1H8BA

Ef-hands 3,4 from alpha-actinin / z-repeat 7 from titin
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
73
structure length
73
Chain Sequence
MADTDTAEQVIASFRILASDKPYILAEELRRELPPDQAQYCIKRMPAYSGPGSVPGALDYAAFSSALYGESDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein
molecule keywords ALPHA-ACTININ 2, SKELETAL MUSCLE ISOFORM
publication title Ca2+-Independent Binding of an EF-Hand Domain to a Novel Motif in the Alpha-Actinin-Titin Complex
pubmed doi rcsb
source organism Homo sapiens
total genus 13
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2001-02-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08726 EFhand_Ca_insen Ca2+ insensitive EF hand
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1h8bA00
2JT0A 4N1FA 2JC2A 1EXRA 1BU3A 4CLNA 3TS5C 3M0WA 2TN4A 1CFFA 3SG6A 1UHHA 2BBNA 2WNDA 2MLFC 4CFRA 1TCOB 2K2AA 2KI4B 2SCPA 3AKAA 1F55A 1F4QA 3EVRA 3CR5X 2P6BB 2AAOA 2AUCA 1NCZA 4PHMA 1OE9B 1F8HA 1YRUB 2BECA 2M7LA 1KCYA 1CM1A 1J1EA 2KI6D 3CGAA 1AHRA 2KBMA 4ORBB 3WNXB 4UPGA 3MSEB 2KGRA 1C07A 2NXQA 4YGCB 1DJHA 4PE4A 5IBWA 3DD4A 1WDCB 1S26D 1BG1A 3BXKA 1A03A 2F2PA 4GPLB 3I5GB 3DF0B 4MBEA 1F71A 4QJ3B 3D0YB 1PK0D 3DF0A 1FBVA 3FIAA 4USLA 4OR9B 2CXJA 3D0YA 5CSJA 1WRLA 1QVIY 3IF7A 2JZIA 3BYAA 1TNQA 1KK7Z 2A4JA 2MJWB 3EK8A 1JF2A 2BCBA 2LVKA 2M9GA 3CZTX 3O6BA 4MZLA 4F0ZB 4XJKA 5FYXA 1SR6C 1A2XA 1SCMC 4BY4A 1NCXA 3I5FC 3PATA 5HKZA 1M46A 1RWYA 2NCPA 1M63B 2F2OA 3EKJA 1JF0A 2LP2A 3TS5B 2LVVA 1EL4A 2E6WA 2F33A 1OMDA 2M1UA 2GV5A 3QRXA 1QIWA 1M31A 4ZCUA 3SG3A 2PSRA 2HQWA 4MSPA 1CDMA 3OX5A 3VROA 2CT9A 4FQOA 1B47A 1WLMA 3CR4X 1IWQA 2L0PA 1DT7B 2KI6C 2BL0C 2DOQA 1EH2A 1S36A 1FF1A 1JFJA 3KPXA 1AK8A 2F3YA 2KAVA 4QJ5B 1QV1A 3SIAA 1XFUO 1M45A 2Q4UA 3NSKA 1WRKA 4ORCB 3BUOB 1LKJA 1YX8A 5CPVA 4QJ4B 1DJWA 1SRAA 4Q04A 2KFFA 1R6PA 2BCAA 4I5LB 4ZCVA 1BF5A 1SCVA 2WCEA 1FW4A 1CFCA 5JOLA 1PVAA 3CLNA 2O5GA 4WRIA 1WY9A 4GGFC 1PSRA 3WHUB 3K21A 1YR5A 2OPOA 3RM1A 2LVJA 2PASA 4AOMA 1GGWA 4R1EA 4ICBA 1JC2A 1BR1B 2AMIA 2FCDA 2L5XB 1DJYA 1TN4A 3GK4X 5J3XA 1QLSA 1AJ5A 2MAZA 1OZOA 1KQMB 2HETA 2PALA 5G08A 1QX7A 2K0JA 2L50A 3KO0A 1L2OC 1Y1UA 1V1FA 1SR6B 1AVSA 1D1OA 4I5JA 1B9AA 1PALA 1SCMB 3VRNA 3LK0A 3I5FB 4C0KA 4I5NB 2K7CA 3DVMA 1NX0A 1HT9A 2L51A 1B7TY 3PM8A 1GQMA 3H4SE 2Y1MA 1AUIB 2CNPA 2Y4QA 3O78A 1ZUZA 1GJYA 1BJFA 1J1DA 2LVIA 5ER4X 5HLOA 1DMOA 2Q91A 3NSLA 3EK7A 3O4YA 1CM4A 2LC5A 1RJVA 1SMGA 2BL0B 3BUXB 2JULA 2ZRTA 1XK4C 2IS9A 3PLFB 4NQGA 3TUYC 1YVLA 1JWDA 1TNPA 2KBIA 1S5GY 3EVUA 3CWGA 4PE1A 1BODA 2HQ8A 3I5HC 1OQPA 3OHMB 2ZKMX 2KYCA 1IGVA 3TDIA 5HYDA 1J7OA 1XFXO 2EGDA 1XA5A 2FOTA 1JSAA 5CSIA 1PVBA 1G33A 2LAPA 1EG4A 1UHKA 2JOJA 1RROA 2KFGA 1Y1XA 3LCPC 2LMVA 3OB2B 4OVNF 4WQ2A 5GQQC 4M2QA 1FPWA 1Y0VH 4GGFA 2H61C 2LLSA 4PALA 4ORAB 1SK6D 2KFHA 2K2FA 2JXLA 4DUQA 1NIWA 1UUSA 4N1GA 5KSZA 1BOCA 1L2OB 4NDDA 3RLZA 1DTLA 1HQVA 1B4CA 1CLLA 2B1UA 2ZN9A 2BE4A 2JTZA 1OMRA 2M49B 4MRXA 1KQMC 1MXEA 2M29A 1DGVA 1F54A 2KQYA 5I2LA 2JTTA 2LE9B 4CFQA 2JPTA 3VGOA 1K95A 2JRFA 1NSHA 4NDCA 1QS7A 2CTNA 3JTDC 5HLVA 5F6TA 4GAOA 1J7PA 3DVJA 1JBAA 1BR4B 4HSZA 2BCXA 3LLEA 4YGEB 1YUUA 4PE0A 1C7WA 1BT6A 1CDPA 1RTP1 1F70A 1LA0A 3ZWHA 1BLQA 2I7AA 3D10A 3BOWB 2Y1NA 2I2RE 1DJGA 1CLMA 1ZACA 2PRUA 1XK4A 3BOWA 3TUYB 1CKKA 4C0LA 1FI5A 1C7VA 2JWWA 2ZNDA 3I5HB 3OX6A 3JVTB 3NSOA 3E3RA 1KFXL 4CPVA 1A29A 2M3WA 3LK1A 2WOSA 3DVKA 1LA3A 2EHBA 1NX2A 4YI8A 1X02A 1WLZA 2WORA 1EJ3A 2QPTA 2LCPA 2I94A 2HF5A 3PALA 1Q80A 5ER5A 1VRKA 5CSNA 1QATA 2ZFDA 4M2OA 1YX7A 3PFVA 1WRZA 3VRPA 3I5IC 4BY5A 3LL8B 1S6IA 2H61A 2K7DA 1CMFA 1G8IA 1LINA 2H2KA 1KFUS 1CB1A 1YUSA 2R2IA 4GUKA 1A75B 2BKIB 2K8MB 2WCBA 4OV2A 2LMTA 5HKYA 1A75A 2EC6C 2O60A 1FI6A 2E30A 2OS8C 2ZNEA 2LANA 4YGAA 2LLUA 3C1VA 4YRUA 3AKBA 1SNLA 1UURA 1ZFSA 4OKHA 4HRGA 4PHKA 5TNCA 1S6JA 2F8PA 1KK7Y 2BE6A 1ALWA 3NXAA 1DGUA 2OTGC 3JTDB 4D1EA 4PE7A 3SG5A 1B8CA 4YGDB 5B8IB 1CMGA 2LHLA 1MF8B 2JNFA 2M7NA 4CIDA 4OCIA 3BUMB 3BUWB 4L9MA 1YTZC 1XO5A 4HREE 2CCMA 1K93D 2L4HA 4PHJA 4YI9A 5PALA 5I2QA 2M8UA 1MQ1A 5CSFA 2LHIA 1DVIA 3IQQA 1KWOC 1PRWA 2KDHA 1K9PA 1TIZA 1QVIZ 1XFWO 4JQ0D 1MHOA 1MXLC 2PMYA 1QLKA 4ETOA 1IKUA 1NUBA 1TNXA 2JT8A 3GK1A 1W7IB 5AEQA 1ALVA 1L7ZA 4U8DA 2LMUA 4E68A 2G2BA 2V53A 1DF0B 3JVTC 1EG3A 2D8NA 4TNCA 1SKTA 1DF0A 1YVHA 3TDZA 1QV0A 1UHIA 3TZ1A 1SL8A 1KK8B 1XFZO 1M39A 1KSOA 3GOFA 5K89A 3KHEA 3I5IB 4M2PA 1DJIA 2FJUB 1ZMZA 3TDUA 4WQ3A 4MN0A 1UHNA 4PDZA 2KGBC 3KF9A 5I8NA 1SL9A 5JJGA 1MUXA 1SY9A 1IH0A 1TCFA 1F4OA 4A4BA 2K7OA 2EC6B 3KEVA 1W7JB 2MBXA 2PVBA 2OS8B 1IJ5A 1XVJA 3A4UB 4MZJA 4N5XA 3VRQA 1TRFA 1QXPA 4GGNA 1K2HA 3O2PA 1K9KA 1OOJA 2KOTA 3AAKA 1S1EA 1QJTA 1SW8A 4FTGA 1MR8A 3SG4A 2KAXA 1E8AA 5AERA 2LUCA 1NYAA 3EK4A 1IG5A 2OTGB 2BBMA 1NP8A 2VRGA 2LP3A 5D69A 3OB1B 1OZSA 2HPSA 1NX1A 1J7QA 3PN7C 1IQ3A 1AP4A 1MWNA 3SIBA 1JFKA 1LVCD 2M0RA 4MLWA 2K61A 1Y1AA 2NZ0A 1YRTB 1V1GA 3EVVA 4PCWA 3SJSA 1KWOB 3SG2A 1XYDA 2JQ6A 1B1GA 3PSRA 1LXFC 2JT3A 1CLBA 1QX5B 2I18A 2NCOA 1K94A 1UWOA 1SPYA 1BMOA 1N0YA 1KSMA 1U5IB 1N2DA 4MVFA 2MRDA 3FWCA 1U5IA 2WCFA 1RK9A 1XFYO 3DVEA 4XJKB 1ODBA 1SBJA 3ZNIA 5HKWA 1TTXA 3ICBA 1R2UA 2QACA 5BPJA 2LV7A 1QX2A 1S6CA 2L4IA 4JWQA 1KFUL 2KSPA 4DS7A 2JU0A 5AANA 1B7TZ 1OMVA 2MA2A 5AFPA 1QTXA 2M97A 5DKRA 3BQ3A 4P2YB 1GGZA 4MZKA 3FWBA 1KK8C 5DKQA 2L2EA 2LM5A 3A8RA 3OP0A 3F45A 4MRYA 1IJ6A 1UHJA 1NCYA 1PULA 1N65A 4GBAA 2RGIA 1CDNA 2NLNA 2JNXA 5KTYA 1K9UA 2KNEA 4YBHB 1OSAA 1RFJA 2LLTA 1NPQA 1S5GZ 4DRWA 2KI4C 3HCMA 4DIRA 1J55A 2KQ6A 2MLEC 3HX4A 1H8BA 3IQOA 4JPZB 2JXCA 1AJ4A 3EKHA 4YGBB 1YURA 2L98A 1JUOA 2ZRSA 3CTNA 2KYFA 2K7BA 1KQVA 1TNWA 1ZOTB 1CDLA 3PN7B 4AQJA 1SL7A 2F3ZA 1Y6WA 5DKNA 1KFXS 5AXIA 3VRRA 1NX3A 2GGZA 1G4YR 2ZN8A 3FS7A 1A4PA 1IQ5A 3WHTB 4A4CA 2SASA 1SYMA 4P5OE 1J7RA 4IL1A 1B8RA 3CS1A 1NWDA 2BKHB 2G9BA 2Y5IA 4XYNA 5KU1A 1B8LA 4DCKA 3BUNB 3WXAA 1UP5A 5D7FA 1WDCC 2M1KB 1H4BA 4NDBA 1TOPA 4I5KA 2GGMA 1IRJA 2LUXA 3I5GC 1RECA 1QIVA 1DJXA 2CBLA 1S3PA 2LNKA 2COLB 4C0JA 4GFTA 3CR2A 3GK2A 3AAJA 4GNKB 2ISDA 4PHNA 2WC8A 2FCEA 1CFDA 1QASA 1XFVO 5I2OA 1K8UA 1K90D 4MEWA 3SG7A 3NSIA 2KHNA 1CNPA 2MHHA 2KAYA 1DJZA 1PSBA 4HRHA 4AQIA 1K96A 1YUTA 1CFPA 1CTRA
