2CT9A

The crystal structure of calcineurin b homologous proein 1 (chp1)
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
196
structure length
185
Chain Sequence
LLRDEELEEIKKETGFSHSQITRLYSRFTSLDKGENGTLSREDFQRIPELAINPLGDRIINAFFSEGEDQVNFRGFMRTLAHFRPIEEPLNSRSNKLHFAFRLYDLDKDDKISRDELLQVLRMMVGVNISDEQLGSIADRTIQEADQDGDSAISFTEFVKVLEKVDVEQKMSIRFLHKLAAALEH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords Calcium-binding protein p22
publication title Structural characterization of calcineurin B homologous protein 1
pubmed doi rcsb
source organism Rattus norvegicus
total genus 68
structure length 185
sequence length 196
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2ct9A00
1YUTA 4N1FA 5CSFA 5HLVA 1IWQA 1XFXO 1J1DA 1XFWO 4CLNA 1LINA 1CMFA 1KFUS 2BE6A 2HETA 1KFXL 1PK0D 1UURA 3I5FB 2JTZA 4GAOA 5HYDA 1DJXA 1IG5A 1QXPA 1UHKA 1WRZA 1LA3A 1KK7Y 3BQ3A 1YTZC 1NX0A 2BKIB 3I5GB 1CDMA 1ZOTB 4MLWA 5AXIA 1LXFC 1DF0B 3JTDB 4C0KA 4P2YB 1B8CA 2LMUA 4MZKA 1RJVA 1B4CA 4CPVA 1GJYA 1EG4A 1AHRA 4HSZA 2BL0C 5J3XA 4CIDA 1OMRA 2JTTA 4GBAA 2PMYA 3EK7A 5D69A 4CFRA 1YUSA 2LP2A 4HRGA 1CLBA 1L7ZA 3BYAA 2KGRA 3AKAA 1QVIY 1G4YR 1M31A 1ZUZA 2EC6B 3BXKA 5IBWA 1ALVA 3DVEA 1C7WA 2MJWB 1U5IA 2HPSA 2CXJA 1WRLA 2KHNA 3OX6A 1NYAA 3BOWB 1JF2A 1CFDA 3FWCA 3ZNIA 4P5OE 2JU0A 2JC2A 2ZNDA 1NX1A 1DJWA 4WQ3A 3SIBA 4NDDA 3GK2A 1KWOC 1NWDA 2LMTA 2FCEA 2LLSA 1L2OB 2MA2A 2RGIA 3PN7B 2M7NA 4MEWA 2ISDA 1CLMA 5ER4X 1RECA 3AAJA 1NX2A 1NPQA 1A4PA 3CR5X 2CNPA 2P6BB 2NXQA 4YGDB 1KQMB 3F45A 3AKBA 1XVJA 4U8DA 3SG5A 4PHMA 3FS7A 5CSNA 3LCPC 2B1UA 4GFTA 1DJIA 2Y1NA 3IQOA 3EKHA 1G33A 3CTNA 2JOJA 2ZKMX 1M45A 2F3ZA 3PFVA 1MQ1A 4DIRA 1TRFA 3IQQA 1S5GY 4A4CA 1QTXA 1CM1A 3EVRA 1PSRA 4I5KA 1K96A 1ZACA 2NLNA 2KBIA 4DUQA 1OMVA 2MBXA 1YR5A 2LVVA 4NDBA 1J1EA 2JPTA 1DGUA 3TUYB 5I2OA 1DJHA 1QLKA 2KAXA 3CR4X 3EKJA 1IKUA 4M2QA 3D0YA 1TCOB 4YBHB 4NQGA 4R1EA 4GGFC 2HQ8A 2WORA 2KI6C 1WLZA 2LV7A 2E6WA 1TNWA 1PVAA 1NCZA 1YVHA 1S3PA 1K94A 2K7CA 1Y6WA 3JVTB 2CT9A 5DKRA 4OV2A 1U5IB 2LMVA 1IQ3A 1KSMA 4F0ZB 1WDCC 4D1EA 2BBMA 4DS7A 1SCVA 1QJTA 2JRFA 1PALA 2L0PA 3EK8A 2F2OA 2JQ6A 2NZ0A 1S1EA 1Y1UA 4PHNA 1MHOA 5TNCA 1BR1B 1WRKA 1RFJA 4XYNA 1V1GA 2JXCA 3RM1A 1K90D 1QATA 1YUUA 3SJSA 1K9KA 1YRUB 1FBVA 1TIZA 2LLTA 3DVKA 1RTP1 2SCPA 3TS5B 3OX5A 2WCBA 1NUBA 3K21A 2L5XB 1A03A 1BOCA 1CTRA 3DD4A 1OZOA 1NCYA 1JF0A 2OS8C 5AANA 2AMIA 1NCXA 3CR2A 3NSKA 1R6PA 3OB1B 4HRHA 1GGWA 1QX5B 4MRXA 2PRUA 3E3RA 2KNEA 1QLSA 1N2DA 1TNQA 1J7PA 1S26D 3KEVA 3FIAA 2M7LA 1KSOA 2L4HA 4YI8A 3VRNA 3SG3A 4JQ0D 3VRQA 4MZLA 2WNDA 2F8PA 1VRKA 2ZRTA 3C1VA 3PALA 1F4QA 1KK8B 2KI4C 3VGOA 2MRDA 1B8RA 3O4YA 2D8NA 1SL7A 1BR4B 3D0YB 3SG2A 2IS9A 2I2RE 2ZN9A 2KFHA 2BL0B 4MN0A 4OKHA 2WCEA 2ZFDA 1S6CA 1Y0VH 2L4IA 1XK4A 3BUNB 4GGFA 1CMGA 4QJ3B 4ZCUA 1X02A 2LNKA 1JUOA 1ZFSA 4GGNA 4OVNF 1DMOA 4C0JA 1F54A 5I2LA 5B8IB 4WRIA 1B7TZ 1TOPA 2M49B 4I5LB 2KYCA 2KDHA 2BCBA 2H2KA 1C7VA 3PATA 2COLB 2EC6C 2JZIA 1J7OA 5CSIA 1IRJA 3LK0A 2K2FA 2LC5A 5D7FA 1DJYA 2AAOA 4DRWA 2KAVA 4USLA 2CTNA 4PHJA 1K8UA 1JSAA 1RK9A 4ORBB 4QJ5B 1ODBA 2GV5A 3KO0A 1XA5A 1K9UA 1M39A 1JFKA 1Y1XA 2LE9B 1MXEA 2JULA 1AJ5A 1SKTA 1SCMB 2KI6D 2K7OA 1W7IB 2Y1MA 1L2OC 2LM5A 3WHTB 1N65A 2M3WA 3EVVA 1GGZA 2K2AA 3PM8A 1KFUL 1Q80A 3DF0A 3MSEB 1B8LA 3AAKA 1FF1A 1MF8B 2OTGB 2VRGA 2K7BA 3I5HC 2PALA 1IJ5A 3GK1A 3I5IC 1FW4A 1AJ4A 1J7QA 1MXLC 2LHIA 1FI6A 2MAZA 3PSRA 1LA0A 2LUXA 2I7AA 2M1KB 1HT9A 2H61C 1F71A 4ORCB 1CB1A 3A8RA 1KQVA 3O2PA 3KF9A 3OP0A 4JWQA 2M1UA 4L9MA 1SL9A 2BBNA 3NSOA 1JBAA 4AOMA 1JFJA 3DVMA 3ZWHA 1BLQA 2M29A 2TN4A 2F33A 1H4BA 2Y5IA 3CLNA 3OHMB 4DCKA 1YVLA 3TZ1A 1KFXS 1K95A 1BT6A 3CGAA 2CBLA 1XFYO 2K0JA 1JWDA 3SG7A 2KFGA 2MHHA 1YX8A 1ALWA 4YGBB 1CDLA 1Y1AA 1DJGA 1DT7B 1WDCB 3VRRA 2BECA 2R2IA 5F6TA 2JNFA 1SBJA 5HLOA 4N5XA 1F8HA 1UHNA 2ZNEA 3HX4A 3NXAA 2KOTA 5AFPA 2LVKA 4ZCVA 2WOSA 1AP4A 1XFZO 1A2XA 3ICBA 1KK7Z 2G9BA 4HREE 1H8BA 1SR6C 2LUCA 3OB2B 1YURA 2KBMA 2KAYA 4E68A 4ICBA 3BUWB 4MZJA 2F2PA 4OR9B 5CPVA 2LVIA 1E8AA 1BU3A 4YRUA 1BMOA 3CWGA 5AEQA 3TDZA 1EH2A 2OS8B 5HKWA 4MSPA 4N1GA 1SY9A 1EXRA 3DF0B 2LP3A 3H4SE 1MUXA 5GQQC 4GNKB 1K93D 1PVBA 1QASA 1QVIZ 4PE0A 2LANA 4GPLB 4CFQA 1RROA 2A4JA 4BY4A 1J7RA 2K7DA 3LL8B 1M46A 2PASA 2L98A 5ER5A 2Q91A 1QX2A 1SPYA 4PE4A 1RWYA 4PHKA 1UHJA 2L51A 3I5FC 4JPZB 1S6JA 2H61A 3CS1A 2LCPA 3I5GC 1XFUO 3VRPA 2K8MB 3O78A 1CFPA 1W7JB 3JTDC 2KI4B 3SG6A 2DOQA 1QS7A 1CDPA 4YI9A 1NP8A 5KU1A 3SG4A 1SYMA 1UWOA 1YRTB 2QACA 3DVJA 2EHBA 1QV0A 1TN4A 3CZTX 3BUOB 1KK8C 1SK6D 4XJKA 1BF5A 2JT0A 2K61A 1UUSA 2JXLA 2OPOA 1IJ6A 4MRYA 5CSJA 1TCFA 4PE7A 2GGMA 1M63B 2ZRSA 1A75A 5FYXA 1ZMZA 1IH0A 2SASA 1G8IA 1UHHA 3TDIA 1B9AA 5JJGA 3O6BA 1CDNA 1F70A 1TNPA 1XO5A 1QIWA 2KYFA 1NSHA 4YGAA 2MLEC 2M8UA 1OSAA 5DKQA 5K89A 4PE1A 5G08A 1DVIA 1KWOB 1CM4A 1S5GZ 2BE4A 3TDUA 1EG3A 4M2OA 1K9PA 1OOJA 2NCPA 1GQMA 1XFVO 1LKJA 5JOLA 2I18A 3M0WA 1IQ5A 2FJUB 2L2EA 2LLUA 4PCWA 1DTLA 3IF7A 2Q4UA 1QV1A 4MBEA 3PN7C 4YGEB 2JT3A 2QPTA 3D10A 2KSPA 1HQVA 3HCMA 1BODA 4WQ2A 1S6IA 1F55A 5KTYA 1KQMC 1CFCA 1N0YA 1BG1A 1QIVA 2FCDA 4BY5A 4A4BA 3RLZA 1SL8A 1SCMC 3KHEA 3I5HB 1B7TY 2EGDA 2HF5A 2LHLA 4I5JA 2M9GA 4Q04A 2O60A 5PALA 3I5IB 1OE9B 1OQPA 4UPGA 5BPJA 2JNXA 2OTGC 1PRWA 2FOTA 5KSZA 3WXAA 5HKZA 4M2PA 1PULA 1JC2A 2KQ6A 5AERA 4GUKA 1BJFA 2KQYA 2NCOA 2AUCA 3PLFB 1CLLA 3TUYC 1YX7A 1DF0A 1SNLA 3BUMB 4IL1A 3WHUB 1AK8A 1B47A 1DGVA 2M0RA 4XJKB 4FQOA 2Y4QA 3GOFA 4TNCA 1B1GA 4I5NB 1FPWA 3KPXA 3EVUA 2CCMA 5DKNA 1OZSA 1DJZA 2PSRA 4FTGA 2F3YA 1SMGA 1A75B 1TTXA 3FWBA 3EK4A 1C07A 1SW8A 5I8NA 1AVSA 1QX7A 1V1FA 1EJ3A 1XK4C 3JVTC 4YGCB 1FI5A 1UP5A 1CNPA 3NSIA 1NX3A 2PVBA 3LK1A 1SRAA 2BKHB 2BCAA 4AQJA 5HKYA 4ORAB 1D1OA 1OMDA 2LAPA 1TNXA 2E30A 2G2BA 1J55A 3BOWA 3QRXA 3NSLA 2O5GA 1S36A 4ETOA 1A29A 2V53A 1CKKA 2JT8A 2JWWA 2WCFA 2MLFC 2M97A 1SR6B 3SIAA 1CFFA 1IGVA 3BUXB 3VROA 2WC8A 1NIWA 1LVCD 1AUIB 4OCIA 1KCYA 1PSBA 1MR8A 3TS5C 3GK4X 4AQIA 1UHIA 4PALA 2HQWA 4C0LA 1MWNA 2KFFA 5I2QA 1WY9A 1R2UA 2GGZA 1XYDA 4NDCA 1EL4A 4QJ4B 2L50A 4PDZA 1WLMA 2LVJA 3WNXB 4MVFA 1K2HA 2KGBC 2I94A 1F4OA 2ZN8A 3A4UB 2BCXA 3LLEA
