1TUZA

Nmr structure of the diacylglycerol kinase alpha, nesgc target hr532
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
118
structure length
118
Chain Sequence
MAKERGLISPSDFAQLQKYMEYSTKKVSDVLKLFEDGEMAKYVQGDAIGYEGFQQFLKIYLEVDNVPRHLSLALFQSFETGHCLNETNVTKDVVCLNDVSCYFSLLEGGRPEDKLEWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords diacylglycerol kinase alpha
publication title NMR structure of Diacylglycerol kinase alpha, NESGC target HR532
rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 22
structure length 118
sequence length 118
ec nomenclature ec 2.7.1.107: Diacylglycerol kinase (ATP).
pdb deposition date 2004-06-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14513 DAG_kinase_N Diacylglycerol kinase N-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.110 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 Diacylglycerol kinase alpha. 1tuzA00
1TUZA
chains in the Genus database with same CATH superfamily
3NSKA 1PVBA 1TNPA 3MSEB 1MF8B 1ZOTB 4U8DA 3VRPA 2FOTA 3SG2A 2WC8A 1BF5A 2KGBC 2KFHA 3SIAA 3BUMB 3EG5B 2PALA 2LLSA 5IBWA 2KSPA 1YX8A 3S0FA 2CCMA 1XO5A 4IJ7A 1QTXA 3PATA 4I5LB 2D8NA 2CNPA 1CLBA 5ER5A 1Q80A 4UPGA 3D73A 3FS7A 4YBHB 2ZNDA 4QJ4B 1DC1A 1JFKA 1CM1A 1M39A 1ZMZA 3M0WA 1PSRA 4HREE 2WC5A 1QIVA 1QVIY 1RTP1 1DGUA 1NP8A 1XFZO 3O6BA 3NSOA 2L4HA 3Q8IA 1EG3A 3PJIA 3BUXB 1YUUA 4MZLA 1B8LA 1QX2A 3D0YA 2A4JA 5JJGA 1TRFA 4YI8A 4A4CA 1WRZA 1DJIA 2K7DA 2PYQA 3CR2A 2KLEA 3L47A 3PN7B 2BBMA 2EC6C 1WDCB 1K2HA 2BKIB 1NYAA 2F2OA 2WORA 2BE4A 1ZACA 1PVAA 5ER4X 4JQ0D 2QEHA 2LC5A 3CS1A 4I5NB 3VRQA 2HQ8A 2KAXA 1OOFA 1CDPA 2WCHA 2Y5IA 4GPLB 4HRHA 3UO9A 1S1EA 3RZSA 1K93D 2K0JA 2M7NA 1CKKA 4INXA 3PN7C 1FPWA 1WDCC 4YGAA 2BNXA 1C3YA 2H61A 1PULA 4NQGA 1HQVA 2JTTA 1JSAA 2LLTA 2HF5A 2KHNA 2M0RA 4ZCVA 1XA5A 4PALA 2I94A 4JKTA 2ERBA 2JC2A 2GGMA 3LK1A 4Q04A 1NUBA 1B8RA 1LXFC 1K94A 2BCAA 4PE1A 1CM4A 1LA0A 5JOLA 3SG5A 2NXQA 2O5GA 2MRDA 1QVIZ 4GAOA 5I8NA 3JVTB 4CFRA 5K89A 1HT9A 2BBNA 3BUNB 1DJYA 1ALVA 1UUSA 1V1GA 5FYXA 3GK4X 1XVJA 3OBVA 4YI9A 2H8VA 4MRXA 1GGWA 1QXPA 1LA3A 