2CT9A

The crystal structure of calcineurin b homologous proein 1 (chp1)
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
196
structure length
185
Chain Sequence
LLRDEELEEIKKETGFSHSQITRLYSRFTSLDKGENGTLSREDFQRIPELAINPLGDRIINAFFSEGEDQVNFRGFMRTLAHFRPIEEPLNSRSNKLHFAFRLYDLDKDDKISRDELLQVLRMMVGVNISDEQLGSIADRTIQEADQDGDSAISFTEFVKVLEKVDVEQKMSIRFLHKLAAALEH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Calcium-binding protein p22
publication title Structural characterization of calcineurin B homologous protein 1
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Metal binding protein
total genus 68
structure length 185
sequence length 196
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2ct9A00
3KO0A 1DTLA 3D0YB 4AOMA 1U5IB 2NCPA 1XYDA 3H4SE 1S6IA 4NQGA 3SJSA 3ICBA 4OV2A 3SG4A 2I94A 4DUQA 4MVFA 4PE0A 1KQVA 4FQOA 2M8UA 2FCEA 2H2KA 2KSPA 2L2EA 2K7BA 2JULA 3DVJA 1M46A 3I5IC 2JTTA 3O2PA 1TNQA 1JC2A 1B7TZ 4PE7A 5D7FA 1Y1AA 1LKJA 1YX8A 1N65A 2WORA 4ORCB 2QACA 1S5GY 2P6BB 1PSRA 1NPQA 1MWNA 3KF9A 2JOJA 3DD4A 1XA5A 5TNCA 4A4CA 2AUCA 2NLNA 3IQOA 2OPOA 2KAVA 1XFWO 2MJWB 2L51A 2Y1MA 2JZIA 2MA2A 1ZUZA 1DJHA 1UHNA 3TDIA 1MXLC 1NWDA 4F0ZB 1ALWA 3BOWB 1IJ6A 1NCYA 4JWQA 1M63B 1QXPA 2OS8B 3FWBA 1XFZO 3BXKA 1QX5B 3FS7A 1JFJA 5DKQA 2LUCA 1DJGA 1NX0A 2KFHA 4M2OA 2CT9A 1UURA 2Q91A 5ER4X 3SG6A 2F2PA 1S5GZ 2HF5A 2LM5A 5JJGA 3O78A 1DT7B 4YI8A 4I5LB 1K93D 1YR5A 1BU3A 2M7LA 2Y4QA 1B4CA 1LXFC 4N1GA 4C0JA 3LCPC 1CM4A 1KWOC 1CDNA 2LP2A 3BUWB 3BQ3A 3PALA 3JVTB 4R1EA 4USLA 1UHKA 1UUSA 2JRFA 2JT3A 3NSKA 2BL0C 4P5OE 2MLEC 1JFKA 1QX7A 2JWWA 2ZN9A 4ZCUA 2VRGA 2MBXA 1F55A 1NUBA 4WQ3A 3CR4X 1EL4A 1TRFA 4D1EA 1EXRA 1NCXA 2F8PA 2LHLA 4NDCA 3C1VA 4DRWA 2BKIB 1SCMB 3EK4A 2JTZA 4DS7A 1JF0A 3KHEA 1CB1A 4M2PA 1WRLA 1DJIA 4MLWA 1PRWA 1QVIY 2LVKA 4GAOA 1IGVA 4MN0A 1KK8C 1FW4A 3CS1A 3EVVA 4HRGA 1UWOA 2F33A 5J3XA 4M2QA 1QIVA 3KPXA 4N5XA 2PMYA 4ZCVA 2M0RA 4I5NB 1QS7A 2L4IA 5DKNA 1CM1A 3I5FB 3I5HC 3JTDB 4ETOA 5G08A 2M1UA 1BF5A 2LMVA 4GGFC 3VRRA 3AAJA 3NXAA 1YRUB 2ISDA 1M45A 1CDMA 3CR5X 1CMFA 1FI6A 4PE1A 1RJVA 3GK2A 1M31A 4ORBB 2JT8A 2F3ZA 3EK8A 3EKJA 1EH2A 3PM8A 1QVIZ 1RFJA 2K61A 1PULA 2M97A 5FYXA 1D1OA 3SG3A 2NCOA 4OVNF 3IF7A 3EKHA 4CIDA 4DCKA 3D10A 1KSMA 2M9GA 1CFDA 1V1FA 4A4BA 2Y1NA 3ZNIA 1MHOA 1FPWA 2LAPA 1Y0VH 4MZLA 3HX4A 1OMDA 1WDCB 2NXQA 4YGAA 4GPLB 4C0KA 1QATA 4GGNA 1E8AA 2ZRSA 1CDLA 2L4HA 2JC2A 4XJKB 3NSIA 1YUUA 1S6JA 4BY4A 5AFPA 4QJ3B 1CTRA 2L50A 4YGEB 2KGBC 1S36A 1L2OB 3O6BA 1MR8A 1TTXA 1B8RA 1QLKA 4GUKA 1DGUA 1WLZA 2F3YA 2CBLA 2JNXA 4IL1A 1JSAA 3CGAA 2WCBA 2M49B 1V1GA 2EC6C 2OTGC 1KWOB 1IQ5A 3TS5B 3RM1A 1FI5A 3DVMA 3BYAA 2KQYA 1RECA 1KQMC 2MHHA 2QPTA 2FJUB 2BL0B 1B8LA 1UHIA 1CLLA 1F54A 2IS9A 1KK7Z 1RK9A 3VGOA 2O5GA 3I5GC 1QASA 1OOJA 3TDUA 2K2AA 2K0JA 1R6PA 1CFCA 3K21A 5HLOA 2ZFDA 1G8IA 3BUXB 4GGFA 2PVBA 4HRHA 4MRXA 3GK1A 4HSZA 1S3PA 1EG3A 3PATA 3DVEA 5AERA 4U8DA 4PDZA 1A03A 1C07A 4I5JA 2I7AA 1DF0A 1N2DA 1H4BA 1YVHA 1FF1A 1SR6C 2G2BA 1IKUA 1UP5A 5JOLA 1KFXL 3O4YA 1XK4A 2SASA 2PALA 3CLNA 5K89A 1B8CA 2KAYA 1QIWA 5DKRA 4TNCA 3LK1A 1TNPA 1N0YA 2KBIA 1SKTA 2PASA 1YX7A 3OHMB 3TUYC 3SG7A 1KFXS 1YVLA 3CTNA 2COLB 2H61C 2K7CA 3PN7C 4GBAA 4OCIA 5I2OA 1AP4A 1CMGA 2LNKA 1HT9A 1HQVA 1NIWA 1OZSA 1SL7A 3MSEB 1MQ1A 3SIBA 1OMRA 2BECA 1KFUL 2ZNDA 5AEQA 4YGDB 1RROA 3DF0A 3SIAA 1JBAA 1QX2A 1SNLA 2HQWA 2LVJA 1C7VA 2Q4UA 2KNEA 4AQIA 1KFUS 4QJ5B 3VRNA 4PCWA 2JU0A 3PFVA 1MUXA 2NZ0A 4MZKA 2BBNA 2KI4B 1EJ3A 1OQPA 1BG1A 3FWCA 4DIRA 3TDZA 1YURA 1W7IB 1L7ZA 1BOCA 1AVSA 4ICBA 1J7RA 1CNPA 4CFQA 4MSPA 1WLMA 1OE9B 4CFRA 2KFGA 3EK7A 1CFFA 1G33A 2HQ8A 1GJYA 1F8HA 1DJXA 2BCBA 2LV7A 2JNFA 3PLFB 2G9BA 3WNXB 2M7NA 2V53A 2WCEA 1CKKA 1ZMZA 1C7WA 4OKHA 5CSFA 1J7QA 1SRAA 1CFPA 5B8IB 1RWYA 2EC6B 5CPVA 4JQ0D 1GGWA 2MAZA 2M29A 1NYAA 2D8NA 5KU1A 2KI6C 2BE4A 4MEWA 1PK0D 2BCXA 3I5IB 1XFVO 5GQQC 1ALVA 5PALA 1PVBA 2LMUA 2Y5IA 2I2RE 3HCMA 1TCOB 4FTGA 3BUNB 2H61A 1A75A 1S6CA 4Q04A 3FIAA 1F4OA 2WC8A 2KI6D 1X02A 4BY5A 3BUMB 3NSOA 4WRIA 1XK4C 1NX3A 1WRZA 2WOSA 5I8NA 2OS8C 1SL8A 1SR6B 2L98A 1K8UA 1YUSA 3LK0A 1TN4A 1WRKA 1H8BA 1AUIB 1K95A 1RTP1 2WCFA 1K2HA 3BUOB 3VROA 1JF2A 2KBMA 4MBEA 5CSIA 1KK7Y 1JUOA 3OP0A 2BE6A 3OB2B 3F45A 2AMIA 4E68A 4HREE 2K2FA 1DJWA 1FBVA 3A8RA 5CSJA 2JT0A 1QLSA 3D0YA 3JVTC 2ZRTA 1SYMA 1LA3A 1U5IA 1ZOTB 1SW8A 1A29A 2RGIA 3AAKA 4YI9A 4YGBB 5AXIA 3GOFA 1G4YR 1A2XA 1PSBA 3VRPA 2LVVA 1J7PA 2KGRA 4XYNA 5CSNA 1Y1UA 1LINA 4PE4A 1SCMC 1Q80A 1TOPA 2ZN8A 2LUXA 3GK4X 4GNKB 1W7JB 2GGZA 5BPJA 3OB1B 1DJYA 1BR4B 1J1EA 1CDPA 1CLMA 2LVIA 1CLBA 2WNDA 4YGCB 1F70A 1A4PA 3EVUA 4WQ2A 2KDHA 4YRUA 2M3WA 1TCFA 1SL9A 2KHNA 4YBHB 2SCPA 1GQMA 3I5FC 3JTDC 5KSZA 1LA0A 1KK8B 1NX2A 2LHIA 4PHJA 1AJ4A 1ODBA 3BOWA 1YUTA 2R2IA 1SK6D 2LANA 2LP3A 3I5HB 1K90D 2L5XB 5HKWA 1QV0A 1SBJA 1DVIA 1OMVA 2LLTA 2LLUA 1B1GA 1B47A 2LE9B 1JWDA 2F2OA 2FCDA 3CR2A 1IRJA 4L9MA 5HLVA 5KTYA 3SG2A 4MRYA 1DF0B 5I2LA 3PSRA 1XO5A 1YTZC 2B1UA 1K9PA 2JXCA 1WDCC 5HKYA 1DJZA 1YRTB 1IQ3A 1J55A 2MRDA 2K7OA 2KFFA 4NDDA 2BKHB 4CPVA 1K94A 2E30A 5AANA 2KYFA 1XFUO 4PHMA 1K9UA 4QJ4B 1L2OC 2KYCA 3DF0B 2ZKMX 1BR1B 1F71A 5HKZA 1KSOA 2O60A 4ORAB 1R2UA 1DMOA 1DGVA 2HPSA 1NCZA 3OX5A 1IH0A 4I5KA 3TS5C 4N1FA 1VRKA 2PRUA 1M39A 2BCAA 1AJ5A 1GGZA 1F4QA 2AAOA 1SMGA 2TN4A 2LC5A 1BODA 2OTGB 5ER5A 1TNWA 5F6TA 3AKBA 1LVCD 2M1KB 5IBWA 3ZWHA 1UHHA 1KQMB 2KOTA 2GV5A 1OSAA 1AHRA 3I5GB 1PVAA 2KAXA 3EVRA 3LLEA 2EGDA 2LLSA 3DVKA 1Y6WA 1PALA 3SG5A 1AK8A 4PALA 2LCPA 4OR9B 1TIZA 2CXJA 1UHJA 1K9KA 2DOQA 3CWGA 1MXEA 1NSHA 2MLFC 1WY9A 1MF8B 2I18A 3CZTX 1XVJA 1QV1A 3NSLA 2A4JA 1NX1A 2E6WA 1XFXO 1J7OA 1SY9A 2GGMA 3A4UB 1K96A 1OZOA 1ZACA 1BMOA 1IWQA 3LL8B 2JXLA 1ZFSA 2LMTA 1S1EA 2HETA 3TUYB 1IG5A 3QRXA 2L0PA 3PN7B 3AKAA 3VRQA 1A75B 4XJKA 1SPYA 3M0WA 2CTNA 1XFYO 1KCYA 4JPZB 1TNXA 3IQQA 1Y1XA 3WHTB 1SCVA 2CCMA 1BJFA 5D69A 2KI4C 5HYDA 3WXAA 2ZNEA 1S26D 4GFTA 3KEVA 4MZJA 2FOTA 1QJTA 4NDBA 1BLQA 2CNPA 3OX6A 2K8MB 2KQ6A 1NP8A 3TZ1A 2JPTA 2PSRA 1QTXA 3E3RA 1B7TY 2JQ6A 3WHUB 4C0LA 4CLNA 1J1DA 2BBMA 1EG4A 4P2YB 1B9AA 4AQJA 5I2QA 1BT6A 2K7DA 4PHNA 4PHKA 4UPGA 2EHBA 1IJ5A 3RLZA
