1TUZA

Nmr structure of the diacylglycerol kinase alpha, nesgc target hr532
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
118
structure length
118
Chain Sequence
MAKERGLISPSDFAQLQKYMEYSTKKVSDVLKLFEDGEMAKYVQGDAIGYEGFQQFLKIYLEVDNVPRHLSLALFQSFETGHCLNETNVTKDVVCLNDVSCYFSLLEGGRPEDKLEWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords diacylglycerol kinase alpha
publication title NMR structure of Diacylglycerol kinase alpha, NESGC target HR532
rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 22
structure length 118
sequence length 118
ec nomenclature ec 2.7.1.107: Diacylglycerol kinase (ATP).
pdb deposition date 2004-06-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14513 DAG_kinase_N Diacylglycerol kinase N-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.110 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 Diacylglycerol kinase alpha. 1tuzA00
1TUZA
chains in the Genus database with same CATH superfamily
1A4PA 3A4UB 3PLFB 2HETA 3UO9A 1AK8A 2LP3A 3V2LA 2JNFA 3O2PA 2M1UA 1LVCD 1QIWA 1OOGA 1TUZA 1CM4A 1IQ5A 1F4OA 1SRAA 2BCBA 5HLOA 1FF1A 1CDNA 1KQVA 1CDPA 1M31A 1N2DA 3OB2B 1ALWA 3D73A 1GJYA 4HRGA 1A75A 5TNCA 4FQTA 1SL8A 3L47A 3FE6A 2MLEC 4HRHA 4YI8A 1FI6A 5GQQC 2OS8C 5AANA 5EL2A 3BOWA 1JF2A 2P70A 3CR5X 1KK8B 1Y1UA 3VB1A 1DELA 1ALVA 2Y1NA 2KOTA 4N1FA 1CLLA 2KSPA 1W9ZA 1K9UA 1DJGA 1MQ1A 1YR5A 2ZRSA 3SG6A 3Q8IA 1KCYA 1L2OB 3R1OA 1IRJA 4MLWA 1PSRA 2MHHA 2M7LA 2GV5A 2JTZA 3IQOA 1TNPA 5HKYA 1B8LA 4OV2A 3D0YB 4YGDB 1GGWA 1G4YR 1V1GA 1DJWA 1JC2A 4OKHA 3D78A 1GM0A 3ICBA 3TDZA 1SMGA 2H2KA 5KU1A 2AUCA 1MXEA 2F3ZA 2ZNEA 4P2YB 4DUQA 2KI4B 1S5GY 4WRIA 2Q4UA 3TZ1A 2I18A 2LLUA 5CSFA 3AKBA 1QLKA 5JOLA 2L5XB 4MVFA 2NLNA 1L2OC 2KFHA 2VRGA 2ZN9A 2JC2A 3OX5A 2K8MB 1J1DA 4PALA 1G33A 3EK7A 4AOMA 1JBAA 5DICA 1OSAA 3ZNIA 2WCEA 1XA5A 2JPOA 5IBWA 1MUXA 1XFYO 2Y4QA 5F6TA 1KQMB 1AVSA 1S5GZ 2Q91A 3WNXB 5I2OA 4N5XA 4U8DA 3O78A 1YX8A 4IJ7A 1CLBA 2LE9B 2BECA 1IJ5A 1QATA 1QX5B 5HYDA 1NCYA 2M8UA 2E6WA 2LP2A 2KI4C 1XFWO 3CZ1A 4PE4A 1A29A 2NCOA 2P71A 1NX0A 2LMUA 2LVJA 1OMDA 1M63B 