2Q4UA 2ZRSA 1UURA 2PASA 3WHUB 1NX1A 1C7VA 3I5HB 4TNCA 2VRGA 1AHRA 1F70A 3OX5A 3IQQA 1CFFA 1JWDA 5HL1A 2MAZA 3JVTC 2CT9A 3AKAA 1C3ZA 1OOIX 1IGVA 2ZN8A 1NCXA 3CR5X 3D75A 4ORAB 3EKJA 4F7FA 3CZ2A 1AJ4A 1N2DA 2KBIA 1TCFA 3R1OA 1B4CA 2L4IA 2LVKA 1BR4B 2M49B 2OTGB 2DOQA 3OHMB 3S0DA 3VRNA 1NPQA 2OPOA 1DJZA 4DRWA 1YUSA 2ISDA 4USLA 4DS7A 1IRJA 1CFCA 5HKYA 1M45A 1KSMA 2BCBA 3I5IB 4YGBB 1A2XA 4DIRA 1IG5A 1ODBA 1OMRA 1U5IB 3BFHA 5F6TA 1KQMB 1KFUS 1DT7B 2E6WA 1R2UA 1RROA 3BQ3A 1BR1B 2GV5A 1TNXA 2H2KA 1BLQA 2LMUA 3FWCA 1CTRA 1FW4A 1LVCD 2AMIA 4CFQA 2JT0A 1SYMA 1Y1XA 1MWNA 2QACA 2AAOA 1CDNA 3TUYC 4YRUA 1NX2A 3LLEA 5EL2A 1OZOA 3H4SE 3GK2A 3I5IC 3SG4A 1QJTA 1NIWA 2HQWA 2KI4B 3KF9A 2K2FA 1KQMC 4DUQA 3D74A 3RLZA 4D1EA 1R6PA 2Q91A 1AVSA 3O78A 3EKHA 1K9UA 1GJYA 2L5YA 1DJHA 3DVMA 2GGZA 4M2PA 5DICA 5I94A 5FI2A 2G2BA 1N65A 1SCMB 1SKTA 4MZKA 4YGDB 3DF0B 5AEQA 1KK8B 1UHNA 2LHLA 2G9BA 3SIBA 5AERA 1MXLC 2JULA 2LP2A 2IS9A 3KHEA 1H4BA 2L2EA 4PHKA 4NDDA 2KI4C 2WOSA 4XJKB 1KSOA 2BE6A 1UHJA 4PE7A 1OSAA 3EVRA 3R72A 2JPOA 3BXKA 2WCKA 3FE8A 2JT8A 1SBJA 3WNXB 1QX5B 4L9MA 1J7PA 3B87A 1BG1A 3VGOA 1SMGA 2BAPA 2JXCA 2NZ0A 5I2QA 1J7RA 2COLB 2KYFA 1SCMC 3QMEA 5B8IB 1XFRA 3K21A 1Z2CB 1FF1A 3DXLA 1QS7A 3L4AA 1Z4HA 3LK0A 2KDHA 3SG6A 1ALWA 1WY9A 1QLSA 4DCKA 4C0KA 2WCJA 3CR4X 3I5FB 1C07A 3CGAA 3L4LA 1XFYO 4MBEA 3FE6A 1SY9A 1Y1AA 4N1FA 1B9AA 1BT6A 3SS5A 3NSLA 2LHIA 2BL0B 1QV1A 4GBAA 2GTEA 2KFFA 1J7QA 2JOJA 1CMFA 3DZTA 1DEKA 2JT3A 3D77A 1S3PA 4CLNA 1MXEA 1EH2A 1GM0A 3JTDB 2I18A 1OZSA 4IL1A 3DD4A 2KYCA 2M7LA 3I5FC 2AUCA 2JTZA 2FJYA 4MSPA 4YGCB 3ZNIA 4MLWA 1PK0D 1YX7A 2K60A 3NSIA 2BL0C 4ETOA 1IIOA 2CTNA 1DF0B 1OMDA 5FI6A 1A29A 1M63B 4OR9B 5CSFA 1J7OA 1NX3A 1FBVA 2JPTA 3JTDC 3WXAA 3O2PA 4AOMA 4JD9A 1DJGA 3SJSA 1L2OB 5DKQA 3OX6A 2WC6A 4BY4A 1S5GY 2Y4QA 3SS4A 2M9GA 5KSZA 5CSJA 2JNXA 1P28A 1GGZA 2JXLA 3D10A 3BFAA 3FE9A 5HYDA 3AKBA 2LE9B 1S26D 2F33A 1SNLA 2KAVA 5D69A 4C0JA 1AUIB 1IWQA 1SW8A 4GFTA 3B88A 2LAPA 2L50A 3D76A 1FI6A 1B47A 1K90D 2LNKA 1TNWA 4YGEB 1XFUO 1X02A 3CTNA 1CFPA 1KFXL 1LINA 1Y0VH 2Y1MA 3CABA 1OQPA 3S0BA 4HSZA 