chains in the Genus database with same CATH superfamily
3KO0A 3CYZA 1DTLA 3D0YB 4AOMA 1U5IB 2NCPA 1XYDA 1DC1A 3H4SE 1S6IA 4NQGA 3SJSA 3ICBA 4OV2A 3SG4A 2K60A 2I94A 4DUQA 1W9ZA 4MVFA 4PE0A 4JD9A 1KQVA 4FQOA 2M8UA 2FCEA 2H2KA 2KSPA 2L2EA 2K7BA 2JULA 3DVJA 1M46A 2YGUA 2JTTA 3I5IC 3O2PA 1TNQA 4FQTA 1JC2A 3S0BA 1B7TZ 4PE7A 5D7FA 1Y1AA 1LKJA 1YX8A 1N65A 2ERBA 2WORA 4ORCB 2QACA 2KLEA 1S5GY 2P6BB 1PSRA 1NPQA 1MWNA 3KF9A 2WCLA 2JOJA 3DD4A 4JKTA 1XA5A 5TNCA 4A4CA 2AUCA 2NLNA 3IQOA 2OPOA 2KAVA 1XFWO 2MJWB 2L51A 2Y1MA 2JZIA 2MA2A 2QEHA 1ZUZA 1DJHA 1UHNA 3TDIA 1MXLC 1NWDA 4F0ZB 1ALWA 3BOWB 1IJ6A 1NCYA 4JWQA 1M63B 1QXPA 2OS8B 3FWBA 2P71A 1XFZO 3BXKA 1QX5B 3FS7A 1JFJA 5DKQA 2LUCA 4F7FA 1DJGA 1NX0A 2KFHA 4M2OA 2CT9A 1UURA 2Q91A 5ER4X 3CZ0A 3SG6A 2F2PA 1S5GZ 2HF5A 2LM5A 5JJGA 3O78A 1DT7B 4YI8A 3R1OA 3V2LA 4I5LB 1K93D 3CABA 1YR5A 1BU3A 2M7LA 2Y4QA 1B4CA 3IVTA 1LS8A 1LXFC 4N1GA 4C0JA 3LCPC 1CM4A 1DEKA 1KWOC 1CDNA 2LP2A 3NHTA 3BUWB 3BQ3A 3PALA 3JVTB 4R1EA 4USLA 1UHKA 1UUSA 2JRFA 2JT3A 3NSKA 2BL0C 4P5OE 3PJIA 2MLEC 3BFBA 1JFKA 3OGNA 1QX7A 2JWWA 2ZN9A 4ZCUA 2VRGA 2MBXA 1F55A 1NUBA 4WQ3A 3CR4X 1EL4A 1TRFA 1TUJA 5D3OA 1EXRA 1NCXA 2F8PA 2LHLA 4NDCA 3C1VA 4DRWA 4D1EA 2BKIB 1SCMB 3EK4A 2JTZA 4DS7A 1JF0A 3KHEA 1CB1A 4M2PA 1WRLA 1DJIA 4MLWA 1PRWA 1QVIY 2LVKA 4GAOA 1IGVA 4MN0A 3Q8IA 1KK8C 1FW4A 3CS1A 3EVVA 4HRGA 1UWOA 2F33A 5J3XA 4M2QA 1QIVA 3KPXA 4N5XA 2H8VA 2PMYA 4ZCVA 2M0RA 4I5NB 1QS7A 2L4IA 5DKNA 1CM1A 3I5FB 3I5HC 3JTDB 3FE9A 5G08A 2M1UA 4ETOA 1TWOA 1BF5A 2LMVA 3L47A 4GGFC 3AAJA 3VRRA 3NXAA 1YRUB 2ISDA 1M45A 1CDMA 3CR5X 1CMFA 1FI6A 4PE1A 1RJVA 3GK2A 1M31A 1DELA 2QEVA 4ORBB 3S0GA 2JT8A 2F3ZA 3EK8A 3EKJA 3RZSA 1EH2A 3PM8A 1QVIZ 1RFJA 2K61A 1PULA 2M97A 5FYXA 1D1OA 3SG3A 2NCOA 4OVNF 3IF7A 3EKHA 4CIDA 4DCKA 3D10A 1KSMA 2M9GA 1CFDA 1V1FA 4A4BA 2Y1NA 3ZNIA 1MHOA 1FPWA 2LAPA 1Y0VH 4MZLA 3HX4A 1OMDA 1WDCB 2NXQA 4YGAA 4GPLB 4C0KA 1QATA 4GGNA 3PM2A 1E8AA 2ZRSA 5FI7A 1CDLA 2L4HA 2JC2A 4XJKB 3NSIA 1YUUA 1S6JA 3NHIA 4BY4A 3B86A 5AFPA 4QJ3B 1CTRA 2L50A 4YGEB 2WC5A 3SS5A 2KGBC 1S36A 1L2OB 3O6BA 1MR8A 1TTXA 1B8RA 1ORGA 1QLKA 4GUKA 1DGUA 1WLZA 2F3YA 2CBLA 2JNXA 3DXLA 4IL1A 1JSAA 3CGAA 2WCBA 2M49B 1V1GA 2EC6C 2OTGC 1KWOB 1IQ5A 3TS5B 3RM1A 1FI5A 3DVMA 3BYAA 2KQYA 1RECA 1KQMC 2MHHA 2QPTA 2FJUB 2BL0B 1B8LA 1UHIA 1CLLA 3S0EA 2IS9A 1KK7Z 1RK9A 3SS3A 3VGOA 2O5GA 3I5GC 1QASA 1OOJA 3TDUA 2K2AA 2K0JA 1R6PA 2KLDA 1CFCA 3K21A 5HLOA 3D73A 2ZFDA 1G8IA 3BUXB 4GGFA 2PVBA 3R1PA 4HRHA 4MRXA 3GK1A 4HSZA 1S3PA 1EG3A 3PATA 3DVEA 5AERA 4U8DA 1T14A 3S0AA 4PDZA 1A03A 2JPOA 1C07A 4I5JA 2I7AA 1DF0A 1N2DA 1H4BA 1YVHA 1OW4A 1FF1A 1SR6C 2G2BA 1IKUA 1UP5A 3B6XA 5JOLA 1KFXL 3O4YA 1XK4A 2SASA 2PALA 3CLNA 5K89A 1B8CA 2KAYA 3CZ2A 1QIWA 5DKRA 4TNCA 3LK1A 1TNPA 1N0YA 2KBIA 1SKTA 2PASA 1YX7A 2WCHA 3OHMB 3SG7A 3TUYC 1KFXS 1YVLA 3CTNA 2COLB 2H61C 2K7CA 3PN7C 4GBAA 4OCIA 5I2OA 1AP4A 1CMGA 2LNKA 1HT9A 1HQVA 1NIWA 1OZSA 1SL7A 3MSEB 1MQ1A 3SIBA 2PQLA 1OMRA 2BECA 2QEBA 1KFUL 2ZNDA 5AEQA 4YGDB 1RROA 3DF0A 3SIAA 1JBAA 1QX2A 1SNLA 2HQWA 2LVJA 3FE6A 1C7VA 2Q4UA 2KNEA 4AQIA 1KFUS 4QJ5B 1IIOA 3VRNA 4PCWA 2JU0A 3PFVA 1MUXA 2NZ0A 4MZKA 2BBNA 2KI4B 1EJ3A 1OQPA 1BG1A 3FWCA 4DIRA 3TDZA 1YURA 1W7IB 1L7ZA 1BOCA 1AVSA 4ICBA 1J7RA 1CNPA 3D77A 4PHKA 4CFQA 1OOIX 4MSPA 3UO9A 1C3ZA 2FJYA 1WLMA 1OE9B 4CFRA 2KFGA 3EK7A 1CFFA 1G33A 2HQ8A 1GJYA 1F8HA 1DJXA 2BCBA 2LV7A 2JNFA 3PLFB 2G9BA 3WNXB 3BFAA 2M7NA 2V53A 2WCEA 2WCKA 1CKKA 1ZMZA 1C7WA 4OKHA 5CSFA 1J7QA 1SRAA 1CFPA 5B8IB 1RWYA 2EC6B 5CPVA 1OOGA 4JQ0D 1TUZA 4PT1A 1GGWA 2MAZA 2M29A 1NYAA 2D8NA 2GTEA 5KU1A 2KI6C 2BE4A 4MEWA 1PK0D 1OOHA 3SS4A 2BCXA 3I5IB 1XFVO 5GQQC 1ALVA 5PALA 1PVBA 2WCJA 2LMUA 2Y5IA 2I2RE 3HCMA 1TCOB 4FTGA 3BUNB 2H61A 1A75A 1S6CA 4Q04A 3FIAA 2L5YA 3O4XA 1F4OA 3UNWA 2WC8A 2KI6D 1X02A 4BY5A 3BUMB 3NSOA 4WRIA 1XK4C 1NX3A 1WRZA 3BFHA 3D78A 2WOSA 5I8NA 2OS8C 3VB1A 3L4LA 1SL8A 1OOFA 1SR6B 1K8UA 2L98A 1YUSA 3LK0A 1TN4A 1WRKA 1H8BA 1AUIB 1K95A 1RTP1 2WCFA 1K2HA 3BUOB 3VROA 1JF2A 3D74A 2KBMA 4MBEA 5CSIA 1KK7Y 1JUOA 3OP0A 2BE6A 3OB2B 3F45A 2AMIA 4E68A 4HREE 2K2FA 1DJWA 1FBVA 1P28A 3A8RA 2KPHA 2JT0A 5CSJA 2PYQA 1QLSA 4KYNA 3D0YA 3JVTC 2ZRTA 1SYMA 1LA3A 1U5IA 1ZOTB 1SW8A 1A29A 2RGIA 3AAKA 4YI9A 4YGBB 5EL2A 5AXIA 3GOFA 1G4YR 2WCMA 1SSEB 1A2XA 1PSBA 3VRPA 2LVVA 1J7PA 2KGRA 4XYNA 5CSNA 5I94A 1Y1UA 1LINA 4PE4A 1SCMC 1Q80A 1TOPA 2ZN8A 2LUXA 2QDIA 3K1EA 3GK4X 4GNKB 1W7JB 2GGZA 5BPJA 3OB1B 1DJYA 1BR4B 1C3YA 1J1EA 1CDPA 1CLMA 2LVIA 1CLBA 2WNDA 4YGCB 1F70A 1A4PA 3EVUA 4WQ2A 2KDHA 4YRUA 2M3WA 1TCFA 1SL9A 2KHNA 4YBHB 1XFRA 1GQMA 2SCPA 3I5FC 3JTDC 5FI2A 5KSZA 1LA0A 1KK8B 1NX2A 2LHIA 4PHJA 1AJ4A 1ODBA 3D75A 3N7HA 3BOWA 1YUTA 2R2IA 1SK6D 2LANA 2LP3A 3I5HB 1K90D 2L5XB 5HKWA 1QV0A 1SBJA 1DVIA 1OMVA 2LLTA 