1TUZA

Nmr structure of the diacylglycerol kinase alpha, nesgc target hr532
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
118
structure length
118
Chain Sequence
MAKERGLISPSDFAQLQKYMEYSTKKVSDVLKLFEDGEMAKYVQGDAIGYEGFQQFLKIYLEVDNVPRHLSLALFQSFETGHCLNETNVTKDVVCLNDVSCYFSLLEGGRPEDKLEWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords diacylglycerol kinase alpha
publication title NMR structure of Diacylglycerol kinase alpha, NESGC target HR532
rcsb
source organism Homo sapiens
total genus 22
structure length 118
sequence length 118
ec nomenclature ec 2.7.1.107: Diacylglycerol kinase (ATP).
pdb deposition date 2004-06-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14513 DAG_kinase_N Diacylglycerol kinase N-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.110 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 Diacylglycerol kinase alpha. 1tuzA00
1TUZA
chains in the Genus database with same CATH superfamily
2KYCA 1J7PA 2JOJA 2M29A 1CLBA 2JT3A 3D75A 3JVTB 1DJXA 1BU3A 5GQQC 3AKBA 1A4PA 4PALA 1MWNA 4C0LA 5KSZA 1SMGA 2FOTA 3PATA 1CFDA 1PALA 1SL8A 2Y4QA 5PALA 3H4SE 1CMFA 1DEKA 1YUTA 1DELA 2O5GA 4CLNA 1UHHA 1A29A 2QDIA 1C3YA 3TDIA 1XO5A 2JXCA 2GGZA 2K61A 4XJKB 4USLA 1FPWA 1J1DA 3AKAA 3C1VA 4XJKA 2CT9A 1SL7A 5AANA 1N2DA 1MXEA 5KTYA 4OV2A 3SG3A 2H61A 2H61C 2ZKMX 3KO0A 2Q4UA 4I5LB 3WNXB 3PALA 1DC1A 4MZKA 1CFFA 3EK4A 4YGBB 3SS3A 5HKYA 2LMUA 2L50A 2L5YA 4NDDA 2E30A 2WCFA 1JC2A 5IBWA 3DVKA 4M2PA 2JTTA 4M2QA 4MEWA 3ZNIA 2F3YA 3CR4X 2LNKA 3I5HB 4FTGA 2M1UA 1CNPA 1C7WA 1WRZA 1SYMA 1FBVA 5CSFA 4QJ3B 3BQ3A 1DJWA 5DKQA 2VRGA 1A75A 1S5GZ 2JZIA 3JTDC 1MQ1A 3NSIA 4C0KA 1F71A 3ICBA 5CPVA 1B47A 2TN4A 1DMOA 1QTXA 2Q91A 2KI4C 2EC6B 2Y1MA 3B6XA 1MUXA 2K7DA 1JBAA 2JULA 1XFWO 1GM0A 1WLZA 1KK8B 3IF7A 3NGVA 3PJIA 3S0GA 3SG7A 5AFPA 5DKNA 1EH2A 1CTRA 3SJSA 1SCMB 2RGIA 2K7OA 2QPTA 1SCMC 3OBVA 4CIDA 4ETOA 4GFTA 2JNFA 1OSAA 1NP8A 4P2YB 2LC5A 4DRWA 2ZNEA 4PHNA 5DKRA 1B7TY 1SBJA 3DVMA 2BNXA 2CBLA 3OGNA 2K60A 3UO9A 1FI6A 2BCAA 4MLWA 1W9ZA 3LCPC 2PALA 1LKJA 1Y1XA 2KOTA 5AXIA 1EJ3A 1KFXS 