1TNQA 5PALA 3VRRA 5I2OA 1CLLA 3S0AA 4MZJA 1M46A 3BYAA 1GQMA 1SPYA 1CMGA 1DTLA 2MBXA 3N7HA 2ZN9A 4WQ3A 2L5XB 2TN4A 1JF2A 3TS5B 1CDLA 1DGVA 1RECA 4ORBB 5DKRA 1QASA 1DELA 2MHHA 2QPTA 3PM8A 1JFJA 2V53A 4PCWA 3IQOA 1S6IA 2F8PA 4I5KA 4M2QA 4MRYA 3DVEA 5AXIA 1KWOB 3VROA 1EL4A 3O4XA 4PDZA 5CPVA 2KPHA 2MA2A 3RM1A 5D3OA 3I5HC 1KK7Y 3TDZA 1WLZA 1DJWA 3EK7A 5KTYA 2JU0A 3F45A 3S0EA 1BODA 3EK4A 1JC2A 2BCXA 1S5GZ 3BUWB 1SRAA 3LCPC 2I7AA 1NX0A 5HLVA 2OTGC 3NGVA 1NCZA 2M8UA 3BOWB 4OKHA 4CPVA 1KWOC 1QX7A 1T14A 1ZUZA 3C1VA 3ICBA 4GUKA 1YRTB 1TUZA 3B7AA 1J55A 2LV7A 3A4UB 2ZNEA 2ZRTA 5TNCA 2NLNA 1OOJA 1RK9A 2LANA 1BJFA 4FTGA 3IF7A 3SS3A 1CLMA 1OMVA 3PFVA 2L51A 3KO0A 2LMVA 2M1UA 1W7IB 1YRUB 3TDUA 3DVJA 4M2OA 2F3YA 3B6XA 3K1EA 2KOTA 3KEVA 2MLEC 2NCPA 1DQEA 1K96A 1XFWO 1LS8A 3EVVA 4QJ3B 5HKZA 4N1GA 4GNKB 5D7FA 2K61A 1G33A 3S0GA 3GK1A 2PVBA 1J1EA 3KPXA 2HPSA 1IJ6A 1UWOA 2P70A 2WCLA 5CSIA 1KK8C 1S6JA 2ZKMX 2F3ZA 5G08A 4MVFA 3EVUA 2RGIA 2LLUA 1ZFSA 3OGNA 1DMOA 1KK7Z 1MR8A 1OOHA 2F2PA 1A03A 1U5IA 1N0YA 1NCYA 1G4YR 1W9ZA 3TDIA 2WCMA 3CDNA 1K9KA 4FQTA 3BJHA 1AJ5A 2LUXA 1WRLA 4NDBA 4PE0A 3BOWA 1AP4A 2JZIA 1DVIA 2HETA 3D78A 4GGFC 1G8IA 1CDMA 2BKHB 1B7TY 3R1VA 3OB2B 1H8BA 2EC6B 1PSBA 3FWBA 4GGNA 1M31A 1BOCA 1EG4A 2H61C 4OCIA 1S36A 1YR5A 1JBAA 3PLFB 2K7CA 4C0LA 1FI5A 1YTZC 2OS8B 2QEVA 2LVIA 2B1UA 3AAKA 4QJ5B 2WNDA 4FQOA 3DF0A 3ZWHA 1TIZA 3A8RA 3DVKA 4ZCUA 1XFXO 5DKNA 3BUOB 1KCYA 3QRXA 2SCPA 2KNEA 5I2LA 3LL8B 4AQJA 1OOGA 1Y1UA 3WHTB 1K95A 1XK4C 5KU1A 2LM5A 4XJKA 2JRFA 1OE9B 4E68A 1QV0A 4P5OE 1YVLA 1W7JB 2MJWB 1RFJA 3I5GB 4WQ2A 2E30A 1AK8A 2FCDA 1PALA 2PQLA 2OS8C 1DJXA 5CSNA 2KAYA 3OP0A 4ORCB 1B1GA 1MUXA 2KQ6A 4INWA 1XFVO 1F55A 2KGRA 1K8UA 3NHIA 4A4BA 2FCEA 5BPJA 1A4PA 1A75B 1F4QA 1QLKA 4GGFA 1SSEB 1NWDA 2SASA 1ORGA 2L0PA 1TCOB 1L7ZA 1L2OC 1SCVA 2JQ6A 2KFGA 2PSRA 4NDCA 5HLOA 3UNWA 1KFXS 2K7BA 3I5GC 2M29A 3HX4A 1TUJA 1BU3A 5J3XA 3O4YA 1UHHA 1QWVA 4KYNA 3CYZA 1E8AA 1CNPA 2EHBA 3OB1B 4JWQA 3CWGA 1MQ1A 2K8MB 3PSRA 3DY9A 1YVHA 4PT1A 1F8HA 3CZ1A 1IJ5A 4PHMA 1YUTA 2LUCA 1XK4A 1IKUA 3PALA 1B7TZ 2CBLA 4N5XA 1Y6WA 