2LLUA 2BAPA 1B1GA 1B47A 2LE9B 3S0FA 1JWDA 2F2OA 2FCDA 3CR2A 1IRJA 4L9MA 5HLVA 5KTYA 3SG2A 3B87A 4MRYA 5DICA 1DF0B 5I2LA 3PSRA 5HL1A 1XO5A 1YTZC 2B1UA 1K9PA 2JXCA 1WDCC 5HKYA 1DJZA 1YRTB 1IQ3A 1J55A 1QWVA 2MRDA 3R72A 2K7OA 2KFFA 2QEOA 4NDDA 5FI6A 2BKHB 4CPVA 1K94A 2BNXA 2E30A 5AANA 2KYFA 1XFUO 3FE8A 4PHMA 1K9UA 4QJ4B 1L2OC 2KYCA 3DF0B 2ZKMX 1BR1B 1F71A 3DZTA 1KSOA 2O60A 4ORAB 3CZ1A 1R2UA 5HKZA 1DMOA 1DGVA 2HPSA 1NCZA 3OX5A 1IH0A 4I5KA 3TS5C 4N1FA 1VRKA 2PRUA 1M39A 2BCAA 2P70A 1AJ5A 1GGZA 1F4QA 2AAOA 3S0DA 1SMGA 1Z2CB 2TN4A 2LC5A 1BODA 2OTGB 3R1VA 5ER5A 1TNWA 5F6TA 3AKBA 1LVCD 2M1KB 4INWA 5IBWA 3NGVA 3EG5B 3ZWHA 1UHHA 1KQMB 2KOTA 2GV5A 1OSAA 1AHRA 3I5GB 1PVAA 2KAXA 3EVRA 3LLEA 2EGDA 1Z4HA 2LLSA 3DVKA 1Y6WA 1PALA 3SG5A 1AK8A 4PALA 2LCPA 3L4AA 3DYEA 4OR9B 1TIZA 2CXJA 1UHJA 1K9KA 2DOQA 3CWGA 1MXEA 1NSHA 1DQEA 2MLFC 1WY9A 1MF8B 2I18A 3CZTX 4OZDA 1XVJA 1QV1A 3NSLA 2A4JA 1NX1A 2E6WA 1XFXO 3BJHA 1J7OA 1SY9A 2GGMA 3A4UB 1K96A 1ZACA 1OZOA 3OBVA 1BMOA 1IWQA 3LL8B 2JXLA 1ZFSA 2LMTA 1S1EA 2HETA 3TUYB 1IG5A 3QRXA 2L0PA 3PN7B 3AKAA 3VRQA 1A75B 4XJKA 1SPYA 3M0WA 2CTNA 1XFYO 3QMEA 3D76A 4JPZB 4IJ7A 1TNXA 3B88A 1Y1XA 3IQQA 1KCYA 3WHTB 1SCVA 2CCMA 1BJFA 5D69A 2KI4C 1GM0A 3CDNA 5HYDA 3WXAA 2ZNEA 1S26D 4GFTA 3KEVA 4MZJA 3DY9A 2FOTA 1QJTA 4NDBA 1BLQA 2CNPA 3OX6A 2K8MB 2KQ6A 1NP8A 3TZ1A 2JPTA 2PSRA 1F54A 1QTXA 3E3RA 1B7TY 2JQ6A 4INXA 3WHUB 4C0LA 1J1DA 2BBMA 4CLNA 1EG4A 3B7AA 4P2YB 1B9AA 4AQJA 2WC6A 5I2QA 1BT6A 2K7DA 4PHNA 2L2CA 4UPGA 2EHBA 1IJ5A 3RLZA
chains in the Genus database with same CATH topology
3KO0A 1DTLA 3D0YB 4AOMA 1U5IB 2NCPA 1XYDA 3H4SE 1S6IA 4NQGA 3SJSA 3ICBA 4OV2A 3SG4A 2I94A 4DUQA 4MVFA 4PE0A 1KQVA 4FQOA 2M8UA 2FCEA 2H2KA 2KSPA 2L2EA 2K7BA 2JULA 3DVJA 1M46A 3I5IC 2JTTA 3O2PA 1TNQA 1JC2A 1B7TZ 4PE7A 5D7FA 1Y1AA 1LKJA 1YX8A 1N65A 2WORA 4ORCB 2QACA 1S5GY 2P6BB 1PSRA 1NPQA 1MWNA 3KF9A 2JOJA 3DD4A 1XA5A 5TNCA 4A4CA 2AUCA 2NLNA 3IQOA 2OPOA 2KAVA 1XFWO 2MJWB 2L51A 2Y1MA 2JZIA 2MA2A 1ZUZA 1DJHA 1UHNA 3TDIA 1MXLC 1NWDA 4F0ZB 1ALWA 3BOWB 1IJ6A 1NCYA 4JWQA 1M63B 1QXPA 2OS8B 3FWBA 1XFZO 3BXKA 1QX5B 3FS7A 1JFJA 5DKQA 2LUCA 1DJGA 1NX0A 2KFHA 4M2OA 2CT9A 1UURA 2Q91A 5ER4X 3SG6A 2F2PA 1S5GZ 2HF5A 2LM5A 5JJGA 3O78A 1DT7B 4YI8A 4I5LB 1K93D 1YR5A 1BU3A 2M7LA 2Y4QA 1B4CA 1LXFC 4N1GA 4C0JA 3LCPC 1CM4A 1KWOC 1CDNA 2LP2A 3BUWB 3BQ3A 3PALA 3JVTB 4R1EA 4USLA 1UHKA 1UUSA 2JRFA 2JT3A 3NSKA 2BL0C 4P5OE 2MLEC 1JFKA 1QX7A 2JWWA 2ZN9A 4ZCUA 2VRGA 2MBXA 1F55A 1NUBA 4WQ3A 3CR4X 1EL4A 1TRFA 4D1EA 1EXRA 1NCXA 2F8PA 2LHLA 4NDCA 3C1VA 4DRWA 2BKIB 1SCMB 3EK4A 2JTZA 4DS7A 1JF0A 3KHEA 1CB1A 4M2PA 1WRLA 1DJIA 4MLWA 1PRWA 1QVIY 2LVKA 4GAOA 1IGVA 4MN0A 1KK8C 1FW4A 3CS1A 3EVVA 4HRGA 1UWOA 2F33A 5J3XA 4M2QA 1QIVA 3KPXA 4N5XA 2PMYA 4ZCVA 2M0RA 4I5NB 1QS7A 2L4IA 5DKNA 1CM1A 3I5FB 3I5HC 3JTDB 4ETOA 5G08A 2M1UA 1BF5A 2LMVA 4GGFC 3VRRA 3AAJA 3NXAA 1YRUB 2ISDA 1M45A 1CDMA 3CR5X 1CMFA 1FI6A 4PE1A 1RJVA 3GK2A 1M31A 4ORBB 2JT8A 2F3ZA 3EK8A 3EKJA 1EH2A 3PM8A 1QVIZ 1RFJA 2K61A 1PULA 2M97A 5FYXA 1D1OA 3SG3A 2NCOA 4OVNF 3IF7A 3EKHA 4CIDA 4DCKA 3D10A 1KSMA 2M9GA 1CFDA 1V1FA 4A4BA 2Y1NA 3ZNIA 1MHOA 1FPWA 2LAPA 1Y0VH 4MZLA 3HX4A 1OMDA 1WDCB 2NXQA 4YGAA 4GPLB 4C0KA 1QATA 4GGNA 1E8AA 2ZRSA 1CDLA 2L4HA 2JC2A 4XJKB 3NSIA 1YUUA 1S6JA 4BY4A 5AFPA 4QJ3B 1CTRA 2L50A 4YGEB 2KGBC 1S36A 1L2OB 3O6BA 1MR8A 1TTXA 1B8RA 1QLKA 4GUKA 1DGUA 1WLZA 2F3YA 2CBLA 2JNXA 4IL1A 1JSAA 3CGAA 2WCBA 2M49B 1V1GA 2EC6C 2OTGC 1KWOB 1IQ5A 3TS5B 3RM1A 1FI5A 3DVMA 3BYAA 2KQYA 1RECA 1KQMC 2MHHA 2QPTA 2FJUB 2BL0B 1B8LA 1UHIA 1CLLA 1F54A 2IS9A 1KK7Z 1RK9A 3VGOA 2O5GA 3I5GC 1QASA 1OOJA 3TDUA 2K2AA 2K0JA 1R6PA 1CFCA 3K21A 5HLOA 2ZFDA 1G8IA 3BUXB 4GGFA 2PVBA 4HRHA 4MRXA 3GK1A 4HSZA 1S3PA 1EG3A 3PATA 3DVEA 5AERA 4U8DA 4PDZA 1A03A 1C07A 4I5JA 2I7AA 1DF0A 1N2DA 1H4BA 1YVHA 1FF1A 1SR6C 2G2BA 1IKUA 1UP5A 5JOLA 1KFXL 3O4YA 1XK4A 2SASA 2PALA 3CLNA 5K89A 1B8CA 2KAYA 1QIWA 5DKRA 4TNCA 3LK1A 1TNPA 1N0YA 2KBIA 1SKTA 2PASA 1YX7A 3OHMB 3TUYC 3SG7A 1KFXS 1YVLA 3CTNA 2COLB 2H61C 2K7CA 3PN7C 4GBAA 4OCIA 5I2OA 1AP4A 1CMGA 2LNKA 1HT9A 1HQVA 1NIWA 1OZSA 1SL7A 3MSEB 1MQ1A 3SIBA 1OMRA 2BECA 1KFUL 2ZNDA 5AEQA 4YGDB 1RROA 3DF0A 3SIAA 1JBAA 1QX2A 1SNLA 2HQWA 2LVJA 1C7VA 2Q4UA 2KNEA 4AQIA 1KFUS 4QJ5B 3VRNA 4PCWA 2JU0A 3PFVA 1MUXA 2NZ0A 4MZKA 2BBNA 2KI4B 1EJ3A 1OQPA 1BG1A 3FWCA 4DIRA 3TDZA 1YURA 1W7IB 1L7ZA 1BOCA 1AVSA 4ICBA 1J7RA 1CNPA 4CFQA 4MSPA 1WLMA 1OE9B 4CFRA 2KFGA 3EK7A 1CFFA 1G33A 2HQ8A 1GJYA 1F8HA 1DJXA 2BCBA 2LV7A 2JNFA 3PLFB 2G9BA 3WNXB 2M7NA 2V53A 2WCEA 1CKKA 1ZMZA 1C7WA 4OKHA 5CSFA 1J7QA 1SRAA 1CFPA 5B8IB 1RWYA 2EC6B 5CPVA 4JQ0D 1GGWA 2MAZA 2M29A 1NYAA 2D8NA 5KU1A 2KI6C 2BE4A 4MEWA 1PK0D 2BCXA 3I5IB 1XFVO 5GQQC 1ALVA 5PALA 1PVBA 2LMUA 2Y5IA 2I2RE 3HCMA 1TCOB 4FTGA 3BUNB 2H61A 1A75A 1S6CA 4Q04A 3FIAA 1F4OA 2WC8A 2KI6D 1X02A 4BY5A 3BUMB 3NSOA 4WRIA 1XK4C 1NX3A 1WRZA 2WOSA 5I8NA 2OS8C 1SL8A 1SR6B 2L98A 1K8UA 1YUSA 3LK0A 1TN4A 1WRKA 1H8BA 1AUIB 1K95A 1RTP1 2WCFA 1K2HA 3BUOB 3VROA 1JF2A 2KBMA 4MBEA 5CSIA 1KK7Y 1JUOA 3OP0A 2BE6A 3OB2B 3F45A 2AMIA 4E68A 4HREE 2K2FA 1DJWA 1FBVA 3A8RA 5CSJA 2JT0A 1QLSA 3D0YA 3JVTC 2ZRTA 1SYMA 1LA3A 1U5IA 1ZOTB 1SW8A 1A29A 2RGIA 3AAKA 4YI9A 4YGBB 5AXIA 3GOFA 1G4YR 1A2XA 1PSBA 3VRPA 2LVVA 1J7PA 2KGRA 4XYNA 5CSNA 1Y1UA 1LINA 4PE4A 1SCMC 1Q80A 1TOPA 2ZN8A 2LUXA 3GK4X 4GNKB 1W7JB 2GGZA 5BPJA 3OB1B 1DJYA 1BR4B 1J1EA 1CDPA 1CLMA 2LVIA 1CLBA 2WNDA 4YGCB 1F70A 1A4PA 