3R1PA

Odorant binding protein 7 from anopheles gambiae with four disulfide bridges, form p1
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
119
structure length
108
Chain Sequence
RYKKPAKMLHEICIAESGASEEQLRTCLDGTVPTAPAAKCYIHCLFDKIDVVDEATGRILLDRLLYHLTRECSHIVTPDKCETAYETVKCYFNAHDEVIKFCHLLVLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Odorant binding protein, antennal
publication title The Crystal Structure of Odorant Binding Protein 7 from Anopheles gambiae Exhibits an Outstanding Adaptability of Its Binding Site.
pubmed doi rcsb
source organism Anopheles gambiae
molecule tags Transport protein
total genus 36
structure length 108
sequence length 119
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2011-03-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01395 PBP_GOBP PBP/GOBP family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.20 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 Pheromone/general odorant binding protein domain 3r1pA00
4INXA 2P71A 1QWVA 3S0EA 3V2LA 3CZ1A 3S0FA 3FE9A 5EL2A 1TWOA 1T14A 2JPOA 2WCHA 3D73A 2WC5A 1OOIX 3FE8A 2KPHA 3CABA 3D75A 2WCMA 3CZ2A 3B86A 3R72A 1OOGA 2H8VA 2L2CA 2QEVA 3DXLA 3QMEA 4OZDA 1GM0A 1LS8A 2QEOA 3BJHA 3R1VA 1C3YA 3D76A 1OOHA 1XFRA 2GTEA 3CYZA 1OW4A 3L4LA 3VB1A 2WCKA 3D77A 3FE6A 3S0BA 3B87A 4JD9A 3CZ0A 3DYEA 3D74A 3D78A 3R1PA 3S0GA 3R1OA 1DQEA 3K1EA 3OGNA 3L47A 2WCLA 1P28A 4INWA 1OOFA 3L4AA 2P70A 3S0DA 3B6XA 2FJYA 2WCJA 1C3ZA 2ERBA 2QEBA 3NHIA 3NGVA 5DICA 3CDNA 4FQTA 4F7FA 3BFHA 4PT1A 3DZTA 3PJIA 3B88A 1ORGA 3N7HA 2QEHA 1TUJA 3BFAA 3BFBA 3S0AA 2WC6A 2QDIA 2PQLA 3Q8IA 3DY9A 3RZSA 3NHTA 3B7AA
chains in the Genus database with same CATH superfamily
1QS7A 2FCEA 2WCFA 1K9UA 3CTNA 1N2DA 2K8MB 2KNEA 1FW4A 1PULA 1ZOTB 4GPLB 1S36A 1JC2A 1LA3A 1DEKA 3KO0A 4OV2A 2LMVA 2JPTA 3FE9A 5EL2A 5HLVA 3V2LA 3S0FA 1YUSA 4OR9B 2GGMA 1TRFA 2E30A 2MBXA 1A29A 1QTXA 2NZ0A 2JZIA 4NDBA 2MRDA 4PHKA 2A4JA 2CCMA 1AUIB 4I5KA 1BF5A 3M0WA 1DJHA 2JT8A 1ZFSA 5ER5A 2L2EA 2M3WA 1Z4HA 3O4YA 1KWOB 2FOTA 1J1EA 3R72A 3NSOA 3IQOA 2KSPA 1DJIA 2H8VA 4GNKB 4YI8A 2HPSA 5PALA 3SG6A 3WXAA 1XYDA 2H61C 4MVFA 1KQVA 1NYAA 2K7BA 1TNXA 1M46A 1GM0A 1MUXA 1NSHA 1SRAA 1OMVA 2H61A 2KGBC 4Q04A 3K21A 4OVNF 1MXLC 2K2AA 3GOFA 2D8NA 3OB2B 1C3YA 2F3ZA 3D76A 1B8CA 1DJGA 1CM4A 3IQQA 1XFRA 2GGZA 3LL8B 3VRNA 4DUQA 1S5GZ 2KFFA 3I5GB 1CLLA 4I5NB 4D1EA 2BKIB 2CT9A 4F0ZB 1CMGA 1IGVA 5AFPA 1YURA 3E3RA 3L4LA 4PHMA 2HETA 2BBNA 1DGUA 2JRFA 1CLBA 2JT3A 5D7FA 