1H8BA

Ef-hands 3,4 from alpha-actinin / z-repeat 7 from titin
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
73
structure length
73
Chain Sequence
MADTDTAEQVIASFRILASDKPYILAEELRRELPPDQAQYCIKRMPAYSGPGSVPGALDYAAFSSALYGESDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ALPHA-ACTININ 2, SKELETAL MUSCLE ISOFORM
publication title Ca2+-Independent Binding of an EF-Hand Domain to a Novel Motif in the Alpha-Actinin-Titin Complex
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein
total genus 13
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2001-02-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08726 EFhand_Ca_insen Ca2+ insensitive EF hand
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1h8bA00
1J7RA 4I5JA 1Y1XA 1PSBA 2NLNA 1MWNA 4CPVA 2H2KA 1LA3A 2PALA 1OZSA 5IBWA 1PVBA 2BL0B 2MHHA 3F45A 1DTLA 1PVAA 4GBAA 1RWYA 2CTNA 1YTZC 1DF0A 4I5NB 2BCXA 1SRAA 2NCOA 4CIDA 4MN0A 2B1UA 1NUBA 5I8NA 3CR4X 1QIWA 1QLSA 1K95A 1KFUS 1NWDA 1BF5A 2K8MB 1S6CA 2KFHA 2ZKMX 3GOFA 1C7VA 4FQOA 1M31A 1XA5A 2JTTA 4YRUA 1S1EA 4OV2A 2ZNDA 3I5GC 5AERA 2PVBA 1ALVA 2R2IA 5DKQA 3CLNA 2KI4C 1DJWA 1K93D 1QXPA 4XJKB 1AHRA 1LA0A 2LANA 1B8CA 3BOWB 3M0WA 2KI6D 4N5XA 3LK0A 1DJZA 1F55A 1DVIA 4YGAA 3I5GB 2JQ6A 1JF2A 2LLTA 2M0RA 4GUKA 5JOLA 1JWDA 2BCAA 3WHTB 3CWGA 2KI4B 2Y4QA 3FWCA 3KF9A 2KFGA 1JFJA 4N1FA 1Y1UA 1OSAA 4M2QA 1WLMA 1PRWA 1YR5A 2BBMA 2NXQA 2F8PA 2LUCA 3GK2A 1SMGA 3OX6A 1CMFA 2E30A 1SCMB 1S6JA 4Q04A 5HLVA 1WRZA 2LHIA 4OKHA 1QTXA 2LV7A 1BR4B 2MBXA 4PHNA 2SCPA 4HSZA 5AXIA 1E8AA 1WRLA 1B47A 1J1DA 3SG3A 1QV0A 1FPWA 1OMDA 1SK6D 1RROA 2WNDA 2E6WA 1QASA 5G08A 5I2OA 2HQ8A 2BKIB 1B8LA 1YX8A 1KSOA 3JTDB 3EK4A 2KDHA 3EK7A 3CR5X 2AUCA 4ORCB 4PCWA 3SG4A 1AJ4A 1ZACA 1MXLC 2I18A 