3EVUA 4WQ2A 2KDHA 4YRUA 2M3WA 1TCFA 1SL9A 2KHNA 4YBHB 2SCPA 1GQMA 3I5FC 3JTDC 5KSZA 1LA0A 1KK8B 1NX2A 2LHIA 4PHJA 1AJ4A 1ODBA 3BOWA 1YUTA 2R2IA 1SK6D 2LANA 2LP3A 3I5HB 1K90D 2L5XB 5HKWA 1QV0A 1SBJA 1DVIA 1OMVA 2LLTA 2LLUA 1B1GA 1B47A 2LE9B 1JWDA 2F2OA 2FCDA 3CR2A 1IRJA 4L9MA 5HLVA 5KTYA 3SG2A 4MRYA 1DF0B 5I2LA 3PSRA 1XO5A 1YTZC 2B1UA 1K9PA 2JXCA 1WDCC 5HKYA 1DJZA 1YRTB 1IQ3A 1J55A 2MRDA 2K7OA 2KFFA 4NDDA 2BKHB 4CPVA 1K94A 2E30A 5AANA 2KYFA 1XFUO 4PHMA 1K9UA 4QJ4B 1L2OC 2KYCA 3DF0B 2ZKMX 1BR1B 1F71A 5HKZA 1KSOA 2O60A 4ORAB 1R2UA 1DMOA 1DGVA 2HPSA 1NCZA 3OX5A 1IH0A 4I5KA 3TS5C 4N1FA 1VRKA 2PRUA 1M39A 2BCAA 1AJ5A 1GGZA 1F4QA 2AAOA 1SMGA 2TN4A 2LC5A 1BODA 2OTGB 5ER5A 1TNWA 5F6TA 3AKBA 1LVCD 2M1KB 5IBWA 3ZWHA 1UHHA 1KQMB 2KOTA 2GV5A 1OSAA 1AHRA 3I5GB 1PVAA 2KAXA 3EVRA 3LLEA 2EGDA 2LLSA 3DVKA 1Y6WA 1PALA 3SG5A 1AK8A 4PALA 2LCPA 4OR9B 1TIZA 2CXJA 1UHJA 1K9KA 2DOQA 3CWGA 1MXEA 1NSHA 2MLFC 1WY9A 1MF8B 2I18A 3CZTX 1XVJA 1QV1A 3NSLA 2A4JA 1NX1A 2E6WA 1XFXO 1J7OA 1SY9A 2GGMA 3A4UB 1K96A 1OZOA 1ZACA 1BMOA 1IWQA 3LL8B 2JXLA 1ZFSA 2LMTA 1S1EA 2HETA 3TUYB 1IG5A 3QRXA 2L0PA 3PN7B 3AKAA 3VRQA 1A75B 4XJKA 1SPYA 3M0WA 2CTNA 1XFYO 1KCYA 4JPZB 1TNXA 3IQQA 1Y1XA 3WHTB 1SCVA 2CCMA 1BJFA 5D69A 2KI4C 5HYDA 3WXAA 2ZNEA 1S26D 4GFTA 3KEVA 4MZJA 2FOTA 1QJTA 4NDBA 1BLQA 2CNPA 3OX6A 2K8MB 2KQ6A 1NP8A 3TZ1A 2JPTA 2PSRA 1QTXA 3E3RA 1B7TY 2JQ6A 3WHUB 4C0LA 4CLNA 1J1DA 2BBMA 1EG4A 4P2YB 1B9AA 4AQJA 5I2QA 1BT6A 2K7DA 4PHNA 4PHKA 4UPGA 2EHBA 1IJ5A 3RLZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KO0 A;  1DTL A;  3D0Y B;  4AOM A;  1U5I B;  2NCP A;  1XYD A;  3H4S E;  1S6I A;  4NQG A;  3SJS A;  3ICB A;  4OV2 A;  3SG4 A;  2I94 A;  4DUQ A;  4MVF A;  4PE0 A;  1KQV A;  4FQO A;  2M8U A;  2FCE A;  2H2K A;  2KSP A;  2L2E A;  2K7B A;  2JUL A;  3DVJ A;  1M46 A;  3I5I C;  2JTT A;  3O2P A;  1TNQ A;  1JC2 A;  1B7T Z;  4PE7 A;  5D7F A;  1Y1A A;  1LKJ A;  1YX8 A;  1N65 A;  2WOR A;  4ORC B;  2QAC A;  1S5G Y;  2P6B B;  1PSR A;  1NPQ A;  1MWN A;  3KF9 A;  2JOJ A;  3DD4 A;  1XA5 A;  5TNC A;  4A4C A;  2AUC A;  2NLN A;  3IQO A;  2OPO A;  2KAV A;  1XFW O;  2MJW B;  2L51 A;  2Y1M A;  2JZI A;  2MA2 A;  1ZUZ A;  1DJH A;  1UHN A;  3TDI A;  1MXL C;  1NWD A;  4F0Z B;  1ALW A;  3BOW B;  1IJ6 A;  1NCY A;  4JWQ A;  1M63 B;  1QXP A;  2OS8 B;  3FWB A;  1XFZ O;  3BXK A;  1QX5 B;  3FS7 A;  1JFJ A;  5DKQ A;  2LUC A;  1DJG A;  1NX0 A;  2KFH A;  4M2O A;  2CT9 A;  1UUR A;  2Q91 A;  5ER4 X;  3SG6 A;  2F2P A;  1S5G Z;  2HF5 A;  2LM5 A;  5JJG A;  3O78 A;  1DT7 B;  4YI8 A;  4I5L B;  1K93 D;  1YR5 A;  1BU3 A;  2M7L A;  2Y4Q A;  1B4C A;  1LXF C;  4N1G A;  4C0J A;  3LCP C;  1CM4 A;  1KWO C;  1CDN A;  2LP2 A;  3BUW B;  3BQ3 A;  3PAL A;  3JVT B;  4R1E A;  4USL A;  1UHK A;  1UUS A;  2JRF A;  2JT3 A;  3NSK A;  2BL0 C;  4P5O E;  2MLE C;  1JFK A;  1QX7 A;  2JWW A;  2ZN9 A;  4ZCU A;  2VRG A;  2MBX A;  1F55 A;  1NUB A;  4WQ3 A;  3CR4 X;  1EL4 A;  1TRF A;  4D1E A;  1EXR A;  1NCX A;  2F8P A;  2LHL A;  4NDC A;  3C1V A;  4DRW A;  2BKI B;  1SCM B;  3EK4 A;  2JTZ A;  4DS7 A;  1JF0 A;  3KHE A;  1CB1 A;  4M2P A;  1WRL A;  1DJI A;  4MLW A;  1PRW A;  1QVI Y;  2LVK A;  4GAO A;  1IGV A;  4MN0 A;  1KK8 C;  1FW4 A;  3CS1 A;  3EVV A;  4HRG A;  1UWO A;  2F33 A;  5J3X A;  4M2Q A;  1QIV A;  3KPX A;  4N5X A;  2PMY A;  4ZCV A;  2M0R A;  4I5N B;  1QS7 A;  2L4I A;  5DKN A;  1CM1 A;  3I5F B;  3I5H C;  3JTD B;  4ETO A;  5G08 A;  2M1U A;  1BF5 A;  2LMV A;  4GGF C;  3VRR A;  3AAJ A;  3NXA A;  1YRU B;  2ISD A;  1M45 A;  1CDM A;  3CR5 X;  1CMF A;  1FI6 A;  4PE1 A;  1RJV A;  3GK2 A;  1M31 A;  4ORB B;  2JT8 A;  2F3Z A;  3EK8 A;  3EKJ A;  1EH2 A;  3PM8 A;  1QVI Z;  1RFJ A;  2K61 A;  1PUL A;  2M97 A;  5FYX A;  1D1O A;  3SG3 A;  2NCO A;  4OVN F;  3IF7 A;  3EKH A;  4CID A;  4DCK A;  3D10 A;  1KSM A;  2M9G A;  1CFD A;  1V1F A;  4A4B A;  2Y1N A;  3ZNI A;  1MHO A;  1FPW A;  2LAP A;  1Y0V H;  4MZL A;  3HX4 A;  1OMD A;  1WDC B;  2NXQ A;  4YGA A;  4GPL B;  4C0K A;  1QAT A;  4GGN A;  1E8A A;  2ZRS A;  1CDL A;  2L4H A;  2JC2 A;  4XJK B;  3NSI A;  1YUU A;  1S6J A;  4BY4 A;  5AFP A;  4QJ3 B;  1CTR A;  2L50 A;  4YGE B;  2KGB C;  1S36 A;  1L2O B;  3O6B A;  1MR8 A;  1TTX A;  1B8R A;  1QLK A;  4GUK A;  1DGU A;  1WLZ A;  2F3Y A;  2CBL A;  2JNX A;  4IL1 A;  1JSA A;  3CGA A;  2WCB A;  2M49 B;  1V1G A;  2EC6 C;  2OTG C;  1KWO B;  1IQ5 A;  3TS5 B;  3RM1 A;  1FI5 A;  3DVM A;  3BYA A;  2KQY A;  1REC A;  1KQM C;  2MHH A;  2QPT A;  2FJU B;  2BL0 B;  1B8L A;  1UHI A;  1CLL A;  1F54 A;  2IS9 A;  1KK7 Z;  1RK9 A;  3VGO A;  2O5G A;  3I5G C;  1QAS A;  1OOJ A;  3TDU A;  2K2A A;  2K0J A;  1R6P A;  1CFC A;  3K21 A;  5HLO A;  2ZFD A;  1G8I A;  3BUX B;  4GGF A;  2PVB A;  4HRH A;  4MRX A;  3GK1 A;  4HSZ A;  1S3P A;  1EG3 A;  3PAT A;  3DVE A;  5AER A;  4U8D A;  4PDZ A;  1A03 A;  1C07 A;  4I5J A;  2I7A A;  1DF0 A;  1N2D A;  1H4B A;  1YVH A;  1FF1 A;  1SR6 C;  2G2B A;  1IKU A;  1UP5 A;  5JOL A;  1KFX L;  3O4Y A;  1XK4 A;  2SAS A;  2PAL A;  3CLN A;  5K89 A;  1B8C A;  2KAY A;  1QIW A;  5DKR A;  4TNC A;  3LK1 A;  1TNP A;  1N0Y A;  2KBI A;  1SKT A;  2PAS A;  1YX7 A;  3OHM B;  3TUY C;  3SG7 A;  1KFX S;  1YVL A;  3CTN A;  2COL B;  2H61 C;  2K7C A;  3PN7 C;  4GBA A;  4OCI A;  5I2O A;  1AP4 A;  1CMG A;  2LNK A;  1HT9 A;  1HQV A;  1NIW A;  1OZS A;  1SL7 A;  3MSE B;  1MQ1 A;  3SIB A;  1OMR A;  2BEC A;  1KFU L;  2ZND A;  5AEQ A;  