5AERA 1BU3A 4JD9A 4YGCB 1KCYA 4M2QA 3D74A 3EVVA 2BE6A 3UNWA 2KAYA 4YGAA 5FYXA 3ZWHA 1JSAA 2QACA 3R1OA 4MSPA 1XFZO 1EH2A 1DQEA 1C7WA 1PVAA 1R6PA 1KFXL 1SNLA 1SR6B 1V1FA 2LMTA 4DIRA 1CDMA 3L47A 4HSZA 3LK1A 2LVJA 4INWA 4E68A 3DVEA 1GGWA 1B8LA 1WDCC 1F54A 1E8AA 1F55A 1RTP1 3OB1B 3PFVA 1YVHA 4ORBB 3SIAA 2BCAA 1RJVA 2G2BA 1CFFA 4WRIA 2FJYA 1AVSA 1C3ZA 1OOJA 2ERBA 3NHIA 3UO9A 3VRRA 5DICA 2MLFC 1TNPA 1FI5A 1KSOA 3HCMA 4MEWA 2LHLA 4QJ3B 1XFUO 1LXFC 1YX7A 3WNXB 2HF5A 3BFHA 4PT1A 1U5IB 3CR4X 3DZTA 3I5HB 2NLNA 5KSZA 3PJIA 1QATA 1RWYA 2DOQA 1DJXA 2M8UA 3I5FB 1B7TZ 2QPTA 1U5IA 1D1OA 1Y1XA 4NQGA 1CMFA 2JOJA 1UUSA 2JU0A 2JXCA 3GK4X 2KQYA 1FI6A 1QIVA 1QVIY 3FIAA 1KK7Z 2L5XB 3BFAA 1ALVA 2BCXA 1UP5A 3CWGA 3TUYB 2QDIA 1KK8C 1OZSA 3TUYC 2JNFA 3O2PA 2NXQA 4USLA 1QX7A 3DD4A 3Q8IA 2LP2A 4PHNA 2M29A 1G33A 4PCWA 1XVJA 3SS3A 1YUTA 1B8RA 4N1GA 1L2OB 2K2FA 2ZRTA 2EC6C 3S0EA 1KFUL 1K95A 2F3YA 2R2IA 2WCHA 1YX8A 3AAJA 2KGRA 2LHIA 1OOIX 1SSEB 2KFGA 2BL0C 1TNQA 3I5IC 1M31A 3CLNA 1TCOB 3JVTB 4MZLA 4PALA 3SS5A 3NSIA 1S6IA 1MHOA 1RECA 2LV7A 3JTDC 4N1FA 2WCMA 3EVRA 2SCPA 3CZ2A 5FI7A 3DF0B 2M7NA 2Q4UA 2L2CA 1SL8A 2QEVA 1B7TY 3PALA 1NCXA 3QMEA 1RFJA 2H2KA 4OZDA 3DF0A 1SK6D 1JWDA 3D0YB 3CR2A 3EVUA 1YRUB 3TDIA 1RROA 4ICBA 2KI4B 1DVIA 1M45A 1M63B 1KK7Y 1QIWA 4PE0A 2K61A 3D0YA 3ZNIA 4GUKA 4HRHA 4MZKA 1IJ6A 1R2UA 4NDDA 2NCPA 3VGOA 2GTEA 1AP4A 2JNXA 2V53A 1J7PA 1S6JA 2LNKA 4YGDB 2KLEA 1K90D 2WCKA 5FI2A 1IQ3A 1TTXA 1IKUA 2CNPA 4DRWA 1DC1A 1JFKA 2ZN9A 1Y6WA 1KWOC 4BY5A 1AHRA 5KTYA 2KLDA 1DELA 2KOTA 1K9KA 2PRUA 3R1PA 1EL4A 2B1UA 1CNPA 2SASA 3BUNB 1YR5A 1A03A 3BXKA 3RLZA 1BG1A 3BUWB 3K1EA 1X02A 2K7OA 3AKAA 1ZUZA 3SG2A 3IF7A 4MRXA 1DGVA 5D3OA 5HKZA 1MXEA 3VROA 1S26D 1SKTA 1IRJA 1Y1AA 2WCLA 3WHTB 2LAPA 2I7AA 5HYDA 4U8DA 4KYNA 1QJTA 2P70A 2JXLA 3I5GC 1UWOA 1QX2A 1UURA 1WY9A 2M97A 2MA2A 2AUCA 3F45A 1BR4B 4ORAB 1MF8B 2KAXA 2VRGA 2QEBA 1CM1A 3TS5B 2G9BA 1JF0A 1SYMA 2OS8B 3CDNA 1S1EA 3CGAA 4FQTA 1BOCA 3NSKA 3PM8A 3EG5B 3LCPC 5I2LA 2ZKMX 2MAZA 3EK7A 3OHMB 1EG3A 4A4CA 4FTGA 1CFCA 1A75B 1S6CA 5BPJA 1PK0D 2LUCA 1IH0A 1LINA 1SR6C 2M9GA 3O78A 1GJYA 4N5XA 5F6TA 1NX0A 1PRWA 1EXRA 3N7HA 1JF2A 5FI6A 5IBWA 3CS1A 1DTLA 2WCBA 1MWNA 3OBVA 3S0AA 2WC6A 1B4CA 2AAOA 4IL1A 1HQVA 2BBMA 3RZSA 3NHTA 3B7AA 2KYCA 4MZJA 2M1KB 1S5GY 4INXA 4CFQA 5I2OA 1Y0VH 1QV1A 2MJWB 3QRXA 1TOPA 2F2OA 3VRPA 1QWVA 1SMGA 3AKBA 2E6WA 3BOWB 2LVKA 3CZ1A 4GGNA 4CPVA 1TWOA 1YUUA 1J7QA 5AANA 2PMYA 3BOWA 1W7JB 2AMIA 3D73A 5JJGA 2K0JA 3I5HC 1LA0A 1K9PA 