2MAZA 1FBVA 1XFUO 2KAYA 4GGFC 4PE7A 1A75A 1GQMA 3HX4A 1SNLA 2K2AA 1B1GA 5DKRA 3BOWA 1CFFA 2LCPA 4C0LA 1SW8A 4OR9B 3SIAA 4AQIA 1QX2A 1F8HA 2FCEA 1EG4A 4CLNA 1NIWA 2RGIA 1QX5B 3DD4A 4GGNA 5HKZA 2JT8A 3QRXA 1YUSA 4CFQA 2COLB 1NSHA 3AAKA 2M1UA 2P6BB 1DMOA 1KK8C 1QVIZ 1KQVA 4P2YB 1MR8A 2LMUA 5AFPA 1L7ZA 1H8BA 2Q4UA 5JJGA 5CPVA 5I2LA 1UHNA 1SKTA 2BKHB 2JULA 4D1EA 2K7CA 5CSIA 1KK8B 4DRWA 3DVJA 3RM1A 3A8RA 2KFFA 1IRJA 1UP5A 2DOQA 1K9UA 3VRQA 2JNXA 3DVEA 4N1GA 1J1EA 3AKAA 1LKJA 1NX0A 1M45A 3H4SE 1DGVA 3PM8A 4R1EA 1FI6A 5AANA 3K21A 2HPSA 3BQ3A 3BXKA 1N65A 1AP4A 1FF1A 1JSAA 4PALA 5GQQC 2JRFA 1N0YA 1Y1AA 4JWQA 3NSOA 5CSJA 3HCMA 1RTP1 4F0ZB 4GGFA 1XFXO 2OPOA 3OB2B 3IF7A 1UHJA 5FYXA 1QJTA 1QX7A 3KEVA 5KU1A 1KFXL 2SASA 3LL8B 3DF0B 1XVJA 3VRPA 2WC8A 4NDCA 4MRXA 3EKJA 1EXRA 1UUSA 4MZJA 2K7OA 2Y1NA 1QVIY 4ORAB 3OB1B 2AMIA 1PULA 1TCOB 2TN4A 3JVTC 4NDBA 1WRKA 2BE6A 1G33A 1GGZA 2L50A 1DJXA 4BY4A 2HF5A 1B9AA 2WCFA 1W7JB 2L5XB 1X02A 2V53A 4GPLB 3JVTB 1DGUA 1TCFA 2KYCA 1DT7B 2K7BA 3E3RA 3ZNIA 2KQYA 3CR2A 1NCXA 1UWOA 3CGAA 1L2OC 2F2PA 2M1KB 1M63B 4OCIA 4YI8A 1SCMC 1BODA 3SJSA 2KBIA 4YGBB 3WNXB 2Y5IA 4I5KA 2LC5A 3GK1A 1SPYA 2GV5A 1V1GA 2KNEA 2Y1MA 3OHMB 1R2UA 2L0PA 4MRYA 1BMOA 2LMVA 2LVVA 1YRTB 3SG6A 1SBJA 1C07A 2MLFC 1L2OB 4BY5A 2JOJA 1U5IB 1MHOA 2KAXA 1AK8A 2OS8B 5D69A 2LHLA 1BG1A 3WXAA 1F4QA 3DF0A 1GJYA 3JTDC 2L2EA 3D0YB 1IQ5A 2JT0A 1GGWA 2JU0A 1SL8A 4UPGA 1K96A 4HREE 2LLUA 1MF8B 1MQ1A 1TNXA 1RECA 1KFUL 3TS5C 1IH0A 2KGRA 1TIZA 3C1VA 3EK8A 3D10A 4NDDA 4PHJA 1BR1B 4AQJA 1XYDA 1DJGA 4OVNF 1DJYA 2L4HA 1FI5A 4USLA 2LAPA 4DS7A 2L98A 1C7WA 4WRIA 2KHNA 3TDUA 1WDCC 1XK4C 2CT9A 2FOTA 2LLSA 2A4JA 3TS5B 4QJ4B 1XFYO 3PSRA 1JC2A 1FW4A 3SG5A 2LVJA 2JTZA 4XJKA 1ZUZA 2PMYA 1H4BA 4JPZB 2MA2A 3PFVA 