1NX1A 1S1EA 1V1FA 3S0DA 1UHIA 2K8MB 1S6JA 2MA2A 2AAOA 2R2IA 4GUKA 1SRAA 1MF8B 3I5FC 5AEQA 1KQMB 1KWOC 3LK0A 2JQ6A 1NYAA 4YRUA 1S5GY 2E6WA 1GQMA 1HQVA 1JF0A 1BMOA 1TNXA 4WQ3A 2BECA 3S0EA 3SG6A 1KFXL 2WOSA 4JWQA 3BOWA 1YX7A 4U8DA 2LV7A 1W7JB 2L2EA 3QRXA 4YI9A 1FI5A 1C07A 2JT8A 1B8CA 2SASA 1IGVA 4ZCVA 3OB1B 1JWDA 2M7LA 3DF0B 1YRTB 2BL0B 2MLEC 2F3ZA 2ZN9A 3DXLA 3DF0A 4A4BA 1IG5A 2AMIA 3TS5B 5CSJA 4YGAA 2Y1NA 3TS5C 1TNWA 2MRDA 1G8IA 1P28A 3CYZA 2JC2A 5FI6A 2EGDA 3D0YB 3BUXB 1IJ6A 3HCMA 3R72A 1TTXA 1B8RA 2M7NA 1XFXO 4N1GA 1XK4A 1XK4C 2JNXA 1B1GA 4GBAA 1D1OA 5I8NA 2O60A 1BR1B 3NHIA 1UP5A 3R1VA 4AOMA 1CLLA 3VRPA 3OX6A 1W7IB 2M0RA 2WCEA 3A4UB 3FS7A 1IWQA 2MBXA 4PE0A 1EXRA 5ER4X 1M45A 2BAPA 3MSEB 2ERBA 1DJZA 1QV1A 3TZ1A 1QS7A 3PLFB 1G33A 1OMRA 1MXLC 1NUBA 1OOFA 1UURA 4N5XA 5CSIA 3PM2A 1A03A 1QX5B 2SCPA 1JFJA 1AVSA 1GGZA 1Z4HA 3OHMB 3EVVA 3O4YA 1N65A 3BUNB 1SKTA 3F45A 3RLZA 3UNWA 1AHRA 5HKZA 4JPZB 1JUOA 1AK8A 1TNQA 1CB1A 1ZMZA 2WC5A 2B1UA 2WCLA 1QJTA 1DJGA 4JQ0D 1NCXA 2GV5A 3NXAA 1KSOA 1CFPA 2G9BA 1QXPA 2JRFA 2YGUA 5DICA 3S0FA 3E3RA 4OVNF 3JVTC 4P5OE 3O6BA 5G08A 2FCEA 4MVFA 3SIAA 4MRYA 4WRIA 1J55A 2HQ8A 2ZRTA 1LINA 2H2KA 1DGVA 3NSOA 2K7CA 2KFFA 1OQPA 1ORGA 4BY5A 3PN7B 3CDNA 2PQLA 2KGBC 4N1FA 1SPYA 2LCPA 2QEOA 4Q04A 3BUMB 1QLKA 2BCXA 1XFVO 5F6TA 3BYAA 2MAZA 3M0WA 4ORAB 4NDBA 4PT1A 3GK1A 2FJYA 1XYDA 1R2UA 4JD9A 1B7TZ 2BBNA 2LANA 2OTGB 3CTNA 2OTGC 1XFRA 1UHJA 3EVUA 1YRUB 3CWGA 1RTP1 3CR2A 4ZCUA 2LP2A 1RWYA 2JPTA 1JFKA 1ZFSA 3I5HC 1LA3A 1SSEB 2KLEA 3K21A 5HYDA 2KI6D 5J3XA 1SW8A 2JXLA 2LVKA 1KQVA 1JSAA 3PFVA 2GTEA 1KCYA 3FE6A 1L2OB 2HF5A 1RECA 1IJ5A 4HRGA 1L2OC 3L4AA 2KYFA 1S6CA 1NWDA 1OW4A 5I2LA 1Y1AA 3EKJA 4BY4A 3AAJA 2EC6C 1TNPA 3D78A 1TRFA 4WQ2A 3TDUA 4A4CA 2WCJA 1KK8C 1BF5A 1BT6A 3O78A 2KHNA 1DF0B 4MZJA 1PULA 3VRQA 1GGWA 1LVCD 1KK7Y 3O2PA 2WCKA 2LUCA 2ZRSA 3CZ2A 1ALWA 1OOJA 1ZUZA 2LHLA 3EVRA 1BR4B 1SK6D 4QJ5B 1IKUA 2K0JA 1T14A 2MJWB 1U5IB 3VRNA 2FJUB 1U5IA 4ORBB 4GGNA 2F8PA 4ICBA 1NCYA 2LUXA 2NCOA 1BLQA 3TDZA 1QWVA 2F2OA 2QEHA 4INWA 1WLMA 5KU1A 1KQMC 2KSPA 3WHTB 4D1EA 1IH0A 2JTZA 