3DVJA 1EJ3A 3I5FC 1BMOA 2KPHA 1AJ5A 2ZRSA 2WC8A 1K96A 3PN7B 5K89A 3PM2A 2M49B 3PN7C 2Q91A 3CABA 4P5OE 4PDZA 1IWQA 1C7VA 1CTRA 3SS4A 2PASA 2Y4QA 3B86A 2JQ6A 1MR8A 3DXLA 2LUXA 4YBHB 4ZCVA 1N0YA 1TIZA 5I8NA 1K8UA 4XJKB 1LKJA 2QEOA 2Y5IA 1W7IB 4IJ7A 1CB1A 1SL9A 3SG5A 1N65A 3HX4A 4AQJA 4XJKA 1L2OC 5HKWA 1B47A 3R1VA 3A8RA 1Z2CB 1RK9A 1IJ5A 2L50A 2LANA 5G08A 2KYFA 1J1DA 1F4QA 3EKHA 4QJ5B 3SG7A 2CBLA 2EGDA 1OW4A 2F33A 4DCKA 4GFTA 2JT0A 4XYNA 4YI9A 1IG5A 2KI6D 3JVTC 2BNXA 1NX3A 1NIWA 5CSIA 2M7LA 3FE6A 3S0BA 2COLB 1DT7B 3H4SE 1QX5B 1DMOA 1K2HA 1DJYA 3BQ3A 2F8PA 1FBVA 2JWWA 1PSRA 3DYEA 4P2YB 3D78A 1V1GA 1SCMB 1MQ1A 1CDNA 5ER4X 1YVLA 1XK4A 4MBEA 4I5JA 1ODBA 1XFXO 1OSAA 1CFPA 2KI4C 1H4BA 1AK8A 1OZOA 2K7DA 3SIBA 3OGNA 1CKKA 2WCEA 1SBJA 1SCVA 1P28A 2K60A 1GQMA 1PVBA 1OOFA 2BECA 5J3XA 4M2OA 5D69A 3S0DA 1G4YR 3CZTX 1VRKA 4YRUA 3B6XA 3DVMA 2OTGB 1J55A 5AEQA 4TNCA 1J7RA 2OTGC 2WCJA 1KQMB 2FCDA 2JULA 2O60A 2WOSA 1F8HA 1KSMA 2L51A 1FPWA 4GGFC 4L9MA 1OE9B 5CSJA 1W9ZA 1C07A 4WQ3A 5I94A 4OCIA 1AJ4A 1WLMA 4GGFA 1ZMZA 4PE7A 2TN4A 3KF9A 1A2XA 1WRKA 5CSNA 1QASA 2I2RE 1KFXS 1CFDA 1CDPA 1NCYA 1TCFA 3KHEA 4JPZB 3IVTA 4C0KA 4PHJA 1TNWA 1TUJA 1NCZA 2KI6C 2RGIA 3BUMB 3BFBA 5GQQC 1DJWA 1SY9A 2FJUB 2BE4A 3TS5C 1YRTB 2PYQA 3TZ1A 2KQ6A 2L4IA 4HRGA 2OS8C 1OMRA 2ZNEA 2P71A 3GK2A 4PE4A 5HLOA 2LVVA 1JBAA 1ALWA 1XFVO 2JTZA 1T14A 5I2QA 2JPOA 4AOMA 4FQOA 3BUXB 4NDCA 1CDLA 1BJFA 3LLEA 3C1VA 3O4XA 1B1GA 1BR1B 2WC5A 4GAOA 4C0JA 3FE8A 2ZFDA 1A75A 3TDZA 2M1UA 1A4PA 1JFJA 5DKRA 2Y1NA 5TNCA 1GGZA 1Y1UA 3D75A 2OPOA 3MSEB 4GBAA 4JKTA 4R1EA 2PVBA 4ZCUA 5B8IB 1FF1A 4AQIA 4YGBB 2I94A 5CPVA 5JOLA 1OOGA 2L0PA 2LC5A 2MHHA 3OP0A 1QLSA 2NCOA 4MLWA 2BAPA 1ZACA 1Q80A 4JQ0D 2F2PA 1LS8A 1NPQA 3VRQA 1TN4A 4JWQA 1QVIZ 2KDHA 3BJHA 3EK4A 4YGEB 3SJSA 1UHJA 1M39A 2KBMA 1TUZA 1YTZC 1JUOA 2PSRA 1UHIA 2BCBA 1BT6A 1KFUS 2JTTA 1OOHA 1QLKA 3PLFB 4UPGA 1WDCB 3FS7A 5AXIA 3CYZA 1IIOA 2KHNA 2YGUA 1H8BA 2BKHB 5KU1A 1F70A 2ZN8A 4HREE 3VB1A 3D77A 4CLNA 3WHUB 1XO5A 2LLUA 1PSBA 3B87A 3LK0A 2GV5A 2LMUA 1WRZA 2CTNA 3CZ0A 3OX5A 1CLMA 1XFYO 2EHBA 4MRYA 2WORA 3S0GA 3SG4A 2HQWA 1NWDA 3ICBA 3KPXA 4M2PA 2Y1MA 2ZNDA 3O6BA 4MN0A 1SPYA 2M0RA 2P6BB 1OMDA 2IS9A 3TDUA 3A4UB 3EK8A 3CR5X 1QXPA 1WRLA 2O5GA 4CIDA 1NP8A 1NX2A 1XA5A 2LLSA 4BY4A 1S3PA 3L4AA 2WNDA 5HL1A 1L7ZA 3GK1A 1F4OA 3KEVA 2LP3A 1K93D 1NX1A 1UHNA 4QJ4B 4ORCB 1SW8A 3BYAA 2LVIA 1KK8B 1BLQA 1DJZA 2CXJA 2LM5A 3NXAA 5HKYA 2LLTA 3NGVA 5DKNA 2ISDA 2KAVA 4C0LA 4WQ2A 3FWCA 2KBIA 5CSFA 2MLEC 