2EC6 C;  1XFU O;  1IG5 A;  1JBA A;  1NWD A;  4PE4 A;  4ORA B;  2KSP A;  4OVN F;  2MRD A;  2K7O A;  4C0J A;  5GQQ C;  2WCE A;  1Y1A A;  2ZND A;  3RLZ A;  4NDB A;  1X02 A;  4DUQ A;  3I5H B;  2V53 A;  1JF2 A;  5CSI A;  4MEW A;  1NX3 A;  1J7Q A;  5I2O A;  1B8C A;  4WQ3 A;  1EJ3 A;  1REC A;  1ZOT B;  2E6W A;  2F3Y A;  1CMG A;  3WHU B;  1TNQ A;  1KQM B;  4OCI A;  1UWO A;  1TNW A;  3IQQ A;  1EXR A;  1QAT A;  3VRR A;  3K21 A;  1A75 B;  2MJW B;  1YX7 A;  1J1D A;  1AP4 A;  2K8M B;  1OZO A;  1LA3 A;  1K8U A;  1L2O C;  1S6I A;  2M1K B;  1WY9 A;  1QIV A;  3JTD C;  3OB1 B;  3BUO B;  1BLQ A;  1C7W A;  1DVI A;  1PUL A;  1R2U A;  3VRN A;  4BY4 A;  2KGB C;  4E68 A;  1M63 B;  1MF8 B;  3BYA A;  2ZNE A;  2LCP A;  1EH2 A;  4R1E A;  3NSL A;  4FQO A;  1JF0 A;  2KI6 D;  3TS5 C;  1BOD A;  1R6P A;  1KFU S;  2ZFD A;  4PE0 A;  2LHI A;  1BOC A;  1K96 A;  2WC8 A;  4XJK A;  1QV0 A;  1CM4 A;  2BE6 A;  2AMI A;  1OOJ A;  1KK8 B;  2I94 A;  1ZUZ A;  4PHJ A;  2LM5 A;  2MHH A;  3BOW A;  2KAX A;  2FCD A;  5BPJ A;  5HYD A;  4QJ4 B;  3CTN A;  3DD4 A;  2COL B;  3TS5 B;  2KOT A;  2M3W A;  3AAK A;  4P2Y B;  2KGR A;  2O5G A;  1NCY A;  1UHH A;  1KSO A;  3VGO A;  4MZJ A;  2K61 A;  4UPG A;  2IS9 A;  3PAT A;  2OS8 C;  1YTZ C;  1IJ6 A;  1ZMZ A;  2LMV A;  3I5F C;  3WHT B;  2LV7 A;  3OHM B;  4MN0 A;  4YGC B;  3O4Y A;  1TRF A;  4CFR A;  4DCK A;  3AAJ A;  3CGA A;  2M9G A;  2LLT A;  1BT6 A;  1QVI Y;  2PAS A;  4GNK B;  2FOT A;  1WLZ A;  1IJ5 A;  1PRW A;  4PHK A;  2JOJ A;  4DIR A;  3I5G B;  4OKH A;  1F54 A;  1PSB A;  4CID A;  1BG1 A;  2PRU A;  1BR1 B;  1SY9 A;  1RJV A;  4USL A;  2JQ6 A;  5I2L A;  2AUC A;  2L4H A;  4HRH A;  1CDN A;  2PVB A;  3JVT B;  2M97 A;  3CR4 X;  3HX4 A;  5I8N A;  2CNP A;  2L98 A;  4N5X A;  5FYX A;  1SRA A;  3VRP A;  5HLV A;  2KI6 C;  1CB1 A;  1Q80 A;  2WCF A;  3CLN A;  1MXL C;  1JSA A;  1B7T Y;  1U5I A;  1IRJ A;  4GUK A;  2Q91 A;  3EK4 A;  1K93 D;  1UHJ A;  1Y1X A;  1PK0 D;  1CDM A;  3O6B A;  1XFY O;  4PHM A;  3E3R A;  3KF9 A;  4HRE E;  2KYF A;  1UP5 A;  2KDH A;  1N2D A;  2R2I A;  1L7Z A;  3O78 A;  4F0Z B;  3GK1 A;  1YUU A;  2AAO A;  4AOM A;  5CSF A;  2HF5 A;  1DF0 B;  1BJF A;  3SG5 A;  1XK4 A;  4NDC A;  4YGB B;  3OB2 B;  2E30 A;  1K9U A;  1SR6 B;  1B9A A;  2PSR A;  2ZN9 A;  3EKJ A;  2CBL A;  1XK4 C;  1SL8 A;  4GBA A;  2JC2 A;  2GGZ A;  2JTZ A;  3F45 A;  2BKI B;  1YUR A;  4PHN A;  1YVH A;  4N1F A;  1YX8 A;  1RFJ A;  1OE9 B;  2I7A A;  2JTT A;  3NXA A;  3OP0 A;  1S26 D;  2KYC A;  3BOW B;  4AQJ A;  1QTX A;  4ZCV A;  2Y5I A;  4D1E A;  2G9B A;  4ORB B;  1OZS A;  1DJG A;  1ALV A;  1EG3 A;  4P5O E;  1BF5 A;  5TNC A;  2ZRS A;  1CFF A;  1F70 A;  2M1U A;  3A8R A;  1U5I B;  1J55 A;  3TDI A;  2LP2 A;  1ALW A;  1SCM B;  2MLF C;  4OR9 B;  1XYD A;  5ER5 A;  1WRL A;  4GAO A;  4I5N B;  3AKA A;  1RWY A;  1QAS A;  1SK6 D;  1QS7 A;  2QAC A;  1DTL A;  3EVR A;  2KAY A;  1DJY A;  2LAP A;  3AKB A;  4MSP A;  4MZK A;  1HQV A;  5DKR A;  2K7B A;  1UHN A;  3SJS A;  1DJZ A;  1KK7 Z;  2H61 C;  4DS7 A;  3KPX A;  3SG2 A;  5HKW A;  1S36 A;  2L4I A;  2JNX A;  3BXK A;  1D1O A;  1K90 D;  2JUL A;  1CFP A;  4PCW A;  2JT0 A;  2B1U A;  1NCX A;  1CDL A;  1JFJ A;  2K2A A;  2LVV A;  4MLW A;  4YGD B;  2WOR A;  3JTD B;  1YRT B;  1XVJ A;  4AQI A;  5KSZ A;  4I5J A;  4YGE B;  2M49 B;  4GGN A;  1TCO B;  2BE4 A;  3KO0 A;  2ZRT A;  2K0J A;  1DGU A;  1KWO B;  2OS8 B;  1TN4 A;  2CCM A;  1DF0 A;  2KQY A;  3OX6 A;  1H8B A;  2BEC A;  2OTG C;  4QJ3 B;  2MA2 A;  1FI5 A;  3BUM B;  1AUI B;  2KAV A;  2NLN A;  1XFW O;  4HRG A;  1M39 A;  2LNK A;  1FPW A;  4PE7 A;  5F6T A;  2HQ8 A;  2Q4U A;  1C7V A;  1KFU L;  1S6J A;  1NSH A;  2ZKM X;  3BUX B;  2LLS A;  1PVB A;  3DF0 A;  2D8N A;  2QPT A;  1TOP A;  1NPQ A;  1KQM C;  4L9M A;  4M2Q A;  1CKK A;  4GGF C;  2LLU A;  1DJH A;  1S3P A;  1M46 A;  1NP8 A;  1J7R A;  1OQP A;  1AJ5 A;  2EC6 B;  2EGD A;  1IQ5 A;  2ISD A;  2JRF A;  4WRI A;  1AHR A;  1QIW A;  3ZWH A;  1CLL A;  1WRZ A;  1XO5 A;  4YRU A;  1XFZ O;  1E8A A;  2LVJ A;  2Y1N A;  3O2P A;  1LIN A;  1OMD A;  4BY5 A;  2KBI A;  3IQO A;  1DJI A;  2MAZ A;  1OMV A;  3CR2 A;  5AAN A;  3TDU A;  2JU0 A;  4JWQ A;  1KFX L;  2FCE A;  3TZ1 A;  2I2R E;  2RGI A;  2K7D A;  1F4O A;  5I2Q A;  1S6C A;  2KFF A;  2JZI A;  3LK1 A;  3CWG A;  2M7L A;  4ZCU A;  2GGM A;  1DMO A;  2H2K A;  5D69 A;  1NX0 A;  1FW4 A;  4CPV A;  3TUY B;  1J7O A;  1L2O B;  3SG6 A;  1H4B A;  2VRG A;  3FIA A;  2LMU A;  3NSK A;  1XA5 A;  1CM1 A;  2L50 A;  1PSR A;  3NSO A;  4M2P A;  1XFV O;  2BBN A;  2H61 A;  5HLO A;  3BUW B;  4XYN A;  2NCO A;  1CFD A;  1UHK A;  1QX7 A;  4FTG A;  2M0R A;  1G8I A;  1ODB A;  2KQ6 A;  4GPL B;  1B7T Z;  1WRK A;  2K2F A;  2O60 A;  1QLK A;  1IQ3 A;  1OMR A;  1G4Y R;  4IL1 A;  2BL0 B;  2BCX A;  3EKH A;  5JJG A;  3QRX A;  1TIZ A;  1SKT A;  2NZ0 A;  3FS7 A;  2KFH A;  1GGZ A;  2OPO A;  4NQG A;  3ZNI A;  1YR5 A;  1WDC B;  1DGV A;  1KSM A;  1NUB A;  1GQM A;  1K9P A;  2OTG B;  3PM8 A;  4GGF A;  2KI4 B;  3MSE B;  1OSA A;  2F2O A;  2L5X B;  2L0P A;  3PN7 C;  5CPV A;  1CTR A;  3GK4 X;  5ER4 X;  2PAL A;  3EVV A;  2P6B B;  1KCY A;  2M29 A;  1BU3 A;  3BQ3 A;  3I5F B;  3KEV A;  3SG3 A;  1CFC A;  1TTX A;  1VRK A;  1Y6W A;  1SL7 A;  1PAL A;  1SYM A;  1SBJ A;  4YGA A;  2L51 A;  1W7J B;  2A4J A;  5HKY A;  4WQ2 A;  1DJW A;  1TCF A;  2LC5 A;  4NDD A;  3WXA A;  4MVF A;  5K89 A;  3OX5 A;  2JT3 A;  3D0Y A;  2MBX A;  1NYA A;  3SG4 A;  4DRW A;  1IWQ A;  3SG7 A;  2CT9 A;  2Y1M A;  3GK2 A;  4OV2 A;  1AJ4 A;  5CSJ A;  1SR6 C;  1SCM C;  4CLN A;  1W7I B;  1K9K A;  1QLS A;  5KTY A;  1IKU A;  2BBM A;  3WNX B;  1A75 A;  2L2E A;  3CS1 A;  4YI9 A;  1J1E A;  1S5G Y;  3LLE A;  1A29 A;  1CLM A;  1S1E A;  2PMY A;  1F8H A;  3HCM A;  4ETO A;  1B4C A;  4PDZ A;  1SL9 A;  3VRO A;  2F8P A;  3PLF B;  3NSI A;  1MUX A;  2SAS A;  2ZN8 A;  1UHI A;  3LCP C;  1BR4 B;  2JNF A;  3I5I B;  1QX2 A;  1CMF A;  4C0K A;  1M45 A;  1CLB A;  2M8U A;  1CNP A;  3I5H C;  1K95 A;  1QJT A;  1WDC C;  1PVA