chains in the Genus database with same CATH superfamily
1YUTA 4N1FA 5CSFA 5HLVA 1IWQA 1XFXO 1J1DA 1XFWO 4JD9A 4CLNA 1LINA 1CMFA 1KFUS 2BE6A 2HETA 1KFXL 1PK0D 1UURA 2WCJA 2JTZA 3I5FB 4GAOA 1DJXA 1IG5A 1QXPA 1UHKA 1WRZA 1LA3A 1KK7Y 3BQ3A 1YTZC 1NX0A 2BKIB 3DZTA 3I5GB 3R72A 1CDMA 1ZOTB 4MLWA 5AXIA 1LXFC 1DF0B 3JTDB 4C0KA 4P2YB 1B8CA 2LMUA 3CDNA 4MZKA 1RJVA 1B4CA 4CPVA 1GJYA 1EG4A 1AHRA 3CZ2A 4HSZA 2BL0C 5J3XA 4CIDA 1T14A 1OMRA 2JTTA 4GBAA 2PMYA 3EK7A 5D69A 4CFRA 1YUSA 2LP2A 4HRGA 1CLBA 1L7ZA 3BYAA 2KGRA 3R1VA 3AKAA 1QVIY 1G4YR 1M31A 1ZUZA 2EC6B 3BXKA 5IBWA 1ALVA 3DVEA 1C7WA 2MJWB 1U5IA 2HPSA 2CXJA 1WRLA 2KHNA 3OX6A 1NYAA 3BOWB 1JF2A 2BAPA 1CFDA 2JPOA 3FWCA 2QEHA 3ZNIA 4P5OE 2JU0A 2JC2A 2WCKA 2ZNDA 1NX1A 2KPHA 1DJWA 4WQ3A 3SIBA 5D3OA 4NDDA 3GK2A 1KWOC 1NWDA 2LMTA 2FCEA 2LLSA 1L2OB 2MA2A 2RGIA 3NHIA 3PN7B 2M7NA 4MEWA 4FQTA 2ISDA 1CLMA 5ER4X 1RECA 3AAJA 1NX2A 1NPQA 1A4PA 3CR5X 2CNPA 3CABA 2P6BB 2NXQA 4YGDB 1KQMB 3F45A 1XFRA 1XVJA 3AKBA 4U8DA 3SG5A 4PHMA 3FS7A 5HYDA 5CSNA 3LCPC 2B1UA 4GFTA 1DJIA 2BNXA 2Y1NA 3IQOA 3EKHA 1G33A 3CTNA 2JOJA 1DELA 1DC1A 2ZKMX 1M45A 3O4XA 2F3ZA 3PFVA 1MQ1A 4DIRA 1TRFA 3IQQA 1S5GY 4A4CA 1QTXA 1CM1A 3EVRA 1PSRA 4I5KA 1K96A 1ZACA 3NGVA 2NLNA 2KBIA 4DUQA 1OMVA 2MBXA 1YR5A 2LVVA 4NDBA 1J1EA 2JPTA 1DGUA 3TUYB 5I2OA 1DJHA 1QLKA 2KAXA 3CR4X 3EKJA 1IKUA 1DEKA 2WCLA 4M2QA 3D0YA 1TCOB 4YBHB 4NQGA 4R1EA 4GGFC 2HQ8A 2WORA 2KI6C 1WLZA 2LV7A 2E6WA 1TNWA 1PVAA 5I94A 1NCZA 1YVHA 1S3PA 1K94A 1ORGA 3NHTA 2K7CA 1Y6WA 3JVTB 2CT9A 5DKRA 4OV2A 1U5IB 2WC5A 2LMVA 1IQ3A 1KSMA 4F0ZB 1WDCC 4D1EA 2BBMA 4DS7A 1SCVA 1QJTA 2JRFA 3D78A 1PALA 2L0PA 3EK8A 2F2OA 2JQ6A 2NZ0A 1S1EA 1Y1UA 3DXLA 4PHNA 3Q8IA 3SS5A 1MHOA 5TNCA 1BR1B 1WRKA 1RFJA 3B6XA 3V2LA 4XYNA 3UO9A 1V1GA 2JXCA 3RM1A 4INWA 1K90D 1QATA 1YUUA 3SJSA 5FI6A 1K9KA 1YRUB 1FBVA 1TIZA 2LLTA 3DVKA 1RTP1 2SCPA 3TS5B 3OX5A 2WCBA 1NUBA 3K21A 2L5XB 1A03A 1BOCA 1CTRA 3DD4A 1OZOA 1NCYA 1JF0A 2OS8C 1GM0A 5AANA 2AMIA 1NCXA 3CR2A 3NSKA 1R6PA 1OOIX 3OB1B 4HRHA 3FE9A 1GGWA 1QX5B 4MRXA 2PRUA 3E3RA 2KNEA 1QLSA 1N2DA 1TNQA 1J7PA 1S26D 3KEVA 3FIAA 3QMEA 2M7LA 3DY9A 1KSOA 2L4HA 3D75A 4YI8A 3VRNA 3SG3A 1LS8A 4JQ0D 3VRQA 3EG5B 3B88A 4MZLA 2WNDA 2F8PA 1VRKA 2ZRTA 3C1VA 3PALA 5EL2A 1F4QA 3S0AA 1KK8B 2KI4C 3VGOA 2MRDA 1B8RA 3O4YA 2D8NA 1SL7A 1BR4B 3D0YB 3SG2A 2IS9A 2I2RE 2ZN9A 3SS3A 2KFHA 2BL0B 4MN0A 4OKHA 2WCEA 2ZFDA 1S6CA 1Y0VH 2L4IA 1XK4A 3BUNB 3IVTA 4GGFA 4OZDA 1CMGA 4QJ3B 4ZCUA 1X02A 4F7FA 2LNKA 1JUOA 1ZFSA 4GGNA 4OVNF 1DMOA 4C0JA 1F54A 5I2LA 5B8IB 4WRIA 1B7TZ 1TOPA 2M49B 4I5LB 2KYCA 2KDHA 2BCBA 2H2KA 3S0FA 1C7VA 3PATA 2COLB 2EC6C 2JZIA 1J7OA 2QEVA 1IRJA 3LK0A 5CSIA 3SS4A 2K2FA 2LC5A 5D7FA 1DJYA 2AAOA 4DRWA 3CYZA 2KAVA 4USLA 2CTNA 4PHJA 1K8UA 1JSAA 1RK9A 4ORBB 4QJ5B 1ODBA 2GV5A 3KO0A 1XA5A 1K9UA 1M39A 1JFKA 1Y1XA 2LE9B 1MXEA 2JULA 1AJ5A 1SKTA 1SCMB 2KI6D 2K7OA 1W7IB 2Y1MA 1L2OC 2LM5A 3WHTB 1N65A 2M3WA 3EVVA 1GGZA 2K2AA 3PM8A 1KFUL 1Q80A 3B7AA 3DF0A 3MSEB 4JKTA 3S0EA 1B8LA 3AAKA 1FF1A 1MF8B 2OTGB 2VRGA 2K7BA 3I5HC 2PALA 1IJ5A 3GK1A 3I5IC 1FW4A 1OOHA 2KLEA 1AJ4A 1J7QA 1MXLC 2LHIA 1FI6A 2MAZA 3PSRA 5FI2A 1LA0A 2LUXA 2I7AA 2M1KB 1HT9A 2H61C 1F71A 4ORCB 1D1OA 1CB1A 3S0GA 3A8RA 1KQVA 3O2PA 3KF9A 3OP0A 4JWQA 2M1UA 4L9MA 1SL9A 2BBNA 3NSOA 1JBAA 4AOMA 1JFJA 3DVMA 3ZWHA 1BLQA 2M29A 2TN4A 3CZ1A 2F33A 1H4BA 3D74A 2Y5IA 3CLNA 2P71A 3OHMB 4DCKA 1YVLA 3TZ1A 1KFXS 1K95A 1BT6A 3L4LA 3CGAA 2CBLA 3PJIA 1SSEB 1XFYO 2K0JA 1JWDA 3SG7A 4KYNA 2KFGA 2MHHA 1P28A 1ALWA 1YX8A 4YGBB 1CDLA 1Y1AA 1DJGA 1DT7B 1WDCB 3VRRA 2BECA 2R2IA 5F6TA 2JNFA 1SBJA 5HLOA 4N5XA 3K1EA 1UHNA 2ZNEA 1F8HA 3HX4A 3NXAA 3BFHA 2KOTA 5AFPA 2LVKA 4ZCVA 2WOSA 1AP4A 1XFZO 1A2XA 3ICBA 3S0BA 1KK7Z 2G9BA 4HREE 1H8BA 1SR6C 2LUCA 3OB2B 1YURA 2KBMA 2KAYA 4E68A 3L4AA 4ICBA 3BUWB 4MZJA 2F2PA 4OR9B 5CPVA 2LVIA 1E8AA 1BU3A 4YRUA 2GTEA 1BMOA 1TUZA 3CWGA 5AEQA 3S0DA 3TDZA 1EH2A 5HL1A 2OS8B 5HKWA 4MSPA 4N1GA 1SY9A 2H8VA 1EXRA 3DF0B 2LP3A 3DYEA 3H4SE 1MUXA 5GQQC 4GNKB 1K93D 1PVBA 1TWOA 1QASA 1QVIZ 4PE0A 2LANA 4GPLB 4CFQA 1RROA 2A4JA 4BY4A 1J7RA 2K7DA 2WC6A 3LL8B 1M46A 2PASA 2L98A 5ER5A 2Q91A 3R1OA 1QX2A 1SPYA 2WCMA 4PE4A 1RWYA 4PHKA 1UHJA 2L51A 2QEOA 3I5FC 3L47A 4JPZB 1S6JA 2H61A 3CS1A 2LCPA 3I5GC 1XFUO 3VRPA 2K8MB 2PQLA 3O78A 1CFPA 1W7JB 3D77A 3JTDC 2KI4B 3SG6A 2DOQA 1QS7A 1CDPA 2YGUA 1NP8A 4YI9A 3SG4A 1SYMA 5KU1A 1UWOA 1YRTB 2QACA 3DVJA 2EHBA 1QV0A 1TN4A 3FE8A 1OOFA 3CZTX 3BUOB 1KK8C 1SK6D 4XJKA 4IJ7A 1BF5A 2JT0A 2K61A 1UUSA 3BFBA 2JXLA 2OPOA 1IJ6A 4MRYA 5CSJA 1TCFA 1Z4HA 2GGMA 4PE7A 1M63B 2ZRSA 1A75A 5FYXA 1ZMZA 3BFAA 1IH0A 2SASA 1G8IA 1UHHA 3D73A 3D76A 3TDIA 1B9AA 5JJGA 3O6BA 1CDNA 1F70A 1TNPA 2WCHA 1XO5A 2K60A 1QIWA 2KYFA 1NSHA 4YGAA 2MLEC 3N7HA 2M8UA 1OSAA 1IIOA 5DKQA 5K89A 4PE1A 5G08A 1DVIA 