chains in the Genus database with same CATH superfamily
2JT0A 4N1FA 2JC2A 3D73A 1EXRA 1BU3A 3QMEA 4CLNA 3TS5C 3M0WA 2TN4A 1CFFA 3SG6A 1UHHA 2BBNA 2WNDA 2MLFC 4CFRA 1IIOA 1TCOB 2K2AA 2KI4B 1GM0A 2SCPA 3AKAA 1F55A 1F4QA 3EVRA 3CR5X 2P6BB 2AAOA 2AUCA 1NCZA 2K60A 4PHMA 1OE9B 1F8HA 1YRUB 2BECA 2M7LA 1KCYA 1CM1A 1J1EA 2KI6D 3CGAA 1AHRA 2KBMA 4ORBB 3WNXB 4UPGA 3MSEB 2KGRA 1C07A 2NXQA 4YGCB 1DJHA 4PE4A 5IBWA 3DD4A 3R1OA 1WDCB 1S26D 1BG1A 3BXKA 1A03A 2F2PA 4GPLB 3I5GB 3DF0B 4MBEA 1F71A 4QJ3B 3D0YB 1PK0D 3DF0A 1FBVA 3FIAA 3UNWA 4USLA 4OR9B 2CXJA 4OZDA 3D0YA 5CSJA 1WRLA 1QVIY 3IF7A 2JZIA 3BYAA 3D75A 5HL1A 1TNQA 1KK7Z 2A4JA 2MJWB 3EK8A 1JF2A 2BCBA 2LVKA 2M9GA 3CZTX 3O6BA 1SSEB 4MZLA 4F0ZB 4XJKA 5FYXA 1SR6C 1DC1A 1A2XA 3V2LA 1SCMC 4BY4A 1NCXA 3I5FC 3PATA 5HKZA 1M46A 1RWYA 2NCPA 1M63B 5FI6A 2F2OA 3EKJA 1JF0A 2LP2A 3TS5B 2LVVA 1EL4A 2E6WA 1ORGA 1OMDA 2F33A 2M1UA 2QEVA 2GV5A 3QRXA 1QIWA 1M31A 4ZCUA 3SG3A 2PSRA 2HQWA 4MSPA 1CDMA 3OX5A 3VROA 2CT9A 4FQOA 1B47A 1WLMA 3CR4X 1IWQA 2L0PA 1DT7B 2KI6C 2BL0C 2DOQA 2WCLA 1EH2A 1S36A 1FF1A 1JFJA 2KLDA 3KPXA 1AK8A 3BFAA 2F3YA 2P71A 3Q8IA 2KAVA 4QJ5B 1C3ZA 1QV1A 2KPHA 3UO9A 3SIAA 2YGUA 1XFUO 1M45A 2Q4UA 3NSKA 4PT1A 1WRKA 4ORCB 3BUOB 1LKJA 1YX8A 3DY9A 5CPVA 4QJ4B 1DJWA 1SRAA 3FE6A 4Q04A 1C3YA 2KFFA 1DELA 1R6PA 2BCAA 4I5LB 3DYEA 4ZCVA 1SCVA 2WCEA 1BF5A 1FW4A 1CFCA 1OOHA 5JOLA 1PVAA 3CLNA 2O5GA 4WRIA 1WY9A 4GGFC 1PSRA 3WHUB 3K21A 1YR5A 2OPOA 3RM1A 2LVJA 2PASA 4AOMA 1GGWA 2ERBA 4R1EA 4ICBA 1JC2A 1BR1B 2AMIA 2FCDA 2L5XB 1DJYA 1TN4A 3GK4X 5J3XA 1QLSA 1AJ5A 2MAZA 3BJHA 3B87A 3NHTA 1OZOA 1KQMB 2HETA 2PALA 5G08A 1QX7A 2K0JA 4JKTA 3S0GA 2L50A 3KO0A 1L2OC 1Y1UA 1V1FA 1SR6B 1AVSA 1D1OA 4I5JA 1B9AA 1PALA 1SCMB 3VRNA 3LK0A 3I5FB 4C0KA 4I5NB 1OOGA 2K7CA 3DVMA 1NX0A 3RZSA 3BFBA 1HT9A 2L51A 3BFHA 1B7TY 3PM8A 1GQMA 3H4SE 2Y1MA 3CDNA 1AUIB 2CNPA 2Y4QA 3O78A 1ZUZA 1GJYA 1BJFA 1J1DA 2LVIA 5ER4X 5HLOA 1DMOA 2Q91A 3NSLA 3EK7A 3O4YA 1CM4A 2LC5A 1RJVA 3N7HA 1SMGA 2BL0B 3BUXB 2JULA 2ZRTA 1XK4C 2IS9A 3PLFB 4NQGA 3TUYC 1YVLA 1JWDA 1TNPA 2KBIA 1S5GY 3EVUA 3CWGA 4PE1A 5DICA 1BODA 2HQ8A 3I5HC 1OQPA 3OHMB 2ZKMX 2KYCA 1IGVA 1DEKA 3TDIA 5HYDA 1J7OA 1XFXO 3S0EA 2EGDA 1XA5A 2FOTA 1JSAA 5CSIA 1PVBA 1G33A 2LAPA 1EG4A 1UHKA 2JOJA 1RROA 2KFGA 1Y1XA 3LCPC 2LMVA 2JPOA 3OB2B 2P70A 4OVNF 4WQ2A 5GQQC 3DZTA 4M2QA 1FPWA 1Y0VH 4GGFA 2H61C 2LLSA 1QWVA 4PALA 4ORAB 1SK6D 2KFHA 3CZ0A 3IVTA 2K2FA 2JXLA 4DUQA 3NHIA 1NIWA 1UUSA 4N1GA 5KSZA 1BOCA 1L2OB 4NDDA 3NGVA 3RLZA 1DTLA 1HQVA 3PJIA 1W9ZA 1B4CA 1CLLA 2B1UA 2ZN9A 2BE4A 3L47A 2JTZA 1OMRA 2M49B 4MRXA 1KQMC 1MXEA 3R1PA 2M29A 1DGVA 1F54A 2KQYA 5I2LA 2JTTA 2LE9B 4CFQA 2JPTA 3VGOA 1K95A 2JRFA 1NSHA 4NDCA 1QS7A 2CTNA 3JTDC 5HLVA 5F6TA 4GAOA 1J7PA 3DVJA 2FJYA 1JBAA 1BR4B 1DQEA 4HSZA 2BCXA 3LLEA 4YGEB 1YUUA 2GTEA 2QEHA 1C7WA 4PE0A 1BT6A 1T14A 1CDPA 1RTP1 1F70A 1LA0A 3ZWHA 1BLQA 2I7AA 3D10A 3BOWB 3D78A 2Y1NA 2I2RE 1DJGA 1CLMA 1ZACA 2PRUA 1XK4A 3BOWA 3OGNA 3TUYB 1CKKA 4C0LA 1FI5A 1C7VA 5FI2A 2JWWA 2ZNDA 3I5HB 1OOIX 3JVTB 3OX6A 3NSOA 3E3RA 1KFXL 3L4LA 4CPVA 1A29A 2M3WA 3LK1A 2WOSA 3DVKA 1LA3A 2EHBA 1NX2A 1Z2CB 4YI8A 1X02A 1WLZA 2WORA 1EJ3A 2QPTA 2LCPA 2I94A 2HF5A 1Z4HA 1Q80A 2WCHA 3PALA 5ER5A 1VRKA 2L5YA 5CSNA 1QATA 2ZFDA 4M2OA 1YX7A 3PFVA 1WRZA 2PYQA 3VRPA 3I5IC 4BY5A 3LL8B 1S6IA 2H61A 2K7DA 1CMFA 1G8IA 1LINA 2H2KA 1KFUS 1CB1A 1YUSA 2R2IA 4GUKA 1A75B 2BKIB 2K8MB 2L2CA 2WCBA 4OV2A 4JD9A 3L4AA 1TWOA 2LMTA 5HKYA 1A75A 2EC6C 2O60A 1FI6A 3CABA 2E30A 3K1EA 2OS8C 2ZNEA 2LANA 4YGAA 2LLUA 3C1VA 4YRUA 3AKBA 1SNLA 1OOFA 3S0BA 1UURA 1ZFSA 4OKHA 4HRGA 4PHKA 5TNCA 1S6JA 2F8PA 1KK7Y 2BE6A 1ALWA 3NXAA 1DGUA 1LS8A 2OTGC 3JTDB 3OBVA 4D1EA 4PE7A 5I94A 2QEBA 3SG5A 1B8CA 4YGDB 5B8IB 1CMGA 2LHLA 1MF8B 2JNFA 2M7NA 4CIDA 4OCIA 3BUMB 3BUWB 4L9MA 1YTZC 1XO5A 4HREE 2CCMA 2BAPA 1K93D 2L4HA 4PHJA 4YI9A 5PALA 5I2QA 3CZ2A 2M8UA 1MQ1A 5CSFA 2LHIA 1DVIA 3IQQA 2WC6A 1KWOC 1PRWA 2KDHA 1K9PA 1TIZA 1QVIZ 1XFWO 2WC5A 4JQ0D 1MHOA 1MXLC 2PMYA 1QLKA 4ETOA 1IKUA 1NUBA 1TNXA 2JT8A 3GK1A 1W7IB 5AEQA 1ALVA 4IJ7A 1L7ZA 4U8DA 2LMUA 3O4XA 4E68A 2G2BA 2V53A 1DF0B 3JVTC 1EG3A 2D8NA 4TNCA 1SKTA 1DF0A 1YVHA 3TDZA 1QV0A 1UHIA 3TZ1A 1SL8A 1KK8B 1XFZO 1M39A 1KSOA 3GOFA 5K89A 3KHEA 3I5IB 4M2PA 1DJIA 2FJUB 1ZMZA 3TDUA 4WQ3A 4MN0A 1UHNA 4PDZA 2KGBC 3KF9A 5I8NA 3S0AA 1SL9A 3B7AA 5JJGA 1MUXA 1SY9A 1IH0A 1TCFA 1F4OA 3D76A 2WCKA 2K7OA 4A4BA 3S0FA 2EC6B 3KEVA 1W7JB 2MBXA 2PVBA 2OS8B 1IJ5A 1XVJA 3A4UB 4MZJA 4N5XA 3VRQA 1TRFA 1QXPA 4GGNA 1K2HA 3O2PA 1K9KA 1OOJA 2KOTA 3AAKA 1S1EA 3S0DA 1QJTA 1SW8A 4FTGA 1MR8A 3SG4A 2KAXA 1E8AA 5AERA 2LUCA 4KYNA 1NYAA 3EK4A 1IG5A 2OTGB 2BBMA 1NP8A 2VRGA 2LP3A 5D69A 3OB1B 1OZSA 2HPSA 1NX1A 3B86A 1J7QA 3PN7C 5EL2A 1IQ3A 1AP4A 5D3OA 1MWNA 