3PATA 4F7FA 2PALA 5DKQA 2EC6B 1XK4C 1K94A 1SCMC 4OKHA 4I5LB 1PALA 2KFHA 1J7OA 1B9AA 3RM1A 3SG3A 1OQPA 2LE9B 1UHHA 3AAKA 2BL0B 3D10A 3I5IB 3FWBA 1QV0A 3PSRA 2K7CA 1LVCD 1ORGA 2L98A 3B88A 4CFRA 1NUBA 2L5YA 1SL7A 3JTDB 3NSLA 1UHKA 2LCPA 1EG4A 2QEHA 2I18A 1DF0B 4ETOA 1IQ5A 1HT9A 2JC2A 4A4BA 4DS7A 1XFWO 1F71A 1WLZA 1BODA 1DF0A 3EKJA 2PQLA 3BUOB 1KQMC 3DY9A 2L4HA 4PE1A 3DVKA 2HQ8A 3OX6A 1G8IA
chains in the Genus database with same CATH topology
4INXA 2P71A 1QWVA 3S0EA 3V2LA 3CZ1A 3S0FA 3FE9A 5EL2A 1TWOA 1T14A 2JPOA 2WCHA 3D73A 2WC5A 1OOIX 3FE8A 2KPHA 3CABA 3D75A 2WCMA 3CZ2A 3B86A 3R72A 1OOGA 2H8VA 2L2CA 2QEVA 3DXLA 3QMEA 4OZDA 1GM0A 1LS8A 2QEOA 3BJHA 3R1VA 1C3YA 3D76A 1OOHA 1XFRA 2GTEA 3CYZA 1OW4A 3L4LA 3VB1A 2WCKA 3D77A 3FE6A 3S0BA 3B87A 4JD9A 3CZ0A 3DYEA 3D74A 3D78A 3R1PA 3S0GA 3R1OA 1DQEA 3K1EA 3OGNA 3L47A 2WCLA 1P28A 4INWA 1OOFA 3L4AA 2P70A 3S0DA 3B6XA 2FJYA 2WCJA 1C3ZA 2ERBA 2QEBA 3NHIA 3NGVA 5DICA 3CDNA 4FQTA 4F7FA 3BFHA 4PT1A 3DZTA 3PJIA 3B88A 1ORGA 3N7HA 2QEHA 1TUJA 3BFAA 3BFBA 3S0AA 2WC6A 2QDIA 2PQLA 3Q8IA 3DY9A 3RZSA 3NHTA 3B7AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4INX A;  2P71 A;  1QWV A;  3S0E A;  3V2L A;  3CZ1 A;  3S0F A;  3FE9 A;  5EL2 A;  1TWO A;  1T14 A;  2JPO A;  2WCH A;  3D73 A;  2WC5 A;  1OOI X;  3FE8 A;  2KPH A;  3CAB A;  3D75 A;  2WCM A;  3CZ2 A;  3B86 A;  3R72 A;  1OOG A;  2H8V A;  2L2C A;  2QEV A;  3DXL A;  3QME A;  4OZD A;  1GM0 A;  1LS8 A;  2QEO A;  3BJH A;  3R1V A;  1C3Y A;  3D76 A;  1OOH A;  1XFR A;  2GTE A;  3CYZ A;  1OW4 A;  3L4L A;  3VB1 A;  2WCK A;  3D77 A;  3FE6 A;  3S0B A;  3B87 A;  4JD9 A;  3CZ0 A;  3DYE A;  3D74 A;  3D78 A;  3R1P A;  3S0G A;  3R1O A;  1DQE A;  3K1E A;  3OGN A;  3L47 A;  2WCL A;  1P28 A;  4INW A;  1OOF A;  3L4A A;  2P70 A;  3S0D A;  3B6X A;  2FJY A;  2WCJ A;  1C3Z A;  2ERB A;  2QEB A;  3NHI A;  3NGV A;  5DIC A;  3CDN A;  4FQT A;  4F7F A;  3BFH A;  4PT1 A;  3DZT A;  3PJI A;  3B88 A;  1ORG A;  3N7H A;  2QEH A;  1TUJ A;  3BFA A;  3BFB A;  3S0A A;  2WC6 A;  2QDI A;  2PQL A;  3Q8I A;  3DY9 A;  3RZS A;  3NHT A;  3B7A A; 
#chains in the Genus database with same CATH topology