2RGIA 3BQ3A 1B8CA 2O5GA 3I5GB 1PVAA 2JNXA 1QX7A 3LK0A 3S0GA 2K2FA 1YTZC 3JTDB 4Q04A 3B88A 2GGMA 1K93D 3I5FB 4DRWA 1C3ZA 1QTXA 2AMIA 2K2AA 2QEVA 1J7RA 2LMTA 4AQJA 4XJKB 3SIAA 1KFUS 3BFAA 3L4LA 1K95A 1RWYA 5D69A 4NDCA 1A03A 3I5IB 3KHEA 1TUJA 1XFUO 1XFZO 1QV1A 1ZMZA 2M9GA 1BR4B 1BLQA 1DJZA 2M1KB 2FJYA 3PFVA 1TN4A 1FBVA 3I5GC 1T14A 4MZJA 1DQEA 3JTDC 1Z2CB 3KF9A 1TCFA 4YGAA 3SG4A 1AJ4A 3NSIA 1OQPA 4C0JA 2JZIA 1J7PA 3FE9A 1K8UA 1AP4A 2LAPA 2ERBA 3ZWHA 1YVLA 2KI6C 4MRXA 2COLB 2HQWA 3OB1B 1UHIA 5ER4X 2ZNDA 5HKWA 1MWNA 3OX6A 2HQ8A 4GFTA 4MBEA 3BUMB 5JJGA 2YGUA 1FPWA 1YVHA 1BMOA 2LUCA 2ISDA 4YGEB 1XFVO 1E8AA 2I94A 1B1GA 1ZACA 3EK8A 2L4IA 3WHUB 4E68A 1G8IA 4ICBA 4JD9A 1J55A 2FOTA 1QJTA 3PALA 1B8RA 3AKAA 2PVBA 2H61A 2KDHA 2MA2A 3EVRA 2LLTA 4M2QA 1XFRA 2QEHA 4JKTA 2PMYA 3R1PA 2M49B 1X02A 3LCPC 3RZSA 3VGOA 1C7WA 3D10A 1W7JB 2OTGB 2I7AA 4MRYA 1K2HA 2IS9A 3BOWB 2WCHA 1KSOA 3PATA 4NQGA 1NX2A 3VRPA 4BY5A 4CIDA 5K89A 1AJ5A 2EC6C 3B7AA 3GK1A 1PALA 2HPSA 3CABA 4YGBB 1CNPA 1LS8A 5B8IB 4N1GA 1XK4C 1CM1A 1DJXA 4MZKA 1IJ6A 2L50A 1TCOB 3BFHA 4FQOA 1PRWA 1WDCB 3TUYC 3OGNA 4ZCUA 3DXLA 1CFDA 3EVVA 3HCMA 3E3RA 5I2LA 1DEKA 1DGVA 3CTNA 4F0ZB 3CS1A 1F70A 2WC8A 1UHHA 1WY9A 1CFCA 1YRTB 4INWA 2CBLA 2OTGC 1B7TY 2KFFA 3DD4A 1KFXS 2PASA 4TNCA 2MRDA 1TIZA 5CSNA 3SJSA 2FJUB 3MSEB 4MSPA 2PALA 1EL4A 4FTGA 1M45A 2LCPA 4PHJA 4QJ4B 1Z4HA 4ORAB 1WDCC 3CZ0A 4I5KA 1NCZA 4JQ0D 2QDIA 3R1VA 2DOQA 1B7TZ 2LVIA 1OZOA 1LA3A 2WCMA 1ZFSA 1PK0D 2L4HA 2JT8A 2WOSA 3CYZA 1KSMA 3CR2A 3LLEA 3DVJA 5PALA 1VRKA 5KTYA 2AAOA 1XVJA 1XYDA 3NSKA 2JRFA 2BBNA 3DVEA 2LUXA 4INXA 1QIVA 2HF5A 1S1EA 2LVVA 5DKQA 2NXQA 1S6IA 2M0RA 2I2RE 4F7FA 1OMVA 1TOPA 1WLMA 2JQ6A 2LANA 3EKHA 2G2BA 4CFRA 2CNPA 3IF7A 4PCWA 1AHRA 2PSRA 3NHTA 1QVIZ 1SCVA 2LMVA 1EH2A 1B47A 2BNXA 1SL7A 1U5IB 3QMEA 3QRXA 4PHKA 4CLNA 3PM2A 2K61A 4C0KA 1UHJA 1Q80A 1IWQA 3D0YA 4L9MA 2KHNA 3GK4X 4PE1A 1QLSA 1RFJA 3SS5A 1YUTA 1KFXL 1K9PA 1ZOTB 1KWOB 1Y1AA 2FCDA 2OPOA 5AERA 2CCMA 2TN4A 3NSLA 5CSJA 3M0WA 2WC5A 3R72A 1NX1A 4A4CA 1XFXO 3FS7A 4CFQA 4IL1A 4YRUA 3K21A 4HSZA 1A2XA 1QXPA 1ZUZA 1SNLA 