3SIBA 1JFKA 1LVCD 2M0RA 4MLWA 2K61A 2WCJA 1OW4A 1Y1AA 2NZ0A 1YRTB 1V1GA 3EVVA 4PCWA 3SJSA 1KWOB 3SG2A 1XYDA 2JQ6A 1B1GA 3PSRA 1LXFC 2JT3A 1CLBA 1QX5B 2I18A 2NCOA 1K94A 1UWOA 1SPYA 3PM2A 1BMOA 1N0YA 1KSMA 1U5IB 1N2DA 4INXA 2MRDA 4MVFA 3FWCA 3FE8A 3SS4A 1U5IA 2WCFA 1RK9A 1XFYO 3DVEA 4XJKB 1ODBA 4F7FA 1SBJA 3ZNIA 5HKWA 1TTXA 3ICBA 1R2UA 2QACA 5BPJA 2LV7A 1QX2A 1S6CA 2L4IA 4JWQA 1KFUL 2KSPA 2WCMA 2JU0A 5AANA 4DS7A 1B7TZ 1OMVA 2MA2A 5AFPA 1QTXA 2M97A 5DKRA 3BQ3A 4P2YB 1GGZA 5FI7A 4MZKA 3FWBA 1KK8C 5DKQA 2L2EA 2LM5A 3A8RA 3CYZA 3OP0A 3F45A 4MRYA 1IJ6A 1UHJA 1NCYA 1P28A 1PULA 1N65A 4GBAA 2H8VA 2RGIA 1CDNA 2NLNA 2JNXA 5KTYA 1K9UA 2KNEA 4YBHB 1OSAA 1RFJA 3R1VA 2LLTA 1NPQA 1S5GZ 4DRWA 2KI4C 3HCMA 4DIRA 1J55A 2KQ6A 2MLEC 2BNXA 3R72A 3HX4A 1H8BA 3IQOA 4FQTA 4JPZB 2JXCA 1AJ4A 3EKHA 4YGBB 1YURA 2L98A 1JUOA 2QEOA 2ZRSA 3CTNA 2KYFA 2K7BA 2QDIA 1KQVA 1TNWA 1ZOTB 1CDLA 3FE9A 3PN7B 3VB1A 4AQJA 1SL7A 2F3ZA 1Y6WA 3EG5B 4INWA 1KFXS 5DKNA 5AXIA 3VRRA 1TUZA 1NX3A 2GGZA 1G4YR 2ZN8A 3FS7A 1A4PA 1IQ5A 3WHTB 4A4CA 2SASA 1SYMA 4P5OE 1J7RA 4IL1A 1B8RA 3CS1A 1NWDA 2BKHB 2G9BA 2Y5IA 4XYNA 5KU1A 1B8LA 4DCKA 3BUNB 3D77A 2PQLA 1UP5A 3WXAA 5D7FA 1WDCC 3CZ1A 2KLEA 2M1KB 3D74A 4NDBA 1TOPA 4I5KA 1H4BA 2GGMA 1IRJA 2LUXA 3I5GC 3SS3A 1RECA 1QIVA 1DJXA 2CBLA 1S3PA 2LNKA 2COLB 4C0JA 4GFTA 3CR2A 3GK2A 1TUJA 3AAJA 4GNKB 2ISDA 3B88A 4PHNA 2WC8A 2FCEA 3B6XA 3SS5A 1CFDA 1QASA 1XFVO 5I2OA 1K8UA 3DXLA 1K90D 4MEWA 3SG7A 3NSIA 1XFRA 2KHNA 1CNPA 2MHHA 2KAYA 1DJZA 1PSBA 4HRHA 4AQIA 1K96A 1YUTA 1CFPA 1CTRA
chains in the Genus database with same CATH topology
2JT0A 4N1FA 2JC2A 1EXRA 1BU3A 4CLNA 3TS5C 3M0WA 2TN4A 1CFFA 3SG6A 1UHHA 2BBNA 2WNDA 2MLFC 4CFRA 1TCOB 2K2AA 2KI4B 2SCPA 3AKAA 1F55A 1F4QA 3EVRA 3CR5X 2P6BB 2AAOA 2AUCA 1NCZA 4PHMA 1OE9B 1F8HA 1YRUB 2BECA 2M7LA 1KCYA 1CM1A 1J1EA 2KI6D 3CGAA 1AHRA 2KBMA 4ORBB 3WNXB 4UPGA 3MSEB 2KGRA 1C07A 2NXQA 4YGCB 1DJHA 4PE4A 5IBWA 3DD4A 1WDCB 1S26D 1BG1A 3BXKA 1A03A 2F2PA 4GPLB 3I5GB 3DF0B 4MBEA 1F71A 4QJ3B 3D0YB 1PK0D 3DF0A 1FBVA 3FIAA 4USLA 4OR9B 2CXJA 3D0YA 5CSJA 1WRLA 1QVIY 3IF7A 2JZIA 3BYAA 1TNQA 1KK7Z 2A4JA 2MJWB 3EK8A 1JF2A 2BCBA 2LVKA 2M9GA 3CZTX 3O6BA 4MZLA 4F0ZB 4XJKA 5FYXA 1SR6C 1A2XA 1SCMC 4BY4A 1NCXA 3I5FC 3PATA 5HKZA 1M46A 1RWYA 2NCPA 1M63B 2F2OA 3EKJA 1JF0A 2LP2A 3TS5B 2LVVA 1EL4A 2E6WA 2F33A 1OMDA 2M1UA 2GV5A 3QRXA 1QIWA 1M31A 4ZCUA 3SG3A 2PSRA 2HQWA 4MSPA 1CDMA 3OX5A 3VROA 2CT9A 4FQOA 1B47A 1WLMA 3CR4X 1IWQA 2L0PA 1DT7B 2KI6C 2BL0C 2DOQA 1EH2A 1S36A 1FF1A 1JFJA 3KPXA 1AK8A 2F3YA 2KAVA 4QJ5B 1QV1A 3SIAA 1XFUO 1M45A 2Q4UA 3NSKA 1WRKA 4ORCB 3BUOB 1LKJA 1YX8A 5CPVA 4QJ4B 1DJWA 1SRAA 4Q04A 2KFFA 1R6PA 2BCAA 4I5LB 4ZCVA 1BF5A 1SCVA 2WCEA 1FW4A 1CFCA 5JOLA 1PVAA 3CLNA 2O5GA 4WRIA 1WY9A 4GGFC 1PSRA 3WHUB 3K21A 1YR5A 2OPOA 3RM1A 2LVJA 2PASA 4AOMA 1GGWA 4R1EA 4ICBA 1JC2A 1BR1B 2AMIA 2FCDA 2L5XB 1DJYA 1TN4A 3GK4X 5J3XA 1QLSA 1AJ5A 2MAZA 1OZOA 1KQMB 2HETA 2PALA 5G08A 1QX7A 2K0JA 2L50A 3KO0A 1L2OC 1Y1UA 1V1FA 1SR6B 1AVSA 1D1OA 4I5JA 1B9AA 1PALA 1SCMB 3VRNA 3LK0A 3I5FB 4C0KA 4I5NB 2K7CA 3DVMA 1NX0A 1HT9A 2L51A 1B7TY 3PM8A 1GQMA 3H4SE 2Y1MA 1AUIB 2CNPA 2Y4QA 3O78A 1ZUZA 1GJYA 1BJFA 1J1DA 2LVIA 5ER4X 5HLOA 1DMOA 2Q91A 3NSLA 3EK7A 3O4YA 1CM4A 2LC5A 1RJVA 1SMGA 2BL0B 3BUXB 2JULA 2ZRTA 1XK4C 2IS9A 3PLFB 4NQGA 3TUYC 1YVLA 1JWDA 1TNPA 2KBIA 1S5GY 3EVUA 3CWGA 4PE1A 1BODA 2HQ8A 3I5HC 1OQPA 3OHMB 2ZKMX 2KYCA 1IGVA 3TDIA 5HYDA 1J7OA 1XFXO 2EGDA 1XA5A 2FOTA 1JSAA 5CSIA 1PVBA 1G33A 2LAPA 1EG4A 1UHKA 2JOJA 1RROA 2KFGA 1Y1XA 3LCPC 2LMVA 3OB2B 4OVNF 4WQ2A 5GQQC 4M2QA 1FPWA 1Y0VH 4GGFA 2H61C 2LLSA 4PALA 4ORAB 1SK6D 2KFHA 2K2FA 2JXLA 4DUQA 1NIWA 1UUSA 4N1GA 5KSZA 1BOCA 1L2OB 4NDDA 3RLZA 1DTLA 1HQVA 1B4CA 1CLLA 2B1UA 2ZN9A 2BE4A 2JTZA 1OMRA 2M49B 4MRXA 1KQMC 1MXEA 2M29A 1DGVA 1F54A 2KQYA 5I2LA 2JTTA 2LE9B 4CFQA 2JPTA 3VGOA 1K95A 2JRFA 1NSHA 4NDCA 1QS7A 2CTNA 3JTDC 5HLVA 5F6TA 4GAOA 1J7PA 3DVJA 1JBAA 1BR4B 4HSZA 2BCXA 3LLEA 4YGEB 1YUUA 4PE0A 1C7WA 1BT6A 1CDPA 1RTP1 1F70A 1LA0A 3ZWHA 1BLQA 2I7AA 3D10A 3BOWB 2Y1NA 2I2RE 1DJGA 1CLMA 1ZACA 2PRUA 1XK4A 3BOWA 3TUYB 1CKKA 4C0LA 1FI5A 1C7VA 2JWWA 2ZNDA 3I5HB 3OX6A 3JVTB 3NSOA 3E3RA 1KFXL 4CPVA 1A29A 2M3WA 3LK1A 2WOSA 3DVKA 1LA3A 2EHBA 1NX2A 4YI8A 1X02A 1WLZA 2WORA 1EJ3A 2QPTA 2LCPA 2I94A 2HF5A 3PALA 1Q80A 5ER5A 1VRKA 5CSNA 1QATA 2ZFDA 4M2OA 1YX7A 3PFVA 1WRZA 3VRPA 3I5IC 4BY5A 3LL8B 1S6IA 2H61A 2K7DA 1CMFA 1G8IA 1LINA 2H2KA 1KFUS 1CB1A 1YUSA 2R2IA 4GUKA 1A75B 2BKIB 2K8MB 2WCBA 4OV2A 2LMTA 5HKYA 1A75A 2EC6C 2O60A 1FI6A 2E30A 2OS8C 2ZNEA 2LANA 4YGAA 2LLUA 3C1VA 4YRUA 3AKBA 1SNLA 1UURA 1ZFSA 4OKHA 4HRGA 4PHKA 5TNCA 1S6JA 2F8PA 1KK7Y 2BE6A 1ALWA 3NXAA 1DGUA 2OTGC 3JTDB 4D1EA 4PE7A 3SG5A 1B8CA 4YGDB 5B8IB 1CMGA 2LHLA 1MF8B 2JNFA 2M7NA 4CIDA 4OCIA 3BUMB 3BUWB 4L9MA 1YTZC 1XO5A 4HREE 2CCMA 1K93D 2L4HA 4PHJA 4YI9A 5PALA 5I2QA 2M8UA 1MQ1A 5CSFA 2LHIA 1DVIA 3IQQA 1KWOC 1PRWA 2KDHA 1K9PA 1TIZA 1QVIZ 1XFWO 4JQ0D 1MHOA 1MXLC 2PMYA 1QLKA 4ETOA 1IKUA 1NUBA 1TNXA 2JT8A 3GK1A 1W7IB 5AEQA 1ALVA 1L7ZA 4U8DA 2LMUA 4E68A 2G2BA 2V53A 1DF0B 3JVTC 1EG3A 2D8NA 4TNCA 1SKTA 1DF0A 1YVHA 3TDZA 1QV0A 1UHIA 3TZ1A 1SL8A 1KK8B 1XFZO 1M39A 1KSOA 3GOFA 5K89A 3KHEA 3I5IB 4M2PA 1DJIA 2FJUB 1ZMZA 3TDUA 4WQ3A 4MN0A 1UHNA 4PDZA 2KGBC 3KF9A 5I8NA 1SL9A 5JJGA 1MUXA 1SY9A 1IH0A 1TCFA 1F4OA 4A4BA 2K7OA 2EC6B 3KEVA 1W7JB 2MBXA 2PVBA 2OS8B 1IJ5A 1XVJA 3A4UB 4MZJA 4N5XA 3VRQA 1TRFA 1QXPA 4GGNA 1K2HA 3O2PA 