 1QS7 A;  2FCE A;  2WCF A;  1K9U A;  3CTN A;  1N2D A;  2K8M B;  2KNE A;  1FW4 A;  1PUL A;  1ZOT B;  4GPL B;  1S36 A;  1JC2 A;  1LA3 A;  1DEK A;  3KO0 A;  4OV2 A;  2LMV A;  2JPT A;  3FE9 A;  5EL2 A;  5HLV A;  3V2L A;  3S0F A;  1YUS A;  4OR9 B;  2GGM A;  1TRF A;  2E30 A;  2MBX A;  1A29 A;  1QTX A;  2NZ0 A;  2JZI A;  4NDB A;  2MRD A;  4PHK A;  2A4J A;  2CCM A;  1AUI B;  4I5K A;  1BF5 A;  3M0W A;  1DJH A;  2JT8 A;  1ZFS A;  5ER5 A;  2L2E A;  2M3W A;  1Z4H A;  3O4Y A;  1KWO B;  2FOT A;  1J1E A;  3R72 A;  3NSO A;  3IQO A;  2KSP A;  1DJI A;  2H8V A;  4GNK B;  4YI8 A;  2HPS A;  5PAL A;  3SG6 A;  3WXA A;  1XYD A;  2H61 C;  4MVF A;  1KQV A;  1NYA A;  2K7B A;  1TNX A;  1M46 A;  1GM0 A;  1MUX A;  1NSH A;  1SRA A;  1OMV A;  2H61 A;  2KGB C;  4Q04 A;  3K21 A;  4OVN F;  1MXL C;  2K2A A;  3GOF A;  2D8N A;  3OB2 B;  1C3Y A;  2F3Z A;  3D76 A;  1B8C A;  1DJG A;  1CM4 A;  3IQQ A;  1XFR A;  2GGZ A;  3LL8 B;  3VRN A;  4DUQ A;  1S5G Z;  2KFF A;  3I5G B;  1CLL A;  4I5N B;  4D1E A;  2BKI B;  2CT9 A;  4F0Z B;  1CMG A;  1IGV A;  5AFP A;  1YUR A;  3E3R A;  3L4L A;  4PHM A;  2HET A;  2BBN A;  1DGU A;  2JRF A;  1CLB A;  2JT3 A;  5D7F A;  5AER A;  1BU3 A;  4JD9 A;  4YGC B;  1KCY A;  4M2Q A;  3D74 A;  3EVV A;  2BE6 A;  3UNW A;  2KAY A;  4YGA A;  5FYX A;  3ZWH A;  1JSA A;  2QAC A;  3R1O A;  4MSP A;  1XFZ O;  1EH2 A;  1DQE A;  1C7W A;  1PVA A;  1R6P A;  1KFX L;  1SNL A;  1SR6 B;  1V1F A;  2LMT A;  4DIR A;  1CDM A;  3L47 A;  4HSZ A;  3LK1 A;  2LVJ A;  4INW A;  4E68 A;  3DVE A;  1GGW A;  1B8L A;  1WDC C;  1F54 A;  1E8A A;  1F55 A;  1RTP 1;  3OB1 B;  3PFV A;  1YVH A;  4ORB B;  3SIA A;  2BCA A;  1RJV A;  2G2B A;  1CFF A;  4WRI A;  2FJY A;  1AVS A;  1C3Z A;  1OOJ A;  2ERB A;  3NHI A;  3UO9 A;  3VRR A;  5DIC A;  2MLF C;  1TNP A;  1FI5 A;  1KSO A;  3HCM A;  4MEW A;  2LHL A;  4QJ3 B;  1XFU O;  1LXF C;  1YX7 A;  3WNX B;  2HF5 A;  3BFH A;  4PT1 A;  1U5I B;  3CR4 X;  3DZT A;  3I5H B;  2NLN A;  5KSZ A;  3PJI A;  1QAT A;  1RWY A;  2DOQ A;  1DJX A;  2M8U A;  3I5F B;  1B7T Z;  2QPT A;  1U5I A;  1D1O A;  1Y1X A;  4NQG A;  1CMF A;  2JOJ A;  1UUS A;  2JU0 A;  2JXC A;  3GK4 X;  2KQY A;  1FI6 A;  1QIV A;  1QVI Y;  3FIA A;  1KK7 Z;  2L5X B;  3BFA A;  1ALV A;  2BCX A;  1UP5 A;  3CWG A;  3TUY B;  2QDI A;  1KK8 C;  1OZS A;  3TUY C;  2JNF A;  3O2P A;  2NXQ A;  4USL A;  1QX7 A;  3DD4 A;  3Q8I A;  2LP2 A;  4PHN A;  2M29 A;  1G33 A;  4PCW A;  1XVJ A;  3SS3 A;  1YUT A;  1B8R A;  4N1G A;  1L2O B;  2K2F A;  2ZRT A;  2EC6 C;  3S0E A;  1KFU L;  1K95 A;  2F3Y A;  2R2I A;  2WCH A;  1YX8 A;  3AAJ A;  2KGR A;  2LHI A;  1OOI X;  1SSE B;  2KFG A;  2BL0 C;  1TNQ A;  3I5I C;  1M31 A;  3CLN A;  1TCO B;  3JVT B;  4MZL A;  4PAL A;  3SS5 A;  3NSI A;  1S6I A;  1MHO A;  1REC A;  2LV7 A;  3JTD C;  4N1F A;  2WCM A;  3EVR A;  2SCP A;  3CZ2 A;  5FI7 A;  