4YGD B;  1RRO A;  3DF0 A;  3SIA A;  1JBA A;  1QX2 A;  1SNL A;  2HQW A;  2LVJ A;  1C7V A;  2Q4U A;  2KNE A;  4AQI A;  1KFU S;  4QJ5 B;  3VRN A;  4PCW A;  2JU0 A;  3PFV A;  1MUX A;  2NZ0 A;  4MZK A;  2BBN A;  2KI4 B;  1EJ3 A;  1OQP A;  1BG1 A;  3FWC A;  4DIR A;  3TDZ A;  1YUR A;  1W7I B;  1L7Z A;  1BOC A;  1AVS A;  4ICB A;  1J7R A;  1CNP A;  4CFQ A;  4MSP A;  1WLM A;  1OE9 B;  4CFR A;  2KFG A;  3EK7 A;  1CFF A;  1G33 A;  2HQ8 A;  1GJY A;  1F8H A;  1DJX A;  2BCB A;  2LV7 A;  2JNF A;  3PLF B;  2G9B A;  3WNX B;  2M7N A;  2V53 A;  2WCE A;  1CKK A;  1ZMZ A;  1C7W A;  4OKH A;  5CSF A;  1J7Q A;  1SRA A;  1CFP A;  5B8I B;  1RWY A;  2EC6 B;  5CPV A;  4JQ0 D;  1GGW A;  2MAZ A;  2M29 A;  1NYA A;  2D8N A;  5KU1 A;  2KI6 C;  2BE4 A;  4MEW A;  1PK0 D;  2BCX A;  3I5I B;  1XFV O;  5GQQ C;  1ALV A;  5PAL A;  1PVB A;  2LMU A;  2Y5I A;  2I2R E;  3HCM A;  1TCO B;  4FTG A;  3BUN B;  2H61 A;  1A75 A;  1S6C A;  4Q04 A;  3FIA A;  1F4O A;  2WC8 A;  2KI6 D;  1X02 A;  4BY5 A;  3BUM B;  3NSO A;  4WRI A;  1XK4 C;  1NX3 A;  1WRZ A;  2WOS A;  5I8N A;  2OS8 C;  1SL8 A;  1SR6 B;  2L98 A;  1K8U A;  1YUS A;  3LK0 A;  1TN4 A;  1WRK A;  1H8B A;  1AUI B;  1K95 A;  1RTP 1;  2WCF A;  1K2H A;  3BUO B;  3VRO A;  1JF2 A;  2KBM A;  4MBE A;  5CSI A;  1KK7 Y;  1JUO A;  3OP0 A;  2BE6 A;  3OB2 B;  3F45 A;  2AMI A;  4E68 A;  4HRE E;  2K2F A;  1DJW A;  1FBV A;  3A8R A;  5CSJ A;  2JT0 A;  1QLS A;  3D0Y A;  3JVT C;  2ZRT A;  1SYM A;  1LA3 A;  1U5I A;  1ZOT B;  1SW8 A;  1A29 A;  2RGI A;  3AAK A;  4YI9 A;  4YGB B;  5AXI A;  3GOF A;  1G4Y R;  1A2X A;  1PSB A;  3VRP A;  2LVV A;  1J7P A;  2KGR A;  4XYN A;  5CSN A;  1Y1U A;  1LIN A;  4PE4 A;  1SCM C;  1Q80 A;  1TOP A;  2ZN8 A;  2LUX A;  3GK4 X;  4GNK B;  1W7J B;  2GGZ A;  5BPJ A;  3OB1 B;  1DJY A;  1BR4 B;  1J1E A;  1CDP A;  1CLM A;  2LVI A;  1CLB A;  2WND A;  4YGC B;  1F70 A;  1A4P A;  3EVU A;  4WQ2 A;  2KDH A;  4YRU A;  2M3W A;  1TCF A;  1SL9 A;  2KHN A;  4YBH B;  2SCP A;  1GQM A;  3I5F C;  3JTD C;  5KSZ A;  1LA0 A;  1KK8 B;  1NX2 A;  2LHI A;  4PHJ A;  1AJ4 A;  1ODB A;  3BOW A;  1YUT A;  2R2I A;  1SK6 D;  2LAN A;  2LP3 A;  3I5H B;  1K90 D;  2L5X B;  5HKW A;  1QV0 A;  1SBJ A;  1DVI A;  1OMV A;  2LLT A;  2LLU A;  1B1G A;  1B47 A;  2LE9 B;  1JWD A;  2F2O A;  2FCD A;  3CR2 A;  1IRJ A;  4L9M A;  5HLV A;  5KTY A;  3SG2 A;  4MRY A;  1DF0 B;  5I2L A;  3PSR A;  1XO5 A;  1YTZ C;  2B1U A;  1K9P A;  2JXC A;  1WDC C;  5HKY A;  1DJZ A;  1YRT B;  1IQ3 A;  1J55 A;  2MRD A;  2K7O A;  2KFF A;  4NDD A;  2BKH B;  4CPV A;  1K94 A;  2E30 A;  5AAN A;  2KYF A;  1XFU O;  4PHM A;  1K9U A;  4QJ4 B;  1L2O C;  2KYC A;  3DF0 B;  2ZKM X;  1BR1 B;  1F71 A;  5HKZ A;  1KSO A;  2O60 A;  4ORA B;  1R2U A;  1DMO A;  1DGV A;  2HPS A;  1NCZ A;  3OX5 A;  1IH0 A;  4I5K A;  3TS5 C;  4N1F A;  1VRK A;  2PRU A;  1M39 A;  2BCA A;  1AJ5 A;  1GGZ A;  1F4Q A;  2AAO A;  1SMG A;  2TN4 A;  2LC5 A;  1BOD A;  2OTG B;  5ER5 A;  1TNW A;  5F6T A;  3AKB A;  1LVC D;  2M1K B;  5IBW A;  3ZWH A;  1UHH A;  1KQM B;  2KOT A;  2GV5 A;  1OSA A;  1AHR A;  3I5G B;  1PVA A;  2KAX A;  3EVR A;  3LLE A;  2EGD A;  2LLS A;  3DVK A;  1Y6W A;  1PAL A;  3SG5 A;  1AK8 A;  4PAL A;  2LCP A;  4OR9 B;  1TIZ A;  2CXJ A;  1UHJ A;  1K9K A;  2DOQ A;  3CWG A;  1MXE A;  1NSH A;  2MLF C;  1WY9 A;  1MF8 B;  2I18 A;  3CZT X;  1XVJ A;  1QV1 A;  3NSL A;  2A4J A;  1NX1 A;  2E6W A;  1XFX O;  1J7O A;  1SY9 A;  2GGM A;  3A4U B;  1K96 A;  1OZO A;  1ZAC A;  1BMO A;  1IWQ A;  3LL8 B;  2JXL A;  1ZFS A;  2LMT A;  1S1E A;  2HET A;  3TUY B;  1IG5 A;  3QRX A;  2L0P A;  3PN7 B;  3AKA A;  3VRQ A;  1A75 B;  4XJK A;  1SPY A;  3M0W A;  2CTN A;  1XFY O;  1KCY A;  4JPZ B;  1TNX A;  3IQQ A;  1Y1X A;  3WHT B;  1SCV A;  2CCM A;  1BJF A;  5D69 A;  2KI4 C;  5HYD A;  3WXA A;  2ZNE A;  1S26 D;  4GFT A;  3KEV A;  4MZJ A;  2FOT A;  1QJT A;  4NDB A;  1BLQ A;  2CNP A;  3OX6 A;  2K8M B;  2KQ6 A;  1NP8 A;  3TZ1 A;  2JPT A;  2PSR A;  1QTX A;  3E3R A;  1B7T Y;  2JQ6 A;  3WHU B;  4C0L A;  4CLN A;  1J1D A;  2BBM A;  1EG4 A;  4P2Y B;  1B9A A;  4AQJ A;  5I2Q A;  1BT6 A;  2K7D A;  4PHN A;  4PHK A;  4UPG A;  2EHB A;  1IJ5 A;  3RLZ A; 
#chains in the Genus database with same CATH topology
 3KO0 A;  3CYZ A;  1DTL A;  3D0Y B;  4AOM A;  1U5I B;  2NCP A;  1XYD A;  1DC1 A;  3H4S E;  1S6I A;  4NQG A;  3SJS A;  3ICB A;  4OV2 A;  3SG4 A;  2K60 A;  2I94 A;  4DUQ A;  1W9Z A;  4MVF A;  4PE0 A;  4JD9 A;  1KQV A;  4FQO A;  2M8U A;  2FCE A;  2H2K A;  2KSP A;  2L2E A;  2K7B A;  2JUL A;  3DVJ A;  1M46 A;  2YGU A;  2JTT A;  3I5I C;  3O2P A;  1TNQ A;  4FQT A;  1JC2 A;  3S0B A;  1B7T Z;  4PE7 A;  5D7F A;  1Y1A A;  1LKJ A;  1YX8 A;  1N65 A;  2ERB A;  2WOR A;  4ORC B;  2QAC A;  2KLE A;  1S5G Y;  2P6B B;  1PSR A;  1NPQ A;  1MWN A;  3KF9 A;  2WCL A;  2JOJ A;  3DD4 A;  4JKT A;  1XA5 A;  5TNC A;  4A4C A;  2AUC A;  2NLN A;  3IQO A;  2OPO A;  2KAV A;  1XFW O;  2MJW B;  2L51 A;  2Y1M A;  2JZI A;  2MA2 A;  2QEH A;  1ZUZ A;  1DJH A;  1UHN A;  3TDI A;  1MXL C;  1NWD A;  4F0Z B;  1ALW A;  3BOW B;  1IJ6 A;  1NCY A;  4JWQ A;  1M63 B;  1QXP A;  2OS8 B;  3FWB A;  2P71 A;  1XFZ O;  3BXK A;  1QX5 B;  3FS7 A;  1JFJ A;  5DKQ A;  2LUC A;  4F7F A;  1DJG A;  1NX0 A;  2KFH A;  4M2O A;  2CT9 A;  1UUR A;  2Q91 A;  5ER4 X;  3CZ0 A;  3SG6 A;  2F2P A;  1S5G Z;  2HF5 A;  2LM5 A;  5JJG A;  3O78 A;  1DT7 B;  4YI8 A;  3R1O A;  3V2L A;  4I5L B;  1K93 D;  3CAB