1KWOB 1CM4A 1S5GZ 2BE4A 3TDUA 1EG3A 4M2OA 1K9PA 1OOJA 2NCPA 1GQMA 1XFVO 1LKJA 5JOLA 2I18A 1C3ZA 3M0WA 1IQ5A 2FJUB 2L2EA 2LLUA 1TUJA 4PCWA 3FE6A 1DTLA 3IF7A 2Q4UA 1QV1A 4MBEA 3PN7C 4YGEB 2JT3A 2QPTA 2KLDA 3D10A 2KSPA 1HQVA 3HCMA 1BODA 4WQ2A 1S6IA 1F55A 5KTYA 1KQMC 1CFCA 1N0YA 1DQEA 1QIVA 2FCDA 2QDIA 4A4BA 4BY5A 3RLZA 1BG1A 1OW4A 1SL8A 1SCMC 3KHEA 1C3YA 3I5HB 1B7TY 2EGDA 2HF5A 2LHLA 3VB1A 4I5JA 2M9GA 4Q04A 2O60A 5PALA 3I5IB 1OE9B 1OQPA 4UPGA 5BPJA 2JNXA 2OTGC 1PRWA 2FJYA 2FOTA 3PM2A 2L5YA 5KSZA 3WXAA 5HKZA 1QWVA 3B86A 4M2PA 1PULA 1JC2A 2KQ6A 3UNWA 4PT1A 5AERA 1OOGA 4GUKA 1BJFA 2KQYA 2NCOA 2AUCA 3PLFB 1CLLA 3TUYC 1YX7A 1DF0A 3OBVA 1SNLA 3BUMB 4IL1A 3WHUB 1AK8A 1B47A 1DGVA 2M0RA 3BJHA 4FQOA 4XJKB 2Y4QA 3GOFA 4TNCA 1B1GA 2L2CA 4I5NB 3KPXA 1W9ZA 3EVUA 1FPWA 2CCMA 5DKNA 1OZSA 2ERBA 1DJZA 2PSRA 4FTGA 2F3YA 1SMGA 2P70A 1A75B 1TTXA 2QEBA 3EK4A 3FWBA 5DICA 1C07A 1SW8A 5I8NA 1AVSA 1QX7A 1V1FA 1EJ3A 1XK4C 3JVTC 4YGCB 1FI5A 1UP5A 1CNPA 3NSIA 1NX3A 2PVBA 3LK1A 1SRAA 2BKHB 2BCAA 3OGNA 4AQJA 4ORAB 5HKYA 1OMDA 2LAPA 5FI7A 1TNXA 2E30A 2G2BA 1J55A 3BOWA 3QRXA 3NSLA 2O5GA 1S36A 4ETOA 1A29A 2V53A 1CKKA 2JT8A 2JWWA 2WCFA 2MLFC 2M97A 1SR6B 3CZ0A 3SIAA 1CFFA 1IGVA 1Z2CB 3BUXB 3VROA 2WC8A 1NIWA 1LVCD 1AUIB 4OCIA 1KCYA 1PSBA 1MR8A 3TS5C 3GK4X 4AQIA 1UHIA 4PALA 2HQWA 4C0LA 1MWNA 2KFFA 5I2QA 1WY9A 1R2UA 2GGZA 1XYDA 4NDCA 1EL4A 4QJ4B 2L50A 3R1PA 4PDZA 1WLMA 2LVJA 3WNXB 4INXA 4MVFA 1K2HA 3RZSA 2KGBC 2I94A 1F4OA 2PYQA 2ZN8A 3B87A 3A4UB 2BCXA 3LLEA
chains in the Genus database with same CATH topology
1YUTA 4N1FA 5CSFA 5HLVA 1IWQA 1XFXO 1J1DA 1XFWO 4CLNA 1LINA 1CMFA 1KFUS 2BE6A 2HETA 1KFXL 1PK0D 1UURA 3I5FB 2JTZA 4GAOA 5HYDA 1DJXA 1IG5A 1QXPA 1UHKA 1WRZA 1LA3A 1KK7Y 3BQ3A 1YTZC 1NX0A 2BKIB 3I5GB 1CDMA 1ZOTB 4MLWA 5AXIA 1LXFC 1DF0B 3JTDB 4C0KA 4P2YB 1B8CA 2LMUA 4MZKA 1RJVA 1B4CA 4CPVA 1GJYA 1EG4A 1AHRA 4HSZA 2BL0C 5J3XA 4CIDA 1OMRA 2JTTA 4GBAA 2PMYA 3EK7A 5D69A 4CFRA 1YUSA 2LP2A 4HRGA 1CLBA 1L7ZA 3BYAA 2KGRA 3AKAA 1QVIY 1G4YR 1M31A 1ZUZA 2EC6B 3BXKA 5IBWA 1ALVA 3DVEA 1C7WA 2MJWB 1U5IA 2HPSA 2CXJA 1WRLA 2KHNA 3OX6A 1NYAA 3BOWB 1JF2A 1CFDA 3FWCA 3ZNIA 4P5OE 2JU0A 2JC2A 2ZNDA 1NX1A 1DJWA 4WQ3A 3SIBA 4NDDA 3GK2A 1KWOC 1NWDA 2LMTA 2FCEA 2LLSA 1L2OB 2MA2A 2RGIA 3PN7B 2M7NA 4MEWA 2ISDA 1CLMA 5ER4X 1RECA 3AAJA 1NX2A 1NPQA 1A4PA 3CR5X 2CNPA 2P6BB 2NXQA 4YGDB 1KQMB 3F45A 3AKBA 1XVJA 4U8DA 3SG5A 4PHMA 3FS7A 5CSNA 3LCPC 2B1UA 4GFTA 1DJIA 2Y1NA 3IQOA 3EKHA 1G33A 3CTNA 2JOJA 2ZKMX 1M45A 2F3ZA 3PFVA 1MQ1A 4DIRA 1TRFA 3IQQA 1S5GY 4A4CA 1QTXA 1CM1A 3EVRA 1PSRA 4I5KA 1K96A 1ZACA 2NLNA 2KBIA 4DUQA 1OMVA 2MBXA 1YR5A 2LVVA 4NDBA 1J1EA 2JPTA 1DGUA 3TUYB 5I2OA 1DJHA 1QLKA 2KAXA 3CR4X 3EKJA 1IKUA 4M2QA 3D0YA 1TCOB 4YBHB 4NQGA 4R1EA 4GGFC 2HQ8A 2WORA 2KI6C 1WLZA 2LV7A 2E6WA 1TNWA 1PVAA 1NCZA 1YVHA 1S3PA 1K94A 2K7CA 1Y6WA 3JVTB 2CT9A 5DKRA 4OV2A 1U5IB 2LMVA 1IQ3A 1KSMA 4F0ZB 1WDCC 4D1EA 2BBMA 4DS7A 1SCVA 1QJTA 2JRFA 1PALA 2L0PA 3EK8A 2F2OA 2JQ6A 2NZ0A 1S1EA 1Y1UA 4PHNA 1MHOA 5TNCA 1BR1B 1WRKA 1RFJA 4XYNA 1V1GA 2JXCA 3RM1A 1K90D 1QATA 1YUUA 3SJSA 1K9KA 1YRUB 1FBVA 1TIZA 2LLTA 3DVKA 1RTP1 2SCPA 3TS5B 3OX5A 2WCBA 1NUBA 3K21A 2L5XB 1A03A 1BOCA 1CTRA 3DD4A 1OZOA 1NCYA 1JF0A 2OS8C 5AANA 2AMIA 1NCXA 3CR2A 3NSKA 1R6PA 3OB1B 4HRHA 1GGWA 1QX5B 4MRXA 2PRUA 3E3RA 2KNEA 1QLSA 1N2DA 1TNQA 1J7PA 1S26D 3KEVA 3FIAA 2M7LA 1KSOA 2L4HA 4YI8A 3VRNA 3SG3A 4JQ0D 3VRQA 4MZLA 2WNDA 2F8PA 1VRKA 2ZRTA 3C1VA 3PALA 1F4QA 1KK8B 2KI4C 3VGOA 2MRDA 1B8RA 3O4YA 2D8NA 1SL7A 1BR4B 3D0YB 3SG2A 2IS9A 2I2RE 2ZN9A 2KFHA 2BL0B 4MN0A 4OKHA 2WCEA 2ZFDA 1S6CA 1Y0VH 2L4IA 1XK4A 3BUNB 4GGFA 1CMGA 4QJ3B 4ZCUA 1X02A 2LNKA 1JUOA 1ZFSA 4GGNA 4OVNF 1DMOA 4C0JA 1F54A 5I2LA 5B8IB 4WRIA 1B7TZ 1TOPA 2M49B 4I5LB 2KYCA 2KDHA 2BCBA 2H2KA 1C7VA 3PATA 2COLB 2EC6C 2JZIA 1J7OA 5CSIA 1IRJA 3LK0A 2K2FA 2LC5A 5D7FA 1DJYA 2AAOA 4DRWA 2KAVA 4USLA 2CTNA 4PHJA 1K8UA 1JSAA 1RK9A 4ORBB 4QJ5B 1ODBA 2GV5A 3KO0A 1XA5A 1K9UA 1M39A 1JFKA 1Y1XA 2LE9B 1MXEA 2JULA 1AJ5A 1SKTA 1SCMB 2KI6D 2K7OA 1W7IB 2Y1MA 1L2OC 2LM5A 3WHTB 1N65A 2M3WA 3EVVA 1GGZA 2K2AA 3PM8A 1KFUL 1Q80A 3DF0A 3MSEB 1B8LA 3AAKA 1FF1A 1MF8B 2OTGB 2VRGA 2K7BA 3I5HC 2PALA 1IJ5A 3GK1A 3I5IC 1FW4A 1AJ4A 1J7QA 1MXLC 2LHIA 1FI6A 2MAZA 3PSRA 1LA0A 2LUXA 2I7AA 2M1KB 1HT9A 2H61C 1F71A 4ORCB 1CB1A 3A8RA 1KQVA 3O2PA 3KF9A 3OP0A 4JWQA 2M1UA 4L9MA 1SL9A 2BBNA 3NSOA 1JBAA 4AOMA 1JFJA 3DVMA 3ZWHA 1BLQA 2M29A 2TN4A 2F33A 1H4BA 2Y5IA 3CLNA 3OHMB 4DCKA 1YVLA 3TZ1A 1KFXS 1K95A 1BT6A 3CGAA 2CBLA 1XFYO 2K0JA 1JWDA 3SG7A 2KFGA 2MHHA 1YX8A 1ALWA 4YGBB 1CDLA 1Y1AA 1DJGA 1DT7B 1WDCB 3VRRA 2BECA 2R2IA 5F6TA 2JNFA 1SBJA 5HLOA 4N5XA 1F8HA 1UHNA 2ZNEA 3HX4A 3NXAA 2KOTA 5AFPA 2LVKA 4ZCVA 2WOSA 1AP4A 1XFZO 1A2XA 3ICBA 1KK7Z 2G9BA 4HREE 1H8BA 1SR6C 2LUCA 3OB2B 1YURA 2KBMA 2KAYA 4E68A 4ICBA 3BUWB 4MZJA 2F2PA 4OR9B 5CPVA 2LVIA 1E8AA 1BU3A 4YRUA 1BMOA 3CWGA 5AEQA 3TDZA 1EH2A 2OS8B 5HKWA 4MSPA 4N1GA 1SY9A 1EXRA 3DF0B 2LP3A 3H4SE 1MUXA 5GQQC 4GNKB 1K93D 1PVBA 1QASA 1QVIZ 4PE0A 2LANA 4GPLB 4CFQA 1RROA 2A4JA 4BY4A 1J7RA 2K7DA 3LL8B 1M46A 2PASA 2L98A 5ER5A 2Q91A 1QX2A 1SPYA 4PE4A 1RWYA 4PHKA 1UHJA 2L51A 3I5FC 4JPZB 1S6JA 2H61A 3CS1A 2LCPA 3I5GC 1XFUO 3VRPA 2K8MB 3O78A 1CFPA 1W7JB 3JTDC 2KI4B 3SG6A 2DOQA 1QS7A 1CDPA 4YI9A 1NP8A 5KU1A 3SG4A 1SYMA 1UWOA 1YRTB 2QACA 3DVJA 2EHBA 1QV0A 1TN4A 3CZTX 3BUOB 1KK8C 1SK6D 4XJKA 1BF5A 2JT0A 2K61A 1UUSA 2JXLA 2OPOA 1IJ6A 4MRYA 5CSJA 1TCFA 4PE7A 2GGMA 1M63B 2ZRSA 1A75A 5FYXA 1ZMZA 1IH0A 2SASA 1G8IA 1UHHA 3TDIA 1B9AA 5JJGA 3O6BA 1CDNA 1F70A 1TNPA 1XO5A 1QIWA 2KYFA 1NSHA 4YGAA 2MLEC 2M8UA 1OSAA 5DKQA 5K89A 4PE1A 5G08A 1DVIA 1KWOB 1CM4A 1S5GZ 2BE4A 3TDUA 1EG3A 4M2OA 1K9PA 1OOJA 2NCPA 1GQMA 1XFVO 1LKJA 5JOLA 2I18A 3M0WA 1IQ5A 2FJUB 2L2EA 2LLUA 4PCWA 1DTLA 3IF7A 2Q4UA 1QV1A 4MBEA 3PN7C 4YGEB 2JT3A 2QPTA 3D10A 2KSPA 1HQVA 3HCMA 1BODA 4WQ2A 1S6IA 1F55A 5KTYA 1KQMC 1CFCA 1N0YA 1BG1A 1QIVA 2FCDA 4BY5A 4A4BA 3RLZA 1SL8A 1SCMC 3KHEA 3I5HB 1B7TY 2EGDA 2HF5A 2LHLA 4I5JA 2M9GA 4Q04A 2O60A 5PALA 3I5IB 1OE9B 1OQPA 4UPGA 5BPJA 2JNXA 2OTGC 1PRWA 2FOTA 5KSZA 3WXAA 5HKZA 4M2PA 1PULA 1JC2A 2KQ6A 5AERA 4GUKA 1BJFA 2KQYA 2NCOA 2AUCA 3PLFB 1CLLA 3TUYC 1YX7A 1DF0A 1SNLA 3BUMB 4IL1A 3WHUB 1AK8A 1B47A 1DGVA 2M0RA 4XJKB 4FQOA 2Y4QA 3GOFA 4TNCA 1B1GA 4I5NB 1FPWA 3KPXA 3EVUA 2CCMA 5DKNA 1OZSA 1DJZA 2PSRA 4FTGA 2F3YA 1SMGA 1A75B 1TTXA 3FWBA 3EK4A 1C07A 1SW8A 5I8NA 1AVSA 1QX7A 1V1FA 1EJ3A 1XK4C 3JVTC 4YGCB 1FI5A 1UP5A 1CNPA 3NSIA 1NX3A 2PVBA 3LK1A 1SRAA 2BKHB 2BCAA 4AQJA 5HKYA 4ORAB 1D1OA 1OMDA 2LAPA 1TNXA 2E30A 2G2BA 1J55A 3BOWA 3QRXA 3NSLA 2O5GA 1S36A 4ETOA 1A29A 2V53A 1CKKA 2JT8A 2JWWA 2WCFA 2MLFC 2M97A 1SR6B 3SIAA 1CFFA 1IGVA 3BUXB 3VROA 2WC8A 1NIWA 1LVCD 1AUIB 4OCIA 1KCYA 1PSBA 1MR8A 3TS5C 3GK4X 4AQIA 1UHIA 4PALA 2HQWA 4C0LA 1MWNA 2KFFA 5I2QA 1WY9A 1R2UA 2GGZA 1XYDA 4NDCA 1EL4A 4QJ4B 2L50A 4PDZA 1WLMA 2LVJA 3WNXB 4MVFA 1K2HA 2KGBC 2I94A 1F4OA 2ZN8A 3A4UB 2BCXA 3LLEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YUT A;  4N1F A;  5CSF A;  5HLV A;  1IWQ A;  1XFX O;  1J1D A;  1XFW O;  4CLN A;  1LIN A;  1CMF A;  1KFU S;  2BE6 A;  2HET A;  1KFX L;  1PK0 D;  1UUR A;  3I5F B;  2JTZ A;  4GAO A;  5HYD A;  1DJX A;  1IG5 A;  1QXP A;  1UHK A;  1WRZ A;  1LA3 A;  1KK7 Y;  3BQ3 A;  1YTZ C;  1NX0 A;  2BKI B;  3I5G B;  1CDM A;  1ZOT B;  4MLW A;  5AXI A;  1LXF C;  1DF0 B;  3JTD B;  4C0K A;  4P2Y B;  1B8C A;  2LMU A;  4MZK A;  1RJV A;  1B4C A;  4CPV A;  1GJY A;  1EG4 A;  1AHR A;  4HSZ A;  2BL0 C;  5J3X A;  4CID A;  1OMR A;  2JTT A;  4GBA A;  2PMY A;  3EK7 A;  5D69 A;  4CFR A;  1YUS A;  2LP2 A;  4HRG A;  1CLB A;  1L7Z A;  3BYA A;  2KGR A;  3AKA A;  1QVI Y;  1G4Y R;  1M31 A;  1ZUZ A;  2EC6 B;  3BXK A;  5IBW A;  1ALV A;  3DVE A;  1C7W A;  2MJW B;  1U5I A;  2HPS A;  2CXJ A;  1WRL A;  2KHN A;  3OX6 A;  1NYA A;  3BOW B;  1JF2 A;  1CFD A;  3FWC A;  3ZNI A;  4P5O E;  2JU0 A;  2JC2 A;  2ZND A;  1NX1 A;  1DJW A;  4WQ3 A;  3SIB A;  4NDD A;  3GK2 A;  1KWO C;  1NWD A;  2LMT A;  2FCE A;  2LLS A;  1L2O B;  2MA2 A;  2RGI A;  3PN7 B;  2M7N A;  4MEW A;  2ISD A;  1CLM A;  5ER4 X;  1REC A;  3AAJ A;  1NX2 A;  1NPQ A;  1A4P A;  3CR5 X;  2CNP A;  2P6B B;  2NXQ A;  4YGD B;  1KQM B;  3F45 A;  3AKB A;  1XVJ A;  4U8D A;  3SG5 A;  4PHM A;  3FS7 A;  5CSN A;  3LCP C;  2B1U A;  4GFT A;  1DJI A;  2Y1N A;  3IQO A;  3EKH A;  1G33 A;  3CTN A;  2JOJ A;  2ZKM X;  1M45 A;  2F3Z A;  3PFV A;  1MQ1 A;  4DIR A;  1TRF A;  3IQQ A;  1S5G Y;  4A4C A;  1QTX A;  1CM1 A;  3EVR A;  1PSR A;  4I5K A;  1K96 A;  1ZAC A;  2NLN A;  2KBI A;  4DUQ A;  1OMV A;  2MBX A;  1YR5 A;  2LVV A;  4NDB A;  1J1E A;  2JPT A;  1DGU A;  3TUY B;  5I2O A;  1DJH A;  1QLK A;  2KAX A;  3CR4 X;  3EKJ A;  1IKU A;  4M2Q A;  3D0Y A;  1TCO B;  4YBH B;  4NQG A;  4R1E A;  4GGF C;  2HQ8 A;  2WOR A;  2KI6 C;  1WLZ A;  2LV7 A;  2E6W A;  1TNW A;  1PVA A;  1NCZ A;  1YVH A;  1S3P A;  1K94 A;  2K7C A;  1Y6W A;  3JVT B;  2CT9 A;  5DKR A;  4OV2 A;  1U5I B;  2LMV A;  1IQ3 A;  1KSM A;  4F0Z B;  1WDC C;  4D1E A;  2BBM A;  4DS7 A;  1SCV A;  1QJT A;  2JRF A;  1PAL A;  2L0P A;  3EK8 A;  2F2O A;  2JQ6 A;  2NZ0 A;  1S1E A;  1Y1U A;  4PHN A;  1MHO A;  5TNC A;  1BR1 B;  1WRK A;  1RFJ A;  4XYN A;  1V1G A;  2JXC A;  3RM1 A;  1K90 D;  1QAT A;  1YUU A;  3SJS A;  1K9K A;  1YRU B;  1FBV A;  1TIZ A;  2LLT A;  3DVK A;  1RTP 1;  2SCP A;  3TS5 B;  3OX5 A;  2WCB A;  1NUB A;  3K21 A;  2L5X B;  1A03 A;  1BOC A;  1CTR A;  3DD4 A;  1OZO A;  1NCY A;  1JF0 A;  2OS8 C;  5AAN A;  2AMI A;  1NCX A;  3CR2 A;  3NSK A;  1R6P A;  3OB1 B;  4HRH A;  1GGW A;  1QX5 B;  4MRX A;  2PRU A;  3E3R A;  2KNE A;  1QLS A;  1N2D A;  1TNQ A;  1J7P A;  1S26 D;  3KEV A;  3FIA A;  2M7L A;  1KSO A;  2L4H A;  4YI8 A;  3VRN A;  3SG3 A;  4JQ0 D;  3VRQ A;  4MZL A;  2WND A;  2F8P A;  1VRK A;  2ZRT A;  3C1V A;  3PAL A;  1F4Q A;  1KK8 B;  2KI4 C;  3VGO A;  2MRD A;  1B8R A;  3O4Y A;  2D8N A;  1SL7 A;  1BR4 B;  3D0Y B;  3SG2 A;  2IS9 A;  2I2R E;  2ZN9 A;  2KFH A;  2BL0 B;  4MN0 A;  4OKH A;  2WCE A;  2ZFD A;  1S6C A;  1Y0V H;  2L4I A;  1XK4 A;  3BUN B;  4GGF A;  1CMG A;  4QJ3 B;  4ZCU A;  1X02 A;  2LNK A;  1JUO A;  1ZFS A;  4GGN A;  4OVN F;  1DMO A;  4C0J A;  1F54 A;  5I2L A;  5B8I B;  4WRI A;  1B7T Z;  1TOP A;  2M49 B;  4I5L B;  2KYC A;  2KDH A;  2BCB A;  2H2K A;  1C7V A;  3PAT A;  2COL B;  2EC6 C;  2JZI A;  1J7O A;  5CSI A;  1IRJ A;  3LK0 A;  2K2F A;  2LC5 A;  5D7F A;  1DJY A;  2AAO A;  4DRW A;  2KAV A;  4USL A;  2CTN A;  4PHJ A;  1K8U A;  1JSA A;  1RK9 A;  4ORB B;  4QJ5 B;  1ODB A;  2GV5 A;  3KO0 A;  1XA5 A;  1K9U A;  1M39 A;  1JFK A;  1Y1X A;  2LE9 B;  1MXE A;  2JUL A;  1AJ5 A;  1SKT A;  1SCM B;  2KI6 D;  2K7O A;  1W7I B;  2Y1M A;  1L2O C;  2LM5 A;  3WHT B;  1N65 A;  2M3W A;  3EVV A;  1GGZ A;  2K2A A;  3PM8 A;  1KFU L;  1Q80 A;  3DF0 A;  3MSE B;  1B8L A;  3AAK A;  1FF1 A;  1MF8 B;  2OTG B;  