3CR4X 3EG5B 1B4CA 3CDNA 2KYFA 4R1EA 3NHIA 2QEOA 2K60A 1DTLA 2MLFC 2BL0B 2KBMA 3A8RA 1ODBA 1OOFA 2PYQA 4DIRA 4ZCVA 3RLZA 2EGDA 3WHTB 2F3YA 2KAYA 1MF8B 2KLDA 1P28A 1KWOC 3DZTA 4OZDA 2MBXA 3UNWA 1W7IB 3DYEA 3BUXB 3DF0B 2M3WA 2F8PA 2ZRTA 3SS3A 1SR6B 2EHBA 3FWBA 3I5HC 5FI2A 3OHMB 1IGVA 2BKHB 1EXRA 1XO5A 4PE7A 3CWGA 3FE8A 1R2UA 1S26D 1QS7A 3B86A 2BE4A 2CXJA 2WCBA 2BL0C 1TWOA 4WQ2A 3RM1A 1DF0B 3EK4A 1QV0A 5BPJA 1C7VA 4I5JA 1BU3A 2F2PA 2EC6B 4GGFC 3C1VA 4XJKA 3FIAA 3SG2A 1CTRA 4I5LB 4GGNA 3BYAA 4PDZA 1MHOA 1CMGA 1EG4A 1TNXA 1TRFA 3KPXA 1SR6C 3SG7A 3TUYB 1J7QA 2KPHA 4ORCB 2NCPA 1KFUL 1F55A 2JXLA 5HLVA 1JSAA 4ORBB 5CSIA 2D8NA 2QACA 3S0BA 4HREE 1A75B 3K1EA 3SIBA 3SG5A 4D1EA 1DMOA 1IIOA 1NP8A 3S0EA 2LVKA 1KK7Y 1AUIB 1K96A 4C0LA 1S3PA 2L5YA 2H61C 3OP0A 1NCXA 2WC6A 1JF0A 2JOJA 2K7DA 3O4XA 2BE6A 1OOHA 2M29A 2L0PA 5G08A 3EVUA 4JPZB 1JFKA 1QX2A 1CFPA 2ZKMX 1LINA 1FW4A 2PQLA 4OCIA 1KK7Z 1NUBA 3PJIA 1ORGA 2K7BA 3IVTA 1CLMA 3LL8B 1BR1B 1TNWA 3N7HA 5D7FA 4BY4A 1CKKA 3GOFA 3KEVA 2P6BB 2QPTA 2WCKA 3TDUA 2LHIA 5AEQA 3KO0A 4MZLA 1HQVA 1UP5A 4GNKB 2L51A 1YX7A 4QJ5B 1YUSA 4YI9A 2WCJA 4PT1A 4AQIA 1SKTA 2WCFA 1M46A 2JU0A 3S0FA 2F33A 3BUWB 2WORA 3TS5C 3D77A 2WNDA 2BBMA 2KGRA 1QVIY 2KNEA 1S6JA 3B87A 3CLNA 4MEWA 1Y0VH 2L2CA 1OE9B 2BCXA 1J7OA 2SCPA 1SSEB 1QASA 3BJHA 1NSHA 2CT9A 5I94A 5I8NA 3NXAA 1OOIX 2KAXA 1DT7B 4M2OA 1HT9A 1DGUA 1BG1A 3LK1A 1BJFA 1RTP1 1YURA 2CTNA 1N65A 2F2OA 2L98A 3NSOA 5FI6A 3CZTX 1YRUB 1NPQA 1SCMB 4M2PA 5J3XA 4A4BA 1DC1A 3FWCA 3HX4A 1D1OA 3TDIA 4UPGA 1BT6A 1TNQA 2KBIA 2K0JA 1TTXA 1CMFA 3JVTB 1NX3A 3S0AA 1KK8C 1PVBA 2E30A 2JT3A 2MJWB 2JTTA 2M7NA 1C07A 1RROA 1UWOA 4USLA 4YGCB 1SL9A 5CPVA 5D3OA 4WQ3A 5AXIA 5AFPA 1F4QA 1FI5A 5HKZA 2JT0A 2LC5A 2LHLA 2PRUA 1DJYA 2KAVA 1BODA 1M39A 2A4JA 3SS4A 3D76A 3AAKA 1WLZA 3I5HB 1Y1XA 4NDDA 2ZFDA 1SCMC 2GGZA 1DVIA 2Y5IA 3B6XA 1IKUA 2JXCA 2LM5A 4DS7A 1UHNA 1CB1A 3S0DA 3O4YA 1EJ3A 3JVTC 2SASA 3EKJA 1BOCA 1JWDA 4PHNA 5HL1A 4QJ3B 1F8HA 2BAPA 2KFGA 1OZSA 3H4SE 4JWQA 1F71A 1V1FA 1MXLC 3AAJA 1EG3A 2R2IA 4OR9B 1WRKA 2H8VA 3CGAA 1SYMA 1U5IA 4GBAA 2LLSA 3D74A 