3DF0 B;  2M7N A;  2Q4U A;  2L2C A;  1SL8 A;  2QEV A;  1B7T Y;  3PAL A;  1NCX A;  3QME A;  1RFJ A;  2H2K A;  4OZD A;  3DF0 A;  1SK6 D;  1JWD A;  3D0Y B;  3CR2 A;  3EVU A;  1YRU B;  3TDI A;  1RRO A;  4ICB A;  2KI4 B;  1DVI A;  1M45 A;  1M63 B;  1KK7 Y;  1QIW A;  4PE0 A;  2K61 A;  3D0Y A;  3ZNI A;  4GUK A;  4HRH A;  4MZK A;  1IJ6 A;  1R2U A;  4NDD A;  2NCP A;  3VGO A;  2GTE A;  1AP4 A;  2JNX A;  2V53 A;  1J7P A;  1S6J A;  2LNK A;  4YGD B;  2KLE A;  1K90 D;  2WCK A;  5FI2 A;  1IQ3 A;  1TTX A;  1IKU A;  2CNP A;  4DRW A;  1DC1 A;  1JFK A;  2ZN9 A;  1Y6W A;  1KWO C;  4BY5 A;  1AHR A;  5KTY A;  2KLD A;  1DEL A;  2KOT A;  1K9K A;  2PRU A;  3R1P A;  1EL4 A;  2B1U A;  1CNP A;  2SAS A;  3BUN B;  1YR5 A;  1A03 A;  3BXK A;  3RLZ A;  1BG1 A;  3BUW B;  3K1E A;  1X02 A;  2K7O A;  3AKA A;  1ZUZ A;  3SG2 A;  3IF7 A;  4MRX A;  1DGV A;  5D3O A;  5HKZ A;  1MXE A;  3VRO A;  1S26 D;  1SKT A;  1IRJ A;  1Y1A A;  2WCL A;  3WHT B;  2LAP A;  2I7A A;  5HYD A;  4U8D A;  4KYN A;  1QJT A;  2P70 A;  2JXL A;  3I5G C;  1UWO A;  1QX2 A;  1UUR A;  1WY9 A;  2M97 A;  2MA2 A;  2AUC A;  3F45 A;  1BR4 B;  4ORA B;  1MF8 B;  2KAX A;  2VRG A;  2QEB A;  1CM1 A;  3TS5 B;  2G9B A;  1JF0 A;  1SYM A;  2OS8 B;  3CDN A;  1S1E A;  3CGA A;  4FQT A;  1BOC A;  3NSK A;  3PM8 A;  3EG5 B;  3LCP C;  5I2L A;  2ZKM X;  2MAZ A;  3EK7 A;  3OHM B;  1EG3 A;  4A4C A;  4FTG A;  1CFC A;  1A75 B;  1S6C A;  5BPJ A;  1PK0 D;  2LUC A;  1IH0 A;  1LIN A;  1SR6 C;  2M9G A;  3O78 A;  1GJY A;  4N5X A;  5F6T A;  1NX0 A;  1PRW A;  1EXR A;  3N7H A;  1JF2 A;  5FI6 A;  5IBW A;  3CS1 A;  1DTL A;  2WCB A;  1MWN A;  3OBV A;  3S0A A;  2WC6 A;  1B4C A;  2AAO A;  4IL1 A;  1HQV A;  2BBM A;  3RZS A;  3NHT A;  3B7A A;  2KYC A;  4MZJ A;  2M1K B;  1S5G Y;  4INX A;  4CFQ A;  5I2O A;  1Y0V H;  1QV1 A;  2MJW B;  3QRX A;  1TOP A;  2F2O A;  3VRP A;  1QWV A;  1SMG A;  3AKB A;  2E6W A;  3BOW B;  2LVK A;  3CZ1 A;  4GGN A;  4CPV A;  1TWO A;  1YUU A;  1J7Q A;  5AAN A;  2PMY A;  3BOW A;  1W7J B;  2AMI A;  3D73 A;  5JJG A;  2K0J A;  3I5H C;  1LA0 A;  1K9P A;  3DVJ A;  1EJ3 A;  3I5F C;  1BMO A;  2KPH A;  1AJ5 A;  2ZRS A;  2WC8 A;  1K96 A;  3PN7 B;  5K89 A;  3PM2 A;  2M49 B;  3PN7 C;  2Q91 A;  3CAB A;  4P5O E;  4PDZ A;  1IWQ A;  1C7V A;  1CTR A;  3SS4 A;  2PAS A;  2Y4Q A;  3B86 A;  2JQ6 A;  1MR8 A;  3DXL A;  2LUX A;  4YBH B;  4ZCV A;  1N0Y A;  1TIZ A;  5I8N A;  1K8U A;  4XJK B;  1LKJ A;  2QEO A;  2Y5I A;  1W7I B;  4IJ7 A;  1CB1 A;  1SL9 A;  3SG5 A;  1N65 