1WDCB 1KK7Z 4XYNA 1OMVA 2BCBA 1R6PA 3BYAA 2L51A 2NZ0A 3I5HC 1S3PA 4HRGA 4M2OA 1UHKA 4ORBB 2MRDA 3BUXB 2MJWB 4P5OE 3EVRA 4A4CA 1K2HA 2CCMA 2O5GA 1CB1A 2JXLA 3NSKA 1NX3A 3TUYC 1U5IA 2JPTA 1SYMA 1CFDA 1CNPA 3I5HB 2ZRSA 2JNFA 4HRHA 1AJ5A 4PHKA 1F71A 4C0KA 2M9GA 1S26D 3LLEA 1LVCD 1BU3A 4MBEA 1SL9A 1M46A 1K9KA 1QLKA 1Q80A 2HQWA 2K61A 3ICBA 4IL1A 1A4PA 3D0YA 3BUNB 3TUYB 5K89A 3EKHA 1RK9A 2WOSA 4PHMA 1IKUA 2OTGC 1F4OA 1F54A 1SR6C 1OOJA 5D7FA 1DF0B 3I5IC 1WY9A 1IGVA 1WLZA 2KYFA 2I94A 1NX2A 2I7AA 5DKNA 1BJFA 2EC6B 1CDNA 1ODBA 2ZN9A 5KSZA 3AAJA 2JZIA 3EVUA 2PSRA 2OTGB 4PDZA 1SR6B 1W7IB 5I2QA 3NSLA 3I5IB 3SG7A 4DUQA 1XO5A 4E68A 1A03A 2GGMA 1YVHA 3PN7B 1B4CA 2M49B 3SG2A 1XK4A 1BOCA 3BUWB 1XFWO 1ZFSA 1AUIB 2O60A 2VRGA 1J7OA 3OP0A 3O2PA 1CLMA 1KK7Y 2CBLA 1CM4A 2LUXA 2QACA 2ZRTA 1CFCA 3VRRA 4MEWA 2L4IA 3KO0A 4MLWA 1QIVA 2JXCA 3CZTX 1A2XA 2BE4A 2EGDA 5TNCA 3I5FC 1B7TY 3DVMA 3TDZA 3EVVA 5ER5A 1YURA 3IQOA 4AOMA 2M3WA 1SCVA 1CDLA 1CLLA 2CXJA 2K7DA 4YBHB 4YGCB 1J7QA 1JUOA 3I5FB 4WQ2A 1KCYA 1K94A 2LMTA 2WCBA 2ZN8A 1G4YR 2D8NA 2F2OA 3AKBA 3KHEA 2KOTA 4ETOA 2G9BA 1LXFC 1NCZA 2KSPA 2PRUA 1S6IA 3BUMB 1SY9A 1J55A 3KPXA 5PALA 2BBNA 1AVSA 3O4YA 1OZOA 5HYDA 2OS8C 1QS7A 1EL4A 2LP2A 4A4BA 1QV1A 1KQMC 4ZCUA 2PASA 1YUTA 3DVKA 1BLQA 4MSPA 1DJIA 2LVIA 1M39A 2KGBC 2M7NA 2F3ZA 1A75B 2LE9B 4NQGA 2LNKA 4PE1A 1KQMB 5HLOA 2LM5A 1Y0VH 3VGOA 3TZ1A 1BT6A 1OQPA 1CM1A 3O78A 2JC2A 4GFTA 2QPTA 1YRUB 1IG5A 1VRKA 1S5GZ 1N2DA 3TDIA 3FIAA 2M29A 1K9PA 1PALA 3GK4X 3LK1A 2JT3A 2K0JA 2M97A 3LCPC 2KAVA 2K2FA 2KBMA 5F6TA 4YI9A 2KI6C 1ZMZA 1IJ6A 3PALA 4GAOA 5J3XA 1B8RA 3PLFB 4C0JA 1MXEA 2G2BA 3WHUB 2EHBA 3BUOB 1F70A 1YX7A 4JQ0D 2FJUB 1QATA 1NCYA 1KWOC 1CTRA 1EH2A 3CS1A 2I2RE 2BECA 1EJ3A 3IQQA 1RFJA 1TNWA 1ZOTB 1NYAA 