A;  4MBE A;  5AEQ A;  3FWC A;  1JFK A;  1HT9 A;  1KK8 C;  2I18 A;  1K94 A;  2F3Z A;  1A03 A;  1GGW A;  3DF0 B;  5J3X A;  1N65 A;  3I5G C;  1F71 A;  2KFG A;  4N1G A;  1K2H A;  2BCA A;  2K7C A;  2LE9 B;  2KHN A;  1XFX O;  3DVK A;  2LAN A;  5D7F A;  2GV5 A;  1QX5 B;  1NX1 A;  2Y4Q A;  2HPS A;  2LP3 A;  1KK7 Y;  3I5I C;  1IGV A;  1C07 A;  1MQ1 A;  1ZFS A;  2SCP A;  1JUO A;  1JC2 A;  2KNE A;  1GJY A;  1NX2 A;  1F4Q A;  5AER A;  2WOS A;  2HET A;  2JXC A;  4I5L B; 
#chains in the Genus database with same CATH topology
 3L4L A;  1SCV A;  2CTN A;  3CZT X;  3CR5 X;  2F33 A;  4JPZ B;  3DVE A;  3BFH A;  2LVI A;  4I5K A;  2BKH B;  5FI2 A;  2G2B A;  4ORC B;  1TNP A;  2JXL A;  1MR8 A;  1YUS A;  1CDP A;  2LMT A;  3PN7 B;  1SW8 A;  4TNC A;  1KWO C;  1N0Y A;  3SIB A;  3H4S E;  1RTP 1;  1V1F A;  1B47 A;  1BMO A;  1SMG A;  2LHL A;  1DJX A;  2DOQ A;  3M0W A;  3FE6 A;  1V1G A;  2QEO A;  1LXF C;  4CFQ A;  3JVT C;  5IBW A;  5CSN A;  1Y1U A;  1ZAC A;  3DVJ A;  4PE1 A;  2LUX A;  5DKN A;  1RK9 A;  3B88 A;  1MXE A;  1QXP A;  1FI6 A;  1LVC D;  3D0Y B;  5AXI A;  1LKJ A;  1QV1 A;  3PSR A;  1Y0V H;  3S0E A;  2EHB A;  1AVS A;  3TDZ A;  2NXQ A;  2QDI A;  2JT8 A;  4C0L A;  3S0G A;  3LL8 B;  2TN4 A;  4MRY A;  3UO9 A;  1JWD A;  3D10 A;  1EL4 A;  1LA0 A;  4ICB A;  1FBV A;  2QEH A;  2WND A;  5B8I B;  1DT7 B;  1B8R A;  1NIW A;  5PAL A;  3D74 A;  3EVU A;  5JOL A;  3C1V A;  5G08 A;  4Q04 A;  5DIC A;  1IH0 A;  1G33 A;  4M2O A;  1KFX S;  2CXJ A;  4A4C A;  3BUN B;  2WCB A;  1YVL A;  1J7P A;  3D73 A;  3DVM A;  1MHO A;  4MZL A;  3SS5 A;  2KBM A;  1B8L A;  1NCZ A;  3IF7 A;  2M7N A;  1M31 A;  4PT1 A;  3FWB A;  4A4B A;  4YI8 A;  3PFV A;  1QVI Z;  2BCB A;  1F55 A;  2MLE C;  2ERB A;  4XJK B;  2NCP A;  3OGN A;  1A4P A;  3PM2 A;  5KU1 A;  1TNX A;  1SNL A;  3R1O A;  1YUT A;  3LK0 A;  4HSZ A;  1WLM A;  3RM1 A;  3KHE A;  1UUR A;  2BL0 C;  3A4U B;  3GOF A;  4PAL A;  1OOG A;  3ICB A;  1UUS A;  3B87 A;  5HKZ A;  3VRQ A;  3EK7 A;  2KI4 C;  2LVK A;  1RRO A;  1EG4 A;  2JWW A;  3FE8 A;  4U8D A;  3SIA A;  1KQV A;  5AFP A;  4JQ0 D;  2FJU B;  2P71 A;  4QJ5 B;  3TUY C;  3EK8 A;  3NHT A;  2F2P A;  1AK8 A;  1B1G A;  1S5G Z;  2HQW A;  2JPT A;  2WCJ A;  1A2X A;  2LUC A;  3R72 A;  1MWN A;  3D78 A;  4MRX A;  4YBH B;  5DKQ A;  3PAL A;  4GFT A;  1YRU B;  1SPY A;  1FF1 A;  2EC6 C;  1XFU O;  1IG5 A;  1JBA A;  2WC5 A;  1NWD A;  4PE4 A;  4ORA B;  2KSP A;  3DY9 A;  4OVN F;  2MRD A;  1C3Y A;  2K7O A;  4C0J A;  5GQQ C;  2WCE A;  1Y1A A;  2ZND A;  3RLZ A;  4NDB A;  4IJ7 A;  1X02 A;  4DUQ A;  3I5H B;  2V53 A;  1JF2 A;  5CSI A;  4MEW A;  1NX3 A;  1J7Q A;  1DC1 A;  5I2O A;  1B8C A;  4WQ3 A;  3CZ1 A;  1EJ3 A;  1REC A;  1ZOT B;  2E6W A;  2F3Y A;  1CMG A;  3WHU B;  1P28 A;  1KQM B;  1TNQ A;  4OCI A;  1TUZ A;  1UWO A;  1TNW A;  3IQQ A;  1EXR A;  1QAT A;  3NGV A;  3K21 A;  3VRR A;  1A75 B;  2MJW B;  1YX7 A;  3K1E A;  1J1D A;  1AP4 A;  2K8M B;  1OZO A;  1DQE A;  1K8U A;  1L2O C;  1LA3 A;  1S6I A;  