2VRG A;  2K7B A;  3I5H C;  2PAL A;  1IJ5 A;  3GK1 A;  3I5I C;  1FW4 A;  1AJ4 A;  1J7Q A;  1MXL C;  2LHI A;  1FI6 A;  2MAZ A;  3PSR A;  1LA0 A;  2LUX A;  2I7A A;  2M1K B;  1HT9 A;  2H61 C;  1F71 A;  4ORC B;  1CB1 A;  3A8R A;  1KQV A;  3O2P A;  3KF9 A;  3OP0 A;  4JWQ A;  2M1U A;  4L9M A;  1SL9 A;  2BBN A;  3NSO A;  1JBA A;  4AOM A;  1JFJ A;  3DVM A;  3ZWH A;  1BLQ A;  2M29 A;  2TN4 A;  2F33 A;  1H4B A;  2Y5I A;  3CLN A;  3OHM B;  4DCK A;  1YVL A;  3TZ1 A;  1KFX S;  1K95 A;  1BT6 A;  3CGA A;  2CBL A;  1XFY O;  2K0J A;  1JWD A;  3SG7 A;  2KFG A;  2MHH A;  1YX8 A;  1ALW A;  4YGB B;  1CDL A;  1Y1A A;  1DJG A;  1DT7 B;  1WDC B;  3VRR A;  2BEC A;  2R2I A;  5F6T A;  2JNF A;  1SBJ A;  5HLO A;  4N5X A;  1F8H A;  1UHN A;  2ZNE A;  3HX4 A;  3NXA A;  2KOT A;  5AFP A;  2LVK A;  4ZCV A;  2WOS A;  1AP4 A;  1XFZ O;  1A2X A;  3ICB A;  1KK7 Z;  2G9B A;  4HRE E;  1H8B A;  1SR6 C;  2LUC A;  3OB2 B;  1YUR A;  2KBM A;  2KAY A;  4E68 A;  4ICB A;  3BUW B;  4MZJ A;  2F2P A;  4OR9 B;  5CPV A;  2LVI A;  1E8A A;  1BU3 A;  4YRU A;  1BMO A;  3CWG A;  5AEQ A;  3TDZ A;  1EH2 A;  2OS8 B;  5HKW A;  4MSP A;  4N1G A;  1SY9 A;  1EXR A;  3DF0 B;  2LP3 A;  3H4S E;  1MUX A;  5GQQ C;  4GNK B;  1K93 D;  1PVB A;  1QAS A;  1QVI Z;  4PE0 A;  2LAN A;  4GPL B;  4CFQ A;  1RRO A;  2A4J A;  4BY4 A;  1J7R A;  2K7D A;  3LL8 B;  1M46 A;  2PAS A;  2L98 A;  5ER5 A;  2Q91 A;  1QX2 A;  1SPY A;  4PE4 A;  1RWY A;  4PHK A;  1UHJ A;  2L51 A;  3I5F C;  4JPZ B;  1S6J A;  2H61 A;  3CS1 A;  2LCP A;  3I5G C;  1XFU O;  3VRP A;  2K8M B;  3O78 A;  1CFP A;  1W7J B;  3JTD C;  2KI4 B;  3SG6 A;  2DOQ A;  1QS7 A;  1CDP A;  4YI9 A;  1NP8 A;  5KU1 A;  3SG4 A;  1SYM A;  1UWO A;  1YRT B;  2QAC A;  3DVJ A;  2EHB A;  1QV0 A;  1TN4 A;  3CZT X;  3BUO B;  1KK8 C;  1SK6 D;  4XJK A;  1BF5 A;  2JT0 A;  2K61 A;  1UUS A;  2JXL A;  2OPO A;  1IJ6 A;  4MRY A;  5CSJ A;  1TCF A;  4PE7 A;  2GGM A;  1M63 B;  2ZRS A;  1A75 A;  5FYX A;  1ZMZ A;  1IH0 A;  2SAS A;  1G8I A;  1UHH A;  3TDI A;  1B9A A;  5JJG A;  3O6B A;  1CDN A;  1F70 A;  1TNP A;  1XO5 A;  1QIW A;  2KYF A;  1NSH A;  4YGA A;  2MLE C;  2M8U A;  1OSA A;  5DKQ A;  5K89 A;  4PE1 A;  5G08 A;  1DVI A;  1KWO B;  1CM4 A;  1S5G Z;  2BE4 A;  3TDU A;  1EG3 A;  4M2O A;  1K9P A;  1OOJ A;  2NCP A;  1GQM A;  1XFV O;  1LKJ A;  5JOL A;  2I18 A;  3M0W A;  1IQ5 A;  2FJU B;  2L2E A;  2LLU A;  4PCW A;  1DTL A;  3IF7 A;  2Q4U A;  1QV1 A;  4MBE A;  3PN7 C;  4YGE B;  2JT3 A;  2QPT A;  3D10 A;  2KSP A;  1HQV A;  3HCM A;  1BOD A;  4WQ2 A;  1S6I A;  1F55 A;  5KTY A;  1KQM C;  1CFC A;  1N0Y A;  1BG1 A;  1QIV A;  2FCD A;  4BY5 A;  4A4B A;  3RLZ A;  1SL8 A;  1SCM C;  3KHE A;  3I5H B;  1B7T Y;  2EGD A;  2HF5 A;  2LHL A;  4I5J A;  2M9G A;  4Q04 A;  2O60 A;  5PAL A;  3I5I B;  1OE9 B;  1OQP A;  4UPG A;  5BPJ A;  2JNX A;  2OTG C;  1PRW A;  2FOT A;  5KSZ A;  3WXA A;  5HKZ A;  4M2P A;  1PUL A;  1JC2 A;  2KQ6 A;  5AER A;  4GUK A;  1BJF A;  2KQY A;  2NCO A;  2AUC A;  3PLF B;  1CLL A;  3TUY C;  1YX7 A;  1DF0 A;  1SNL A;  3BUM B;  4IL1 A;  3WHU B;  1AK8 A;  1B47 A;  1DGV A;  2M0R A;  4XJK B;  4FQO A;  2Y4Q A;  3GOF A;  4TNC A;  1B1G A;  4I5N B;  1FPW A;  3KPX A;  3EVU A;  2CCM A;  5DKN A;  1OZS A;  1DJZ A;  2PSR A;  4FTG A;  2F3Y A;  1SMG A;  1A75 B;  1TTX A;  3FWB A;  3EK4 A;  1C07 A;  1SW8 A;  5I8N A;  1AVS A;  1QX7 A;  1V1F A;  1EJ3 A;  1XK4 C;  3JVT C;  4YGC B;  1FI5 A;  1UP5 A;  1CNP A;  3NSI A;  1NX3 A;  2PVB A;  3LK1 A;  1SRA A;  2BKH B;  2BCA A;  4AQJ A;  5HKY A;  4ORA B;  1D1O A;  1OMD A;  2LAP A;  1TNX A;  2E30 A;  2G2B A;  1J55 A;  3BOW A;  3QRX A;  3NSL A;  2O5G A;  1S36 A;  4ETO A;  1A29 A;  2V53 A;  1CKK A;  2JT8 A;  2JWW A;  2WCF A;  2MLF C;  2M97 A;  1SR6 B;  3SIA A;  1CFF A;  1IGV A;  3BUX B;  3VRO A;  2WC8 A;  1NIW A;  1LVC D;  1AUI B;  4OCI A;  1KCY A;  1PSB A;  1MR8 A;  3TS5 C;  3GK4 X;  4AQI A;  1UHI A;  4PAL A;  2HQW A;  4C0L A;  1MWN A;  2KFF A;  5I2Q A;  1WY9 A;  1R2U A;  2GGZ A;  1XYD A;  4NDC A;  1EL4 A;  4QJ4 B;  2L50 A;  4PDZ A;  1WLM A;  2LVJ A;  3WNX B;  4MVF A;  1K2H A;  2KGB C;  2I94 A;  1F4O A;  2ZN8 A;  3A4U B;  2BCX A;  3LLE A; 
#chains in the Genus database with same CATH topology
 1YUT A;  4N1F A;  5CSF A;  5HLV A;  1IWQ A;  1XFX O;  1J1D A;  1XFW O;  4JD9 A;  4CLN A;  1LIN A;  1CMF A;  1KFU S;  2BE6 A;  2HET A;  1KFX L;  1PK0 D;  1UUR A;  2WCJ A;  2JTZ A;  3I5F B;  4GAO A;  1DJX A;  1IG5 A;  1QXP A;  1UHK A;  1WRZ A;  1LA3 A;  1KK7 Y;  3BQ3 A;  1YTZ C;  1NX0 A;  2BKI B;  3DZT A;  3I5G B;  3R72 A;  1CDM A;  1ZOT B;  4MLW A;  5AXI A;  1LXF C;  1DF0 B;  3JTD B;  4C0K A;  4P2Y B;  1B8C A;  2LMU A;  3CDN A;  4MZK A;  1RJV A;  1B4C A;  4CPV A;  1GJY A;  1EG4 A;  1AHR A;  3CZ2 A;  4HSZ A;  2BL0 C;  5J3X A;  4CID A;  1T14 A;  1OMR A;  2JTT A;  4GBA A;  2PMY A;  3EK7 A;  5D69 A;  4CFR A;  1YUS A;  2LP2 A;  4HRG A;  1CLB A;  1L7Z A;  3BYA A;  2KGR A;  3R1V A;  3AKA A;  1QVI Y;  1G4Y R;  1M31 A;  1ZUZ A;  2EC6 B;  3BXK A;  5IBW A;  1ALV A;  3DVE A;  1C7W A;  2MJW B;  1U5I A;  2HPS A;  2CXJ A;  1WRL A;  2KHN A;  3OX6 A;  1NYA A;  3BOW B;  1JF2 A;  2BAP A;  1CFD A;  2JPO A;  3FWC A;  2QEH A;  3ZNI A;  4P5O E;  2JU0 A;  2JC2 A;  2WCK A;  2ZND A;  1NX1 A;  2KPH A;  1DJW A;  4WQ3 A;  3SIB A;  5D3O A;  4NDD A;  3GK2 A;  1KWO C;  1NWD A;  2LMT A;  2FCE A;  2LLS A;  1L2O B;  2MA2 A;  2RGI A;  3NHI A;  3PN7 B;  2M7N A;  