1TRFA 2H61C 1OMRA 3A4UB 1CFPA 5BPJA 1NPQA 1KWOB 1TOPA 2GGZA 4ICBA 3VROA 2LVKA 4PE4A 4WQ3A 1LINA 5ER4X 2FCDA 5HKYA 1NP8A 1SL7A 3PATA 5HKWA 1Y6WA 4QJ5B 1B7TZ 2F3YA 1YUUA 5CSFA 5AEQA 1PSRA 1XFZO 5B8IB 1CMGA 1V1FA 4ZCVA 1HT9A 2AAOA 2M7LA 1JBAA 3ZWHA 4L9MA 4MVFA 1G8IA 2IS9A 4FTGA 4I5LB 1J7PA 2ISDA 1KSMA 3OX5A 2NCPA 3O6BA 1K8UA 1CLBA 2EC6C 3RLZA 2Q91A 1XFVO 4GNKB 2M8UA 1CDMA 1TTXA 4QJ3B 1CKKA 2MLEC 4MZKA 4TNCA 1KFXS 1S5GY 1UURA 2HETA 1TNPA 1D1OA 2WCEA 3PN7C 4M2PA 3NXAA 5CSNA 3SIBA 1HQVA 2WORA 4CFRA 1IQ3A 2CNPA 2KQ6A 2F33A 4DCKA 2LP3A 1IJ5A 1JF0A 1EG3A 1TN4A 1A29A 1NX1A 3FWBA 4DIRA 1IWQA 3CTNA 3FS7A 2ZNEA 1S36A 1CDPA 3MSEB 1UHIA 1K90D 1JFKA 1PK0D 1UHHA 4PE0A 4U8DA 4YGEB 1ALWA 1YVLA 1OE9B 1TNQA 5KTYA 1DJHA 2ZFDA 2H61A 3VRNA 4MZLA 2JWWA 1RJVA 4YGDB 2BL0C 1MUXA 3NSIA
chains in the Genus database with same CATH superfamily
1J7RA 4I5JA 1Y1XA 2QEBA 1PSBA 2NLNA 1MWNA 4CPVA 3V2LA 2H2KA 1LA3A 3R72A 2PALA 1OZSA 5IBWA 5FI6A 1PVBA 2BL0B 2MHHA 3F45A 1DTLA 1PVAA 4GBAA 1RWYA 2CTNA 1YTZC 1DF0A 4I5NB 2BCXA 1SRAA 2NCOA 2WCJA 3EG5B 4CIDA 4MN0A 2B1UA 1NUBA 5I8NA 3CR4X 1QIWA 3B88A 1QLSA 3PJIA 1K95A 1KFUS 1NWDA 1BF5A 2K8MB 1S6CA 2KFHA 2ZKMX 3GOFA 1DELA 2GTEA 1C7VA 4FQOA 1M31A 1XA5A 2JTTA 4YRUA 1S1EA 4OV2A 2ZNDA 3I5GC 5AERA 2PVBA 1ALVA 1OOFA 2R2IA 5DKQA 3N7HA 3CLNA 2KI4C 1DJWA 1K93D 1QXPA 4XJKB 1AHRA 1LA0A 2LANA 1B8CA 3BOWB 3M0WA 2KI6D 4N5XA 3LK0A 3UNWA 1DJZA 1F55A 1DVIA 4YGAA 3I5GB 2JQ6A 1JF2A 2LLTA 2M0RA 4GUKA 5JOLA 1JWDA 2BCAA 3WHTB 3OBVA 3CWGA 2KI4B 2Y4QA 3IVTA 3FWCA 3KF9A 2KFGA 1JFJA 4N1FA 1Y1UA 1OSAA 4M2QA 2P70A 1WLMA 2L2CA 1PRWA 1YR5A 2BBMA 2NXQA 2F8PA 2LUCA 3B86A 3GK2A 4FQTA 1SMGA 3OX6A 1CMFA 2E30A 1SCMB 1S6JA 4Q04A 5HLVA 1WRZA 2LHIA 4OKHA 1QTXA 2LV7A 1BR4B 2MBXA 1P28A 4PHNA 