3AAKA 2WC6A 2LE9B 2L98A 1CM4A 1MHOA 3IQQA 3A8RA 4PHMA 3I5IB 3TUYB 2I18A 4FQOA 1TIZA 3BUOB 2JPOA 3TUYC 4PHJA 2I94A 2WCHA 2BE4A 3GOFA 1PSRA 1S3PA 1K8UA 1NX3A 1FF1A 1DVIA 2DOQA 3BFBA 3CS1A 4HSZA 2BL0C 3IVTA 1JF2A 4MN0A 1NPQA 3SG2A 4IJ7A 3KHEA 3BJHA 4YI8A 3BUWB 4PE4A 3FWBA 4YGCB 1UHKA 3VB1A 1QIVA 2ZFDA 1YTZC 3QMEA 4GNKB 1XFUO 2FCDA 2PRUA 2LMTA 2LMVA 3D0YA 1QX7A 3R1PA 4NDCA 4MRXA 3CGAA 3SG4A 5HL1A 1UWOA 3D77A 1NX0A 2KDHA 1XA5A 2HQWA 2PYQA 3CR5X 3KEVA 1SCVA 1WRLA 3CZ1A 1GJYA 1K9KA 1F4QA 5FYXA 5AERA 2QACA 1PRWA 2LVIA 4TNCA 1DJIA 4AQJA 1KSMA 2LM5A 4GGFA 4GGFC 1CMGA 2QEBA 2KNEA 3DVEA 1IQ5A 1FW4A 1DJYA 1TOPA 1Y6WA 1MR8A 3OB2B 1DJHA 5HLOA 4PDZA 2PSRA 3GK2A 1QATA 1LS8A 2BKHB 3B86A 1K9PA 3EK8A 3KPXA 3RM1A 3WXAA 1R6PA 2KPHA 2M9GA 4OKHA 2PASA 4YBHB 1H4BA 2K7BA 1OMVA 2CXJA 4CPVA 2NCPA 2M97A 2P6BB 1YUSA 3LLEA 2LAPA 2KQ6A 1L7ZA 1CDLA 4L9MA 1ODBA 1QV0A 3D10A 4MSPA 5JOLA 4C0JA 2PVBA 2CCMA 3BFHA 1YX8A 4E68A 5HKWA 3LL8B 1Q80A 1K95A 1BOCA 3DVJA 1J7RA 2LLSA 3EKHA 1AP4A 3O4XA 1VRKA 1BJFA 2MLFC 1IRJA 2IS9A 1EL4A 2K2FA 3GK4X 4INXA 1CDNA 1NIWA 3RZSA 1XFZO 1WDCB 2NXQA 2COLB 5JJGA 1OOHA 1WDCC 1HT9A 2K2AA 2P71A 4YGEB 5ER5A 1UHNA 3PN7C 1TUZA 1IIOA 3K1EA 1M31A 2KFGA 1KK7Z 1S36A 2HETA 2LHIA 2F2PA 1F8HA 2WNDA 5D69A 2CNPA 1J7QA 3B7AA 3NHTA 5FI7A 2PMYA 3R1OA 3N7HA 1TWOA 1YVHA 2AUCA 4GAOA 1PSBA 2WCMA 4PE7A 1EG3A 2KLDA 1S6IA 3D74A 1KFUS 1S26D 2LVJA 2L2CA 3SG5A 2L5XB 2KAVA 3S0AA 4PHKA 3OX5A 4F7FA 1OMDA 1SL9A 2KAYA 2Y5IA 1C3ZA 1LXFC 1QVIZ 2CTNA 3NSKA 5B8IB 1F70A 1QLSA 4DCKA 2M8UA 1KFUL 4HRHA 3HX4A 1IQ3A 1K96A 1OE9B 1ZACA 2LLUA 1K90D 3NSLA 1Y0VH 2L51A 1NX2A 1WY9A 1C7VA 1EG4A 5BPJA 2BCBA 2EHBA 3FWCA 2GGMA 4PCWA 1LA0A 5CSNA 2I7AA 2MHHA 1DF0A 1QASA 2NZ0A 1PVBA 1RK9A 1UUSA 1DTLA 3B87A 3JTDB 1A75B 2M49B 4XYNA 4QJ4B 4OZDA 1CLMA 1SNLA 1XVJA 1K94A 2KI4B 2M1KB 5I94A 2L4HA 1OOIX 2L4IA 1QIWA 2LLTA 3CZ0A 2HPSA 1DQEA 1PK0D 2LP3A 2ISDA 1AUIB 4I5KA 1ZOTB 5I2QA 1V1GA 3WHUB 3SS5A 1F55A 2JWWA 5HLVA 2KAXA 4AQIA 1OZOA 2H8VA 1RROA 2ZN8A 1QVIY 1B4CA 1K2HA 1ALVA 3V2LA 2L0PA 3KF9A 3I5IC 4CFRA 1SY9A 2F33A 2KBMA 1PVAA 1NCZA 5TNCA 