2Y1NA 1CFDA 1UP5A 1J1DA 4PHJA 1WRKA 2P6BB 4MEWA 3CZ0A 2JWWA 1CB1A 1XYDA 2KQYA 2R2IA 4CIDA 4P2YB 2M3WA 1EXRA 2WCBA 1F4OA 1DF0A 1EJ3A 1TOPA 3DYEA 4OZDA 4PHNA 5FI7A 1KQVA 1UHKA 2I2RE 3IVTA 4HRGA 2ZFDA 3V2LA 3VB1A 2LP3A 3NHTA 2KI6D 2K7OA 2K2AA 4PE4A 1IQ3A 1NSHA 1MHOA 1VRKA 3CZTX 1BMOA 4OVNF 3TS5C 2MLFC 2P71A 2PRUA 2KBMA 4MN0A 4AQIA 2KLDA 4R1EA 2WCFA 1UHIA 1JUOA 1YURA 5AFPA 2KI6C 1F71A 4OV2A 4I5JA 5GQQC 2BECA 2L2CA 2PMYA 2M1KB 1SR6B 1TN4A 1K9PA 1WLMA 3TUYB 1PRWA 3B86A 2QDIA 1RWYA 5HKWA 1V1FA 1A75A 4JPZB 2YGUA 1LKJA 3GOFA 2QEOA 2LVJA 3BFBA 3FIAA 1C7WA 2LVVA 2LCPA 4WRIA 1SL7A 4F0ZB 1KFUL 2EGDA 1SL9A 2M97A 1D1OA 1F54A 1SL8A 1OW4A 3AAJA 3R1PA 1B8CA 1QATA 3D0YB 3NXAA 3PM2A 4ICBA 1IQ5A 1S6CA 3SG7A 1JF0A 1RJVA 2JNFA 3EK8A 1IH0A 1SR6C 4BY5A 2L98A 4XYNA 2CXJA 1TTXA 2LMTA 2NCOA 5AANA 1TWOA 1QIWA 2FJUB 2WCEA 3SG3A 2QEBA 3CLNA 1SK6D 2O60A 3E3RA 3TZ1A 3HCMA
chains in the Genus database with same CATH topology
1TUZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TUZ A; 
#chains in the Genus database with same CATH topology
 3NSK A;  1PVB A;  1TNP A;  3MSE B;  1MF8 B;  1ZOT B;  4U8D A;  3VRP A;  2FOT A;  3SG2 A;  2WC8 A;  1BF5 A;  2KGB C;  2KFH A;  3SIA A;  3BUM B;  3EG5 B;  2PAL A;  2LLS A;  5IBW A;  2KSP A;  1YX8 A;  3S0F A;  2CCM A;  1XO5 A;  4IJ7 A;  1QTX A;  3PAT A;  4I5L B;  2D8N A;  2CNP A;  1CLB A;  5ER5 A;  1Q80 A;  4UPG A;  3D73 A;  3FS7 A;  4YBH B;  2ZND A;  4QJ4 B;  1DC1 A;  1JFK A;  1CM1 A;  1M39 A;  1ZMZ A;  3M0W A;  1PSR A;  4HRE E;  2WC5 A;  1QIV A;  1QVI Y;  1RTP 1;  1DGU A;  1NP8 A;  1XFZ O;  3O6B A;  3NSO A;  2L4H A;  3Q8I A;  1EG3 A;  3PJI A;  3BUX B;  1YUU A;  4MZL A;  1B8L A;  1QX2 A;  3D0Y A;  2A4J A;  5JJG A;  1TRF A;  4YI8 A;  4A4C A;  1WRZ A;  1DJI A;  2K7D A;  2PYQ A;  3CR2 A;  2KLE A;  3L47 A;  3PN7 B;  2BBM A;  2EC6 C;  1WDC B;  1K2H A;  2BKI B;  1NYA A;  2F2O A;  2WOR A;  2BE4 A;  1ZAC A;  1PVA A;  5ER4 X;  4JQ0 D;  2QEH A;  2LC5 A;  3CS1 A;  4I5N B;  3VRQ A;  2HQ8 A;  2KAX A;  1OOF A;  1CDP A;  2WCH A;  2Y5I A;  4GPL B;  4HRH A;  3UO9 A;  1S1E A;  3RZS