1WY9 A;  1QIV A;  2M1K B;  3JTD C;  3BUO B;  3OB1 B;  1BLQ A;  1C7W A;  3S0B A;  1DVI A;  1PUL A;  1R2U A;  3VRN A;  4BY4 A;  2KGB C;  4E68 A;  1M63 B;  1MF8 B;  3BYA A;  1Z4H A;  2ZNE A;  2LCP A;  5FI7 A;  1ORG A;  1EH2 A;  2BNX A;  4R1E A;  3NSL A;  4INW A;  4FQO A;  1JF0 A;  2KI6 D;  4KYN A;  3TS5 C;  1BOD A;  1R6P A;  1KFU S;  3BJH A;  2ZFD A;  4PE0 A;  2LHI A;  1BOC A;  1K96 A;  2WC8 A;  4XJK A;  1QV0 A;  1CM4 A;  2BE6 A;  2AMI A;  1OOJ A;  2I94 A;  2QEV A;  1ZUZ A;  4PHJ A;  2LM5 A;  3SS3 A;  2MHH A;  3BOW A;  2KAX A;  2FCD A;  3BFA A;  5BPJ A;  5HYD A;  4QJ4 B;  3CTN A;  3DD4 A;  2COL B;  3TS5 B;  2KOT A;  2M3W A;  3AAK A;  4P2Y B;  2KGR A;  2O5G A;  1NCY A;  1UHH A;  1KSO A;  3VGO A;  4MZJ A;  2K61 A;  4UPG A;  1W9Z A;  2IS9 A;  3PAT A;  2OS8 C;  1YTZ C;  1IJ6 A;  1ZMZ A;  2LMV A;  3I5F C;  3WHT B;  1QWV A;  2LV7 A;  3OHM B;  4MN0 A;  4YGC B;  3O4Y A;  1TRF A;  4CFR A;  4DCK A;  3AAJ A;  3CGA A;  2M9G A;  3FE9 A;  2LLT A;  3R1P A;  1BT6 A;  1QVI Y;  2PAS A;  4GNK B;  2FOT A;  1WLZ A;  1IJ5 A;  1PRW A;  4PHK A;  2JOJ A;  4DIR A;  3I5G B;  4OKH A;  3D76 A;  1F54 A;  1Z2C B;  1PSB A;  4CID A;  1BG1 A;  2PRU A;  1BR1 B;  1SY9 A;  2WCL A;  1RJV A;  4USL A;  2JQ6 A;  3L4A A;  5I2L A;  2AUC A;  2L4H A;  4HRH A;  1CDN A;  2JPO A;  2PVB A;  4F7F A;  3JVT B;  2M97 A;  3CR4 X;  3DZT A;  3HX4 A;  5I8N A;  2CNP A;  2L98 A;  4N5X A;  4OZD A;  1OW4 A;  3Q8I A;  5FYX A;  1SRA A;  2WCM A;  3VRP A;  2KLD A;  4JKT A;  5HLV A;  2KI6 C;  1CB1 A;  1Q80 A;  2WCF A;  3CLN A;  1MXL C;  1JSA A;  1B7T Y;  1U5I A;  1IRJ A;  3B7A A;  4GUK A;  2Q91 A;  3EK4 A;  1K93 D;  1UHJ A;  1Y1X A;  1PK0 D;  1CDM A;  2QEB A;  1XFY O;  3O6B A;  4PHM A;  3E3R A;  3KF9 A;  4HRE E;  5D3O A;  2KYF A;  1UP5 A;  2KDH A;  1LS8 A;  1N2D A;  2R2I A;  1L7Z A;  3O78 A;  4F0Z B;  3GK1 A;  1YUU A;  2AAO A;  4AOM A;  5CSF A;  2HF5 A;  1DF0 B;  1BJF A;  3SG5 A;  1XK4 A;  4NDC A;  4YGB B;  2L5Y A;  3OB2 B;  2E30 A;  1K9U A;  1SR6 B;  1B9A A;  2PSR A;  2ZN9 A;  3CAB A;  3EKJ A;  2CBL A;  1XK4 C;  1SL8 A;  4GBA A;  2JC2 A;  2GGZ A;  2JTZ A;  3F45 A;  2BKI B;  1YUR A;  4PHN A;  1YVH A;  4N1F A;  1YX8 A;  1DEK A;  1RFJ A;  1OE9 B;  2I7A A;  2JTT A;  3NXA A;  2WCK A;  3OP0 A;  1S26 D;  2KYC A;  3BOW B;  4AQJ A;  1QTX A;  4ZCV A;  2Y5I A;  4D1E A;  2G9B A;  4ORB B;  1OZS A;  1DJG A;  1ALV A;  1EG3 A;  1OOH A;  4P5O E;  5TNC A;  1BF5 A;  2P70 A;  2ZRS A;  1CFF A;  1F70 A;  1TWO A;  2M1U A;  3A8R A;  1U5I B;  2L2C A;  1J55 A;  3TDI A;  2LP2 A;  1ALW A;  1SCM B;  2MLF C;  4OR9 B;  1XYD A;  5ER5 A;  1WRL A;  4GAO A;  4I5N B;  3AKA A;  1RWY A;  1QAS A;  1SK6 D;  1QS7 A;  2QAC A;  1DTL A;  3EVR A;  2KAY A;  1DJY A;  2LAP A;  3AKB A;  4FQT A;  4MSP A;  4MZK A;  1HQV A;  3VB1 A;  5DKR A;  2K7B A;  1UHN A;  3SJS A;  1DJZ A;  1KK7 Z;  2H61 C;  4DS7 A;  3KPX A;  3SG2 A;  5HKW A;  1S36 A;  2L4I A;  2JNX A;  3BXK A;  1D1O A;  1K90 D;  2JUL A;  1CFP A;  4PCW A;  2JT0 A;  2B1U