1CFCA 2D8NA 2G2BA 2M3WA 3I5FB 4F0ZB 1A2XA 1KWOB 1WRKA 1J1EA 3DYEA 4I5JA 1YURA 2BBMA 1CDPA 4MBEA 3SS4A 3VRRA 2V53A 5I2OA 1OZSA 3EK7A 4DUQA 3BOWB 2OS8B 1E8AA 2KI6C 2OS8C 3LK1A 4DS7A 2BE6A 3EG5B 1DGUA 3BXKA 3FIAA 5D7FA 3IQOA 2JT0A 3ZWHA 1CM1A 2ZNDA 3S0BA 1F54A 3D76A 1AJ5A 3SIBA 1B9AA 3Q8IA 4JKTA 1CKKA 3BFAA 2NLNA 4R1EA 1YVLA 3PSRA 1AJ4A 4I5NB 1M46A 3FE8A 1TN4A 3OP0A 2KBIA 2LVVA 3B88A 4PE1A 4M2OA 1RFJA 2BKIB 1F4OA 1CDMA 4IL1A 3DD4A 3L4LA 1DT7B 1M39A 4FQTA 1K9UA 1BG1A 2KFHA 4DIRA 1BODA 3CLNA 5D3OA 4OCIA 4CFQA 2KGRA 4NQGA 3VROA 4ORCB 1J7OA 1NSHA 3I5GB 1RJVA 2P70A 4OR9B 3FE9A 3DZTA 1Y1UA 2I2RE 1OOGA 3CABA 2OPOA 2WORA 3I5GC 4HREE 5K89A 1K93D 2JU0A 5EL2A 2WC8A 3D73A 1B8LA 1G4YR 1YR5A 3DY9A 1XFYO 4GPLB 5FI2A 3CZTX 4KYNA 4UPGA 1M63B 1H8BA 1TCOB 1SR6B 3VGOA 1TCFA 2WCBA 1SR6C 3L47A 2QEVA 1X02A 2KQYA 1Z2CB 1QX2A 1N0YA 3PM8A 2A4JA 4MZLA 1YUUA 4YGDB 1TUJA
chains in the Genus database with same CATH topology
1TUZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TUZ A; 
#chains in the Genus database with same CATH topology
 2KYC A;  1J7P A;  2JOJ A;  2M29 A;  1CLB A;  2JT3 A;  3D75 A;  3JVT B;  1DJX A;  1BU3 A;  5GQQ C;  3AKB A;  1A4P A;  4PAL A;  1MWN A;  4C0L A;  5KSZ A;  1SMG A;  2FOT A;  3PAT A;  1CFD A;  1PAL A;  1SL8 A;  2Y4Q A;  5PAL A;  3H4S E;  1CMF A;  1DEK A;  1YUT A;  1DEL A;  2O5G A;  4CLN A;  1UHH A;  1A29 A;  2QDI A;  1C3Y A;  3TDI A;  1XO5 A;  2JXC A;  2GGZ A;  2K61 A;  4XJK B;  4USL A;  1FPW A;  1J1D A;  3AKA A;  3C1V A;  4XJK A;  2CT9 A;  1SL7 A;  5AAN A;  1N2D A;  1MXE A;  5KTY A;  4OV2 A;  3SG3 A;  2H61 A;  2H61 C;  2ZKM X;  3KO0 A;  2Q4U A;  4I5L B;  3WNX B;  3PAL A;  1DC1 A;  4MZK A;  1CFF A;  3EK4 A;  4YGB B;  3SS3 A;  5HKY A;  2LMU A;  2L50 A;  2L5Y A;  4NDD A;  2E30 A;  2WCF A;  1JC2 A;  5IBW A;  3DVK A;  4M2P A;  2JTT A;  4M2Q A;  4MEW A;  3ZNI A;  2F3Y A;  3CR4 X;  2LNK A;  3I5H B;  4FTG A;  2M1U A;  1CNP A;  1C7W A;  1WRZ A;  1SYM A;  1FBV A;  5CSF A;  4QJ3 B;  3BQ3 A;  1DJW A;  5DKQ A;  2VRG A;  1A75 A;  1S5G Z;  2JZI A;  3JTD C;  1MQ1 A;  3NSI A;  4C0K A;  