A;  1K93 D;  2K0J A;  2M7N A;  1CKK A;  4INX A;  3PN7 C;  1FPW A;  1WDC C;  4YGA A;  2BNX A;  1C3Y A;  2H61 A;  1PUL A;  4NQG A;  1HQV A;  2JTT A;  1JSA A;  2LLT A;  2HF5 A;  2KHN A;  2M0R A;  4ZCV A;  1XA5 A;  4PAL A;  2I94 A;  4JKT A;  2ERB A;  2JC2 A;  2GGM A;  3LK1 A;  4Q04 A;  1NUB A;  1B8R A;  1LXF C;  1K94 A;  2BCA A;  4PE1 A;  1CM4 A;  1LA0 A;  5JOL A;  3SG5 A;  2NXQ A;  2O5G A;  2MRD A;  1QVI Z;  4GAO A;  5I8N A;  3JVT B;  4CFR A;  5K89 A;  1HT9 A;  2BBN A;  3BUN B;  1DJY A;  1ALV A;  1UUS A;  1V1G A;  5FYX A;  3GK4 X;  1XVJ A;  3OBV A;  4YI9 A;  2H8V A;  4MRX A;  1GGW A;  1QXP A;  1LA3 A;  2Q4U A;  2ZRS A;  1UUR A;  2PAS A;  3WHU B;  1NX1 A;  1C7V A;  3I5H B;  4TNC A;  2VRG A;  1AHR A;  1F70 A;  3OX5 A;  3IQQ A;  1CFF A;  1JWD A;  5HL1 A;  2MAZ A;  3JVT C;  2CT9 A;  3AKA A;  1C3Z A;  1OOI X;  1IGV A;  2ZN8 A;  1NCX A;  3CR5 X;  3D75 A;  4ORA B;  3EKJ A;  4F7F A;  3CZ2 A;  1AJ4 A;  1N2D A;  2KBI A;  1TCF A;  3R1O A;  1B4C A;  2L4I A;  2LVK A;  1BR4 B;  2M49 B;  2OTG B;  2DOQ A;  3OHM B;  3S0D A;  3VRN A;  1NPQ A;  2OPO A;  1DJZ A;  4DRW A;  1YUS A;  2ISD A;  4USL A;  4DS7 A;  1IRJ A;  1CFC A;  5HKY A;  1M45 A;  1KSM A;  2BCB A;  3I5I B;  4YGB B;  1A2X A;  4DIR A;  1IG5 A;  1ODB A;  1OMR A;  1U5I B;  3BFH A;  5F6T A;  1KQM B;  1KFU S;  1DT7 B;  2E6W A;  1R2U A;  1RRO A;  3BQ3 A;  1BR1 B;  2GV5 A;  1TNX A;  2H2K A;  1BLQ A;  2LMU A;  3FWC A;  1CTR A;  1FW4 A;  1LVC D;  2AMI A;  4CFQ A;  2JT0 A;  1SYM A;  1Y1X A;  1MWN A;  2QAC A;  2AAO A;  1CDN A;  3TUY C;  4YRU A;  1NX2 A;  3LLE A;  5EL2 A;  1OZO A;  3H4S E;  3GK2 A;  3I5I C;  3SG4 A;  1QJT A;  1NIW A;  2HQW A;  2KI4 B;  3KF9 A;  2K2F A;  1KQM C;  4DUQ A;  3D74 A;  3RLZ A;  4D1E A;  1R6P A;  2Q91 A;  1AVS A;  3O78 A;  3EKH A;  1K9U A;  1GJY A;  2L5Y A;  1DJH A;  3DVM A;  2GGZ A;  4M2P A;  5DIC A;  5I94 A;  5FI2 A;  2G2B A;  1N65 A;  1SCM B;  1SKT A;  4MZK A;  4YGD B;  3DF0 B;  5AEQ A;  1KK8 B;  1UHN A;  2LHL A;  2G9B A;  3SIB A;  5AER A;  1MXL C;  2JUL A;  2LP2 A;  2IS9 A;  3KHE A;  1H4B A;  2L2E A;  4PHK A;  