1K9KA 1OOJA 2KOTA 3AAKA 1S1EA 1QJTA 1SW8A 4FTGA 1MR8A 3SG4A 2KAXA 1E8AA 5AERA 2LUCA 1NYAA 3EK4A 1IG5A 2OTGB 2BBMA 1NP8A 2VRGA 2LP3A 5D69A 3OB1B 1OZSA 2HPSA 1NX1A 1J7QA 3PN7C 1IQ3A 1AP4A 1MWNA 3SIBA 1JFKA 1LVCD 2M0RA 4MLWA 2K61A 1Y1AA 2NZ0A 1YRTB 1V1GA 3EVVA 4PCWA 3SJSA 1KWOB 3SG2A 1XYDA 2JQ6A 1B1GA 3PSRA 1LXFC 2JT3A 1CLBA 1QX5B 2I18A 2NCOA 1K94A 1UWOA 1SPYA 1BMOA 1N0YA 1KSMA 1U5IB 1N2DA 4MVFA 2MRDA 3FWCA 1U5IA 2WCFA 1RK9A 1XFYO 3DVEA 4XJKB 1ODBA 1SBJA 3ZNIA 5HKWA 1TTXA 3ICBA 1R2UA 2QACA 5BPJA 2LV7A 1QX2A 1S6CA 2L4IA 4JWQA 1KFUL 2KSPA 4DS7A 2JU0A 5AANA 1B7TZ 1OMVA 2MA2A 5AFPA 1QTXA 2M97A 5DKRA 3BQ3A 4P2YB 1GGZA 4MZKA 3FWBA 1KK8C 5DKQA 2L2EA 2LM5A 3A8RA 3OP0A 3F45A 4MRYA 1IJ6A 1UHJA 1NCYA 1PULA 1N65A 4GBAA 2RGIA 1CDNA 2NLNA 2JNXA 5KTYA 1K9UA 2KNEA 4YBHB 1OSAA 1RFJA 2LLTA 1NPQA 1S5GZ 4DRWA 2KI4C 3HCMA 4DIRA 1J55A 2KQ6A 2MLEC 3HX4A 1H8BA 3IQOA 4JPZB 2JXCA 1AJ4A 3EKHA 4YGBB 1YURA 2L98A 1JUOA 2ZRSA 3CTNA 2KYFA 2K7BA 1KQVA 1TNWA 1ZOTB 1CDLA 3PN7B 4AQJA 1SL7A 2F3ZA 1Y6WA 5DKNA 1KFXS 5AXIA 3VRRA 1NX3A 2GGZA 1G4YR 2ZN8A 3FS7A 1A4PA 1IQ5A 3WHTB 4A4CA 2SASA 1SYMA 4P5OE 1J7RA 4IL1A 1B8RA 3CS1A 1NWDA 2BKHB 2G9BA 2Y5IA 4XYNA 5KU1A 1B8LA 4DCKA 3BUNB 3WXAA 1UP5A 5D7FA 1WDCC 2M1KB 1H4BA 4NDBA 1TOPA 4I5KA 2GGMA 1IRJA 2LUXA 3I5GC 1RECA 1QIVA 1DJXA 2CBLA 1S3PA 2LNKA 2COLB 4C0JA 4GFTA 3CR2A 3GK2A 3AAJA 4GNKB 2ISDA 4PHNA 2WC8A 2FCEA 1CFDA 1QASA 1XFVO 5I2OA 1K8UA 1K90D 4MEWA 3SG7A 3NSIA 2KHNA 1CNPA 2MHHA 2KAYA 1DJZA 1PSBA 4HRHA 4AQIA 1K96A 1YUTA 1CFPA 1CTRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JT0 A;  4N1F A;  2JC2 A;  1EXR A;  1BU3 A;  4CLN A;  3TS5 C;  3M0W A;  2TN4 A;  1CFF A;  3SG6 A;  1UHH A;  2BBN A;  2WND A;  2MLF C;  4CFR A;  1TCO B;  2K2A A;  2KI4 B;  2SCP A;  3AKA A;  1F55 A;  1F4Q A;  3EVR A;  3CR5 X;  2P6B B;  2AAO A;  2AUC A;  1NCZ A;  4PHM A;  1OE9 B;  1F8H A;  1YRU B;  2BEC A;  2M7L A;  1KCY A;  1CM1 A;  1J1E A;  2KI6 D;  3CGA A;  1AHR A;  2KBM A;  4ORB B;  3WNX B;  4UPG A;  3MSE B;  2KGR A;  1C07 A;  2NXQ A;  4YGC B;  1DJH A;  4PE4 A;  5IBW A;  3DD4 A;  1WDC B;  1S26 D;  1BG1 A;  3BXK A;  1A03 A;  2F2P A;  4GPL B;  3I5G B;  3DF0 B;  4MBE A;  1F71 A;  4QJ3 B;  3D0Y B;  1PK0 D;  3DF0 A;  1FBV A;  3FIA A;  4USL A;  4OR9 B;  2CXJ A;  3D0Y A;  5CSJ A;  1WRL A;  1QVI Y;  3IF7 A;  2JZI A;  3BYA A;  1TNQ A;  1KK7 Z;  2A4J A;  2MJW B;  3EK8 A;  1JF2 A;  2BCB A;  2LVK A;  2M9G A;  3CZT X;  3O6B A;  4MZL A;  4F0Z B;  4XJK A;  5FYX A;  1SR6 C;  1A2X A;  1SCM C;  4BY4 A;  1NCX A;  3I5F C;  3PAT A;  5HKZ A;  1M46 A;  1RWY A;  2NCP A;  1M63 B;  2F2O A;  3EKJ A;  1JF0 A;  2LP2 A;  3TS5 B;  2LVV A;  1EL4 A;  2E6W A;  2F33 A;  1OMD A;  2M1U A;  2GV5 A;  3QRX A;  1QIW A;  1M31 A;  4ZCU A;  3SG3 A;  2PSR A;  2HQW A;  4MSP A;  1CDM A;  3OX5 A;  3VRO A;  2CT9 A;  4FQO A;  1B47 A;  1WLM A;  3CR4 X;  1IWQ A;  2L0P A;  1DT7 B;  2KI6 C;  2BL0 C;  2DOQ A;  1EH2 A;  1S36 A;  1FF1 A;  1JFJ A;  3KPX A;  1AK8 A;  2F3Y A;  2KAV A;  4QJ5 B;  1QV1 A;  3SIA A;  1XFU O;  1M45 A;  2Q4U A;  3NSK A;  1WRK A;  4ORC B;  3BUO B;  1LKJ A;  1YX8 A;  5CPV A;  4QJ4 B;  1DJW A;  1SRA A;  4Q04 A;  2KFF A;  1R6P A;  2BCA A;  4I5L B;  4ZCV A;  1BF5 A;  1SCV A;  2WCE A;  1FW4 A;  1CFC A;  5JOL A;  1PVA A;  3CLN A;  2O5G A;  4WRI A;  1WY9 A;  4GGF C;  1PSR A;  3WHU B;  3K21 A;  1YR5 A;  2OPO A;  3RM1 A;  2LVJ A;  2PAS A;  4AOM A;  1GGW A;  4R1E A;  4ICB A;  1JC2 A;  1BR1 B;  2AMI A;  2FCD A;  2L5X B;  1DJY A;  1TN4 A;  3GK4 X;  5J3X A;  1QLS A;  1AJ5 A;  2MAZ A;  1OZO A;  1KQM B;  2HET A;  2PAL A;  5G08 A;  1QX7 A;  2K0J A;  2L50 A;  3KO0 A;  1L2O C;  1Y1U A;  1V1F A;  1SR6 B;  1AVS A;  1D1O A;  4I5J A;  1B9A A;  1PAL A;  1SCM B;  3VRN A;  3LK0 A;  3I5F B;  4C0K A;  4I5N B;  2K7C A;  3DVM A;  1NX0 A;  1HT9 A;  2L51 A;  1B7T Y;  3PM8 A;  1GQM A;  3H4S E;  2Y1M A;  1AUI B;  2CNP A;  2Y4Q A;  3O78 A;  1ZUZ A;  1GJY A;  1BJF A;  1J1D A;  2LVI A;  5ER4 X;  5HLO A;  1DMO A;  2Q91 A;  3NSL A;  3EK7 A;  3O4Y A;  1CM4 A;  2LC5 A;  1RJV A;  1SMG A;  2BL0 B;  3BUX B;  2JUL A;  2ZRT A;  1XK4 C;  2IS9 A;  3PLF B;  4NQG A;  3TUY C;  1YVL A;  1JWD A;  1TNP A;  2KBI A;  1S5G Y;  3EVU A;  3CWG A;  4PE1 A;  1BOD A;  2HQ8 A;  3I5H C;  1OQP A;  3OHM B;  2ZKM X;  2KYC A;  1IGV A;  3TDI A;  5HYD A;  1J7O A;  1XFX O;  2EGD A;  1XA5 A;  2FOT A;  1JSA A;  5CSI A;  1PVB A;  1G33 A;  2LAP A;  1EG4 A;  1UHK A;  2JOJ A;  1RRO A;  2KFG A;  1Y1X A;  3LCP C;  2LMV A;  3OB2 B;  4OVN F;  4WQ2 A;  5GQQ C;  4M2Q A;  1FPW A;  1Y0V H;  4GGF A;  2H61 C;  2LLS A;  4PAL A;  4ORA B;  1SK6 D;  2KFH A;  2K2F A;  2JXL A;  4DUQ A;  1NIW A;  1UUS A;  4N1G A;  5KSZ A;  1BOC A;  1L2O B;  4NDD A;  3RLZ A;  1DTL A;  1HQV A;  1B4C A;  1CLL A;  2B1U A;  2ZN9 A;  2BE4 A;  2JTZ A;  1OMR A;  2M49 B;  4MRX A;  1KQM C;  1MXE A;  2M29 A;  1DGV A;  1F54 A;  2KQY A;  5I2L A;  2JTT A;  2LE9 B;  4CFQ A;  2JPT A;  3VGO A;  1K95 A;  2JRF A;  1NSH A;  4NDC A;  1QS7 A;  2CTN A;  3JTD C;  5HLV A;  5F6T A;  4GAO A;  1J7P A;  3DVJ A;  1JBA A;  1BR4 B;  4HSZ A;  2BCX A;  3LLE A;  4YGE B;  1YUU A;  4PE0 A;  1C7W A;  1BT6 A;  1CDP A;  1RTP 1;  1F70 A;  1LA0 A;  3ZWH A;  1BLQ A;  2I7A A;  3D10 A;  3BOW B;  2Y1N A;  2I2R E;  1DJG A;  1CLM A;  1ZAC A;  2PRU A;  1XK4 A;  3BOW A;  3TUY B;  1CKK A;  4C0L A;  1FI5 A;  1C7V A;  2JWW A;  2ZND A;  3I5H B;  3OX6 A;  3JVT B;  3NSO A;  3E3R A;  