1F71 A;  3ICB A;  5CPV A;  1B47 A;  2TN4 A;  1DMO A;  1QTX A;  2Q91 A;  2KI4 C;  2EC6 B;  2Y1M A;  3B6X A;  1MUX A;  2K7D A;  1JBA A;  2JUL A;  1XFW O;  1GM0 A;  1WLZ A;  1KK8 B;  3IF7 A;  3NGV A;  3PJI A;  3S0G A;  3SG7 A;  5AFP A;  5DKN A;  1EH2 A;  1CTR A;  3SJS A;  1SCM B;  2RGI A;  2K7O A;  2QPT A;  1SCM C;  3OBV A;  4CID A;  4ETO A;  4GFT A;  2JNF A;  1OSA A;  1NP8 A;  4P2Y B;  2LC5 A;  4DRW A;  2ZNE A;  4PHN A;  5DKR A;  1B7T Y;  1SBJ A;  3DVM A;  2BNX A;  2CBL A;  3OGN A;  2K60 A;  3UO9 A;  1FI6 A;  2BCA A;  4MLW A;  1W9Z A;  3LCP C;  2PAL A;  1LKJ A;  1Y1X A;  2KOT A;  5AXI A;  1EJ3 A;  1KFX S;  1NX1 A;  1S1E A;  1V1F A;  3S0D A;  1UHI A;  2K8M B;  1S6J A;  2MA2 A;  2AAO A;  2R2I A;  4GUK A;  1SRA A;  1MF8 B;  3I5F C;  5AEQ A;  1KQM B;  1KWO C;  3LK0 A;  2JQ6 A;  1NYA A;  4YRU A;  1S5G Y;  2E6W A;  1GQM A;  1HQV A;  1JF0 A;  1BMO A;  1TNX A;  4WQ3 A;  2BEC A;  3S0E A;  3SG6 A;  1KFX L;  2WOS A;  4JWQ A;  3BOW A;  1YX7 A;  4U8D A;  2LV7 A;  1W7J B;  2L2E A;  3QRX A;  4YI9 A;  1FI5 A;  1C07 A;  2JT8 A;  1B8C A;  2SAS A;  1IGV A;  4ZCV A;  3OB1 B;  1JWD A;  2M7L A;  3DF0 B;  1YRT B;  2BL0 B;  2MLE C;  2F3Z A;  2ZN9 A;  3DXL A;  3DF0 A;  4A4B A;  1IG5 A;  2AMI A;  3TS5 B;  5CSJ A;  4YGA A;  2Y1N A;  3TS5 C;  1TNW A;  2MRD A;  1G8I A;  1P28 A;  3CYZ A;  2JC2 A;  5FI6 A;  2EGD A;  3D0Y B;  3BUX B;  1IJ6 A;  3HCM A;  3R72 A;  1TTX A;  1B8R A;  2M7N A;  1XFX O;  4N1G A;  1XK4 A;  1XK4 C;  2JNX A;  1B1G A;  4GBA A;  1D1O A;  5I8N A;  2O60 A;  1BR1 B;  3NHI A;  1UP5 A;  3R1V A;  4AOM A;  1CLL A;  3VRP A;  3OX6 A;  1W7I B;  2M0R A;  2WCE A;  3A4U B;  3FS7 A;  1IWQ A;  2MBX A;  4PE0 A;  1EXR A;  5ER4 X;  1M45 A;  2BAP A;  3MSE B;  2ERB A;  1DJZ A;  1QV1 A;  3TZ1 A;  1QS7 A;  3PLF B;  1G33 A;  1OMR A;  1MXL C;  1NUB A;  1OOF A;  1UUR A;  4N5X A;  5CSI A;  3PM2 A;  1A03 A;  1QX5 B;  2SCP A;  1JFJ A;  1AVS A;  1GGZ A;  1Z4H A;  3OHM B;  3EVV A;  3O4Y A;  1N65 A;  3BUN B;  1SKT A;  3F45 A;  3RLZ A;  3UNW A;  1AHR A;  5HKZ A;  4JPZ B;  1JUO A;  1AK8 A;  1TNQ A;  1CB1 A;  1ZMZ A;  2WC5 A;  2B1U A;  2WCL A;  1QJT A;  1DJG A;  4JQ0 D;  1NCX A;  2GV5 A;  3NXA A;  1KSO A;  1CFP A;  2G9B A;  1QXP A;  2JRF A;  2YGU A;  5DIC A;  3S0F A;  3E3R A;  4OVN F;  3JVT C;  4P5O E;  3O6B A;  5G08 A;  2FCE A;  4MVF A;  3SIA A;  4MRY A;  4WRI A;  1J55 A;  2HQ8 A;  2ZRT A;  1LIN A;  2H2K A;  1DGV A;  3NSO A;  2K7C A;  2KFF A;  1OQP A;  1ORG A;  4BY5 A;  3PN7 B;  3CDN A;  2PQL A;  2KGB C;  4N1F A;  1SPY A;  2LCP A;  2QEO A;  4Q04 A;  3BUM B;  1QLK A;  2BCX A;  1XFV O;  5F6T A;  3BYA A;  2MAZ A;  3M0W A;  4ORA B;  4NDB A;  4PT1 A;  3GK1 A;  2FJY A;  1XYD A;  1R2U A;  4JD9 A;  1B7T Z;  2BBN A;  2LAN A;  2OTG B;  3CTN A;  2OTG C;  1XFR A;  1UHJ A;  3EVU A;  1YRU B;  3CWG A;  1RTP 1;  3CR2 A;  4ZCU A;  2LP2 A;  1RWY A;  2JPT A;  1JFK A;  1ZFS A;  3I5H C;  1LA3 A;  1SSE B;  2KLE A;  3K21 A;  5HYD A;  2KI6 D;  5J3X A;  1SW8 A;  2JXL A;  2LVK A;  1KQV A;  1JSA A;  3PFV A;  2GTE A;  1KCY A;  3FE6 A;  1L2O B;  2HF5 A;  1REC A;  1IJ5 A;  4HRG A;  1L2O C;  3L4A A;  2KYF A;  1S6C A;  1NWD A;  1OW4 A;  5I2L A;  1Y1A A;  3EKJ A;  4BY4 A;  3AAJ A;  2EC6 C;  1TNP A;  3D78 A;  1TRF A;  4WQ2 A;  3TDU A;  4A4C A;  2WCJ A;  1KK8 C;  1BF5 A;  1BT6 A;  3O78 A;  2KHN A;  1DF0 B;  4MZJ A;  1PUL A;  3VRQ A;  1GGW A;  1LVC D;  1KK7 Y;  3O2P A;  2WCK A;  2LUC A;  2ZRS A;  3CZ2 A;  1ALW A;  1OOJ A;  1ZUZ A;  2LHL A;  3EVR A;  1BR4 B;  1SK6 D;  4QJ5 B;  1IKU A;  2K0J A;  1T14 A;  2MJW B;  1U5I B;  3VRN A;  2FJU B;  1U5I A;  4ORB B;  4GGN A;  2F8P A;  4ICB A;  1NCY A;  2LUX A;  2NCO A;  1BLQ A;  3TDZ A;  1QWV A;  2F2O A;  2QEH A;  4INW A;  1WLM A;  5KU1 A;  1KQM C;  2KSP A;  3WHT B;  4D1E A;  1IH0 A;  2JTZ A;  3AAK A;  2WC6 A;  2LE9 B;  2L98 A;  1CM4 A;  1MHO A;  3IQQ A;  3A8R A;  4PHM A;  3I5I B;  3TUY B;  2I18 A;  4FQO A;  1TIZ A;  3BUO B;  2JPO A;  3TUY C;  4PHJ A;  2I94 A;  2WCH A;  2BE4 A;  3GOF A;  1PSR A;  1S3P A;  1K8U A;  1NX3 A;  1FF1 A;  1DVI A;  2DOQ A;  3BFB A;  3CS1 A;  4HSZ A;  2BL0 C;  3IVT A;  1JF2 A;  4MN0 A;  1NPQ A;  3SG2 A;  4IJ7 A;  3KHE A;  3BJH A;  4YI8 A;  3BUW B;  