4NDD A;  2KI4 C;  2WOS A;  4XJK B;  1KSO A;  2BE6 A;  1UHJ A;  4PE7 A;  1OSA A;  3EVR A;  3R72 A;  2JPO A;  3BXK A;  2WCK A;  3FE8 A;  2JT8 A;  1SBJ A;  3WNX B;  1QX5 B;  4L9M A;  1J7P A;  3B87 A;  1BG1 A;  3VGO A;  1SMG A;  2BAP A;  2JXC A;  2NZ0 A;  5I2Q A;  1J7R A;  2COL B;  2KYF A;  1SCM C;  3QME A;  5B8I B;  1XFR A;  3K21 A;  1Z2C B;  1FF1 A;  3DXL A;  1QS7 A;  3L4A A;  1Z4H A;  3LK0 A;  2KDH A;  3SG6 A;  1ALW A;  1WY9 A;  1QLS A;  4DCK A;  4C0K A;  2WCJ A;  3CR4 X;  3I5F B;  1C07 A;  3CGA A;  3L4L A;  1XFY O;  4MBE A;  3FE6 A;  1SY9 A;  1Y1A A;  4N1F A;  1B9A A;  1BT6 A;  3SS5 A;  3NSL A;  2LHI A;  2BL0 B;  1QV1 A;  4GBA A;  2GTE A;  2KFF A;  1J7Q A;  2JOJ A;  1CMF A;  3DZT A;  1DEK A;  2JT3 A;  3D77 A;  1S3P A;  4CLN A;  1MXE A;  1EH2 A;  1GM0 A;  3JTD B;  2I18 A;  1OZS A;  4IL1 A;  3DD4 A;  2KYC A;  2M7L A;  3I5F C;  2AUC A;  2JTZ A;  2FJY A;  4MSP A;  4YGC B;  3ZNI A;  4MLW A;  1PK0 D;  1YX7 A;  2K60 A;  3NSI A;  2BL0 C;  4ETO A;  1IIO A;  2CTN A;  1DF0 B;  1OMD A;  5FI6 A;  1A29 A;  1M63 B;  4OR9 B;  5CSF A;  1J7O A;  1NX3 A;  1FBV A;  2JPT A;  3JTD C;  3WXA A;  3O2P A;  4AOM A;  4JD9 A;  1DJG A;  3SJS A;  1L2O B;  5DKQ A;  3OX6 A;  2WC6 A;  4BY4 A;  1S5G Y;  2Y4Q A;  3SS4 A;  2M9G A;  5KSZ A;  5CSJ A;  2JNX A;  1P28 A;  1GGZ A;  2JXL A;  3D10 A;  3BFA A;  3FE9 A;  5HYD A;  3AKB A;  2LE9 B;  1S26 D;  2F33 A;  1SNL A;  2KAV A;  5D69 A;  4C0J A;  1AUI B;  1IWQ A;  1SW8 A;  4GFT A;  3B88 A;  2LAP A;  2L50 A;  3D76 A;  1FI6 A;  1B47 A;  1K90 D;  2LNK A;  1TNW A;  4YGE B;  1XFU O;  1X02 A;  3CTN A;  1CFP A;  1KFX L;  1LIN A;  1Y0V H;  2Y1M A;  3CAB A;  1OQP A;  3S0B A;  4HSZ A;  1TNQ A;  5PAL A;  3VRR A;  5I2O A;  1CLL A;  3S0A A;  4MZJ A;  1M46 A;  3BYA A;  1GQM A;  1SPY A;  1CMG A;  1DTL A;  2MBX A;  3N7H A;  2ZN9 A;  4WQ3 A;  2L5X B;  2TN4 A;  1JF2 A;  3TS5 B;  1CDL A;  1DGV A;  1REC A;  4ORB B;  5DKR A;  1QAS A;  1DEL A;  2MHH A;  2QPT A;  3PM8 A;  1JFJ A;  2V53 A;  4PCW A;  3IQO A;  1S6I A;  2F8P A;  4I5K A;  4M2Q A;  4MRY A;  3DVE A;  5AXI A;  1KWO B;  3VRO