3BFBA 3BUNB 1RJVA 4NDBA 2JWWA 5FI7A 1K94A 1OW4A 2ZN8A 1YUUA 4YBHB 1DJIA 1B9AA 3IQQA 1H8BA 1JUOA 1GQMA 1IH0A 1BF5A 2K7CA 1L7ZA 1KQMC 2V53A 3PM8A 2LNKA 2NZ0A 1PSBA 1K9KA 4CPVA 1RK9A 2Y1MA 1N0YA 5DKNA 1OMRA 1IG5A 1GGZA 1S6CA 2KGBC 2O60A 2JPTA 4GPLB 2JULA 2QEBA 1S36A 1R6PA 3O6BA 1WRZA 2K7OA 4MN0A 1UUSA 2B1UA 4P5OE 1CFFA 3VROA 2KQ6A 1SPYA 3OBVA 1K90D 3PN7B 1F54A 1SK6D 3BUOB 3GK2A 3DVKA 5DKRA 3I5FC 1CDLA 4PHMA 4GGFA 1LXFC 4GUKA 4GAOA 2MAZA 2BCAA 1MR8A 3DF0A 1H4BA 1JFJA 1UURA 4XYNA 5ER5A 2G9BA 3VRNA 1WRLA 2FCEA 2L2EA 3F45A 2KYCA 4I5NB 1SW8A 3VRRA 4DCKA 1IQ3A 3I5IC 5I2QA 1NYAA 3D75A 1DJHA 2M97A 1NIWA 2WCLA 3DY9A 2BKIB 1QWVA 3VRQA 1NWDA 3L4AA 5KSZA 3PN7C 1OOJA 1UHKA 1RECA 1PULA 1LKJA 2KQYA 1CDMA 4OVNF 1J1EA 5FYXA 1LA0A 1DF0A 1C3YA 2OS8B 3NGVA 4PE0A 3SG3A 3WXAA 3DVMA 2GTEA 4KYNA 2LV7A 1SBJA 3CZ2A 1Y6WA 4ETOA 1SY9A 3BXKA 2KLEA 3TS5B 1XK4A 3PSRA 2KI6D
chains in the Genus database with same CATH topology
1TUZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TUZ A; 
#chains in the Genus database with same CATH topology
 1A4P A;  3A4U B;  3PLF B;  2HET A;  3UO9 A;  1AK8 A;  2LP3 A;  3V2L A;  2JNF A;  3O2P A;  2M1U A;  1LVC D;  1QIW A;  1OOG A;  1TUZ A;  1CM4 A;  1IQ5 A;  1F4O A;  1SRA A;  2BCB A;  5HLO A;  1FF1 A;  1CDN A;  1KQV A;  1CDP A;  1M31 A;  1N2D A;  3OB2 B;  1ALW A;  3D73 A;  1GJY A;  4HRG A;  1A75 A;  5TNC A;  4FQT A;  1SL8 A;  3L47 A;  3FE6 A;  2MLE C;  4HRH A;  4YI8 A;  1FI6 A;  5GQQ C;  2OS8 C;  5AAN A;  5EL2 A;  3BOW A;  1JF2 A;  2P70 A;  3CR5 X;  1KK8 B;  1Y1U A;  3VB1 A;  1DEL A;  1ALV A;  2Y1N A;  2KOT A;  4N1F A;  1CLL A;  2KSP A;  1W9Z A;  1K9U A;  1DJG A;  1MQ1 A;  1YR5 A;  2ZRS A;  3SG6 A;  3Q8I A;  1KCY A;  1L2O B;  3R1O A;  1IRJ A;  4MLW A;  1PSR A;  2MHH A;  2M7L A;  2GV5 A;  2JTZ A;  3IQO A;  1TNP A;  5HKY A;  1B8L A;  4OV2 A;  3D0Y B;  4YGD B;  1GGW A;  1G4Y R;  1V1G A;  1DJW A;  1JC2 A;  4OKH A;  3D78 A;  1GM0 A;  3ICB A;  3TDZ A;  1SMG A;  2H2K A;  5KU1 A;  2AUC A;  1MXE A;  2F3Z A;  2ZNE A;  4P2Y B;  4DUQ A;  2KI4 B;  1S5G Y;  4WRI A;  2Q4U A;  3TZ1 