4PE4 A;  3FWB A;  4YGC B;  1UHK A;  3VB1 A;  1QIV A;  2ZFD A;  1YTZ C;  3QME A;  4GNK B;  1XFU O;  2FCD A;  2PRU A;  2LMT A;  2LMV A;  3D0Y A;  1QX7 A;  3R1P A;  4NDC A;  4MRX A;  3CGA A;  3SG4 A;  5HL1 A;  1UWO A;  3D77 A;  1NX0 A;  2KDH A;  1XA5 A;  2HQW A;  2PYQ A;  3CR5 X;  3KEV A;  1SCV A;  1WRL A;  3CZ1 A;  1GJY A;  1K9K A;  1F4Q A;  5FYX A;  5AER A;  2QAC A;  1PRW A;  2LVI A;  4TNC A;  1DJI A;  4AQJ A;  1KSM A;  2LM5 A;  4GGF A;  4GGF C;  1CMG A;  2QEB A;  2KNE A;  3DVE A;  1IQ5 A;  1FW4 A;  1DJY A;  1TOP A;  1Y6W A;  1MR8 A;  3OB2 B;  1DJH A;  5HLO A;  4PDZ A;  2PSR A;  3GK2 A;  1QAT A;  1LS8 A;  2BKH B;  3B86 A;  1K9P A;  3EK8 A;  3KPX A;  3RM1 A;  3WXA A;  1R6P A;  2KPH A;  2M9G A;  4OKH A;  2PAS A;  4YBH B;  1H4B A;  2K7B A;  1OMV A;  2CXJ A;  4CPV A;  2NCP A;  2M97 A;  2P6B B;  1YUS A;  3LLE A;  2LAP A;  2KQ6 A;  1L7Z A;  1CDL A;  4L9M A;  1ODB A;  1QV0 A;  3D10 A;  4MSP A;  5JOL A;  4C0J A;  2PVB A;  2CCM A;  3BFH A;  1YX8 A;  4E68 A;  5HKW A;  3LL8 B;  1Q80 A;  1K95 A;  1BOC A;  3DVJ A;  1J7R A;  2LLS A;  3EKH A;  1AP4 A;  3O4X A;  1VRK A;  1BJF A;  2MLF C;  1IRJ A;  2IS9 A;  1EL4 A;  2K2F A;  3GK4 X;  4INX A;  1CDN A;  1NIW A;  3RZS A;  1XFZ O;  1WDC B;  2NXQ A;  2COL B;  5JJG A;  1OOH A;  1WDC C;  1HT9 A;  2K2A A;  2P71 A;  4YGE B;  5ER5 A;  1UHN A;  3PN7 C;  1TUZ A;  1IIO A;  3K1E A;  1M31 A;  2KFG A;  1KK7 Z;  1S36 A;  2HET A;  2LHI A;  2F2P A;  1F8H A;  2WND A;  5D69 A;  2CNP A;  1J7Q A;  3B7A A;  3NHT A;  5FI7 A;  2PMY A;  3R1O A;  3N7H A;  1TWO A;  1YVH A;  2AUC A;  4GAO A;  1PSB A;  2WCM A;  4PE7 A;  1EG3 A;  2KLD A;  1S6I A;  3D74 A;  1KFU S;  1S26 D;  2LVJ A;  2L2C A;  3SG5 A;  2L5X B;  2KAV A;  3S0A A;  4PHK A;  3OX5 A;  4F7F A;  1OMD A;  1SL9 A;  2KAY A;  2Y5I A;  1C3Z A;  1LXF C;  1QVI Z;  2CTN A;  3NSK A;  5B8I B;  1F70 A;  1QLS A;  4DCK A;  2M8U A;  1KFU L;  4HRH A;  3HX4 A;  1IQ3 A;  1K96 A;  1OE9 B;  1ZAC A;  2LLU A;  1K90 D;  3NSL A;  1Y0V H;  2L51 A;  1NX2 A;  1WY9 A;  1C7V A;  1EG4 A;  5BPJ A;  2BCB A;  2EHB A;  3FWC A;  2GGM A;  4PCW