2SCPA 4HSZA 5AXIA 3D77A 1E8AA 1WRLA 4JKTA 1B47A 1J1DA 3SG3A 1QV0A 1FPWA 1OMDA 1SK6D 1RROA 2WNDA 2E6WA 1QASA 5G08A 5I2OA 2HQ8A 2BKIB 1B8LA 1YX8A 1KSOA 2KLDA 3JTDB 3EK4A 2KDHA 3EK7A 3CR5X 2AUCA 4ORCB 4PCWA 3DY9A 3SG4A 1AJ4A 1ZACA 5I94A 1MXLC 2I18A 2WCMA 2MAZA 1FBVA 1XFUO 2KAYA 4GGFC 4PE7A 1A75A 1GQMA 3HX4A 2WC5A 1SNLA 2K2AA 1B1GA 5DKRA 3BOWA 1CFFA 1C3ZA 2LCPA 4C0LA 1SW8A 4OR9B 3SIAA 4AQIA 1QX2A 1F8HA 2FCEA 1EG4A 4CLNA 1NIWA 2RGIA 3S0DA 1QX5B 3DD4A 4GGNA 5HKZA 2JT8A 3QRXA 1YUSA 4CFQA 2COLB 1NSHA 3AAKA 2M1UA 2P6BB 1DMOA 1KK8C 1QVIZ 1KQVA 4P2YB 1MR8A 2LMUA 5AFPA 1L7ZA 1H8BA 2Q4UA 5JJGA 5CPVA 5I2LA 3CYZA 1UHNA 1SKTA 2BKHB 2JULA 2ERBA 2K7CA 4D1EA 5CSIA 1KK8B 4DRWA 5EL2A 3DVJA 3OGNA 3RM1A 3A8RA 3SS5A 2KFFA 1IRJA 1UP5A 2DOQA 1K9UA 3S0FA 3VRQA 2JNXA 3DVEA 1OOIX 4N1GA 1J1EA 3AKAA 1LKJA 1NX0A 1M45A 3H4SE 1DGVA 3PM8A 4R1EA 1FI6A 5AANA 3K21A 2HPSA 3BQ3A 3BXKA 1N65A 1AP4A 1DC1A 2WCHA 1FF1A 1JSAA 3NHTA 4PALA 3BFAA 5GQQC 2JRFA 3NGVA 1N0YA 1Y1AA 1DQEA 4JWQA 3NSOA 5CSJA 3HCMA 1RTP1 4F0ZB 2QEHA 1XFXO 2OPOA 4GGFA 3SS3A 3OB2B 3IF7A 1UHJA 5FYXA 1QJTA 1QX7A 3KEVA 5KU1A 1KFXL 2SASA 1QWVA 3LL8B 3DF0B 1SSEB 1XVJA 3VRPA 2WC8A 4NDCA 4MRXA 3EKJA 1EXRA 1UUSA 4MZJA 2K7OA 1TUZA 2Y1NA 4F7FA 1QVIY 3D78A 3VB1A 4ORAB 3OB1B 2AMIA 1PULA 1TCOB 2TN4A 3JVTC 4NDBA 1WRKA 2BE6A 3K1EA 1G33A 1GGZA 2L50A 1DJXA 4BY4A 2HF5A 1OOHA 1B9AA 2WCFA 1W7JB 2L5XB 1X02A 2V53A 4GPLB 3JVTB 2BNXA 1DGUA 1TCFA 2KYCA 1OOGA 3B7AA 2K7BA 1DT7B 3E3RA 3ZNIA 2KQYA 3CR2A 1NCXA 1UWOA 3CGAA 1L2OC 2F2PA 2M1KB 1M63B 4OCIA 4YI8A 1SCMC 1BODA 3SJSA 2KBIA 4YGBB 3WNXB 2Y5IA 2BAPA 3R1VA 4I5KA 2LC5A 3GK1A 1SPYA 5HL1A 2GV5A 1V1GA 2KNEA 2Y1MA 3OHMB 1R2UA 2L0PA 4MRYA 1BMOA 2LMVA 2LVVA 1YRTB 4JD9A 1SBJA 5DICA 3SG6A 2MLFC 3TDUA 1L2OB 4BY5A 3CZ2A 