A;  1YR5 A;  1BU3 A;  2M7L A;  2Y4Q A;  1B4C A;  3IVT A;  1LS8 A;  1LXF C;  4N1G A;  4C0J A;  3LCP C;  1CM4 A;  1DEK A;  1KWO C;  1CDN A;  2LP2 A;  3NHT A;  3BUW B;  3BQ3 A;  3PAL A;  3JVT B;  4R1E A;  4USL A;  1UHK A;  1UUS A;  2JRF A;  2JT3 A;  3NSK A;  2BL0 C;  4P5O E;  3PJI A;  2MLE C;  3BFB A;  1JFK A;  3OGN A;  1QX7 A;  2JWW A;  2ZN9 A;  4ZCU A;  2VRG A;  2MBX A;  1F55 A;  1NUB A;  4WQ3 A;  3CR4 X;  1EL4 A;  1TRF A;  1TUJ A;  5D3O A;  1EXR A;  1NCX A;  2F8P A;  2LHL A;  4NDC A;  3C1V A;  4DRW A;  4D1E A;  2BKI B;  1SCM B;  3EK4 A;  2JTZ A;  4DS7 A;  1JF0 A;  3KHE A;  1CB1 A;  4M2P A;  1WRL A;  1DJI A;  4MLW A;  1PRW A;  1QVI Y;  2LVK A;  4GAO A;  1IGV A;  4MN0 A;  3Q8I A;  1KK8 C;  1FW4 A;  3CS1 A;  3EVV A;  4HRG A;  1UWO A;  2F33 A;  5J3X A;  4M2Q A;  1QIV A;  3KPX A;  4N5X A;  2H8V A;  2PMY A;  4ZCV A;  2M0R A;  4I5N B;  1QS7 A;  2L4I A;  5DKN A;  1CM1 A;  3I5F B;  3I5H C;  3JTD B;  3FE9 A;  5G08 A;  2M1U A;  4ETO A;  1TWO A;  1BF5 A;  2LMV A;  3L47 A;  4GGF C;  3AAJ A;  3VRR A;  3NXA A;  1YRU B;  2ISD A;  1M45 A;  1CDM A;  3CR5 X;  1CMF A;  1FI6 A;  4PE1 A;  1RJV A;  3GK2 A;  1M31 A;  1DEL A;  2QEV A;  4ORB B;  3S0G A;  2JT8 A;  2F3Z A;  3EK8 A;  3EKJ A;  3RZS A;  1EH2 A;  3PM8 A;  1QVI Z;  1RFJ A;  2K61 A;  1PUL A;  2M97 A;  5FYX A;  1D1O A;  3SG3 A;  2NCO A;  4OVN F;  3IF7 A;  3EKH A;  4CID A;  4DCK A;  3D10 A;  1KSM A;  2M9G A;  1CFD A;  1V1F A;  4A4B A;  2Y1N A;  3ZNI A;  1MHO A;  1FPW A;  2LAP A;  1Y0V H;  4MZL A;  3HX4 A;  1OMD A;  1WDC B;  2NXQ A;  4YGA A;  4GPL B;  4C0K A;  1QAT A;  4GGN A;  3PM2 A;  1E8A A;  2ZRS A;  5FI7 A;  1CDL A;  2L4H A;  2JC2 A;  4XJK B;  3NSI A;  1YUU A;  1S6J A;  3NHI A;  4BY4 A;  3B86 A;  5AFP A;  4QJ3 B;  1CTR A;  2L50 A;  4YGE B;  2WC5 A;  3SS5 A;  2KGB C;  1S36 A;  1L2O B;  3O6B A;  1MR8 A;  1TTX A;  1B8R A;  1ORG A;  1QLK A;  4GUK A;  1DGU A;  1WLZ A;  2F3Y A;  2CBL A;  2JNX A;  3DXL A;  4IL1 A;  1JSA A;  3CGA A;  2WCB A;  2M49 B;  1V1G A;  2EC6 C;  2OTG C;  1KWO B;  1IQ5 A;  3TS5 B;  3RM1 A;  1FI5 A;  3DVM A;  3BYA A;  2KQY A;  1REC A;  1KQM C;  2MHH A;  2QPT A;  2FJU B;  2BL0 B;  1B8L A;  1UHI A;  1CLL A;  3S0E A;  2IS9 A;  1KK7 Z;  1RK9 A;  3SS3 A;  3VGO A;  2O5G A;  3I5G C;  1QAS A;  1OOJ A;  3TDU A;  2K2A A;  2K0J A;  1R6P A;  2KLD A;  1CFC A;  3K21 A;  5HLO A;  3D73 A;  2ZFD A;  1G8I A;  3BUX B;  4GGF A;  2PVB A;  3R1P A;  4HRH A;  4MRX A;  3GK1 A;  4HSZ A;  1S3P A;  1EG3 A;  3PAT A;  3DVE A;  5AER A;  4U8D A;  1T14 A;  3S0A A;  4PDZ A;  1A03 A;  2JPO A;  1C07 A;  4I5J A;  2I7A A;  1DF0 A;  1N2D A;  1H4B A;  1YVH A;  1OW4 A;  1FF1 A;  1SR6 C;  2G2B A;  1IKU A;  1UP5 A;  3B6X A;  5JOL A;  1KFX L;  3O4Y A;  1XK4 A;  2SAS A;  2PAL A;  3CLN A;  5K89 A;  1B8C A;  2KAY A;  3CZ2 A;  1QIW A;  5DKR A;  4TNC A;  3LK1 A;  1TNP A;  1N0Y A;  2KBI A;  1SKT A;  2PAS A;  1YX7 A;  2WCH A;  3OHM B;  3SG7 A;  3TUY C;  1KFX S;  1YVL A;  3CTN A;  2COL B;  2H61 C;  2K7C A;  3PN7 C;  4GBA A;  4OCI A;  5I2O A;  1AP4 A;  1CMG A;  2LNK A;  1HT9 A;  1HQV A;  1NIW A;  1OZS A;  1SL7 A;  3MSE B;  1MQ1 A;  3SIB A;  2PQL A;  1OMR A;  2BEC A;  2QEB A;  1KFU L;  2ZND A;  5AEQ A;  4YGD B;  1RRO A;  3DF0 A;  3SIA A;  1JBA A;  1QX2 A;  1SNL A;  2HQW A;  2LVJ A;  3FE6 A;  1C7V A;  2Q4U A;  2KNE A;  4AQI A;  1KFU S;  4QJ5 B;  1IIO A;  3VRN A;  4PCW A;  2JU0 A;  3PFV A;  1MUX A;  2NZ0 A;  4MZK A;  2BBN A;  2KI4 B;  1EJ3 A;  1OQP A;  1BG1 A;  3FWC A;  4DIR A;  3TDZ A;  1YUR A;  1W7I B;  1L7Z A;  1BOC A;  1AVS A;  4ICB A;  1J7R A;  1CNP A;  3D77 A;  4PHK A;  4CFQ A;  1OOI X;  4MSP A;  3UO9 A;  1C3Z A;  2FJY A;  1WLM A;  1OE9 B;  4CFR A;  2KFG A;  3EK7 A;  1CFF A;  1G33 A;  2HQ8 A;  1GJY A;  1F8H A;  1DJX A;  2BCB A;  2LV7 A;  2JNF A;  3PLF B;  2G9B A;  3WNX B;  3BFA A;  2M7N A;  2V53 A;  2WCE A;  2WCK A;  1CKK A;  1ZMZ A;  1C7W A;  4OKH A;  5CSF A;  1J7Q A;  1SRA A;  1CFP A;  5B8I B;  1RWY A;  2EC6 B;  5CPV A;  1OOG A;  4JQ0 D;  1TUZ A;  4PT1 A;  1GGW A;  2MAZ A;  2M29 A;  1NYA A;  2D8N A;  2GTE A;  5KU1 A;  2KI6 C;  2BE4 A;  4MEW A;  1PK0 D;  1OOH A;  3SS4 A;  2BCX A;  3I5I B;  1XFV O;  5GQQ C;  1ALV A;  5PAL A;  1PVB A;  2WCJ A;  2LMU A;  2Y5I A;  2I2R E;  3HCM A;  1TCO B;  4FTG A;  3BUN B;  2H61 A;  1A75 A;  1S6C A;  4Q04 A;  3FIA A;  2L5Y A;  3O4X A;  1F4O A;  3UNW A;  2WC8 A;  2KI6 D;  1X02 A;  4BY5 A;  3BUM B;  3NSO A;  4WRI A;  1XK4 C;  1NX3 A;  1WRZ A;  3BFH A;  3D78 A;  2WOS A;  5I8N A;  2OS8 C;  3VB1 A;  3L4L A;  1SL8 A;  1OOF A;  1SR6 B;  1K8U A;  2L98 A;  1YUS A;  3LK0 A;  1TN4 A;  1WRK A;  1H8B A;  1AUI B;  1K95 A;  1RTP 1;  2WCF A;  1K2H A;  3BUO B;  3VRO A;  1JF2 A;  3D74 A;  2KBM A;  4MBE A;  5CSI A;  1KK7 Y;  1JUO A;  3OP0 A;  2BE6 A;  3OB2 B;  3F45 A;  2AMI A;  4E68 A;  4HRE E;  2K2F A;  1DJW A;  1FBV A;  1P28 A;  3A8R A;  2KPH A;  2JT0 A;  5CSJ A;  2PYQ A;  1QLS A;  4KYN A;  3D0Y A;  3JVT C;  2ZRT A;  1SYM A;  1LA3 A;  1U5I A;  1ZOT B;  1SW8 A;  1A29 A;  2RGI A;  3AAK A;  4YI9 A;  4YGB B;  5EL2 A;  5AXI A;  3GOF A;  1G4Y R;  2WCM A;  1SSE B;  1A2X A;  1PSB A;  3VRP A;  2LVV A;  1J7P A;  2KGR A;  4XYN A;  5CSN A;  5I94 A;  1Y1U A;  1LIN A;  4PE4 A;  1SCM C;  1Q80 A;  1TOP A;  2ZN8 A;  2LUX A;  2QDI A;  3K1E A;  3GK4 X;  4GNK B;  1W7J B;  2GGZ A;  5BPJ A;  3OB1 B;  1DJY A;  1BR4 B;  1C3Y A;  1J1E A;  1CDP A;  1CLM A;  2LVI A;  1CLB A;  