A;  3HX4 A;  4AQJ A;  4XJK A;  1L2O C;  5HKW A;  1B47 A;  3R1V A;  3A8R A;  1Z2C B;  1RK9 A;  1IJ5 A;  2L50 A;  2LAN A;  5G08 A;  2KYF A;  1J1D A;  1F4Q A;  3EKH A;  4QJ5 B;  3SG7 A;  2CBL A;  2EGD A;  1OW4 A;  2F33 A;  4DCK A;  4GFT A;  2JT0 A;  4XYN A;  4YI9 A;  1IG5 A;  2KI6 D;  3JVT C;  2BNX A;  1NX3 A;  1NIW A;  5CSI A;  2M7L A;  3FE6 A;  3S0B A;  2COL B;  1DT7 B;  3H4S E;  1QX5 B;  1DMO A;  1K2H A;  1DJY A;  3BQ3 A;  2F8P A;  1FBV A;  2JWW A;  1PSR A;  3DYE A;  4P2Y B;  3D78 A;  1V1G A;  1SCM B;  1MQ1 A;  1CDN A;  5ER4 X;  1YVL A;  1XK4 A;  4MBE A;  4I5J A;  1ODB A;  1XFX O;  1OSA A;  1CFP A;  2KI4 C;  1H4B A;  1AK8 A;  1OZO A;  2K7D A;  3SIB A;  3OGN A;  1CKK A;  2WCE A;  1SBJ A;  1SCV A;  1P28 A;  2K60 A;  1GQM A;  1PVB A;  1OOF A;  2BEC A;  5J3X A;  4M2O A;  5D69 A;  3S0D A;  1G4Y R;  3CZT X;  1VRK A;  4YRU A;  3B6X A;  3DVM A;  2OTG B;  1J55 A;  5AEQ A;  4TNC A;  1J7R A;  2OTG C;  2WCJ A;  1KQM B;  2FCD A;  2JUL A;  2O60 A;  2WOS A;  1F8H A;  1KSM A;  2L51 A;  1FPW A;  4GGF C;  4L9M A;  1OE9 B;  5CSJ A;  1W9Z A;  1C07 A;  4WQ3 A;  5I94 A;  4OCI A;  1AJ4 A;  1WLM A;  4GGF A;  1ZMZ A;  4PE7 A;  2TN4 A;  3KF9 A;  1A2X A;  1WRK A;  5CSN A;  1QAS A;  2I2R E;  1KFX S;  1CFD A;  1CDP A;  1NCY A;  1TCF A;  3KHE A;  4JPZ B;  3IVT A;  4C0K A;  4PHJ A;  1TNW A;  1TUJ A;  1NCZ A;  2KI6 C;  2RGI A;  3BUM B;  3BFB A;  5GQQ C;  1DJW A;  1SY9 A;  2FJU B;  2BE4 A;  3TS5 C;  1YRT B;  2PYQ A;  3TZ1 A;  2KQ6 A;  2L4I A;  4HRG A;  2OS8 C;  1OMR A;  2ZNE A;  2P71 A;  3GK2 A;  4PE4 A;  5HLO A;  2LVV A;  1JBA A;  1ALW A;  1XFV O;  2JTZ A;  1T14 A;  5I2Q A;  2JPO A;  4AOM A;  4FQO A;  3BUX B;  4NDC A;  1CDL A;  1BJF A;  3LLE A;  3C1V A;  3O4X A;  1B1G A;  1BR1 B;  2WC5 A;  4GAO A;  4C0J A;  3FE8 A;  2ZFD A;  1A75 A;  3TDZ A;  2M1U A;  1A4P A;  1JFJ A;  5DKR A;  2Y1N A;  5TNC A;  1GGZ A;  1Y1U A;  3D75 A;  2OPO A;  3MSE B;  4GBA A;  4JKT A;  4R1E A;  2PVB A;  4ZCU A;  5B8I B;  1FF1 A;  4AQI A;  4YGB B;  2I94 A;  5CPV A;  5JOL A;  1OOG A;  2L0P A;  2LC5 A;  2MHH A;  3OP0 A;  1QLS A;  2NCO A;  4MLW A;  2BAP A;  1ZAC A;  1Q80 A;  4JQ0 D;  2F2P A;  1LS8 A;  1NPQ A;  3VRQ A;  1TN4 A;  4JWQ A;  1QVI Z;  2KDH A;  3BJH A;  3EK4 A;  4YGE B;  3SJS A;  1UHJ A;  1M39 A;  2KBM A;  1TUZ A;  1YTZ C;  1JUO A;  2PSR A;  1UHI A;  2BCB A;  1BT6 A;  1KFU S;  2JTT A;  1OOH A;  1QLK A;  3PLF B;  4UPG A;  1WDC B;  3FS7 A;  5AXI A;  3CYZ A;  1IIO A;  2KHN A;  2YGU A;  1H8B A;  2BKH B;  