1KFX L;  4CPV A;  1A29 A;  2M3W A;  3LK1 A;  2WOS A;  3DVK A;  1LA3 A;  2EHB A;  1NX2 A;  4YI8 A;  1X02 A;  1WLZ A;  2WOR A;  1EJ3 A;  2QPT A;  2LCP A;  2I94 A;  2HF5 A;  3PAL A;  1Q80 A;  5ER5 A;  1VRK A;  5CSN A;  1QAT A;  2ZFD A;  4M2O A;  1YX7 A;  3PFV A;  1WRZ A;  3VRP A;  3I5I C;  4BY5 A;  3LL8 B;  1S6I A;  2H61 A;  2K7D A;  1CMF A;  1G8I A;  1LIN A;  2H2K A;  1KFU S;  1CB1 A;  1YUS A;  2R2I A;  4GUK A;  1A75 B;  2BKI B;  2K8M B;  2WCB A;  4OV2 A;  2LMT A;  5HKY A;  1A75 A;  2EC6 C;  2O60 A;  1FI6 A;  2E30 A;  2OS8 C;  2ZNE A;  2LAN A;  4YGA A;  2LLU A;  3C1V A;  4YRU A;  3AKB A;  1SNL A;  1UUR A;  1ZFS A;  4OKH A;  4HRG A;  4PHK A;  5TNC A;  1S6J A;  2F8P A;  1KK7 Y;  2BE6 A;  1ALW A;  3NXA A;  1DGU A;  2OTG C;  3JTD B;  4D1E A;  4PE7 A;  3SG5 A;  1B8C A;  4YGD B;  5B8I B;  1CMG A;  2LHL A;  1MF8 B;  2JNF A;  2M7N A;  4CID A;  4OCI A;  3BUM B;  3BUW B;  4L9M A;  1YTZ C;  1XO5 A;  4HRE E;  2CCM A;  1K93 D;  2L4H A;  4PHJ A;  4YI9 A;  5PAL A;  5I2Q A;  2M8U A;  1MQ1 A;  5CSF A;  2LHI A;  1DVI A;  3IQQ A;  1KWO C;  1PRW A;  2KDH A;  1K9P A;  1TIZ A;  1QVI Z;  1XFW O;  4JQ0 D;  1MHO A;  1MXL C;  2PMY A;  1QLK A;  4ETO A;  1IKU A;  1NUB A;  1TNX A;  2JT8 A;  3GK1 A;  1W7I B;  5AEQ A;  1ALV A;  1L7Z A;  4U8D A;  2LMU A;  4E68 A;  2G2B A;  2V53 A;  1DF0 B;  3JVT C;  1EG3 A;  2D8N A;  4TNC A;  1SKT A;  1DF0 A;  1YVH A;  3TDZ A;  1QV0 A;  1UHI A;  3TZ1 A;  1SL8 A;  1KK8 B;  1XFZ O;  1M39 A;  1KSO A;  3GOF A;  5K89 A;  3KHE A;  3I5I B;  4M2P A;  1DJI A;  2FJU B;  1ZMZ A;  3TDU A;  4WQ3 A;  4MN0 A;  1UHN A;  4PDZ A;  2KGB C;  3KF9 A;  5I8N A;  1SL9 A;  5JJG A;  1MUX A;  1SY9 A;  1IH0 A;  1TCF A;  1F4O A;  4A4B A;  2K7O A;  2EC6 B;  3KEV A;  1W7J B;  2MBX A;  2PVB A;  2OS8 B;  1IJ5 A;  1XVJ A;  3A4U B;  4MZJ A;  4N5X A;  3VRQ A;  1TRF A;  1QXP A;  4GGN A;  1K2H A;  3O2P A;  1K9K A;  1OOJ A;  2KOT A;  3AAK A;  1S1E A;  1QJT A;  1SW8 A;  4FTG A;  1MR8 A;  3SG4 A;  2KAX A;  1E8A A;  5AER A;  2LUC A;  1NYA A;  3EK4 A;  1IG5 A;  2OTG B;  2BBM A;  1NP8 A;  2VRG A;  2LP3 A;  5D69 A;  3OB1 B;  1OZS A;  2HPS A;  1NX1 A;  1J7Q A;  3PN7 C;  1IQ3 A;  1AP4 A;  1MWN A;  3SIB A;  1JFK A;  1LVC D;  2M0R A;  4MLW A;  2K61 A;  1Y1A A;  2NZ0 A;  1YRT B;  1V1G A;  3EVV A;  4PCW A;  3SJS A;  1KWO B;  3SG2 A;  1XYD A;  2JQ6 A;  1B1G A;  3PSR A;  1LXF C;  2JT3 A;  1CLB A;  1QX5 B;  2I18 A;  2NCO A;  1K94 A;  1UWO A;  1SPY A;  1BMO A;  1N0Y A;  1KSM A;  1U5I B;  1N2D A;  4MVF A;  2MRD A;  3FWC A;  1U5I A;  2WCF A;  1RK9 A;  1XFY O;  3DVE A;  4XJK B;  1ODB A;  1SBJ A;  3ZNI A;  5HKW A;  1TTX A;  3ICB A;  1R2U A;  2QAC A;  5BPJ A;  2LV7 A;  1QX2 A;  1S6C A;  2L4I A;  4JWQ A;  1KFU L;  2KSP A;  4DS7 A;  2JU0 A;  5AAN A;  1B7T Z;  1OMV A;  2MA2 A;  5AFP A;  1QTX A;  2M97 A;  5DKR A;  3BQ3 A;  4P2Y B;  1GGZ A;  4MZK A;  3FWB A;  1KK8 C;  5DKQ A;  2L2E A;  2LM5 A;  3A8R A;  3OP0 A;  3F45 A;  4MRY A;  1IJ6 A;  1UHJ A;  1NCY A;  1PUL A;  1N65 A;  4GBA A;  2RGI A;  1CDN A;  2NLN A;  2JNX A;  5KTY A;  1K9U A;  2KNE A;  4YBH B;  1OSA A;  1RFJ A;  2LLT A;  1NPQ A;  1S5G Z;  4DRW A;  2KI4 C;  3HCM A;  4DIR A;  1J55 A;  2KQ6 A;  2MLE C;  3HX4 A;  1H8B A;  3IQO A;  4JPZ B;  2JXC A;  1AJ4 A;  3EKH A;  4YGB B;  1YUR A;  2L98 A;  1JUO A;  2ZRS A;  3CTN A;  2KYF A;  2K7B A;  1KQV A;  1TNW A;  1ZOT B;  1CDL A;  3PN7 B;  4AQJ A;  1SL7 A;  2F3Z A;  1Y6W A;  5DKN A;  1KFX S;  5AXI A;  3VRR A;  1NX3 A;  2GGZ A;  1G4Y R;  2ZN8 A;  3FS7 A;  1A4P A;  1IQ5 A;  3WHT B;  4A4C A;  2SAS A;  1SYM A;  4P5O E;  1J7R A;  4IL1 A;  1B8R A;  3CS1 A;  1NWD A;  2BKH B;  2G9B A;  2Y5I A;  4XYN A;  5KU1 A;  1B8L A;  4DCK A;  3BUN B;  3WXA A;  1UP5 A;  5D7F A;  1WDC C;  2M1K B;  1H4B A;  4NDB A;  1TOP A;  4I5K A;  2GGM A;  1IRJ A;  2LUX A;  3I5G C;  1REC A;  1QIV A;  1DJX A;  2CBL A;  1S3P A;  2LNK A;  2COL B;  4C0J A;  4GFT A;  3CR2 A;  3GK2 A;  3AAJ A;  4GNK B;  2ISD A;  4PHN A;  2WC8 A;  2FCE A;  1CFD A;  1QAS A;  1XFV O;  5I2O A;  1K8U A;  1K90 D;  4MEW A;  3SG7 A;  3NSI A;  2KHN A;  1CNP A;  2MHH A;  2KAY A;  1DJZ A;  1PSB A;  4HRH A;  4AQI A;  1K96 A;  1YUT A;  1CFP A;  1CTR A; 
#chains in the Genus database with same CATH topology
 2JT0 A;  4N1F A;  2JC2 A;  3D73 A;  1EXR A;  1BU3 A;  3QME A;  4CLN A;  3TS5 C;  3M0W A;  2TN4 A;  1CFF A;  3SG6 A;  1UHH A;  2BBN A;  2WND A;  2MLF C;  4CFR A;  1IIO A;  1TCO B;  2K2A A;  2KI4 B;  1GM0 A;  2SCP A;  3AKA A;  1F55 A;  1F4Q A;  3EVR A;  3CR5 X;  2P6B B;  2AAO A;  2AUC A;  1NCZ A;  2K60 A;  4PHM A;  1OE9 B;  1F8H A;  1YRU B;  2BEC A;  2M7L A;  1KCY A;  1CM1 A;  1J1E A;  2KI6 D;  3CGA A;  1AHR A;  2KBM A;  4ORB B;  3WNX B;  4UPG A;  3MSE B;  2KGR A;  1C07 A;  2NXQ A;  4YGC B;  1DJH A;  4PE4 A;  5IBW A;  3DD4 A;  3R1O A;  1WDC B;  1S26 D;  1BG1 A;  3BXK A;  1A03 A;  2F2P A;  4GPL B;  3I5G B;  3DF0 B;  4MBE A;  1F71 A;  4QJ3 B;  3D0Y B;  1PK0 D;  3DF0 A;  1FBV A;  3FIA A;  3UNW A;  4USL A;  4OR9 B;  2CXJ A;  4OZD A;  3D0Y A;  5CSJ A;  1WRL A;  1QVI Y;  3IF7 A;  2JZI A;  3BYA A;  3D75 A;  5HL1 A;  1TNQ A;  1KK7 Z;  2A4J A;  2MJW B;  3EK8 A;  1JF2 A;  2BCB A;  2LVK A;  2M9G A;  3CZT X;  3O6B A;  1SSE B;  4MZL A;  4F0Z B;  4XJK A;  5FYX A;  1SR6 C;  1DC1 A;  1A2X A;  3V2L A;  1SCM C;  4BY4 A;  1NCX A;  3I5F C;  3PAT A;  5HKZ A;  1M46 A;  1RWY A;  2NCP A;  1M63 B;  5FI6 A;  2F2O A;  3EKJ A;  1JF0 A;  