2WND A;  4YGC B;  1F70 A;  1A4P A;  3EVU A;  4WQ2 A;  2KDH A;  4YRU A;  2M3W A;  1TCF A;  1SL9 A;  2KHN A;  4YBH B;  1XFR A;  1GQM A;  2SCP A;  3I5F C;  3JTD C;  5FI2 A;  5KSZ A;  1LA0 A;  1KK8 B;  1NX2 A;  2LHI A;  4PHJ A;  1AJ4 A;  1ODB A;  3D75 A;  3N7H A;  3BOW A;  1YUT A;  2R2I A;  1SK6 D;  2LAN A;  2LP3 A;  3I5H B;  1K90 D;  2L5X B;  5HKW A;  1QV0 A;  1SBJ A;  1DVI A;  1OMV A;  2LLT A;  2LLU A;  2BAP A;  1B1G A;  1B47 A;  2LE9 B;  3S0F A;  1JWD A;  2F2O A;  2FCD A;  3CR2 A;  1IRJ A;  4L9M A;  5HLV A;  5KTY A;  3SG2 A;  3B87 A;  4MRY A;  5DIC A;  1DF0 B;  5I2L A;  3PSR A;  5HL1 A;  1XO5 A;  1YTZ C;  2B1U A;  1K9P A;  2JXC A;  1WDC C;  5HKY A;  1DJZ A;  1YRT B;  1IQ3 A;  1J55 A;  1QWV A;  2MRD A;  3R72 A;  2K7O A;  2KFF A;  2QEO A;  4NDD A;  5FI6 A;  2BKH B;  4CPV A;  1K94 A;  2BNX A;  2E30 A;  5AAN A;  2KYF A;  1XFU O;  3FE8 A;  4PHM A;  1K9U A;  4QJ4 B;  1L2O C;  2KYC A;  3DF0 B;  2ZKM X;  1BR1 B;  1F71 A;  3DZT A;  1KSO A;  2O60 A;  4ORA B;  3CZ1 A;  1R2U A;  5HKZ A;  1DMO A;  1DGV A;  2HPS A;  1NCZ A;  3OX5 A;  1IH0 A;  4I5K A;  3TS5 C;  4N1F A;  1VRK A;  2PRU A;  1M39 A;  2BCA A;  2P70 A;  1AJ5 A;  1GGZ A;  1F4Q A;  2AAO A;  3S0D A;  1SMG A;  1Z2C B;  2TN4 A;  2LC5 A;  1BOD A;  2OTG B;  3R1V A;  5ER5 A;  1TNW A;  5F6T A;  3AKB A;  1LVC D;  2M1K B;  4INW A;  5IBW A;  3NGV A;  3EG5 B;  3ZWH A;  1UHH A;  1KQM B;  2KOT A;  2GV5 A;  1OSA A;  1AHR A;  3I5G B;  1PVA A;  2KAX A;  3EVR A;  3LLE A;  2EGD A;  1Z4H A;  2LLS A;  3DVK A;  1Y6W A;  1PAL A;  3SG5 A;  1AK8 A;  4PAL A;  2LCP A;  3L4A A;  3DYE A;  4OR9 B;  1TIZ A;  2CXJ A;  1UHJ A;  1K9K A;  2DOQ A;  3CWG A;  1MXE A;  1NSH A;  1DQE A;  2MLF C;  1WY9 A;  1MF8 B;  2I18 A;  3CZT X;  4OZD A;  1XVJ A;  1QV1 A;  3NSL A;  2A4J A;  1NX1 A;  2E6W A;  1XFX O;  3BJH A;  1J7O A;  1SY9 A;  2GGM A;  3A4U B;  1K96 A;  1ZAC A;  1OZO A;  3OBV A;  1BMO A;  1IWQ A;  3LL8 B;  2JXL A;  1ZFS A;  2LMT A;  1S1E A;  2HET A;  3TUY B;  1IG5 A;  3QRX A;  2L0P A;  3PN7 B;  3AKA A;  3VRQ A;  1A75 B;  4XJK A;  1SPY A;  3M0W A;  2CTN A;  1XFY O;  3QME A;  3D76 A;  4JPZ B;  4IJ7 A;  1TNX A;  3B88 A;  1Y1X A;  3IQQ A;  1KCY A;  3WHT B;  1SCV A;  2CCM A;  1BJF A;  5D69 A;  2KI4 C;  1GM0 A;  3CDN A;  5HYD A;  3WXA A;  2ZNE A;  1S26 D;  4GFT A;  3KEV A;  4MZJ A;  3DY9 A;  2FOT A;  1QJT A;  4NDB A;  1BLQ A;  2CNP A;  3OX6 A;  2K8M B;  2KQ6 A;  1NP8 A;  3TZ1 A;  2JPT A;  2PSR A;  1F54 A;  1QTX A;  3E3R A;  1B7T Y;  2JQ6 A;  4INX A;  3WHU B;  4C0L A;  1J1D A;  2BBM A;  4CLN A;  1EG4 A;  3B7A A;  4P2Y B;  1B9A A;  4AQJ A;  2WC6 A;  5I2Q A;  1BT6 A;  2K7D A;  4PHN A;  2L2C A;  4UPG A;  2EHB A;  1IJ5 A;  3RLZ A; 
#chains in the Genus database with same CATH homology
 3KO0 A;  1DTL A;  3D0Y B;  4AOM A;  1U5I B;  2NCP A;  1XYD A;  3H4S E;  1S6I A;  4NQG A;  3SJS A;  3ICB A;  4OV2 A;  3SG4 A;  2I94 A;  4DUQ A;  4MVF A;  4PE0 A;  1KQV A;  4FQO A;  2M8U A;  2FCE A;  2H2K A;  2KSP A;  2L2E A;  2K7B A;  2JUL A;  3DVJ A;  1M46 A;  3I5I C;  2JTT A;  3O2P A;  1TNQ A;  1JC2 A;  1B7T Z;  4PE7 A;  5D7F A;  1Y1A A;  1LKJ A;  1YX8 A;  1N65 A;  2WOR A;  4ORC B;  2QAC A;  1S5G Y;  2P6B B;  1PSR A;  1NPQ A;  1MWN A;  3KF9 A;  2JOJ A;  3DD4 A;  1XA5 A;  5TNC A;  4A4C A;  2AUC A;  2NLN A;  3IQO A;  2OPO A;  2KAV A;  1XFW O;  2MJW B;  2L51 A;  2Y1M A;  2JZI A;  2MA2 A;  1ZUZ A;  1DJH A;  1UHN A;  3TDI A;  1MXL C;  1NWD A;  4F0Z B;  1ALW A;  3BOW B;  1IJ6 A;  1NCY A;  4JWQ A;  1M63 B;  1QXP A;  2OS8 B;  3FWB A;  1XFZ O;  3BXK A;  1QX5 B;  3FS7 A;  1JFJ A;  5DKQ A;  2LUC A;  1DJG A;  1NX0 A;  2KFH A;  4M2O A;  2CT9 A;  1UUR A;  2Q91 A;  5ER4 X;  3SG6 A;  2F2P A;  1S5G Z;  2HF5 A;  2LM5 A;  5JJG A;  3O78 A;  1DT7 B;  4YI8 A;  4I5L B;  1K93 D;  1YR5 A;  1BU3 A;  2M7L A;  2Y4Q A;  1B4C A;  1LXF C;  4N1G A;  4C0J A;  3LCP C;  1CM4 A;  1KWO C;  1CDN A;  2LP2 A;  3BUW B;  3BQ3 A;  3PAL A;  3JVT B;  4R1E A;  4USL A;  1UHK A;  1UUS A;  2JRF A;  2JT3 A;  3NSK A;  2BL0 C;  4P5O E;  2MLE C;  1JFK A;  1QX7 A;  2JWW A;  2ZN9 A;  4ZCU A;  2VRG A;  2MBX A;  1F55 A;  1NUB A;  4WQ3 A;  3CR4 X;  1EL4 A;  1TRF A;  4D1E A;  1EXR A;  1NCX A;  2F8P A;  2LHL A;  4NDC A;  3C1V A;  4DRW A;  2BKI B;  1SCM B;  3EK4 A;  2JTZ A;  4DS7 A;  1JF0 A;  3KHE A;  1CB1 A;  4M2P A;  1WRL A;  1DJI A;  4MLW A;  1PRW A;  1QVI Y;  2LVK A;  4GAO A;  1IGV A;  4MN0 A;  1KK8 C;  1FW4 A;  3CS1 A;  3EVV A;  4HRG A;  1UWO A;  2F33 A;  5J3X A;  4M2Q A;  1QIV A;  3KPX A;  4N5X A;  2PMY A;  4ZCV A;  2M0R A;  4I5N B;  1QS7 A;  2L4I A;  5DKN A;  1CM1 A;  3I5F B;  3I5H C;  3JTD B;  4ETO A;  5G08 A;  2M1U A;  1BF5 A;  2LMV A;  4GGF C;  3VRR A;  3AAJ A;  3NXA A;  1YRU B;  2ISD A;  1M45 A;  1CDM A;  3CR5 X;  1CMF A;  1FI6 A;  4PE1 A;  1RJV A;  3GK2 A;  1M31 A;  4ORB B;  2JT8 A;  2F3Z A;  3EK8 A;  3EKJ A;  1EH2 A;  3PM8 A;  1QVI Z;  1RFJ A;  2K61 A;  1PUL A;  2M97 A;  5FYX A;  1D1O A;  3SG3 A;  2NCO A;  4OVN F;  3IF7 A;  3EKH A;  4CID A;  4DCK A;  3D10 A;  1KSM A;  2M9G A;  1CFD A;  1V1F A;  4A4B A;  2Y1N A;  3ZNI A;  1MHO A;  1FPW A;  2LAP A;  1Y0V H;  4MZL A;  3HX4 A;  1OMD A;  1WDC B;  2NXQ A;  4YGA A;  4GPL B;  4C0K A;  1QAT A;  4GGN A;  1E8A A;  2ZRS A;  1CDL A;  2L4H A;  2JC2 A;  4XJK B;  3NSI A;  1YUU A;  1S6J A;  4BY4 A;  5AFP A;  4QJ3 B;  1CTR A;  2L50 A;  4YGE B;  2KGB C;  1S36 A;  1L2O B;  3O6B A;  1MR8 A;  1TTX A;  