A;  1LA0 A;  5CSN A;  2I7A A;  2MHH A;  1DF0 A;  1QAS A;  2NZ0 A;  1PVB A;  1RK9 A;  1UUS A;  1DTL A;  3B87 A;  3JTD B;  1A75 B;  2M49 B;  4XYN A;  4QJ4 B;  4OZD A;  1CLM A;  1SNL A;  1XVJ A;  1K94 A;  2KI4 B;  2M1K B;  5I94 A;  2L4H A;  1OOI X;  2L4I A;  1QIW A;  2LLT A;  3CZ0 A;  2HPS A;  1DQE A;  1PK0 D;  2LP3 A;  2ISD A;  1AUI B;  4I5K A;  1ZOT B;  5I2Q A;  1V1G A;  3WHU B;  3SS5 A;  1F55 A;  2JWW A;  5HLV A;  2KAX A;  4AQI A;  1OZO A;  2H8V A;  1RRO A;  2ZN8 A;  1QVI Y;  1B4C A;  1K2H A;  1ALV A;  3V2L A;  2L0P A;  3KF9 A;  3I5I C;  4CFR A;  1SY9 A;  2F33 A;  2KBM A;  1PVA A;  1NCZ A;  5TNC A;  1CFC A;  2D8N A;  2G2B A;  2M3W A;  3I5F B;  4F0Z B;  1A2X A;  1KWO B;  1WRK A;  1J1E A;  3DYE A;  4I5J A;  1YUR A;  2BBM A;  1CDP A;  4MBE A;  3SS4 A;  3VRR A;  2V53 A;  5I2O A;  1OZS A;  3EK7 A;  4DUQ A;  3BOW B;  2OS8 B;  1E8A A;  2KI6 C;  2OS8 C;  3LK1 A;  4DS7 A;  2BE6 A;  3EG5 B;  1DGU A;  3BXK A;  3FIA A;  5D7F A;  3IQO A;  2JT0 A;  3ZWH A;  1CM1 A;  2ZND A;  3S0B A;  1F54 A;  3D76 A;  1AJ5 A;  3SIB A;  1B9A A;  3Q8I A;  4JKT A;  1CKK A;  3BFA A;  2NLN A;  4R1E A;  1YVL A;  3PSR A;  1AJ4 A;  4I5N B;  1M46 A;  3FE8 A;  1TN4 A;  3OP0 A;  2KBI A;  2LVV A;  3B88 A;  4PE1 A;  4M2O A;  1RFJ A;  2BKI B;  1F4O A;  1CDM A;  4IL1 A;  3DD4 A;  3L4L A;  1DT7 B;  1M39 A;  4FQT A;  1K9U A;  1BG1 A;  2KFH A;  4DIR A;  1BOD A;  3CLN A;  5D3O A;  4OCI A;  4CFQ A;  2KGR A;  4NQG A;  3VRO A;  4ORC B;  1J7O A;  1NSH A;  3I5G B;  1RJV A;  2P70 A;  4OR9 B;  3FE9 A;  3DZT A;  1Y1U A;  2I2R E;  1OOG A;  3CAB A;  2OPO A;  2WOR A;  3I5G C;  4HRE E;  5K89 A;  1K93 D;  2JU0 A;  5EL2 A;  2WC8 A;  3D73 A;  1B8L A;  1G4Y R;  1YR5 A;  3DY9 A;  1XFY O;  4GPL B;  5FI2 A;  3CZT X;  4KYN A;  4UPG A;  1M63 B;  1H8B A;  1TCO B;  1SR6 B;  3VGO A;  1TCF A;  2WCB A;  1SR6 C;  3L47 A;  2QEV A;  1X02 A;  2KQY A;  1Z2C B;  1QX2 A;  1N0Y A;  3PM8 A;  2A4J A;  4MZL A;  1YUU A;  4YGD B;  1TUJ A; 
#chains in the Genus database with same CATH homology
 1TUZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...