A;  1NCX A;  4INX A;  1CDL A;  3DXL A;  1JFJ A;  2K2A A;  2LVV A;  4MLW A;  4YGD B;  2WOR A;  3JTD B;  1YRT B;  1XVJ A;  2K60 A;  4AQI A;  5KSZ A;  3B6X A;  4I5J A;  4YGE B;  2M49 B;  4GGN A;  1TCO B;  2BE4 A;  3KO0 A;  2HET A;  1SSE B;  2K0J A;  1DGU A;  2BAP A;  2ZRT A;  1KWO B;  2OS8 B;  1TN4 A;  2PYQ A;  2CCM A;  1DF0 A;  2KQY A;  3OX6 A;  2PQL A;  1GM0 A;  1H8B A;  2BEC A;  3N7H A;  2OTG C;  3BFB A;  3EG5 B;  2MA2 A;  4QJ3 B;  1FI5 A;  3BUM B;  1AUI B;  2KAV A;  2NLN A;  1XFW O;  4HRG A;  1M39 A;  2LNK A;  3SS4 A;  1FPW A;  4PE7 A;  5F6T A;  2HQ8 A;  2Q4U A;  1C7V A;  1C3Z A;  1KFU L;  1S6J A;  1NSH A;  2ZKM X;  3BUX B;  2LLS A;  1PVB A;  3DF0 A;  2D8N A;  2QPT A;  1TOP A;  1NPQ A;  3R1V A;  1KQM C;  4L9M A;  3IVT A;  4M2Q A;  1CKK A;  4GGF C;  2LLU A;  1DJH A;  1S3P A;  1M46 A;  1NP8 A;  1J7R A;  1OQP A;  3L47 A;  1AJ5 A;  2EC6 B;  2EGD A;  2GTE A;  3CZ2 A;  1IQ5 A;  2ISD A;  2KLE A;  2JRF A;  4WRI A;  1AHR A;  1QIW A;  3ZWH A;  1CLL A;  1WRZ A;  1XO5 A;  4YRU A;  1XFZ O;  1E8A A;  2LVJ A;  2Y1N A;  3O2P A;  1LIN A;  1IIO A;  1OMD A;  4BY5 A;  2KBI A;  3IQO A;  1DJI A;  2MAZ A;  1OMV A;  3CR2 A;  5AAN A;  3TDU A;  2JU0 A;  4JWQ A;  1KFX L;  2FCE A;  3TZ1 A;  2I2R E;  2RGI A;  2K7D A;  1F4O A;  5I2Q A;  1S6C A;  2KFF A;  2JZI A;  3LK1 A;  3CWG A;  2M7L A;  4ZCU A;  2GGM A;  1DMO A;  2H2K A;  5D69 A;  1NX0 A;  1FW4 A;  4CPV A;  3TUY B;  3S0F A;  1J7O A;  1L2O B;  3SG6 A;  1H4B A;  2VRG A;  4JD9 A;  3FIA A;  2LMU A;  3NSK A;  1XA5 A;  1CM1 A;  2L50 A;  1PSR A;  3NSO A;  3NHI A;  4M2P A;  3CYZ A;  1XFV O;  2BBN A;  2H61 A;  5HLO A;  3BUW B;  4XYN A;  2NCO A;  1CFD A;  1UHK A;  1QX7 A;  4FTG A;  2M0R A;  1G8I A;  1ODB A;  2KQ6 A;  4GPL B;  1B7T Z;  1WRK A;  2K2F A;  2O60 A;  1QLK A;  1IQ3 A;  1OMR A;  1G4Y R;  4IL1 A;  2BL0 B;  5HL1 A;  2BCX A;  3EKH A;  5JJG A;  3QRX A;  1TIZ A;  1SKT A;  2NZ0 A;  3FS7 A;  3S0D A;  2KFH A;  1GGZ A;  2OPO A;  4NQG A;  5EL2 A;  3ZNI A;  1YR5 A;  1WDC B;  1DGV A;  1OOF A;  1KSM A;  1NUB A;  1GQM A;  1K9P A;  2H8V A;  2OTG B;  3PM8 A;  4GGF A;  2KI4 B;  3MSE B;  3CZ0 A;  1OSA A;  2F2O A;  2L5X B;  2L0P A;  3PN7 C;  5CPV A;  1CTR A;  1OOI X;  3GK4 X;  2PAL A;  3EVV A;  5ER4 X;  2P6B B;  3D77 A;  3DYE A;  1KCY A;  2M29 A;  1BU3 A;  3BQ3 A;  3I5F B;  3KEV A;  3SG3 A;  1CFC A;  1TTX A;  1VRK A;  1Y6W A;  1SL7 A;  1PAL A;  1SYM A;  5FI6 A;  1SBJ A;  4YGA A;  2L51 A;  1W7J B;  2A4J A;  5HKY A;  4WQ2 A;  1DJW A;  1TCF A;  2LC5 A;  4NDD A;  3WXA A;  4MVF A;  2FJY A;  5K89 A;  1TUJ A;  3OX5 A;  2JT3 A;  3D0Y A;  2MBX A;  5I94 A;  1NYA A;  3SG4 A;  4DRW A;  1IWQ A;  3SG7 A;  2CT9 A;  2Y1M A;  3S0A A;  3GK2 A;  4OV2 A;  1XFR A;  1AJ4 A;  5CSJ A;  1SR6 C;  1SCM C;  4CLN A;  1W7I B;  1K9K A;  1QLS A;  5KTY A;  1IKU A;  2BBM A;  3WNX B;  1A75 A;  2L2E A;  3CS1 A;  4YI9 A;  1J1E A;  1S5G Y;  3D75 A;  3LLE A;  1A29 A;  1CLM A;  1S1E A;  2PMY A;  1F8H A;  3HCM A;  4ETO A;  3PJI A;  1B4C A;  