2JOJA 1U5IB 1MHOA 2KAXA 1LS8A 1AK8A 2OS8B 5D69A 2LHLA 1BG1A 3WXAA 1F4QA 3DF0A 1GJYA 3JTDC 2L2EA 3D0YB 1IQ5A 2JT0A 1GGWA 2JU0A 1SL8A 4PT1A 4UPGA 1K96A 4HREE 2LLUA 1MF8B 1MQ1A 2QDIA 2WCKA 2KPHA 1TNXA 3O4XA 1RECA 1KFUL 3TS5C 1IH0A 3D73A 2KGRA 1TIZA 3C1VA 3EK8A 3D10A 4NDDA 4PHJA 1BR1B 4AQJA 1XYDA 1DJGA 4OVNF 1DJYA 2L4HA 5D3OA 4USLA 2LAPA 1FI5A 4DS7A 2L98A 1C7WA 3R1PA 2KHNA 4WRIA 1WDCC 1XK4C 2CT9A 2FOTA 2LLSA 3BJHA 2A4JA 3TS5B 4QJ4B 1XFYO 3PSRA 1JC2A 1GM0A 1FW4A 3SG5A 2LVJA 2JTZA 4XJKA 1ZUZA 2PMYA 1H4BA 4JPZB 3S0GA 2MA2A 4IJ7A 3PFVA 1WDCB 1KK7Z 4XYNA 1OMVA 3S0AA 2BCBA 1R6PA 3BYAA 2L51A 2NZ0A 3I5HC 1S3PA 4HRGA 4M2OA 1UHKA 3DZTA 4ORBB 1Z2CB 2MRDA 3BUXB 2MJWB 4P5OE 3EVRA 4A4CA 1K2HA 1W9ZA 2CCMA 2O5GA 2JXLA 3NSKA 1CB1A 1NX3A 3TUYC 1U5IA 2JPTA 1SYMA 1CFDA 1CNPA 3I5HB 2ZRSA 2JNFA 4HRHA 1AJ5A 4PHKA 1F71A 4C0KA 2M9GA 1S26D 3LLEA 1LVCD 1BU3A 3L4LA 1SL9A 1M46A 4MBEA 1K9KA 1QLKA 1Q80A 2HQWA 2K61A 3ICBA 4IL1A 1A4PA 3D0YA 3BUNB 3TUYB 5K89A 3EKHA 1C07A 1OW4A 1RK9A 2WOSA 4PHMA 1IKUA 2OTGC 1F4OA 1F54A 1SR6C 1OOJA 3PM2A 4INWA 5D7FA 1DF0B 3I5IC 1WY9A 1IGVA 1WLZA 3SS4A 2KYFA 2I94A 1NX2A 2I7AA 5DKNA 1BJFA 2EC6B 1CDNA 1ODBA 2ZN9A 2QEOA 5KSZA 3AAJA 3Q8IA 2JZIA 3EVUA 2PSRA 2K60A 2OTGB 4PDZA 1SR6B 1W7IB 5I2QA 3NSLA 1ORGA 3I5IB 3SG7A 4DUQA 1XO5A 4E68A 1A03A 2GGMA 1YVHA 3PN7B 1B4CA 2M49B 3SG2A 1XK4A 1BOCA 3BUWB 1XFWO 1ZFSA 1AUIB 2O60A 2VRGA 1J7OA 1T14A 3OP0A 3O2PA 1CLMA 1KK7Y 2CBLA 1CM4A 2LUXA 2QACA 2ZRTA 1CFCA 3VRRA 4MEWA 2L4IA 5FI2A 3KO0A 4MLWA 1QIVA 2JXCA 3CZTX 1A2XA 2BE4A 3S0BA 2EGDA 2WCLA 5TNCA 3I5FC 1B7TY 3DVMA 3R1OA 3TDZA 3EVVA 5ER5A 1YURA 2KLEA 3IQOA 4AOMA 2M3WA 1SCVA 1CDLA 1CLLA 2CXJA 2K7DA 4YBHB 3FE6A 4YGCB 3L47A 1J7QA 1JUOA 3I5FB 4WQ2A 1KCYA 1K94A 2LMTA 2WCBA 2ZN8A 1G4YR 2D8NA 