A;  2I18 A;  2LLU A;  5CSF A;  3AKB A;  1QLK A;  5JOL A;  2L5X B;  4MVF A;  2NLN A;  1L2O C;  2KFH A;  2VRG A;  2ZN9 A;  2JC2 A;  3OX5 A;  2K8M B;  1J1D A;  4PAL A;  1G33 A;  3EK7 A;  4AOM A;  1JBA A;  5DIC A;  1OSA A;  3ZNI A;  2WCE A;  1XA5 A;  2JPO A;  5IBW A;  1MUX A;  1XFY O;  2Y4Q A;  5F6T A;  1KQM B;  1AVS A;  1S5G Z;  2Q91 A;  3WNX B;  5I2O A;  4N5X A;  4U8D A;  3O78 A;  1YX8 A;  4IJ7 A;  1CLB A;  2LE9 B;  2BEC A;  1IJ5 A;  1QAT A;  1QX5 B;  5HYD A;  1NCY A;  2M8U A;  2E6W A;  2LP2 A;  2KI4 C;  1XFW O;  3CZ1 A;  4PE4 A;  1A29 A;  2NCO A;  2P71 A;  1NX0 A;  2LMU A;  2LVJ A;  1OMD A;  1M63 B;  2RGI A;  3BQ3 A;  1B8C A;  2O5G A;  3I5G B;  1PVA A;  2JNX A;  1QX7 A;  3LK0 A;  3S0G A;  2K2F A;  1YTZ C;  3JTD B;  4Q04 A;  3B88 A;  2GGM A;  1K93 D;  3I5F B;  4DRW A;  1C3Z A;  1QTX A;  2AMI A;  2K2A A;  2QEV A;  1J7R A;  2LMT A;  4AQJ A;  4XJK B;  3SIA A;  1KFU S;  3BFA A;  3L4L A;  1K95 A;  1RWY A;  5D69 A;  4NDC A;  1A03 A;  3I5I B;  3KHE A;  1TUJ A;  1XFU O;  1XFZ O;  1QV1 A;  1ZMZ A;  2M9G A;  1BR4 B;  1BLQ A;  1DJZ A;  2M1K B;  2FJY A;  3PFV A;  1TN4 A;  1FBV A;  3I5G C;  1T14 A;  4MZJ A;  1DQE A;  3JTD C;  1Z2C B;  3KF9 A;  1TCF A;  4YGA A;  3SG4 A;  1AJ4 A;  3NSI A;  1OQP A;  4C0J A;  2JZI A;  1J7P A;  3FE9 A;  1K8U A;  1AP4 A;  2LAP A;  2ERB A;  3ZWH A;  1YVL A;  2KI6 C;  4MRX A;  2COL B;  2HQW A;  3OB1 B;  1UHI A;  5ER4 X;  2ZND A;  5HKW A;  1MWN A;  3OX6 A;  2HQ8 A;  4GFT A;  4MBE A;  3BUM B;  5JJG A;  2YGU A;  1FPW A;  1YVH A;  1BMO A;  2LUC A;  2ISD A;  4YGE B;  1XFV O;  1E8A A;  2I94 A;  1B1G A;  1ZAC A;  3EK8 A;  2L4I A;  3WHU B;  4E68 A;  1G8I A;  4ICB A;  4JD9 A;  1J55 A;  2FOT A;  1QJT A;  3PAL A;  1B8R A;  3AKA A;  2PVB A;  2H61 A;  2KDH A;  2MA2 A;  3EVR A;  2LLT A;  4M2Q A;  1XFR A;  2QEH A;  4JKT A;  2PMY A;  3R1P A;  2M49 B;  1X02 A;  3LCP C;  3RZS A;  3VGO A;  1C7W A;  3D10 A;  1W7J B;  2OTG B;  2I7A A;  4MRY A;  1K2H A;  2IS9 A;  3BOW B;  2WCH A;  1KSO A;  3PAT A;  4NQG A;  1NX2 A;  3VRP A;  4BY5 A;  4CID A;  5K89 A;  1AJ5 A;  2EC6 C;  3B7A A;  3GK1 A;  1PAL A;  2HPS A;  3CAB A;  4YGB B;  1CNP A;  1LS8 A;  5B8I B;  4N1G A;  1XK4 C;  1CM1 A;  1DJX A;  4MZK A;  1IJ6 A;  2L50 A;  1TCO B;  3BFH A;  4FQO A;  1PRW A;  1WDC B;  3TUY C;  3OGN A;  4ZCU A;  3DXL A;  1CFD A;  3EVV A;  3HCM A;  3E3R A;  5I2L A;  1DEK A;  1DGV A;  3CTN A;  4F0Z B;  3CS1 A;  1F70 A;  2WC8 A;  1UHH A;  1WY9 A;  1CFC A;  1YRT B;  4INW A;  2CBL A;  2OTG C;  1B7T Y;  2KFF A;  3DD4 A;  1KFX S;  2PAS A;  4TNC A;  2MRD A;  1TIZ A;  5CSN A;  3SJS A;  2FJU B;  3MSE B;  4MSP A;  2PAL A;  1EL4 A;  4FTG A;  1M45 A;  2LCP A;  4PHJ A;  4QJ4 B;  1Z4H A;  4ORA B;  1WDC C;  3CZ0 A;  4I5K A;  1NCZ A;  4JQ0 D;  2QDI A;  3R1V A;  2DOQ A;  1B7T Z;  2LVI A;  1OZO A;  1LA3 A;  2WCM A;  1ZFS A;  1PK0 D;  2L4H A;  2JT8 A;  2WOS A;  3CYZ A;  1KSM A;  3CR2 A;  3LLE A;  3DVJ A;  5PAL A;  1VRK A;  5KTY A;  2AAO A;  1XVJ A;  1XYD A;  3NSK A;  2JRF A;  2BBN A;  3DVE A;  2LUX A;  4INX A;  1QIV A;  2HF5 A;  1S1E A;  2LVV A;  5DKQ A;  2NXQ A;  1S6I A;  2M0R A;  2I2R E;  4F7F A;  1OMV A;  1TOP A;  1WLM A;  2JQ6 A;  2LAN A;  3EKH A;  2G2B A;  4CFR A;  2CNP A;  3IF7 A;  4PCW A;  1AHR A;  2PSR A;  3NHT A;  1QVI Z;  1SCV A;  2LMV A;  1EH2 A;  1B47 A;  2BNX A;  1SL7 A;  1U5I B;  3QME A;  3QRX A;  4PHK A;  4CLN A;  3PM2 A;  2K61 A;  4C0K A;  1UHJ A;  1Q80 A;  1IWQ A;  3D0Y A;  4L9M A;  2KHN A;  3GK4 X;  4PE1 A;  1QLS A;  1RFJ A;  3SS5 A;  1YUT A;  1KFX L;  1K9P A;  1ZOT B;  1KWO B;  1Y1A A;  2FCD A;  2OPO A;  5AER A;  2CCM A;  2TN4 A;  3NSL A;  5CSJ A;  3M0W A;  2WC5 A;  3R72 A;  1NX1 A;  4A4C A;  1XFX O;  3FS7 A;  4CFQ A;  4IL1 A;  4YRU A;  3K21 A;  4HSZ A;  1A2X A;  1QXP A;  1ZUZ A;  1SNL A;  3CR4 X;  3EG5 B;  1B4C A;  3CDN A;  2KYF A;  4R1E A;  3NHI A;  2QEO A;  2K60 A;  1DTL A;  2MLF C;  2BL0 B;  2KBM A;  3A8R A;  1ODB A;  1OOF A;  2PYQ A;  4DIR A;  4ZCV A;  3RLZ A;  2EGD A;  3WHT B;  2F3Y A;  2KAY A;  1MF8 B;  2KLD A;  1P28 A;  1KWO C;  3DZT A;  4OZD A;  2MBX A;  3UNW A;  1W7I B;  3DYE A;  3BUX B;  3DF0 B;  2M3W A;  2F8P A;  2ZRT A;  3SS3 A;  1SR6 B;  2EHB A;  3FWB A;  3I5H