3O4X A;  1SL9 A;  4PDZ A;  2F8P A;  3VRO A;  3QME A;  3PLF B;  3NSI A;  1MUX A;  2SAS A;  2ZN8 A;  1UHI A;  3LCP C;  1BR4 B;  2JNF A;  3I5I B;  1QX2 A;  1CMF A;  4C0K A;  1M45 A;  1CLB A;  2M8U A;  1CNP A;  3I5H C;  1K95 A;  3OBV A;  1QJT A;  1DEL A;  2KPH A;  1WDC C;  1PVA A;  4MBE A;  5AEQ A;  3UNW A;  3FWC A;  1JFK A;  1HT9 A;  1KK8 C;  3B86 A;  2I18 A;  1K94 A;  2F3Z A;  2WC6 A;  1A03 A;  1GGW A;  3DF0 B;  5J3X A;  1N65 A;  3I5G C;  1F71 A;  2KFG A;  4N1G A;  1K2H A;  2BCA A;  1T14 A;  2K7C A;  2LE9 B;  2KHN A;  1XFX O;  3DVK A;  2LAN A;  5D7F A;  2GV5 A;  1QX5 B;  1NX1 A;  2Y4Q A;  2HPS A;  2LP3 A;  1KK7 Y;  3I5I C;  1IGV A;  1C07 A;  1MQ1 A;  3CDN A;  1ZFS A;  3V2L A;  2SCP A;  1JUO A;  1JC2 A;  2KNE A;  1GJY A;  1NX2 A;  1F4Q A;  2YGU A;  5AER A;  3RZS A;  2WOS A;  2WCH A;  1KK8 B;  2JXC A;  4I5L B; 
#chains in the Genus database with same CATH homology
 1SCV A;  2CTN A;  3CZT X;  3CR5 X;  2F33 A;  4JPZ B;  3DVE A;  4I5K A;  2LVI A;  2BKH B;  2G2B A;  4ORC B;  1TNP A;  2JXL A;  1MR8 A;  1YUS A;  1CDP A;  2LMT A;  3PN7 B;  1SW8 A;  4TNC A;  1KWO C;  1N0Y A;  3SIB A;  3H4S E;  1RTP 1;  1V1F A;  1B47 A;  1BMO A;  1SMG A;  2LHL A;  1DJX A;  2DOQ A;  3M0W A;  1V1G A;  1LXF C;  4CFQ A;  3JVT C;  5IBW A;  5CSN A;  1Y1U A;  1ZAC A;  3DVJ A;  4PE1 A;  2LUX A;  5DKN A;  1RK9 A;  1MXE A;  1QXP A;  1FI6 A;  1LVC D;  3D0Y B;  5AXI A;  1LKJ A;  1QV1 A;  3PSR A;  1Y0V H;  2EHB A;  1AVS A;  3TDZ A;  2NXQ A;  2JT8 A;  4C0L A;  3LL8 B;  2TN4 A;  4MRY A;  1JWD A;  3D10 A;  1EL4 A;  1LA0 A;  4ICB A;  1FBV A;  2WND A;  5B8I B;  1DT7 B;  1B8R A;  1NIW A;  5PAL A;  3EVU A;  5JOL A;  3C1V A;  5G08 A;  4Q04 A;  1IH0 A;  1G33 A;  4M2O A;  1KFX S;  2CXJ A;  4A4C A;  3BUN B;  2WCB A;  1YVL A;  1J7P A;  3DVM A;  1MHO A;  4MZL A;  2KBM A;  1B8L A;  1NCZ A;  3IF7 A;  2M7N A;  1M31 A;  3FWB A;  4A4B A;  4YI8 A;  3PFV A;  1QVI Z;  2BCB A;  1F55 A;  2MLE C;  4XJK B;  2NCP A;  5KU1 A;  1A4P A;  1TNX A;  1SNL A;  1YUT A;  3LK0 A;  4HSZ A;  1WLM A;  3RM1 A;  3KHE A;  1UUR A;  2BL0 C;  3A4U B;  3GOF A;  4PAL A;  3ICB A;  1UUS A;  5HKZ A;  3VRQ A;  3EK7 A;  2KI4 C;  2LVK A;  1RRO A;  1EG4 A;  2JWW A;  4U8D A;  3SIA A;  1KQV A;  5AFP A;  4JQ0 D;  2FJU B;  4QJ5 B;  3TUY C;  1B1G A;  3EK8 A;  1AK8 A;  2F2P A;  1S5G Z;  2HQW A;  2JPT A;  1A2X A;  2LUC A;  1MWN A;  4MRX A;  4YBH B;  5DKQ A;  3PAL A;  4GFT A;  1YRU B;  1SPY A;  1FF1 A;  2EC6 C;  1XFU O;  1IG5 A;  1JBA A;  1NWD A;  4PE4 A;  4ORA B;  2KSP A;  4OVN F;  2MRD A;  2K7O A;  4C0J A;  5GQQ C;  2WCE A;  1Y1A A;  2ZND A;  3RLZ A;  4NDB A;  1X02 A;  4DUQ A;  3I5H B;  2V53 A;  1JF2 A;  5CSI A;  4MEW A;  1NX3 A;  1J7Q A;  5I2O A;  1B8C A;  4WQ3 A;  1EJ3 A;  1REC A;  1ZOT B;  2E6W A;  2F3Y A;  1CMG A;  3WHU B;  1TNQ A;  1KQM B;  4OCI A;  1UWO A;  1TNW A;  3IQQ A;  1EXR A;  1QAT A;  3VRR A;  3K21 A;  1A75 B;  2MJW B;  1YX7 A;  1J1D A;  1AP4 A;  2K8M B;  1OZO A;  1LA3 A;  1K8U A;  1L2O C;  