2F2OA 3AKBA 3KHEA 2KOTA 4ETOA 2G9BA 1LXFC 1NCZA 2KSPA 2PRUA 3BFHA 1S6IA 3BUMB 1SY9A 1J55A 3KPXA 3NHIA 5PALA 2BBNA 1AVSA 3O4YA 1OZOA 5HYDA 2OS8C 1QS7A 1EL4A 2LP2A 2P71A 4A4BA 1QV1A 1KQMC 2JPOA 1TUJA 4ZCUA 2PASA 1YUTA 3DVKA 1BLQA 4MSPA 1DJIA 2LVIA 3D74A 1M39A 2KGBC 2M7NA 2F3ZA 1A75B 3CDNA 2LE9B 4NQGA 2LNKA 4PE1A 1KQMB 5HLOA 1DEKA 2LM5A 1Y0VH 3VGOA 3TZ1A 1BT6A 1OQPA 1XFRA 1CM1A 3O78A 2JC2A 4GFTA 2QPTA 1YRUB 1IG5A 1VRKA 1S5GZ 1N2DA 3TDIA 3FIAA 2M29A 1K9PA 1PALA 3GK4X 3LK1A 2JT3A 2K0JA 2PYQA 3S0EA 2M97A 3LCPC 2KAVA 4OZDA 2K2FA 2KBMA 5F6TA 4YI9A 2KI6C 1ZMZA 1IJ6A 3PALA 4GAOA 5J3XA 3CZ1A 3B87A 1B8RA 3PLFB 4C0JA 1MXEA 3BFBA 2G2BA 4INXA 3WHUB 3FE9A 2EHBA 3DYEA 3BUOB 2WC6A 1F70A 1YX7A 4JQ0D 2FJUB 1QATA 1NCYA 1KWOC 3B6XA 1CTRA 1EH2A 3CS1A 2I2RE 2BECA 1EJ3A 3IQQA 4KYNA 1RFJA 1TNWA 2H8VA 1ZOTB 1NYAA 1TRFA 2H61C 1OMRA 3RZSA 3A4UB 1CFPA 5BPJA 1NPQA 1KWOB 1TOPA 2GGZA 4ICBA 3VROA 2LVKA 4PE4A 4WQ3A 1LINA 5ER4X 2FCDA 5HKYA 1NP8A 1SL7A 3PATA 5HKWA 1Y6WA 4QJ5B 1B7TZ 2F3YA 1YUUA 5CSFA 5AEQA 1PSRA 1XFZO 2FJYA 5B8IB 1CMGA 1V1FA 4ZCVA 1HT9A 2AAOA 2M7LA 1JBAA 3UO9A 3ZWHA 4L9MA 4MVFA 1G8IA 2IS9A 4FTGA 4I5LB 1J7PA 2YGUA 2ISDA 1KSMA 3D76A 3DXLA 3OX5A 2NCPA 5FI7A 3O6BA 1K8UA 1CLBA 2EC6C 3CZ0A 3RLZA 1Z4HA 2Q91A 1XFVO 4GNKB 2M8UA 1CDMA 1TTXA 4QJ3B 1CKKA 2MLEC 3QMEA 4MZKA 3FE8A 4TNCA 1KFXS 1S5GY 1UURA 2HETA 1TNPA 1D1OA 2WCEA 3PN7C 4M2PA 1C3YA 3NXAA 1TWOA 5CSNA 3SIBA 1HQVA 2WORA 4CFRA 1IQ3A 3CABA 2CNPA 2KQ6A 2F33A 4DCKA 2LP3A 2PQLA 1IJ5A 1JF0A 1EG3A 1TN4A 1A29A 1NX1A 3FWBA 4DIRA 1IWQA 3CTNA 3FS7A 3D75A 2ZNEA 1S36A 1CDPA 3MSEB 1IIOA 1UHIA 1K90D 2L5YA 1JFKA 1PK0D 1UHHA 4PE0A 4U8DA 4YGEB 1ALWA 1YVLA 1OE9B 1TNQA 3L4AA 5KTYA 2QEVA 1DJHA 2ZFDA 2H61A 3VRNA 4MZLA 2JWWA 1RJVA 4YGDB 2BL0C 1MUXA 3NSIA