5KU1 A;  1F70 A;  2ZN8 A;  4HRE E;  3VB1 A;  3D77 A;  4CLN A;  3WHU B;  1XO5 A;  2LLU A;  1PSB A;  3B87 A;  3LK0 A;  2GV5 A;  2LMU A;  1WRZ A;  2CTN A;  3CZ0 A;  3OX5 A;  1CLM A;  1XFY O;  2EHB A;  4MRY A;  2WOR A;  3S0G A;  3SG4 A;  2HQW A;  1NWD A;  3ICB A;  3KPX A;  4M2P A;  2Y1M A;  2ZND A;  3O6B A;  4MN0 A;  1SPY A;  2M0R A;  2P6B B;  1OMD A;  2IS9 A;  3TDU A;  3A4U B;  3EK8 A;  3CR5 X;  1QXP A;  1WRL A;  2O5G A;  4CID A;  1NP8 A;  1NX2 A;  1XA5 A;  2LLS A;  4BY4 A;  1S3P A;  3L4A A;  2WND A;  5HL1 A;  1L7Z A;  3GK1 A;  1F4O A;  3KEV A;  2LP3 A;  1K93 D;  1NX1 A;  1UHN A;  4QJ4 B;  4ORC B;  1SW8 A;  3BYA A;  2LVI A;  1KK8 B;  1BLQ A;  1DJZ A;  2CXJ A;  2LM5 A;  3NXA A;  5HKY A;  2LLT A;  3NGV A;  5DKN A;  2ISD A;  2KAV A;  4C0L A;  4WQ2 A;  3FWC A;  2KBI A;  5CSF A;  2MLE C;  3PAT A;  4F7F A;  2PAL A;  5DKQ A;  2EC6 B;  1XK4 C;  1K94 A;  1SCM C;  4OKH A;  4I5L B;  1PAL A;  2KFH A;  1J7O A;  1B9A A;  3RM1 A;  3SG3 A;  1OQP A;  2LE9 B;  1UHH A;  3AAK A;  2BL0 B;  3D10 A;  3I5I B;  3FWB A;  1QV0 A;  3PSR A;  2K7C A;  1LVC D;  1ORG A;  2L98 A;  3B88 A;  4CFR A;  1NUB A;  2L5Y A;  1SL7 A;  3JTD B;  3NSL A;  1UHK A;  2LCP A;  1EG4 A;  2QEH A;  2I18 A;  1DF0 B;  4ETO A;  1IQ5 A;  1HT9 A;  2JC2 A;  4A4B A;  4DS7 A;  1XFW O;  1F71 A;  1WLZ A;  1BOD A;  1DF0 A;  3EKJ A;  2PQL A;  3BUO B;  1KQM C;  3DY9 A;  2L4H A;  4PE1 A;  3DVK A;  2HQ8 A;  3OX6 A;  1G8I A; 
#chains in the Genus database with same CATH homology
 4INX A;  2P71 A;  1QWV A;  3S0E A;  3V2L A;  3CZ1 A;  3S0F A;  3FE9 A;  5EL2 A;  1TWO A;  1T14 A;  2JPO A;  2WCH A;  3D73 A;  2WC5 A;  1OOI X;  3FE8 A;  2KPH A;  3CAB A;  3D75 A;  2WCM A;  3CZ2 A;  3B86 A;  3R72 A;  1OOG A;  2H8V A;  2L2C A;  2QEV A;  3DXL A;  3QME A;  4OZD A;  1GM0 A;  1LS8 A;  2QEO A;  3BJH A;  3R1V A;  1C3Y A;  3D76 A;  1OOH A;  1XFR A;  2GTE A;  3CYZ A;  1OW4 A;  3L4L A;  3VB1 A;  2WCK A;  3D77 A;  3FE6 A;  3S0B A;  3B87 A;  4JD9 A;  3CZ0 A;  3DYE A;  3D74 A;  3D78 A;  3R1P A;  3S0G A;  3R1O A;  1DQE A;  3K1E A;  3OGN A;  3L47 A;  2WCL A;  1P28 A;  4INW A;  1OOF A;  3L4A A;  2P70 A;  3S0D A;  3B6X A;  2FJY A;  2WCJ A;  1C3Z A;  2ERB A;  2QEB A;  3NHI A;  3NGV A;  5DIC A;  3CDN A;  4FQT A;  4F7F A;  3BFH A;  4PT1 A;  3DZT A;  3PJI A;  3B88 A;  1ORG A;  3N7H A;  2QEH A;  1TUJ A;  3BFA A;  3BFB A;  3S0A A;  2WC6 A;  2QDI A;  2PQL A;  3Q8I A;  3DY9 A;  3RZS A;  3NHT A;  3B7A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...