1S6I A;  2M1K B;  1WY9 A;  1QIV A;  3JTD C;  3OB1 B;  3BUO B;  1BLQ A;  1C7W A;  1DVI A;  1PUL A;  1R2U A;  3VRN A;  4BY4 A;  2KGB C;  4E68 A;  1M63 B;  1MF8 B;  3BYA A;  2ZNE A;  2LCP A;  1EH2 A;  4R1E A;  3NSL A;  4FQO A;  1JF0 A;  2KI6 D;  3TS5 C;  1BOD A;  1R6P A;  1KFU S;  2ZFD A;  4PE0 A;  2LHI A;  1BOC A;  1K96 A;  2WC8 A;  4XJK A;  1QV0 A;  1CM4 A;  2BE6 A;  2AMI A;  1OOJ A;  1KK8 B;  2I94 A;  1ZUZ A;  4PHJ A;  2LM5 A;  2MHH A;  3BOW A;  2KAX A;  2FCD A;  5BPJ A;  5HYD A;  4QJ4 B;  3CTN A;  3DD4 A;  2COL B;  3TS5 B;  2KOT A;  2M3W A;  3AAK A;  4P2Y B;  2KGR A;  2O5G A;  1NCY A;  1UHH A;  1KSO A;  3VGO A;  4MZJ A;  2K61 A;  4UPG A;  2IS9 A;  3PAT A;  2OS8 C;  1YTZ C;  1IJ6 A;  1ZMZ A;  2LMV A;  3I5F C;  3WHT B;  2LV7 A;  3OHM B;  4MN0 A;  4YGC B;  3O4Y A;  1TRF A;  4CFR A;  4DCK A;  3AAJ A;  3CGA A;  2M9G A;  2LLT A;  1BT6 A;  1QVI Y;  2PAS A;  4GNK B;  2FOT A;  1WLZ A;  1IJ5 A;  1PRW A;  4PHK A;  2JOJ A;  4DIR A;  3I5G B;  4OKH A;  1F54 A;  1PSB A;  4CID A;  1BG1 A;  2PRU A;  1BR1 B;  1SY9 A;  1RJV A;  4USL A;  2JQ6 A;  5I2L A;  2AUC A;  2L4H A;  4HRH A;  1CDN A;  2PVB A;  3JVT B;  2M97 A;  3CR4 X;  3HX4 A;  5I8N A;  2CNP A;  2L98 A;  4N5X A;  5FYX A;  1SRA A;  3VRP A;  5HLV A;  2KI6 C;  1CB1 A;  1Q80 A;  2WCF A;  3CLN A;  1MXL C;  1JSA A;  1B7T Y;  1U5I A;  1IRJ A;  4GUK A;  2Q91 A;  3EK4 A;  1K93 D;  1UHJ A;  1Y1X A;  1PK0 D;  1CDM A;  3O6B A;  1XFY O;  4PHM A;  3E3R A;  3KF9 A;  4HRE E;  2KYF A;  1UP5 A;  2KDH A;  1N2D A;  2R2I A;  1L7Z A;  3O78 A;  4F0Z B;  3GK1 A;  1YUU A;  2AAO A;  4AOM A;  5CSF A;  2HF5 A;  1DF0 B;  1BJF A;  3SG5 A;  1XK4 A;  4NDC A;  4YGB B;  3OB2 B;  2E30 A;  1K9U A;  1SR6 B;  1B9A A;  2PSR A;  2ZN9 A;  3EKJ A;  2CBL A;  1XK4 C;  1SL8 A;  4GBA A;  2JC2 A;  2GGZ A;  2JTZ A;  3F45 A;  2BKI B;  1YUR A;  4PHN A;  1YVH A;  4N1F A;  1YX8 A;  1RFJ A;  1OE9 B;  2I7A A;  2JTT A;  3NXA A;  3OP0 A;  1S26 D;  2KYC A;  3BOW B;  4AQJ A;  1QTX A;  4ZCV A;  2Y5I A;  4D1E A;  2G9B A;  4ORB B;  1OZS A;  1DJG A;  1ALV A;  1EG3 A;  4P5O E;  1BF5 A;  5TNC A;  2ZRS A;  1CFF A;  1F70 A;  2M1U A;  3A8R A;  1U5I B;  1J55 A;  3TDI A;  2LP2 A;  1ALW A;  1SCM B;  2MLF C;  4OR9 B;  1XYD A;  5ER5 A;  1WRL A;  4GAO A;  4I5N B;  3AKA A;  1RWY A;  1QAS A;  1SK6 D;  1QS7 A;  2QAC A;  1DTL A;  3EVR A;  2KAY A;  1DJY A;  2LAP A;  3AKB A;  4MSP A;  4MZK A;  1HQV A;  5DKR A;  2K7B A;  1UHN A;  3SJS A;  1DJZ A;  1KK7 Z;  2H61 C;  4DS7 A;  3KPX A;  3SG2 A;  5HKW A;  1S36 A;  2L4I A;  2JNX A;  3BXK A;  1D1O A;  1K90 D;  2JUL A;  1CFP A;  4PCW A;  2JT0 A;  2B1U A;  1NCX A;  1CDL A;  1JFJ A;  2K2A A;  2LVV A;  4MLW A;  4YGD B;  2WOR A;  3JTD B;  1YRT B;  1XVJ A;  4AQI A;  5KSZ A;  4I5J A;  4YGE B;  2M49 B;  4GGN A;  1TCO B;  2BE4 A;  3KO0 A;  2ZRT A;  2K0J A;  1DGU A;  1KWO B;  2OS8 B;  1TN4 A;  2CCM A;  1DF0 A;  2KQY A;  3OX6 A;  1H8B A;  2BEC A;  2OTG C;  4QJ3 B;  2MA2 A;  1FI5 A;  3BUM B;  1AUI B;  2KAV A;  2NLN