4MEW A;  4FQT A;  2ISD A;  1CLM A;  5ER4 X;  1REC A;  3AAJ A;  1NX2 A;  1NPQ A;  1A4P A;  3CR5 X;  2CNP A;  3CAB A;  2P6B B;  2NXQ A;  4YGD B;  1KQM B;  3F45 A;  1XFR A;  1XVJ A;  3AKB A;  4U8D A;  3SG5 A;  4PHM A;  3FS7 A;  5HYD A;  5CSN A;  3LCP C;  2B1U A;  4GFT A;  1DJI A;  2BNX A;  2Y1N A;  3IQO A;  3EKH A;  1G33 A;  3CTN A;  2JOJ A;  1DEL A;  1DC1 A;  2ZKM X;  1M45 A;  3O4X A;  2F3Z A;  3PFV A;  1MQ1 A;  4DIR A;  1TRF A;  3IQQ A;  1S5G Y;  4A4C A;  1QTX A;  1CM1 A;  3EVR A;  1PSR A;  4I5K A;  1K96 A;  1ZAC A;  3NGV A;  2NLN A;  2KBI A;  4DUQ A;  1OMV A;  2MBX A;  1YR5 A;  2LVV A;  4NDB A;  1J1E A;  2JPT A;  1DGU A;  3TUY B;  5I2O A;  1DJH A;  1QLK A;  2KAX A;  3CR4 X;  3EKJ A;  1IKU A;  1DEK A;  2WCL A;  4M2Q A;  3D0Y A;  1TCO B;  4YBH B;  4NQG A;  4R1E A;  4GGF C;  2HQ8 A;  2WOR A;  2KI6 C;  1WLZ A;  2LV7 A;  2E6W A;  1TNW A;  1PVA A;  5I94 A;  1NCZ A;  1YVH A;  1S3P A;  1K94 A;  1ORG A;  3NHT A;  2K7C A;  1Y6W A;  3JVT B;  2CT9 A;  5DKR A;  4OV2 A;  1U5I B;  2WC5 A;  2LMV A;  1IQ3 A;  1KSM A;  4F0Z B;  1WDC C;  4D1E A;  2BBM A;  4DS7 A;  1SCV A;  1QJT A;  2JRF A;  3D78 A;  1PAL A;  2L0P A;  3EK8 A;  2F2O A;  2JQ6 A;  2NZ0 A;  1S1E A;  1Y1U A;  3DXL A;  4PHN A;  3Q8I A;  3SS5 A;  1MHO A;  5TNC A;  1BR1 B;  1WRK A;  1RFJ A;  3B6X A;  3V2L A;  4XYN A;  3UO9 A;  1V1G A;  2JXC A;  3RM1 A;  4INW A;  1K90 D;  1QAT A;  1YUU A;  3SJS A;  5FI6 A;  1K9K A;  1YRU B;  1FBV A;  1TIZ A;  2LLT A;  3DVK A;  1RTP 1;  2SCP A;  3TS5 B;  3OX5 A;  2WCB A;  1NUB A;  3K21 A;  2L5X B;  1A03 A;  1BOC A;  1CTR A;  3DD4 A;  1OZO A;  1NCY A;  1JF0 A;  2OS8 C;  1GM0 A;  5AAN A;  2AMI A;  1NCX A;  3CR2 A;  3NSK A;  1R6P A;  1OOI X;  3OB1 B;  4HRH A;  3FE9 A;  1GGW A;  1QX5 B;  4MRX A;  2PRU A;  3E3R A;  2KNE A;  1QLS A;  1N2D A;  1TNQ A;  1J7P A;  1S26 D;  3KEV A;  3FIA A;  3QME A;  2M7L A;  3DY9 A;  1KSO A;  2L4H A;  3D75 A;  4YI8 A;  3VRN A;  3SG3 A;  1LS8 A;  4JQ0 D;  3VRQ A;  3EG5 B;  3B88 A;  4MZL A;  2WND A;  2F8P A;  1VRK A;  2ZRT A;  3C1V A;  3PAL A;  5EL2 A;  1F4Q A;  3S0A A;  1KK8 B;  2KI4 C;  3VGO A;  2MRD A;  1B8R A;  3O4Y A;  2D8N A;  1SL7 A;  1BR4 B;  3D0Y B;  3SG2 A;  2IS9 A;  2I2R E;  2ZN9 A;  3SS3 A;  2KFH A;  2BL0 B;  4MN0 A;  4OKH A;  2WCE A;  2ZFD A;  1S6C A;  1Y0V H;  2L4I A;  1XK4 A;  3BUN B;  3IVT A;  4GGF A;  4OZD A;  1CMG A;  4QJ3 B;  4ZCU A;  1X02 A;  4F7F A;  2LNK A;  1JUO A;  1ZFS A;  4GGN A;  4OVN F;  1DMO A;  4C0J A;  1F54 A;  5I2L A;  5B8I B;  4WRI A;  1B7T Z;  1TOP A;  2M49 B;  4I5L B;  2KYC A;  2KDH A;  2BCB A;  2H2K A;  3S0F A;  1C7V A;  3PAT A;  2COL B;  2EC6 C;  2JZI A;  1J7O A;  2QEV A;  1IRJ A;  3LK0 A;  5CSI A;  3SS4 A;  2K2F A;  2LC5 A;  5D7F A;  1DJY A;  2AAO A;  4DRW A;  3CYZ A;  2KAV A;  4USL A;  2CTN A;  4PHJ A;  1K8U A;  1JSA A;  1RK9 A;  4ORB B;  4QJ5 B;  1ODB A;  2GV5 A;  3KO0 A;  1XA5 A;  1K9U A;  1M39 A;  1JFK A;  1Y1X A;  2LE9 B;  1MXE A;  2JUL A;  1AJ5 A;  1SKT A;  1SCM B;  2KI6 D;  2K7O A;  1W7I B;  2Y1M A;  1L2O C;  2LM5 A;  3WHT B;  1N65 A;  2M3W A;  3EVV A;  1GGZ A;  2K2A A;  3PM8 A;  1KFU L;  1Q80 A;  3B7A A;  3DF0 A;  3MSE B;  4JKT A;  3S0E A;  1B8L A;  3AAK A;  1FF1 A;  1MF8 B;  2OTG B;  2VRG A;  2K7B A;  3I5H C;  2PAL A;  1IJ5 A;  3GK1 A;  3I5I C;  1FW4 A;  1OOH A;  2KLE A;  1AJ4 A;  1J7Q A;  1MXL C;  2LHI A;  1FI6 A;  2MAZ A;  3PSR A;  5FI2 A;  1LA0 A;  2LUX A;  2I7A A;  2M1K B;  1HT9 A;  2H61 C;  1F71 A;  4ORC B;  1D1O A;  1CB1 A;  3S0G A;  3A8R A;  1KQV A;  3O2P A;  3KF9 A;  3OP0 A;  4JWQ A;  2M1U A;  4L9M A;  1SL9 A;  2BBN A;  3NSO A;  1JBA A;  4AOM A;  1JFJ A;  3DVM A;  3ZWH A;  1BLQ A;  2M29 A;  2TN4 A;  3CZ1 A;  2F33 A;  1H4B A;  3D74 A;  2Y5I A;  3CLN A;  2P71 A;  3OHM B;  4DCK A;  1YVL A;  3TZ1 A;  1KFX S;  1K95 A;  1BT6 A;  3L4L A;  3CGA A;  2CBL A;  3PJI A;  1SSE B;  1XFY O;  2K0J A;  1JWD A;  3SG7 A;  4KYN A;  2KFG A;  2MHH A;  1P28 A;  1ALW A;  1YX8 A;  4YGB B;  1CDL A;  1Y1A A;  1DJG A;  1DT7 B;  1WDC B;  3VRR A;  2BEC A;  2R2I A;  5F6T A;  2JNF A;  1SBJ A;  5HLO A;  4N5X A;  3K1E A;  1UHN A;  2ZNE A;  1F8H A;  3HX4 A;  3NXA A;  3BFH A;  2KOT A;  5AFP A;  2LVK A;  4ZCV A;  2WOS A;  1AP4 A;  1XFZ O;  1A2X A;  3ICB A;  3S0B A;  1KK7 Z;  2G9B A;  4HRE E;  1H8B A;  1SR6 C;  2LUC A;  3OB2 B;  1YUR A;  2KBM A;  2KAY A;  4E68 A;  3L4A A;  4ICB A;  3BUW B;  4MZJ A;  2F2P A;  4OR9 B;  5CPV A;  2LVI A;  1E8A A;  1BU3 A;  4YRU A;  2GTE A;  1BMO A;  1TUZ A;  3CWG A;  5AEQ A;  3S0D A;  3TDZ A;  1EH2 A;  5HL1 A;  2OS8 B;  5HKW A;  4MSP A;  4N1G A;  1SY9 A;  2H8V A;  1EXR A;  3DF0 B;  2LP3 A;  3DYE A;  3H4S E;  1MUX A;  5GQQ C;  4GNK B;  1K93 D;  1PVB A;  1TWO A;  1QAS A;  1QVI Z;  4PE0 A;  2LAN A;  4GPL B;  4CFQ A;  1RRO A;  2A4J A;  4BY4 A;  1J7R A;  2K7D A;  2WC6 A;  3LL8 B;  1M46 A;  2PAS A;  2L98 A;  5ER5 A;  2Q91 A;  3R1O A;  1QX2 A;  1SPY A;  2WCM A;  4PE4 A;  1RWY A;  4PHK A;  1UHJ A;  2L51 A;  2QEO A;  3I5F C;  3L47 A;  4JPZ B;  1S6J A;  2H61 A;  3CS1 A;  2LCP A;  3I5G C;  1XFU O;  3VRP A;  2K8M B;  2PQL A;  3O78 A;  1CFP A;  1W7J B;  3D77 A;  3JTD C;  2KI4 B;  3SG6 A;  2DOQ A;  1QS7 A;  1CDP A;  2YGU A;  1NP8 A;  4YI9 A;  3SG4 A;  1SYM A;  5KU1 A;  1UWO A;  1YRT B;  2QAC A;  3DVJ A;  2EHB A;  1QV0 A;  1TN4 A;  3FE8 A;  1OOF A;  3CZT X;  3BUO B;  1KK8 C;  1SK6 D;  4XJK A;  4IJ7 A;  1BF5 A;  2JT0 A;  2K61 A;  1UUS A;  3BFB