C;  5FI2 A;  3OHM B;  1IGV A;  2BKH B;  1EXR A;  1XO5 A;  4PE7 A;  3CWG A;  3FE8 A;  1R2U A;  1S26 D;  1QS7 A;  3B86 A;  2BE4 A;  2CXJ A;  2WCB A;  2BL0 C;  1TWO A;  4WQ2 A;  3RM1 A;  1DF0 B;  3EK4 A;  1QV0 A;  5BPJ A;  1C7V A;  4I5J A;  1BU3 A;  2F2P A;  2EC6 B;  4GGF C;  3C1V A;  4XJK A;  3FIA A;  3SG2 A;  1CTR A;  4I5L B;  4GGN A;  3BYA A;  4PDZ A;  1MHO A;  1CMG A;  1EG4 A;  1TNX A;  1TRF A;  3KPX A;  1SR6 C;  3SG7 A;  3TUY B;  1J7Q A;  2KPH A;  4ORC B;  2NCP A;  1KFU L;  1F55 A;  2JXL A;  5HLV A;  1JSA A;  4ORB B;  5CSI A;  2D8N A;  2QAC A;  3S0B A;  4HRE E;  1A75 B;  3K1E A;  3SIB A;  3SG5 A;  4D1E A;  1DMO A;  1IIO A;  1NP8 A;  3S0E A;  2LVK A;  1KK7 Y;  1AUI B;  1K96 A;  4C0L A;  1S3P A;  2L5Y A;  2H61 C;  3OP0 A;  1NCX A;  2WC6 A;  1JF0 A;  2JOJ A;  2K7D A;  3O4X A;  2BE6 A;  1OOH A;  2M29 A;  2L0P A;  5G08 A;  3EVU A;  4JPZ B;  1JFK A;  1QX2 A;  1CFP A;  2ZKM X;  1LIN A;  1FW4 A;  2PQL A;  4OCI A;  1KK7 Z;  1NUB A;  3PJI A;  1ORG A;  2K7B A;  3IVT A;  1CLM A;  3LL8 B;  1BR1 B;  1TNW A;  3N7H A;  5D7F A;  4BY4 A;  1CKK A;  3GOF A;  3KEV A;  2P6B B;  2QPT A;  2WCK A;  3TDU A;  2LHI A;  5AEQ A;  3KO0 A;  4MZL A;  1HQV A;  1UP5 A;  4GNK B;  2L51 A;  1YX7 A;  4QJ5 B;  1YUS A;  4YI9 A;  2WCJ A;  4PT1 A;  4AQI A;  1SKT A;  2WCF A;  1M46 A;  2JU0 A;  3S0F A;  2F33 A;  3BUW B;  2WOR A;  3TS5 C;  3D77 A;  2WND A;  2BBM A;  2KGR A;  1QVI Y;  2KNE A;  1S6J A;  3B87 A;  3CLN A;  4MEW A;  1Y0V H;  2L2C A;  1OE9 B;  2BCX A;  1J7O A;  2SCP A;  1SSE B;  1QAS A;  3BJH A;  1NSH A;  2CT9 A;  5I94 A;  5I8N A;  3NXA A;  1OOI X;  2KAX A;  1DT7 B;  4M2O A;  1HT9 A;  1DGU A;  1BG1 A;  3LK1 A;  1BJF A;  1RTP 1;  1YUR A;  2CTN A;  1N65 A;  2F2O A;  2L98 A;  3NSO A;  5FI6 A;  3CZT X;  1YRU B;  1NPQ A;  1SCM B;  4M2P A;  5J3X A;  4A4B A;  1DC1 A;  3FWC A;  3HX4 A;  1D1O A;  3TDI A;  4UPG A;  1BT6 A;  1TNQ A;  2KBI A;  2K0J A;  1TTX A;  1CMF A;  3JVT B;  1NX3 A;  3S0A A;  1KK8 C;  1PVB A;  2E30 A;  2JT3 A;  2MJW B;  2JTT A;  2M7N A;  1C07 A;  1RRO A;  1UWO A;  4USL A;  4YGC B;  1SL9 A;  