A;  1EL4 A;  3O4X A;  4PDZ A;  5CPV A;  2KPH A;  2MA2 A;  3RM1 A;  5D3O A;  3I5H C;  1KK7 Y;  3TDZ A;  1WLZ A;  1DJW A;  3EK7 A;  5KTY A;  2JU0 A;  3F45 A;  3S0E A;  1BOD A;  3EK4 A;  1JC2 A;  2BCX A;  1S5G Z;  3BUW B;  1SRA A;  3LCP C;  2I7A A;  1NX0 A;  5HLV A;  2OTG C;  3NGV A;  1NCZ A;  2M8U A;  3BOW B;  4OKH A;  4CPV A;  1KWO C;  1QX7 A;  1T14 A;  1ZUZ A;  3C1V A;  3ICB A;  4GUK A;  1YRT B;  1TUZ A;  3B7A A;  1J55 A;  2LV7 A;  3A4U B;  2ZNE A;  2ZRT A;  5TNC A;  2NLN A;  1OOJ A;  1RK9 A;  2LAN A;  1BJF A;  4FTG A;  3IF7 A;  3SS3 A;  1CLM A;  1OMV A;  3PFV A;  2L51 A;  3KO0 A;  2LMV A;  2M1U A;  1W7I B;  1YRU B;  3TDU A;  3DVJ A;  4M2O A;  2F3Y A;  3B6X A;  3K1E A;  2KOT A;  3KEV A;  2MLE C;  2NCP A;  1DQE A;  1K96 A;  1XFW O;  1LS8 A;  3EVV A;  4QJ3 B;  5HKZ A;  4N1G A;  4GNK B;  5D7F A;  2K61 A;  1G33 A;  3S0G A;  3GK1 A;  2PVB A;  1J1E A;  3KPX A;  2HPS A;  1IJ6 A;  1UWO A;  2P70 A;  2WCL A;  5CSI A;  1KK8 C;  1S6J A;  2ZKM X;  2F3Z A;  5G08 A;  4MVF A;  3EVU A;  2RGI A;  2LLU A;  1ZFS A;  3OGN A;  1DMO A;  1KK7 Z;  1MR8 A;  1OOH A;  2F2P A;  1A03 A;  1U5I A;  1N0Y A;  1NCY A;  1G4Y R;  1W9Z A;  3TDI A;  2WCM A;  3CDN A;  1K9K A;  4FQT A;  3BJH A;  1AJ5 A;  2LUX A;  1WRL A;  4NDB A;  4PE0 A;  3BOW A;  1AP4 A;  2JZI A;  1DVI A;  2HET A;  3D78 A;  4GGF C;  1G8I A;  1CDM A;  2BKH B;  1B7T Y;  3R1V A;  3OB2 B;  1H8B A;  2EC6 B;  1PSB A;  3FWB A;  4GGN A;  1M31 A;  1BOC A;  1EG4 A;  2H61 C;  4OCI A;  1S36 A;  1YR5 A;  1JBA A;  3PLF B;  2K7C A;  4C0L A;  1FI5 A;  1YTZ C;  2OS8 B;  2QEV A;  2LVI A;  2B1U A;  3AAK A;  4QJ5 B;  2WND A;  4FQO A;  3DF0 A;  3ZWH A;  1TIZ A;  3A8R A;  3DVK A;  4ZCU A;  1XFX O;  5DKN A;  3BUO B;  1KCY A;  3QRX A;  2SCP A;  2KNE A;  5I2L A;  3LL8 B;  4AQJ A;  1OOG A;  1Y1U A;  3WHT B;  1K95 A;  1XK4 C;  5KU1 A;  2LM5 A;  4XJK A;  2JRF A;  1OE9 B;  4E68 A;  1QV0 A;  4P5O E;  1YVL A;  1W7J B;  2MJW B;  1RFJ A;  3I5G B;  4WQ2 A;  2E30 A;  1AK8 A;  2FCD A;  1PAL A;  2PQL A;  2OS8 C;  1DJX A;  5CSN A;  2KAY A;  3OP0 A;  4ORC B;  1B1G A;  1MUX A;  