A;  2JXL A;  2OPO A;  1IJ6 A;  4MRY A;  5CSJ A;  1TCF A;  1Z4H A;  2GGM A;  4PE7 A;  1M63 B;  2ZRS A;  1A75 A;  5FYX A;  1ZMZ A;  3BFA A;  1IH0 A;  2SAS A;  1G8I A;  1UHH A;  3D73 A;  3D76 A;  3TDI A;  1B9A A;  5JJG A;  3O6B A;  1CDN A;  1F70 A;  1TNP A;  2WCH A;  1XO5 A;  2K60 A;  1QIW A;  2KYF A;  1NSH A;  4YGA A;  2MLE C;  3N7H A;  2M8U A;  1OSA A;  1IIO A;  5DKQ A;  5K89 A;  4PE1 A;  5G08 A;  1DVI A;  1KWO B;  1CM4 A;  1S5G Z;  2BE4 A;  3TDU A;  1EG3 A;  4M2O A;  1K9P A;  1OOJ A;  2NCP A;  1GQM A;  1XFV O;  1LKJ A;  5JOL A;  2I18 A;  1C3Z A;  3M0W A;  1IQ5 A;  2FJU B;  2L2E A;  2LLU A;  1TUJ A;  4PCW A;  3FE6 A;  1DTL A;  3IF7 A;  2Q4U A;  1QV1 A;  4MBE A;  3PN7 C;  4YGE B;  2JT3 A;  2QPT A;  2KLD A;  3D10 A;  2KSP A;  1HQV A;  3HCM A;  1BOD A;  4WQ2 A;  1S6I A;  1F55 A;  5KTY A;  1KQM C;  1CFC A;  1N0Y A;  1DQE A;  1QIV A;  2FCD A;  2QDI A;  4A4B A;  4BY5 A;  3RLZ A;  1BG1 A;  1OW4 A;  1SL8 A;  1SCM C;  3KHE A;  1C3Y A;  3I5H B;  1B7T Y;  2EGD A;  2HF5 A;  2LHL A;  3VB1 A;  4I5J A;  2M9G A;  4Q04 A;  2O60 A;  5PAL A;  3I5I B;  1OE9 B;  1OQP A;  4UPG A;  5BPJ A;  2JNX A;  2OTG C;  1PRW A;  2FJY A;  2FOT A;  3PM2 A;  2L5Y A;  5KSZ A;  3WXA A;  5HKZ A;  1QWV A;  3B86 A;  4M2P A;  1PUL A;  1JC2 A;  2KQ6 A;  3UNW A;  4PT1 A;  5AER A;  1OOG A;  4GUK A;  1BJF A;  2KQY A;  2NCO A;  2AUC A;  3PLF B;  1CLL A;  3TUY C;  1YX7 A;  1DF0 A;  3OBV A;  1SNL A;  3BUM B;  4IL1 A;  3WHU B;  1AK8 A;  1B47 A;  1DGV A;  2M0R A;  3BJH A;  4FQO A;  4XJK B;  2Y4Q A;  3GOF A;  4TNC A;  1B1G A;  2L2C A;  4I5N B;  3KPX A;  1W9Z A;  3EVU A;  1FPW A;  2CCM A;  5DKN A;  1OZS A;  2ERB A;  1DJZ A;  2PSR A;  4FTG A;  2F3Y A;  1SMG A;  2P70 A;  1A75 B;  1TTX A;  2QEB A;  3EK4 A;  3FWB A;  5DIC A;  1C07 A;  1SW8 A;  5I8N A;  1AVS A;  1QX7 A;  1V1F A;  1EJ3 A;  1XK4 C;  3JVT C;  4YGC B;  1FI5 A;  1UP5 A;  1CNP A;  3NSI A;  1NX3 A;  2PVB A;  3LK1 A;  1SRA A;  2BKH B;  2BCA A;  3OGN A;  4AQJ A;  4ORA B;  5HKY A;  1OMD A;  2LAP A;  5FI7 A;  1TNX A;  2E30 A;  2G2B A;  1J55 A;  3BOW A;  3QRX A;  3NSL A;  2O5G A;  1S36 A;  4ETO A;  1A29 A;  2V53 A;  1CKK A;  2JT8 A;  2JWW A;  2WCF A;  2MLF C;  2M97 A;  1SR6 B;  3CZ0 A;  3SIA A;  1CFF A;  1IGV A;  1Z2C B;  3BUX B;  3VRO A;  2WC8 A;  1NIW A;  1LVC D;  1AUI B;  4OCI A;  1KCY A;  1PSB A;  1MR8 A;  3TS5 C;  3GK4 X;  4AQI A;  1UHI A;  4PAL A;  2HQW A;  4C0L A;  1MWN A;  2KFF A;  5I2Q A;  1WY9 A;  1R2U A;  2GGZ A;  1XYD A;  4NDC A;  1EL4 A;  4QJ4 B;  2L50 A;  3R1P A;  4PDZ A;  1WLM A;  2LVJ A;  3WNX B;  4INX A;  4MVF A;  1K2H A;  3RZS A;  2KGB C;  2I94 A;  1F4O A;  2PYQ A;  2ZN8 A;  3B87 A;  3A4U B;  2BCX A;  3LLE A; 
#chains in the Genus database with same CATH homology
 1YUT A;  4N1F A;  5CSF A;  5HLV A;  1IWQ A;  1XFX O;  1J1D A;  1XFW O;  4CLN A;  1LIN A;  1CMF A;  1KFU S;  2BE6 A;  2HET A;  1KFX L;  1PK0 D;  1UUR A;  3I5F B;  2JTZ A;  4GAO A;  5HYD A;  1DJX A;  1IG5 A;  1QXP A;  1UHK A;  1WRZ A;  1LA3 A;  1KK7 Y;  3BQ3 A;  1YTZ C;  1NX0 A;  2BKI B;  3I5G B;  1CDM A;  1ZOT B;  4MLW A;  5AXI A;  1LXF C;  1DF0 B;  3JTD B;  4C0K A;  4P2Y B;  1B8C A;  2LMU A;  4MZK A;  1RJV A;  1B4C A;  4CPV A;  1GJY A;  1EG4 A;  1AHR A;  4HSZ A;  2BL0 C;  5J3X A;  4CID A;  1OMR A;  2JTT A;  4GBA A;  2PMY A;  3EK7 A;  5D69 A;  4CFR A;  1YUS A;  2LP2 A;  4HRG A;  1CLB A;  1L7Z A;  3BYA A;  2KGR A;  3AKA A;  1QVI Y;  1G4Y R;  1M31 A;  1ZUZ A;  2EC6 B;  3BXK A;  5IBW A;  1ALV A;  3DVE A;  1C7W A;  2MJW B;  1U5I A;  2HPS A;  2CXJ A;  1WRL A;  2KHN A;  3OX6 A;  1NYA A;  3BOW B;  1JF2 A;  1CFD A;  3FWC A;  3ZNI A;  4P5O E;  2JU0 A;  2JC2 A;  2ZND A;  1NX1 A;  1DJW A;  4WQ3 A;  3SIB A;  4NDD A;  3GK2 A;  1KWO C;  1NWD A;  2LMT A;  2FCE A;  2LLS A;  1L2O B;  2MA2 A;  2RGI A;  3PN7 B;  2M7N A;  4MEW A;  2ISD A;  1CLM A;  5ER4 X;  1REC A;  3AAJ A;  1NX2 A;  1NPQ A;  1A4P A;  3CR5 X;  2CNP A;  2P6B B;  2NXQ A;  4YGD B;  1KQM B;  3F45 A;  3AKB A;  1XVJ A;  4U8D A;  3SG5 A;  4PHM A;  3FS7 A;  5CSN A;  3LCP C;  2B1U A;  4GFT A;  1DJI A;  2Y1N A;  3IQO A;  3EKH A;  1G33 A;  3CTN A;  2JOJ A;  2ZKM X;  1M45 A;  2F3Z A;  3PFV A;  1MQ1 A;  4DIR A;  1TRF A;  3IQQ A;  1S5G Y;  4A4C A;  1QTX A;  1CM1 A;  3EVR A;  1PSR A;  4I5K A;  1K96 A;  1ZAC A;  2NLN A;  2KBI A;  4DUQ A;  1OMV A;  2MBX A;  1YR5 A;  2LVV A;  4NDB A;  1J1E A;  2JPT A;  1DGU A;  3TUY B;  5I2O A;  1DJH A;  1QLK A;  2KAX A;  3CR4 X;  3EKJ A;  1IKU A;  4M2Q A;  3D0Y A;  1TCO B;  4YBH B;  4NQG A;  4R1E A;  4GGF C;  2HQ8 A;  2WOR A;  2KI6 C;  1WLZ A;  2LV7 A;  2E6W A;  1TNW A;  1PVA A;  1NCZ A;  1YVH A;  1S3P A;  1K94 A;  2K7C A;  1Y6W A;  3JVT B;  2CT9 A;  5DKR A;  4OV2 A;  1U5I B;  2LMV A;  1IQ3 A;  1KSM A;  4F0Z B;  1WDC C;  4D1E A;  2BBM A;  4DS7 A;  1SCV A;  1QJT A;  2JRF A;  1PAL A;  2L0P A;  3EK8 A;  2F2O A;  2JQ6 A;  2NZ0 A;  1S1E A;  1Y1U A;  4PHN A;  1MHO A;  5TNC A;  1BR1 B;  1WRK A;  1RFJ A;  4XYN A;  1V1G A;  2JXC A;  3RM1 A;  1K90 D;  1QAT A;  1YUU A;  3SJS A;  1K9K A;  1YRU B;  1FBV A;  1TIZ A;  2LLT A;  3DVK A;  1RTP 1;  2SCP A;  3TS5 B;  3OX5 A;  2WCB A;  1NUB A;  3K21 A;  2L5X B;  1A03 A;  1BOC A;  1CTR A;  3DD4 A;  1OZO A;  1NCY A;  1JF0 A;  2OS8 C;  5AAN A;  2AMI A;  1NCX A;  3CR2 A;  3NSK A;  1R6P A;  3OB1 B;  4HRH A;  1GGW A;  1QX5 B;  4MRX A;  2PRU A;  3E3R A;  2KNE A;  1QLS A;  1N2D A;  1TNQ A;  1J7P A;  1S26 