A;  1XFW O;  4HRG A;  1M39 A;  2LNK A;  1FPW A;  4PE7 A;  5F6T A;  2HQ8 A;  2Q4U A;  1C7V A;  1KFU L;  1S6J A;  1NSH A;  2ZKM X;  3BUX B;  2LLS A;  1PVB A;  3DF0 A;  2D8N A;  2QPT A;  1TOP A;  1NPQ A;  1KQM C;  4L9M A;  4M2Q A;  1CKK A;  4GGF C;  2LLU A;  1DJH A;  1S3P A;  1M46 A;  1NP8 A;  1J7R A;  1OQP A;  1AJ5 A;  2EC6 B;  2EGD A;  1IQ5 A;  2ISD A;  2JRF A;  4WRI A;  1AHR A;  1QIW A;  3ZWH A;  1CLL A;  1WRZ A;  1XO5 A;  4YRU A;  1XFZ O;  1E8A A;  2LVJ A;  2Y1N A;  3O2P A;  1LIN A;  1OMD A;  4BY5 A;  2KBI A;  3IQO A;  1DJI A;  2MAZ A;  1OMV A;  3CR2 A;  5AAN A;  3TDU A;  2JU0 A;  4JWQ A;  1KFX L;  2FCE A;  3TZ1 A;  2I2R E;  2RGI A;  2K7D A;  1F4O A;  5I2Q A;  1S6C A;  2KFF A;  2JZI A;  3LK1 A;  3CWG A;  2M7L A;  4ZCU A;  2GGM A;  1DMO A;  2H2K A;  5D69 A;  1NX0 A;  1FW4 A;  4CPV A;  3TUY B;  1J7O A;  1L2O B;  3SG6 A;  1H4B A;  2VRG A;  3FIA A;  2LMU A;  3NSK A;  1XA5 A;  1CM1 A;  2L50 A;  1PSR A;  3NSO A;  4M2P A;  1XFV O;  2BBN A;  2H61 A;  5HLO A;  3BUW B;  4XYN A;  2NCO A;  1CFD A;  1UHK A;  1QX7 A;  4FTG A;  2M0R A;  1G8I A;  1ODB A;  2KQ6 A;  4GPL B;  1B7T Z;  1WRK A;  2K2F A;  2O60 A;  1QLK A;  1IQ3 A;  1OMR A;  1G4Y R;  4IL1 A;  2BL0 B;  2BCX A;  3EKH A;  5JJG A;  3QRX A;  1TIZ A;  1SKT A;  2NZ0 A;  3FS7 A;  2KFH A;  1GGZ A;  2OPO A;  4NQG A;  3ZNI A;  1YR5 A;  1WDC B;  1DGV A;  1KSM A;  1NUB A;  1GQM A;  1K9P A;  2OTG B;  3PM8 A;  4GGF A;  2KI4 B;  3MSE B;  1OSA A;  2F2O A;  2L5X B;  2L0P A;  3PN7 C;  5CPV A;  1CTR A;  3GK4 X;  5ER4 X;  2PAL A;  3EVV A;  2P6B B;  1KCY A;  2M29 A;  1BU3 A;  3BQ3 A;  3I5F B;  3KEV A;  3SG3 A;  1CFC A;  1TTX A;  1VRK A;  1Y6W A;  1SL7 A;  1PAL A;  1SYM A;  1SBJ A;  4YGA A;  2L51 A;  1W7J B;  2A4J A;  5HKY A;  4WQ2 A;  1DJW A;  1TCF A;  2LC5 A;  4NDD A;  3WXA A;  4MVF A;  5K89 A;  3OX5 A;  2JT3 A;  3D0Y A;  2MBX A;  1NYA A;  3SG4 A;  4DRW A;  1IWQ A;  3SG7 A;  2CT9 A;  2Y1M A;  3GK2 A;  4OV2 A;  1AJ4 A;  5CSJ A;  1SR6 C;  1SCM C;  4CLN A;  1W7I B;  1K9K A;  1QLS A;  5KTY A;  1IKU A;  2BBM A;  3WNX B;  1A75 A;  2L2E A;  3CS1 A;  4YI9 A;  1J1E A;  1S5G Y;  3LLE A;  1A29 A;  1CLM A;  1S1E A;  2PMY A;  1F8H A;  3HCM A;  4ETO A;  1B4C A;  4PDZ A;  1SL9 A;  3VRO A;  2F8P A;  3PLF B;  3NSI A;  1MUX A;  2SAS A;  2ZN8 A;  1UHI A;  3LCP C;  1BR4 B;  2JNF A;  3I5I B;  1QX2 A;  1CMF A;  4C0K A;  1M45 A;  1CLB A;  2M8U A;  1CNP A;  3I5H C;  1K95 A;  1QJT A;  1WDC C;  1PVA A;  4MBE A;  5AEQ A;  3FWC A;  1JFK A;  1HT9 A;  1KK8 C;  2I18 A;  1K94 A;  2F3Z A;  1A03 A;  1GGW A;  3DF0 B;  5J3X A;  1N65 A;  3I5G C;  1F71 A;  2KFG A;  4N1G A;  1K2H A;  2BCA A;  2K7C A;  2LE9 B;  2KHN A;  1XFX O;  3DVK A;  2LAN A;  5D7F A;  2GV5 A;  1QX5 B;  1NX1 A;  2Y4Q A;  2HPS A;  2LP3 A;  1KK7 Y;  3I5I C;  1IGV A;  1C07 A;  1MQ1 A;  1ZFS A;  2SCP A;  1JUO A;  1JC2 A;  2KNE A;  1GJY A;  1NX2 A;  1F4Q A;  5AER A;  2WOS A;  2HET A;  2JXC A;  4I5L B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...