2KQ6 A;  4INW A;  1XFV O;  1F55 A;  2KGR A;  1K8U A;  3NHI A;  4A4B A;  2FCE A;  5BPJ A;  1A4P A;  1A75 B;  1F4Q A;  1QLK A;  4GGF A;  1SSE B;  1NWD A;  2SAS A;  1ORG A;  2L0P A;  1TCO B;  1L7Z A;  1L2O C;  1SCV A;  2JQ6 A;  2KFG A;  2PSR A;  4NDC A;  5HLO A;  3UNW A;  1KFX S;  2K7B A;  3I5G C;  2M29 A;  3HX4 A;  1TUJ A;  1BU3 A;  5J3X A;  3O4Y A;  1UHH A;  1QWV A;  4KYN A;  3CYZ A;  1E8A A;  1CNP A;  2EHB A;  3OB1 B;  4JWQ A;  3CWG A;  1MQ1 A;  2K8M B;  3PSR A;  3DY9 A;  1YVH A;  4PT1 A;  1F8H A;  3CZ1 A;  1IJ5 A;  4PHM A;  1YUT A;  2LUC A;  1XK4 A;  1IKU A;  3PAL A;  1B7T Z;  2CBL A;  4N5X A;  1Y6W A;  2Y1N A;  1CFD A;  1UP5 A;  1J1D A;  4PHJ A;  1WRK A;  2P6B B;  4MEW A;  3CZ0 A;  2JWW A;  1CB1 A;  1XYD A;  2KQY A;  2R2I A;  4CID A;  4P2Y B;  2M3W A;  1EXR A;  2WCB A;  1F4O A;  1DF0 A;  1EJ3 A;  1TOP A;  3DYE A;  4OZD A;  4PHN A;  5FI7 A;  1KQV A;  1UHK A;  2I2R E;  3IVT A;  4HRG A;  2ZFD A;  3V2L A;  3VB1 A;  2LP3 A;  3NHT A;  2KI6 D;  2K7O A;  2K2A A;  4PE4 A;  1IQ3 A;  1NSH A;  1MHO A;  1VRK A;  3CZT X;  1BMO A;  4OVN F;  3TS5 C;  2MLF C;  2P71 A;  2PRU A;  2KBM A;  4MN0 A;  4AQI A;  2KLD A;  4R1E A;  2WCF A;  1UHI A;  1JUO A;  1YUR A;  5AFP A;  2KI6 C;  1F71 A;  4OV2 A;  4I5J A;  5GQQ C;  2BEC A;  2L2C A;  2PMY A;  2M1K B;  1SR6 B;  1TN4 A;  1K9P A;  1WLM A;  3TUY B;  1PRW A;  3B86 A;  2QDI A;  1RWY A;  5HKW A;  1V1F A;  1A75 A;  4JPZ B;  2YGU A;  1LKJ A;  3GOF A;  2QEO A;  2LVJ A;  3BFB A;  3FIA A;  1C7W A;  2LVV A;  2LCP A;  4WRI A;  1SL7 A;  4F0Z B;  1KFU L;  2EGD A;  1SL9 A;  2M97 A;  1D1O A;  1F54 A;  1SL8 A;  1OW4 A;  3AAJ A;  3R1P A;  1B8C A;  1QAT A;  3D0Y B;  3NXA A;  3PM2 A;  4ICB A;  1IQ5 A;  1S6C A;  3SG7 A;  1JF0 A;  1RJV A;  2JNF A;  3EK8 A;  1IH0 A;  1SR6 C;  4BY5 A;  2L98 A;  4XYN A;  2CXJ A;  1TTX A;  2LMT A;  2NCO A;  5AAN A;  1TWO A;  1QIW A;  2FJU B;  2WCE A;  3SG3 A;  2QEB A;  3CLN A;  1SK6 D;  2O60 A;  3E3R A;  3TZ1 A;  3HCM A; 
#chains in the Genus database with same CATH homology
 1TUZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...