D;  3KEV A;  3FIA A;  2M7L A;  1KSO A;  2L4H A;  4YI8 A;  3VRN A;  3SG3 A;  4JQ0 D;  3VRQ A;  4MZL A;  2WND A;  2F8P A;  1VRK A;  2ZRT A;  3C1V A;  3PAL A;  1F4Q A;  1KK8 B;  2KI4 C;  3VGO A;  2MRD A;  1B8R A;  3O4Y A;  2D8N A;  1SL7 A;  1BR4 B;  3D0Y B;  3SG2 A;  2IS9 A;  2I2R E;  2ZN9 A;  2KFH A;  2BL0 B;  4MN0 A;  4OKH A;  2WCE A;  2ZFD A;  1S6C A;  1Y0V H;  2L4I A;  1XK4 A;  3BUN B;  4GGF A;  1CMG A;  4QJ3 B;  4ZCU A;  1X02 A;  2LNK A;  1JUO A;  1ZFS A;  4GGN A;  4OVN F;  1DMO A;  4C0J A;  1F54 A;  5I2L A;  5B8I B;  4WRI A;  1B7T Z;  1TOP A;  2M49 B;  4I5L B;  2KYC A;  2KDH A;  2BCB A;  2H2K A;  1C7V A;  3PAT A;  2COL B;  2EC6 C;  2JZI A;  1J7O A;  5CSI A;  1IRJ A;  3LK0 A;  2K2F A;  2LC5 A;  5D7F A;  1DJY A;  2AAO A;  4DRW A;  2KAV A;  4USL A;  2CTN A;  4PHJ A;  1K8U A;  1JSA A;  1RK9 A;  4ORB B;  4QJ5 B;  1ODB A;  2GV5 A;  3KO0 A;  1XA5 A;  1K9U A;  1M39 A;  1JFK A;  1Y1X A;  2LE9 B;  1MXE A;  2JUL A;  1AJ5 A;  1SKT A;  1SCM B;  2KI6 D;  2K7O A;  1W7I B;  2Y1M A;  1L2O C;  2LM5 A;  3WHT B;  1N65 A;  2M3W A;  3EVV A;  1GGZ A;  2K2A A;  3PM8 A;  1KFU L;  1Q80 A;  3DF0 A;  3MSE B;  1B8L A;  3AAK A;  1FF1 A;  1MF8 B;  2OTG B;  2VRG A;  2K7B A;  3I5H C;  2PAL A;  1IJ5 A;  3GK1 A;  3I5I C;  1FW4 A;  1AJ4 A;  1J7Q A;  1MXL C;  2LHI A;  1FI6 A;  2MAZ A;  3PSR A;  1LA0 A;  2LUX A;  2I7A A;  2M1K B;  1HT9 A;  2H61 C;  1F71 A;  4ORC B;  1CB1 A;  3A8R A;  1KQV A;  3O2P A;  3KF9 A;  3OP0 A;  4JWQ A;  2M1U A;  4L9M A;  1SL9 A;  2BBN A;  3NSO A;  1JBA A;  4AOM A;  1JFJ A;  3DVM A;  3ZWH A;  1BLQ A;  2M29 A;  2TN4 A;  2F33 A;  1H4B A;  2Y5I A;  3CLN A;  3OHM B;  4DCK A;  1YVL A;  3TZ1 A;  1KFX S;  1K95 A;  1BT6 A;  3CGA A;  2CBL A;  1XFY O;  2K0J A;  1JWD A;  3SG7 A;  2KFG A;  2MHH A;  1YX8 A;  1ALW A;  4YGB B;  1CDL A;  1Y1A A;  1DJG A;  1DT7 B;  1WDC B;  3VRR A;  2BEC A;  2R2I A;  5F6T A;  2JNF A;  1SBJ A;  5HLO A;  4N5X A;  1F8H A;  1UHN A;  2ZNE A;  3HX4 A;  3NXA A;  2KOT A;  5AFP A;  2LVK A;  4ZCV A;  2WOS A;  1AP4 A;  1XFZ O;  1A2X A;  3ICB A;  1KK7 Z;  2G9B A;  4HRE E;  1H8B A;  1SR6 C;  2LUC A;  3OB2 B;  1YUR A;  2KBM A;  2KAY A;  4E68 A;  4ICB A;  3BUW B;  4MZJ A;  2F2P A;  4OR9 B;  5CPV A;  2LVI A;  1E8A A;  1BU3 A;  4YRU A;  1BMO A;  3CWG A;  5AEQ A;  3TDZ A;  1EH2 A;  2OS8 B;  5HKW A;  4MSP A;  4N1G A;  1SY9 A;  1EXR A;  3DF0 B;  2LP3 A;  3H4S E;  1MUX A;  5GQQ C;  4GNK B;  1K93 D;  1PVB A;  1QAS A;  1QVI Z;  4PE0 A;  2LAN A;  4GPL B;  4CFQ A;  1RRO A;  2A4J A;  4BY4 A;  1J7R A;  2K7D A;  3LL8 B;  1M46 A;  2PAS A;  2L98 A;  5ER5 A;  2Q91 A;  1QX2 A;  1SPY A;  4PE4 A;  1RWY A;  4PHK A;  1UHJ A;  2L51 A;  3I5F C;  4JPZ B;  1S6J A;  2H61 A;  3CS1 A;  2LCP A;  3I5G C;  1XFU O;  3VRP A;  2K8M B;  3O78 A;  1CFP A;  1W7J B;  3JTD C;  2KI4 B;  3SG6 A;  2DOQ A;  1QS7 A;  1CDP A;  4YI9 A;  1NP8 A;  5KU1 A;  3SG4 A;  1SYM A;  1UWO A;  1YRT B;  2QAC A;  3DVJ A;  2EHB A;  1QV0 A;  1TN4 A;  3CZT X;  3BUO B;  1KK8 C;  1SK6 D;  4XJK A;  1BF5 A;  2JT0 A;  2K61 A;  1UUS A;  2JXL A;  2OPO A;  1IJ6 A;  4MRY A;  5CSJ A;  1TCF A;  4PE7 A;  2GGM A;  1M63 B;  2ZRS A;  1A75 A;  5FYX A;  1ZMZ A;  1IH0 A;  2SAS A;  1G8I A;  1UHH A;  3TDI A;  1B9A A;  5JJG A;  3O6B A;  1CDN A;  1F70 A;  1TNP A;  1XO5 A;  1QIW A;  2KYF A;  1NSH A;  4YGA A;  2MLE C;  2M8U A;  1OSA A;  5DKQ A;  5K89 A;  4PE1 A;  5G08 A;  1DVI A;  1KWO B;  1CM4 A;  1S5G Z;  2BE4 A;  3TDU A;  1EG3 A;  4M2O A;  1K9P A;  1OOJ A;  2NCP A;  1GQM A;  1XFV O;  1LKJ A;  5JOL A;  2I18 A;  3M0W A;  1IQ5 A;  2FJU B;  2L2E A;  2LLU A;  4PCW A;  1DTL A;  3IF7 A;  2Q4U A;  1QV1 A;  4MBE A;  3PN7 C;  4YGE B;  2JT3 A;  2QPT A;  3D10 A;  2KSP A;  1HQV A;  3HCM A;  1BOD A;  4WQ2 A;  1S6I A;  1F55 A;  5KTY A;  1KQM C;  1CFC A;  1N0Y A;  1BG1 A;  1QIV A;  2FCD A;  4BY5 A;  4A4B A;  3RLZ A;  1SL8 A;  1SCM C;  3KHE A;  3I5H B;  1B7T Y;  2EGD A;  2HF5 A;  2LHL A;  4I5J A;  2M9G A;  4Q04 A;  2O60 A;  5PAL A;  3I5I B;  1OE9 B;  1OQP A;  4UPG A;  5BPJ A;  2JNX A;  2OTG C;  1PRW A;  2FOT A;  5KSZ A;  3WXA A;  5HKZ A;  4M2P A;  1PUL A;  1JC2 A;  2KQ6 A;  5AER A;  4GUK A;  1BJF A;  2KQY A;  2NCO A;  2AUC A;  3PLF B;  1CLL A;  3TUY C;  1YX7 A;  1DF0 A;  1SNL A;  3BUM B;  4IL1 A;  3WHU B;  1AK8 A;  1B47 A;  1DGV A;  2M0R A;  4XJK B;  4FQO A;  2Y4Q A;  3GOF A;  4TNC A;  1B1G A;  4I5N B;  1FPW A;  3KPX A;  3EVU A;  2CCM A;  5DKN A;  1OZS A;  1DJZ A;  2PSR A;  4FTG A;  2F3Y A;  1SMG A;  1A75 B;  1TTX A;  3FWB A;  3EK4 A;  1C07 A;  1SW8 A;  5I8N A;  1AVS A;  1QX7 A;  1V1F A;  1EJ3 A;  1XK4 C;  3JVT C;  4YGC B;  1FI5 A;  1UP5 A;  1CNP A;  3NSI A;  1NX3 A;  2PVB A;  3LK1 A;  1SRA A;  2BKH B;  2BCA A;  4AQJ A;  5HKY A;  4ORA B;  1D1O A;  1OMD A;  2LAP A;  1TNX A;  2E30 A;  2G2B A;  1J55 A;  3BOW A;  3QRX A;  3NSL A;  2O5G A;  1S36 A;  4ETO A;  1A29 A;  2V53 A;  1CKK A;  2JT8 A;  2JWW A;  2WCF A;  2MLF C;  2M97 A;  1SR6 B;  3SIA A;  1CFF A;  1IGV A;  3BUX B;  3VRO A;  2WC8 A;  1NIW A;  1LVC D;  1AUI B;  4OCI A;  1KCY A;  1PSB A;  1MR8 A;  3TS5 C;  3GK4 X;  4AQI A;  1UHI A;  4PAL A;  2HQW A;  4C0L A;  1MWN A;  2KFF A;  5I2Q A;  1WY9 A;  1R2U A;  2GGZ A;  1XYD A;  4NDC A;  1EL4 A;  4QJ4 B;  2L50 A;  4PDZ A;  1WLM A;  2LVJ A;  3WNX B;  4MVF A;  1K2H A;  2KGB C;  2I94 A;  1F4O A;  2ZN8 A;  3A4U B;  2BCX A;  3LLE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...