2LP2 A;  3TS5 B;  2LVV A;  1EL4 A;  2E6W A;  1ORG A;  1OMD A;  2F33 A;  2M1U A;  2QEV A;  2GV5 A;  3QRX A;  1QIW A;  1M31 A;  4ZCU A;  3SG3 A;  2PSR A;  2HQW A;  4MSP A;  1CDM A;  3OX5 A;  3VRO A;  2CT9 A;  4FQO A;  1B47 A;  1WLM A;  3CR4 X;  1IWQ A;  2L0P A;  1DT7 B;  2KI6 C;  2BL0 C;  2DOQ A;  2WCL A;  1EH2 A;  1S36 A;  1FF1 A;  1JFJ A;  2KLD A;  3KPX A;  1AK8 A;  3BFA A;  2F3Y A;  2P71 A;  3Q8I A;  2KAV A;  4QJ5 B;  1C3Z A;  1QV1 A;  2KPH A;  3UO9 A;  3SIA A;  2YGU A;  1XFU O;  1M45 A;  2Q4U A;  3NSK A;  4PT1 A;  1WRK A;  4ORC B;  3BUO B;  1LKJ A;  1YX8 A;  3DY9 A;  5CPV A;  4QJ4 B;  1DJW A;  1SRA A;  3FE6 A;  4Q04 A;  1C3Y A;  2KFF A;  1DEL A;  1R6P A;  2BCA A;  4I5L B;  3DYE A;  4ZCV A;  1SCV A;  2WCE A;  1BF5 A;  1FW4 A;  1CFC A;  1OOH A;  5JOL A;  1PVA A;  3CLN A;  2O5G A;  4WRI A;  1WY9 A;  4GGF C;  1PSR A;  3WHU B;  3K21 A;  1YR5 A;  2OPO A;  3RM1 A;  2LVJ A;  2PAS A;  4AOM A;  1GGW A;  2ERB A;  4R1E A;  4ICB A;  1JC2 A;  1BR1 B;  2AMI A;  2FCD A;  2L5X B;  1DJY A;  1TN4 A;  3GK4 X;  5J3X A;  1QLS A;  1AJ5 A;  2MAZ A;  3BJH A;  3B87 A;  3NHT A;  1OZO A;  1KQM B;  2HET A;  2PAL A;  5G08 A;  1QX7 A;  2K0J A;  4JKT A;  3S0G A;  2L50 A;  3KO0 A;  1L2O C;  1Y1U A;  1V1F A;  1SR6 B;  1AVS A;  1D1O A;  4I5J A;  1B9A A;  1PAL A;  1SCM B;  3VRN A;  3LK0 A;  3I5F B;  4C0K A;  4I5N B;  1OOG A;  2K7C A;  3DVM A;  1NX0 A;  3RZS A;  3BFB A;  1HT9 A;  2L51 A;  3BFH A;  1B7T Y;  3PM8 A;  1GQM A;  3H4S E;  2Y1M A;  3CDN A;  1AUI B;  2CNP A;  2Y4Q A;  3O78 A;  1ZUZ A;  1GJY A;  1BJF A;  1J1D A;  2LVI A;  5ER4 X;  5HLO A;  1DMO A;  2Q91 A;  3NSL A;  3EK7 A;  3O4Y A;  1CM4 A;  2LC5 A;  1RJV A;  3N7H A;  1SMG A;  2BL0 B;  3BUX B;  2JUL A;  2ZRT A;  1XK4 C;  2IS9 A;  3PLF B;  4NQG A;  3TUY C;  1YVL A;  1JWD A;  1TNP A;  2KBI A;  1S5G Y;  3EVU A;  3CWG A;  4PE1 A;  5DIC A;  1BOD A;  2HQ8 A;  3I5H C;  1OQP A;  3OHM B;  2ZKM X;  2KYC A;  1IGV A;  1DEK A;  3TDI A;  5HYD A;  1J7O A;  1XFX O;  3S0E A;  2EGD A;  1XA5 A;  2FOT A;  1JSA A;  5CSI A;  1PVB A;  1G33 A;  2LAP A;  1EG4 A;  1UHK A;  2JOJ A;  1RRO A;  2KFG A;  1Y1X A;  3LCP C;  2LMV A;  2JPO A;  3OB2 B;  2P70 A;  4OVN F;  4WQ2 A;  5GQQ C;  3DZT A;  4M2Q A;  1FPW A;  1Y0V H;  4GGF A;  2H61 C;  2LLS A;  1QWV A;  4PAL A;  4ORA B;  1SK6 D;  2KFH A;  3CZ0 A;  3IVT A;  2K2F A;  2JXL A;  4DUQ A;  3NHI A;  1NIW A;  1UUS A;  4N1G A;  5KSZ A;  1BOC A;  1L2O B;  4NDD A;  3NGV A;  3RLZ A;  1DTL A;  1HQV A;  3PJI A;  1W9Z A;  1B4C A;  1CLL A;  2B1U A;  2ZN9 A;  2BE4 A;  3L47 A;  2JTZ A;  1OMR A;  2M49 B;  4MRX A;  1KQM C;  1MXE A;  3R1P A;  2M29 A;  1DGV A;  1F54 A;  2KQY A;  5I2L A;  2JTT A;  2LE9 B;  4CFQ A;  2JPT A;  3VGO A;  1K95 A;  2JRF A;  1NSH A;  4NDC A;  1QS7 A;  2CTN A;  3JTD C;  5HLV A;  5F6T A;  4GAO A;  1J7P A;  3DVJ A;  2FJY A;  1JBA A;  1BR4 B;  1DQE A;  4HSZ A;  2BCX A;  3LLE A;  4YGE B;  1YUU A;  2GTE A;  2QEH A;  1C7W A;  4PE0 A;  1BT6 A;  1T14 A;  1CDP A;  1RTP 1;  1F70 A;  1LA0 A;  3ZWH A;  1BLQ A;  2I7A A;  3D10 A;  3BOW B;  3D78 A;  2Y1N A;  2I2R E;  1DJG A;  1CLM A;  1ZAC A;  2PRU A;  1XK4 A;  3BOW A;  3OGN A;  3TUY B;  1CKK A;  4C0L A;  1FI5 A;  1C7V A;  5FI2 A;  2JWW A;  2ZND A;  3I5H B;  1OOI X;  3JVT B;  3OX6 A;  3NSO A;  3E3R A;  1KFX L;  3L4L A;  4CPV A;  1A29 A;  2M3W A;  3LK1 A;  2WOS A;  3DVK A;  1LA3 A;  2EHB A;  1NX2 A;  1Z2C B;  4YI8 A;  1X02 A;  1WLZ A;  2WOR A;  1EJ3 A;  2QPT A;  2LCP A;  2I94 A;  2HF5 A;  1Z4H A;  1Q80 A;  2WCH A;  3PAL A;  5ER5 A;  1VRK A;  2L5Y A;  5CSN A;  1QAT A;  2ZFD A;  4M2O A;  1YX7 A;  3PFV A;  1WRZ A;  2PYQ A;  3VRP A;  3I5I C;  4BY5 A;  3LL8 B;  1S6I A;  2H61 A;  2K7D A;  1CMF A;  1G8I A;  1LIN A;  2H2K A;  1KFU S;  1CB1 A;  1YUS A;  2R2I A;  4GUK A;  1A75 B;  2BKI B;  2K8M B;  2L2C A;  2WCB A;  4OV2 A;  4JD9 A;  3L4A A;  1TWO A;  2LMT A;  5HKY A;  1A75 A;  2EC6 C;  2O60 A;  1FI6 A;  3CAB A;  2E30 A;  3K1E A;  2OS8 C;  2ZNE A;  2LAN A;  4YGA A;  2LLU A;  3C1V A;  4YRU A;  3AKB A;  1SNL A;  1OOF A;  3S0B A;  1UUR A;  1ZFS A;  4OKH A;  4HRG A;  4PHK A;  5TNC A;  1S6J A;  2F8P A;  1KK7 Y;  2BE6 A;  1ALW A;  3NXA A;  1DGU A;  1LS8 A;  2OTG C;  3JTD B;  3OBV A;  4D1E A;  4PE7 A;  5I94 A;  2QEB A;  3SG5 A;  1B8C A;  4YGD B;  5B8I B;  1CMG A;  2LHL A;  1MF8 B;  2JNF A;  2M7N A;  4CID A;  4OCI A;  3BUM B;  3BUW B;  4L9M A;  1YTZ C;  1XO5 A;  4HRE E;  2CCM A;  2BAP A;  1K93 D;  2L4H A;  4PHJ A;  4YI9 A;  5PAL A;  5I2Q A;  3CZ2 A;  2M8U A;  1MQ1 A;  5CSF A;  2LHI A;  1DVI A;  3IQQ A;  2WC6 A;  1KWO C;  1PRW A;  2KDH A;  1K9P A;  1TIZ A;  1QVI Z;  1XFW O;  2WC5 A;  4JQ0 D;  1MHO A;  1MXL C;  2PMY A;  1QLK A;  4ETO A;  1IKU A;  1NUB A;  1TNX A;  2JT8 A;  3GK1 A;  1W7I B;  5AEQ A;  1ALV A;  4IJ7 A;  1L7Z A;  4U8D A;  2LMU A;  3O4X A;  4E68 A;  2G2B A;  2V53 A;  1DF0 B;  3JVT C;  1EG3 A;  2D8N A;  4TNC A;  1SKT A;  1DF0 A;  1YVH A;  3TDZ A;  1QV0 A;  1UHI A;  3TZ1 A;  1SL8 A;  1KK8 B;  1XFZ O;  1M39 A;  1KSO A;  3GOF A;  5K89 A;  3KHE A;  3I5I B;  4M2P A;  1DJI A;  2FJU B;  1ZMZ A;  3TDU A;  4WQ3 A;  4MN0 A;  1UHN A;  4PDZ A;  2KGB C;  3KF9 A;  5I8N A;  3S0A A;  1SL9 A;  3B7A A;  5JJG A;  1MUX A;  1SY9 A;  1IH0 A;  1TCF A;  1F4O A;  3D76 A;  2WCK A;  2K7O A;  4A4B A;  3S0F A;  2EC6 B;  3KEV A;  1W7J B;  2MBX A;  2PVB A;  2OS8 B;  1IJ5 A;  1XVJ A;  3A4U B;  4MZJ A;  4N5X A;  3VRQ A;  1TRF A;  