5CPV A;  5D3O A;  4WQ3 A;  5AXI A;  5AFP A;  1F4Q A;  1FI5 A;  5HKZ A;  2JT0 A;  2LC5 A;  2LHL A;  2PRU A;  1DJY A;  2KAV A;  1BOD A;  1M39 A;  2A4J A;  3SS4 A;  3D76 A;  3AAK A;  1WLZ A;  3I5H B;  1Y1X A;  4NDD A;  2ZFD A;  1SCM C;  2GGZ A;  1DVI A;  2Y5I A;  3B6X A;  1IKU A;  2JXC A;  2LM5 A;  4DS7 A;  1UHN A;  1CB1 A;  3S0D A;  3O4Y A;  1EJ3 A;  3JVT C;  2SAS A;  3EKJ A;  1BOC A;  1JWD A;  4PHN A;  5HL1 A;  4QJ3 B;  1F8H A;  2BAP A;  2KFG A;  1OZS A;  3H4S E;  4JWQ A;  1F71 A;  1V1F A;  1MXL C;  3AAJ A;  1EG3 A;  2R2I A;  4OR9 B;  1WRK A;  2H8V A;  3CGA A;  1SYM A;  1U5I A;  4GBA A;  2LLS A;  3D74 A;  3BFB A;  3BUN B;  1RJV A;  4NDB A;  2JWW A;  5FI7 A;  1K94 A;  1OW4 A;  2ZN8 A;  1YUU A;  4YBH B;  1DJI A;  1B9A A;  3IQQ A;  1H8B A;  1JUO A;  1GQM A;  1IH0 A;  1BF5 A;  2K7C A;  1L7Z A;  1KQM C;  2V53 A;  3PM8 A;  2LNK A;  2NZ0 A;  1PSB A;  1K9K A;  4CPV A;  1RK9 A;  2Y1M A;  1N0Y A;  5DKN A;  1OMR A;  1IG5 A;  1GGZ A;  1S6C A;  2KGB C;  2O60 A;  2JPT A;  4GPL B;  2JUL A;  2QEB A;  1S36 A;  1R6P A;  3O6B A;  1WRZ A;  2K7O A;  4MN0 A;  1UUS A;  2B1U A;  4P5O E;  1CFF A;  3VRO A;  2KQ6 A;  1SPY A;  3OBV A;  1K90 D;  3PN7 B;  1F54 A;  1SK6 D;  3BUO B;  3GK2 A;  3DVK A;  5DKR A;  3I5F C;  1CDL A;  4PHM A;  4GGF A;  1LXF C;  4GUK A;  4GAO A;  2MAZ A;  2BCA A;  1MR8 A;  3DF0 A;  1H4B A;  1JFJ A;  1UUR A;  4XYN A;  5ER5 A;  2G9B A;  3VRN A;  1WRL A;  2FCE A;  2L2E A;  3F45 A;  2KYC A;  4I5N B;  1SW8 A;  3VRR A;  4DCK A;  1IQ3 A;  3I5I C;  5I2Q A;  1NYA A;  3D75 A;  1DJH A;  2M97 A;  1NIW A;  2WCL A;  3DY9 A;  2BKI B;  1QWV A;  3VRQ A;  1NWD A;  3L4A A;  5KSZ A;  3PN7 C;  1OOJ A;  1UHK A;  1REC A;  1PUL A;  1LKJ A;  2KQY A;  1CDM A;  4OVN F;  1J1E A;  5FYX A;  1LA0 A;  1DF0 A;  1C3Y A;  2OS8 B;  3NGV A;  4PE0 A;  3SG3 A;  3WXA A;  3DVM A;  2GTE A;  4KYN A;  2LV7 A;  1SBJ A;  3CZ2 A;  1Y6W A;  4ETO A;  1SY9 A;  3BXK A;  2KLE A;  3TS5 B;  1XK4 A;  3PSR A;  2KI6 D; 
#chains in the Genus database with same CATH homology
 1TUZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...