1B8R A;  1QLK A;  4GUK A;  1DGU A;  1WLZ A;  2F3Y A;  2CBL A;  2JNX A;  4IL1 A;  1JSA A;  3CGA A;  2WCB A;  2M49 B;  1V1G A;  2EC6 C;  2OTG C;  1KWO B;  1IQ5 A;  3TS5 B;  3RM1 A;  1FI5 A;  3DVM A;  3BYA A;  2KQY A;  1REC A;  1KQM C;  2MHH A;  2QPT A;  2FJU B;  2BL0 B;  1B8L A;  1UHI A;  1CLL A;  1F54 A;  2IS9 A;  1KK7 Z;  1RK9 A;  3VGO A;  2O5G A;  3I5G C;  1QAS A;  1OOJ A;  3TDU A;  2K2A A;  2K0J A;  1R6P A;  1CFC A;  3K21 A;  5HLO A;  2ZFD A;  1G8I A;  3BUX B;  4GGF A;  2PVB A;  4HRH A;  4MRX A;  3GK1 A;  4HSZ A;  1S3P A;  1EG3 A;  3PAT A;  3DVE A;  5AER A;  4U8D A;  4PDZ A;  1A03 A;  1C07 A;  4I5J A;  2I7A A;  1DF0 A;  1N2D A;  1H4B A;  1YVH A;  1FF1 A;  1SR6 C;  2G2B A;  1IKU A;  1UP5 A;  5JOL A;  1KFX L;  3O4Y A;  1XK4 A;  2SAS A;  2PAL A;  3CLN A;  5K89 A;  1B8C A;  2KAY A;  1QIW A;  5DKR A;  4TNC A;  3LK1 A;  1TNP A;  1N0Y A;  2KBI A;  1SKT A;  2PAS A;  1YX7 A;  3OHM B;  3TUY C;  3SG7 A;  1KFX S;  1YVL A;  3CTN A;  2COL B;  2H61 C;  2K7C A;  3PN7 C;  4GBA A;  4OCI A;  5I2O A;  1AP4 A;  1CMG A;  2LNK A;  1HT9 A;  1HQV A;  1NIW A;  1OZS A;  1SL7 A;  3MSE B;  1MQ1 A;  3SIB A;  1OMR A;  2BEC A;  1KFU L;  2ZND A;  5AEQ A;  4YGD B;  1RRO A;  3DF0 A;  3SIA A;  1JBA A;  1QX2 A;  1SNL A;  2HQW A;  2LVJ A;  1C7V A;  2Q4U A;  2KNE A;  4AQI A;  1KFU S;  4QJ5 B;  3VRN A;  4PCW A;  2JU0 A;  3PFV A;  1MUX A;  2NZ0 A;  4MZK A;  2BBN A;  2KI4 B;  1EJ3 A;  1OQP A;  1BG1 A;  3FWC A;  4DIR A;  3TDZ A;  1YUR A;  1W7I B;  1L7Z A;  1BOC A;  1AVS A;  4ICB A;  1J7R A;  1CNP A;  4CFQ A;  4MSP A;  1WLM A;  1OE9 B;  4CFR A;  2KFG A;  3EK7 A;  1CFF A;  1G33 A;  2HQ8 A;  1GJY A;  1F8H A;  1DJX A;  2BCB A;  2LV7 A;  2JNF A;  3PLF B;  2G9B A;  3WNX B;  2M7N A;  2V53 A;  2WCE A;  1CKK A;  1ZMZ A;  1C7W A;  4OKH A;  5CSF A;  1J7Q A;  1SRA A;  1CFP A;  5B8I B;  1RWY A;  2EC6 B;  5CPV A;  4JQ0 D;  1GGW A;  2MAZ A;  2M29 A;  1NYA A;  2D8N A;  5KU1 A;  2KI6 C;  2BE4 A;  4MEW A;  1PK0 D;  2BCX A;  3I5I B;  1XFV O;  5GQQ C;  1ALV A;  5PAL A;  1PVB A;  2LMU A;  2Y5I A;  2I2R E;  3HCM A;  1TCO B;  4FTG A;  3BUN B;  2H61 A;  1A75 A;  1S6C A;  4Q04 A;  3FIA A;  1F4O A;  2WC8 A;  2KI6 D;  1X02 A;  4BY5 A;  3BUM B;  3NSO A;  4WRI A;  1XK4 C;  1NX3 A;  1WRZ A;  2WOS A;  5I8N A;  2OS8 C;  1SL8 A;  1SR6 B;  2L98 A;  1K8U A;  1YUS A;  3LK0 A;  1TN4 A;  1WRK A;  1H8B A;  1AUI B;  1K95 A;  1RTP 1;  2WCF A;  1K2H A;  3BUO B;  3VRO A;  1JF2 A;  2KBM A;  4MBE A;  5CSI A;  1KK7 Y;  1JUO A;  3OP0 A;  2BE6 A;  3OB2 B;  3F45 A;  2AMI A;  4E68 A;  4HRE E;  2K2F A;  1DJW A;  1FBV A;  3A8R A;  5CSJ A;  2JT0 A;  1QLS A;  3D0Y A;  3JVT C;  2ZRT A;  1SYM A;  1LA3 A;  1U5I A;  1ZOT B;  1SW8 A;  1A29 A;  2RGI A;  3AAK A;  4YI9 A;  4YGB B;  5AXI A;  3GOF A;  1G4Y R;  1A2X A;  1PSB A;  3VRP A;  2LVV A;  1J7P A;  2KGR A;  4XYN A;  5CSN A;  1Y1U A;  1LIN A;  4PE4 A;  1SCM C;  1Q80 A;  1TOP A;  2ZN8 A;  2LUX A;  3GK4 X;  4GNK B;  1W7J B;  2GGZ A;  5BPJ A;  3OB1 B;  1DJY A;  1BR4 B;  1J1E A;  1CDP A;  1CLM A;  2LVI A;  1CLB A;  2WND A;  4YGC B;  1F70 A;  1A4P A;  3EVU A;  4WQ2 A;  2KDH A;  4YRU A;  2M3W A;  1TCF A;  1SL9 A;  2KHN A;  4YBH B;  2SCP A;  1GQM A;  3I5F C;  3JTD C;  5KSZ A;  1LA0 A;  1KK8 B;  1NX2 A;  2LHI A;  4PHJ A;  1AJ4 A;  1ODB A;  3BOW A;  1YUT A;  2R2I A;  1SK6 D;  2LAN A;  2LP3 A;  3I5H B;  1K90 D;  2L5X B;  5HKW A;  1QV0 A;  1SBJ A;  1DVI A;  1OMV A;  2LLT A;  2LLU A;  1B1G A;  1B47 A;  2LE9 B;  1JWD A;  2F2O A;  2FCD A;  3CR2 A;  1IRJ A;  4L9M A;  5HLV A;  5KTY A;  3SG2 A;  4MRY A;  1DF0 B;  5I2L A;  3PSR A;  1XO5 A;  1YTZ C;  2B1U A;  1K9P A;  2JXC A;  1WDC C;  5HKY A;  1DJZ A;  1YRT B;  1IQ3 A;  1J55 A;  2MRD A;  2K7O A;  2KFF A;  4NDD A;  2BKH B;  4CPV A;  1K94 A;  2E30 A;  5AAN A;  2KYF A;  1XFU O;  4PHM A;  1K9U A;  4QJ4 B;  1L2O C;  2KYC A;  3DF0 B;  2ZKM X;  1BR1 B;  1F71 A;  5HKZ A;  1KSO A;  2O60 A;  4ORA B;  1R2U A;  1DMO A;  1DGV A;  2HPS A;  1NCZ A;  3OX5 A;  1IH0 A;  4I5K A;  3TS5 C;  4N1F A;  1VRK A;  2PRU A;  1M39 A;  2BCA A;  1AJ5 A;  1GGZ A;  1F4Q A;  2AAO A;  1SMG A;  2TN4 A;  2LC5 A;  1BOD A;  2OTG B;  5ER5 A;  1TNW A;  5F6T A;  3AKB A;  1LVC D;  2M1K B;  5IBW A;  3ZWH A;  1UHH A;  1KQM B;  2KOT A;  2GV5 A;  1OSA A;  1AHR A;  3I5G B;  1PVA A;  2KAX A;  3EVR A;  3LLE A;  2EGD A;  2LLS A;  3DVK A;  1Y6W A;  1PAL A;  3SG5 A;  1AK8 A;  4PAL A;  2LCP A;  4OR9 B;  1TIZ A;  2CXJ A;  1UHJ A;  1K9K A;  2DOQ A;  3CWG A;  1MXE A;  1NSH A;  2MLF C;  1WY9 A;  1MF8 B;  2I18 A;  3CZT X;  1XVJ A;  1QV1 A;  3NSL A;  2A4J A;  1NX1 A;  2E6W A;  1XFX O;  1J7O A;  1SY9 A;  2GGM A;  3A4U B;  1K96 A;  1OZO A;  1ZAC A;  1BMO A;  1IWQ A;  3LL8 B;  2JXL A;  1ZFS A;  2LMT A;  1S1E A;  2HET A;  3TUY B;  1IG5 A;  3QRX A;  2L0P A;  3PN7 B;  3AKA A;  3VRQ A;  1A75 B;  4XJK A;  1SPY A;  3M0W A;  2CTN A;  1XFY O;  1KCY A;  4JPZ B;  1TNX A;  3IQQ A;  1Y1X A;  3WHT B;  1SCV A;  2CCM A;  1BJF A;  5D69 A;  2KI4 C;  5HYD A;  3WXA A;  2ZNE A;  1S26 D;  4GFT A;  3KEV A;  4MZJ A;  2FOT A;  1QJT A;  4NDB A;  1BLQ A;  2CNP A;  3OX6 A;  2K8M B;  2KQ6 A;  1NP8 A;  3TZ1 A;  2JPT A;  2PSR A;  1QTX A;  3E3R A;  1B7T Y;  2JQ6 A;  3WHU B;  4C0L A;  4CLN A;  1J1D A;  2BBM A;  1EG4 A;  4P2Y B;  1B9A A;  4AQJ A;  5I2Q A;  1BT6 A;  2K7D A;  4PHN A;  4PHK A;  4UPG A;  2EHB A;  1IJ5 A;  3RLZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...