1QXP A;  4GGN A;  1K2H A;  3O2P A;  1K9K A;  1OOJ A;  2KOT A;  3AAK A;  1S1E A;  3S0D A;  1QJT A;  1SW8 A;  4FTG A;  1MR8 A;  3SG4 A;  2KAX A;  1E8A A;  5AER A;  2LUC A;  4KYN A;  1NYA A;  3EK4 A;  1IG5 A;  2OTG B;  2BBM A;  1NP8 A;  2VRG A;  2LP3 A;  5D69 A;  3OB1 B;  1OZS A;  2HPS A;  1NX1 A;  3B86 A;  1J7Q A;  3PN7 C;  5EL2 A;  1IQ3 A;  1AP4 A;  5D3O A;  1MWN A;  3SIB A;  1JFK A;  1LVC D;  2M0R A;  4MLW A;  2K61 A;  2WCJ A;  1OW4 A;  1Y1A A;  2NZ0 A;  1YRT B;  1V1G A;  3EVV A;  4PCW A;  3SJS A;  1KWO B;  3SG2 A;  1XYD A;  2JQ6 A;  1B1G A;  3PSR A;  1LXF C;  2JT3 A;  1CLB A;  1QX5 B;  2I18 A;  2NCO A;  1K94 A;  1UWO A;  1SPY A;  3PM2 A;  1BMO A;  1N0Y A;  1KSM A;  1U5I B;  1N2D A;  4INX A;  2MRD A;  4MVF A;  3FWC A;  3FE8 A;  3SS4 A;  1U5I A;  2WCF A;  1RK9 A;  1XFY O;  3DVE A;  4XJK B;  1ODB A;  4F7F A;  1SBJ A;  3ZNI A;  5HKW A;  1TTX A;  3ICB A;  1R2U A;  2QAC A;  5BPJ A;  2LV7 A;  1QX2 A;  1S6C A;  2L4I A;  4JWQ A;  1KFU L;  2KSP A;  2WCM A;  2JU0 A;  5AAN A;  4DS7 A;  1B7T Z;  1OMV A;  2MA2 A;  5AFP A;  1QTX A;  2M97 A;  5DKR A;  3BQ3 A;  4P2Y B;  1GGZ A;  5FI7 A;  4MZK A;  3FWB A;  1KK8 C;  5DKQ A;  2L2E A;  2LM5 A;  3A8R A;  3CYZ A;  3OP0 A;  3F45 A;  4MRY A;  1IJ6 A;  1UHJ A;  1NCY A;  1P28 A;  1PUL A;  1N65 A;  4GBA A;  2H8V A;  2RGI A;  1CDN A;  2NLN A;  2JNX A;  5KTY A;  1K9U A;  2KNE A;  4YBH B;  1OSA A;  1RFJ A;  3R1V A;  2LLT A;  1NPQ A;  1S5G Z;  4DRW A;  2KI4 C;  3HCM A;  4DIR A;  1J55 A;  2KQ6 A;  2MLE C;  2BNX A;  3R72 A;  3HX4 A;  1H8B A;  3IQO A;  4FQT A;  4JPZ B;  2JXC A;  1AJ4 A;  3EKH A;  4YGB B;  1YUR A;  2L98 A;  1JUO A;  2QEO A;  2ZRS A;  3CTN A;  2KYF A;  2K7B A;  2QDI A;  1KQV A;  1TNW A;  1ZOT B;  1CDL A;  3FE9 A;  3PN7 B;  3VB1 A;  4AQJ A;  1SL7 A;  2F3Z A;  1Y6W A;  3EG5 B;  4INW A;  1KFX S;  5DKN A;  5AXI A;  3VRR A;  1TUZ A;  1NX3 A;  2GGZ A;  1G4Y R;  2ZN8 A;  3FS7 A;  1A4P A;  1IQ5 A;  3WHT B;  4A4C A;  2SAS A;  1SYM A;  4P5O E;  1J7R A;  4IL1 A;  1B8R A;  3CS1 A;  1NWD A;  2BKH B;  2G9B A;  2Y5I A;  4XYN A;  5KU1 A;  1B8L A;  4DCK A;  3BUN B;  3D77 A;  2PQL A;  1UP5 A;  3WXA A;  5D7F A;  1WDC C;  3CZ1 A;  2KLE A;  2M1K B;  3D74 A;  4NDB A;  1TOP A;  4I5K A;  1H4B A;  2GGM A;  1IRJ A;  2LUX A;  3I5G C;  3SS3 A;  1REC A;  1QIV A;  1DJX A;  2CBL A;  1S3P A;  2LNK A;  2COL B;  4C0J A;  4GFT A;  3CR2 A;  3GK2 A;  1TUJ A;  3AAJ A;  4GNK B;  2ISD A;  3B88 A;  4PHN A;  2WC8 A;  2FCE A;  3B6X A;  3SS5 A;  1CFD A;  1QAS A;  1XFV O;  5I2O A;  1K8U A;  3DXL A;  1K90 D;  4MEW A;  3SG7 A;  3NSI A;  1XFR A;  2KHN A;  1CNP A;  2MHH A;  2KAY A;  1DJZ A;  1PSB A;  4HRH A;  4AQI A;  1K96 A;  1YUT A;  1CFP A;  1CTR A; 
#chains in the Genus database with same CATH homology
 2JT0 A;  4N1F A;  2JC2 A;  1EXR A;  1BU3 A;  4CLN A;  3TS5 C;  3M0W A;  2TN4 A;  1CFF A;  3SG6 A;  1UHH A;  2BBN A;  2WND A;  2MLF C;  4CFR A;  1TCO B;  2K2A A;  2KI4 B;  2SCP A;  3AKA A;  1F55 A;  1F4Q A;  3EVR A;  3CR5 X;  2P6B B;  2AAO A;  2AUC A;  1NCZ A;  4PHM A;  1OE9 B;  1F8H A;  1YRU B;  2BEC A;  2M7L A;  1KCY A;  1CM1 A;  1J1E A;  2KI6 D;  3CGA A;  1AHR A;  2KBM A;  4ORB B;  3WNX B;  4UPG A;  3MSE B;  2KGR A;  1C07 A;  2NXQ A;  4YGC B;  1DJH A;  4PE4 A;  5IBW A;  3DD4 A;  1WDC B;  1S26 D;  1BG1 A;  3BXK A;  1A03 A;  2F2P A;  4GPL B;  3I5G B;  3DF0 B;  4MBE A;  1F71 A;  4QJ3 B;  3D0Y B;  1PK0 D;  3DF0 A;  1FBV A;  3FIA A;  4USL A;  4OR9 B;  2CXJ A;  3D0Y A;  5CSJ A;  1WRL A;  1QVI Y;  3IF7 A;  2JZI A;  3BYA A;  1TNQ A;  1KK7 Z;  2A4J A;  2MJW B;  3EK8 A;  1JF2 A;  2BCB A;  2LVK A;  2M9G A;  3CZT X;  3O6B A;  4MZL A;  4F0Z B;  4XJK A;  5FYX A;  1SR6 C;  1A2X A;  1SCM C;  4BY4 A;  1NCX A;  3I5F C;  3PAT A;  5HKZ A;  1M46 A;  1RWY A;  2NCP A;  1M63 B;  2F2O A;  3EKJ A;  1JF0 A;  2LP2 A;  3TS5 B;  2LVV A;  1EL4 A;  2E6W A;  2F33 A;  1OMD A;  2M1U A;  2GV5 A;  3QRX A;  1QIW A;  1M31 A;  4ZCU A;  3SG3 A;  2PSR A;  2HQW A;  4MSP A;  1CDM A;  3OX5 A;  3VRO A;  2CT9 A;  4FQO A;  1B47 A;  1WLM A;  3CR4 X;  1IWQ A;  2L0P A;  1DT7 B;  2KI6 C;  2BL0 C;  2DOQ A;  1EH2 A;  1S36 A;  1FF1 A;  1JFJ A;  3KPX A;  1AK8 A;  2F3Y A;  2KAV A;  4QJ5 B;  1QV1 A;  3SIA A;  1XFU O;  1M45 A;  2Q4U A;  3NSK A;  1WRK A;  4ORC B;  3BUO B;  1LKJ A;  1YX8 A;  5CPV A;  4QJ4 B;  1DJW A;  1SRA A;  4Q04 A;  2KFF A;  1R6P A;  2BCA A;  4I5L B;  4ZCV A;  1BF5 A;  1SCV A;  2WCE A;  1FW4 A;  1CFC A;  5JOL A;  1PVA A;  3CLN A;  2O5G A;  4WRI A;  1WY9 A;  4GGF C;  1PSR A;  3WHU B;  3K21 A;  1YR5 A;  2OPO A;  3RM1 A;  2LVJ A;  2PAS A;  4AOM A;  1GGW A;  4R1E A;  4ICB A;  1JC2 A;  1BR1 B;  2AMI A;  2FCD A;  2L5X B;  1DJY A;  1TN4 A;  3GK4 X;  5J3X A;  1QLS A;  1AJ5 A;  2MAZ A;  1OZO A;  1KQM B;  2HET A;  2PAL A;  5G08 A;  1QX7 A;  2K0J A;  2L50 A;  3KO0 A;  1L2O C;  1Y1U A;  1V1F A;  1SR6 B;  1AVS A;  1D1O A;  4I5J A;  1B9A A;  1PAL A;  1SCM B;  3VRN A;  3LK0 A;  3I5F B;  4C0K A;  4I5N B;  2K7C A;  3DVM A;  1NX0 A;  1HT9 A;  2L51 A;  1B7T Y;  3PM8 A;  1GQM A;  3H4S E;  2Y1M A;  1AUI B;  2CNP A;  2Y4Q A;  3O78 A;  1ZUZ A;  1GJY A;  1BJF A;  1J1D A;  2LVI A;  5ER4 X;  5HLO A;  1DMO A;  2Q91 A;  3NSL A;  3EK7 A;  3O4Y A;  1CM4 A;  2LC5 A;  1RJV A;  1SMG A;  2BL0 B;  3BUX B;  2JUL A;  2ZRT A;  1XK4 C;  2IS9 A;  3PLF B;  4NQG A;  3TUY C;  1YVL A;  1JWD A;  1TNP A;  2KBI A;  1S5G Y;  3EVU A;  3CWG A;  4PE1 A;  1BOD A;  2HQ8 A;  3I5H C;  1OQP A;  3OHM B;  2ZKM X;  2KYC A;  1IGV A;  3TDI A;  5HYD A;  1J7O A;  1XFX O;  2EGD A;  1XA5 A;  2FOT A;  1JSA A;  5CSI A;  1PVB A;  1G33 A;  2LAP A;  1EG4 A;  1UHK A;  2JOJ A;  1RRO A;  2KFG A;  1Y1X A;  3LCP C;  2LMV A;  3OB2 B;  4OVN F;  4WQ2 A;  5GQQ C;  4M2Q A;  1FPW A;  1Y0V H;  4GGF A;  2H61 C;  2LLS A;  4PAL A;  4ORA B;  1SK6 D;  2KFH A;  2K2F A;  2JXL A;  4DUQ A;  1NIW A;  1UUS A;  4N1G A;  5KSZ A;  1BOC A;  1L2O B;  4NDD A;  3RLZ A;  1DTL A;  1HQV A;  1B4C A;  1CLL A;  2B1U A;  2ZN9 A;  2BE4 A;  2JTZ A;  1OMR A;  2M49 B;  4MRX A;  1KQM C;  1MXE A;  2M29 A;  1DGV A;  1F54 A;  2KQY A;  5I2L A;  2JTT A;  2LE9 B;  4CFQ A;  2JPT A;  3VGO A;  1K95 A;  2JRF A;  1NSH A;  4NDC A;  1QS7 A;  2CTN A;  3JTD C;  5HLV A;  5F6T A;  4GAO A;  1J7P A;  3DVJ A;  1JBA A;  1BR4 B;  4HSZ A;  2BCX A;  3LLE A;  4YGE B;  1YUU A;  4PE0 A;  1C7W A;  1BT6 A;  1CDP A;  1RTP 1;  1F70 A;  1LA0 A;  3ZWH A;  1BLQ A;  2I7A A;  3D10 A;  3BOW B;  2Y1N A;  2I2R E;  1DJG A;  1CLM A;  1ZAC A;  2PRU A;  1XK4 A;  3BOW A;  3TUY B;  1CKK A;  4C0L A;  1FI5 A;  1C7V A;  2JWW A;  2ZND A;  3I5H B;  3OX6 A;  3JVT B;  3NSO A;  3E3R A;  1KFX L;  4CPV A;  1A29 A;  2M3W A;  3LK1 A;  2WOS A;  3DVK A;  1LA3 A;  2EHB A;  1NX2 A;  4YI8 A;  1X02 A;  1WLZ A;  2WOR A;  1EJ3 A;  2QPT A;  2LCP A;  2I94 A;  2HF5 A;  3PAL A;  1Q80 A;  5ER5 A;  1VRK A;  5CSN A;  1QAT A;  2ZFD A;  4M2O A;  1YX7 A;  3PFV A;  1WRZ A;  3VRP A;  3I5I C;  4BY5 A;  3LL8 B;  1S6I A;  2H61 A;  2K7D A;  1CMF A;  1G8I A;  1LIN A;  2H2K A;  1KFU S;  1CB1 A;  1YUS A;  2R2I A;  4GUK A;  1A75 B;  2BKI B;  2K8M B;  2WCB A;  4OV2 A;  2LMT A;  5HKY A;  1A75 A;  2EC6 C;  2O60 A;  1FI6 A;  2E30 A;  2OS8 C;  2ZNE A;  2LAN A;  4YGA A;  2LLU A;  3C1V A;  4YRU A;  3AKB A;  1SNL A;  1UUR A;  1ZFS A;  4OKH A;  4HRG A;  4PHK A;  5TNC A;  1S6J A;  2F8P A;  1KK7 Y;  2BE6 A;  1ALW A;  3NXA A;  1DGU A;  2OTG C;  3JTD B;  4D1E A;  4PE7 A;  3SG5 A;  1B8C A;  4YGD B;  5B8I B;  1CMG A;  2LHL A;  1MF8 B;  2JNF A;  2M7N A;  4CID A;  4OCI A;  3BUM B;  3BUW B;  4L9M A;  1YTZ C;  1XO5 A;  4HRE E;  2CCM A;  1K93 D;  2L4H A;  4PHJ A;  4YI9 A;  5PAL A;  5I2Q A;  2M8U A;  1MQ1 A;  5CSF A;  2LHI A;  1DVI A;  3IQQ A;  1KWO C;  1PRW A;  2KDH A;  1K9P A;  1TIZ A;  1QVI Z;  1XFW O;  4JQ0 D;  1MHO A;  1MXL C;  2PMY A;  1QLK A;  4ETO A;  1IKU A;  1NUB A;  1TNX A;  2JT8 A;  3GK1 A;  1W7I B;  5AEQ A;  1ALV A;  1L7Z A;  4U8D A;  2LMU A;  4E68 A;  2G2B A;  2V53 A;  1DF0 B;  3JVT C;  1EG3 A;  2D8N A;  4TNC A;  1SKT A;  1DF0 A;  1YVH A;  3TDZ A;  1QV0 A;  1UHI A;  3TZ1 A;  1SL8 A;  1KK8 B;  1XFZ O;  1M39 A;  1KSO A;  3GOF A;  5K89 A;  3KHE A;  3I5I B;  4M2P A;  1DJI A;  2FJU B;  1ZMZ A;  3TDU A;  4WQ3 A;  4MN0 A;  1UHN A;  4PDZ A;  2KGB C;  3KF9 A;  5I8N A;  1SL9 A;  5JJG A;  1MUX A;  1SY9 A;  1IH0 A;  1TCF A;  1F4O A;  4A4B A;  2K7O A;  2EC6 B;  3KEV A;  1W7J B;  2MBX A;  2PVB A;  2OS8 B;  1IJ5 A;  1XVJ A;  3A4U B;  4MZJ A;  4N5X A;  3VRQ A;  1TRF A;  1QXP A;  4GGN A;  1K2H A;  3O2P A;  1K9K A;  1OOJ A;  2KOT A;  3AAK A;  1S1E A;  1QJT A;  1SW8 A;  4FTG A;  1MR8 A;  3SG4 A;  2KAX A;  1E8A A;  5AER A;  2LUC A;  1NYA A;  3EK4 A;  1IG5 A;  2OTG B;  2BBM A;  1NP8 A;  2VRG A;  2LP3 A;  5D69 A;  3OB1 B;  1OZS A;  2HPS A;  1NX1 A;  1J7Q A;  3PN7 C;  1IQ3 A;  1AP4 A;  1MWN A;  3SIB A;  1JFK A;  1LVC D;  2M0R A;  4MLW A;  2K61 A;  1Y1A A;  2NZ0 A;  1YRT B;  1V1G A;  3EVV A;  4PCW A;  3SJS A;  1KWO B;  3SG2 A;  1XYD A;  2JQ6 A;  1B1G A;  3PSR A;  1LXF C;  2JT3 A;  1CLB A;  1QX5 B;  2I18 A;  2NCO A;  1K94 A;  1UWO A;  1SPY A;  1BMO A;  1N0Y A;  1KSM A;  1U5I B;  1N2D A;  4MVF A;  2MRD A;  3FWC A;  1U5I A;  2WCF A;  1RK9 A;  1XFY O;  3DVE A;  4XJK B;  1ODB A;  1SBJ A;  3ZNI A;  5HKW A;  1TTX A;  3ICB A;  1R2U A;  2QAC A;  5BPJ A;  2LV7 A;  1QX2 A;  1S6C A;  2L4I A;  4JWQ A;  1KFU L;  2KSP A;  4DS7 A;  2JU0 A;  5AAN A;  1B7T Z;  1OMV A;  2MA2 A;  5AFP A;  1QTX A;  2M97 A;  5DKR A;  3BQ3 A;  4P2Y B;  1GGZ A;  4MZK A;  3FWB A;  1KK8 C;  5DKQ A;  2L2E A;  2LM5 A;  3A8R A;  3OP0 A;  3F45 A;  4MRY A;  1IJ6 A;  1UHJ A;  1NCY A;  1PUL A;  1N65 A;  4GBA A;  2RGI A;  1CDN A;  2NLN A;  2JNX A;  5KTY A;  1K9U A;  2KNE A;  4YBH B;  1OSA A;  1RFJ A;  2LLT A;  1NPQ A;  1S5G Z;  4DRW A;  2KI4 C;  3HCM A;  4DIR A;  1J55 A;  2KQ6 A;  2MLE C;  3HX4 A;  1H8B A;  3IQO A;  4JPZ B;  2JXC A;  1AJ4 A;  3EKH A;  4YGB B;  1YUR A;  2L98 A;  1JUO A;  2ZRS A;  3CTN A;  2KYF A;  2K7B A;  1KQV A;  1TNW A;  1ZOT B;  1CDL A;  3PN7 B;  4AQJ A;  1SL7 A;  2F3Z A;  1Y6W A;  5DKN A;  1KFX S;  5AXI A;  3VRR A;  1NX3 A;  2GGZ A;  1G4Y R;  2ZN8 A;  3FS7 A;  1A4P A;  1IQ5 A;  3WHT B;  4A4C A;  2SAS A;  1SYM A;  4P5O E;  1J7R A;  4IL1 A;  1B8R A;  3CS1 A;  1NWD A;  2BKH B;  2G9B A;  2Y5I A;  4XYN A;  5KU1 A;  1B8L A;  4DCK A;  3BUN B;  3WXA A;  1UP5 A;  5D7F A;  1WDC C;  2M1K B;  1H4B A;  4NDB A;  1TOP A;  4I5K A;  2GGM A;  1IRJ A;  2LUX A;  3I5G C;  1REC A;  1QIV A;  1DJX A;  2CBL A;  1S3P A;  2LNK A;  2COL B;  4C0J A;  4GFT A;  3CR2 A;  3GK2 A;  3AAJ A;  4GNK B;  2ISD A;  4PHN A;  2WC8 A;  2FCE A;  1CFD A;  1QAS A;  1XFV O;  5I2O A;  1K8U A;  1K90 D;  4MEW A;  3SG7 A;  3NSI A;  2KHN A;  1CNP A;  2MHH A;  2KAY A;  1DJZ A;  1PSB A;  4HRH A;  4AQI A;  1K96 A;  1YUT A;  1CFP A;  1CTR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...