chains in the Genus database with same CATH topology
1J7RA 4I5JA 1Y1XA 1PSBA 2NLNA 1MWNA 4CPVA 2H2KA 1LA3A 2PALA 1OZSA 5IBWA 1PVBA 2BL0B 2MHHA 3F45A 1DTLA 1PVAA 4GBAA 1RWYA 2CTNA 1YTZC 1DF0A 4I5NB 2BCXA 1SRAA 2NCOA 4CIDA 4MN0A 2B1UA 1NUBA 5I8NA 3CR4X 1QIWA 1QLSA 1K95A 1KFUS 1NWDA 1BF5A 2K8MB 1S6CA 2KFHA 2ZKMX 3GOFA 1C7VA 4FQOA 1M31A 1XA5A 2JTTA 4YRUA 1S1EA 4OV2A 2ZNDA 3I5GC 5AERA 2PVBA 1ALVA 2R2IA 5DKQA 3CLNA 2KI4C 1DJWA 1K93D 1QXPA 4XJKB 1AHRA 1LA0A 2LANA 1B8CA 3BOWB 3M0WA 2KI6D 4N5XA 3LK0A 1DJZA 1F55A 1DVIA 4YGAA 3I5GB 2JQ6A 1JF2A 2LLTA 2M0RA 4GUKA 5JOLA 1JWDA 2BCAA 3WHTB 3CWGA 2KI4B 2Y4QA 3FWCA 3KF9A 2KFGA 1JFJA 4N1FA 1Y1UA 1OSAA 4M2QA 1WLMA 1PRWA 1YR5A 2BBMA 2NXQA 2F8PA 2LUCA 3GK2A 1SMGA 3OX6A 1CMFA 2E30A 1SCMB 1S6JA 4Q04A 5HLVA 1WRZA 2LHIA 4OKHA 1QTXA 2LV7A 1BR4B 2MBXA 4PHNA 2SCPA 4HSZA 5AXIA 1E8AA 1WRLA 1B47A 1J1DA 3SG3A 1QV0A 1FPWA 1OMDA 1SK6D 1RROA 2WNDA 2E6WA 1QASA 5G08A 5I2OA 2HQ8A 2BKIB 1B8LA 1YX8A 1KSOA 3JTDB 3EK4A 2KDHA 3EK7A 3CR5X 2AUCA 4ORCB 4PCWA 3SG4A 1AJ4A 1ZACA 1MXLC 2I18A 2MAZA 1FBVA 1XFUO 2KAYA 4GGFC 4PE7A 1A75A 1GQMA 3HX4A 1SNLA 2K2AA 1B1GA 5DKRA 3BOWA 1CFFA 2LCPA 4C0LA 1SW8A 4OR9B 3SIAA 4AQIA 1QX2A 1F8HA 2FCEA 1EG4A 4CLNA 1NIWA 2RGIA 1QX5B 3DD4A 4GGNA 5HKZA 2JT8A 3QRXA 1YUSA 4CFQA 2COLB 1NSHA 3AAKA 2M1UA 2P6BB 1DMOA 1KK8C 1QVIZ 1KQVA 4P2YB 1MR8A 2LMUA 5AFPA 1L7ZA 1H8BA 2Q4UA 5JJGA 5CPVA 5I2LA 1UHNA 1SKTA 2BKHB 2JULA 4D1EA 2K7CA 5CSIA 1KK8B 4DRWA 3DVJA 3RM1A 3A8RA 2KFFA 1IRJA 1UP5A 2DOQA 1K9UA 3VRQA 2JNXA 3DVEA 4N1GA 1J1EA 3AKAA 1LKJA 1NX0A 1M45A 3H4SE 1DGVA 3PM8A 4R1EA 1FI6A 5AANA 3K21A 2HPSA 3BQ3A 3BXKA 1N65A 1AP4A 1FF1A 1JSAA 4PALA 5GQQC 2JRFA 1N0YA 1Y1AA 4JWQA 3NSOA 5CSJA 3HCMA 1RTP1 4F0ZB 4GGFA 1XFXO 2OPOA 3OB2B 3IF7A 1UHJA 5FYXA 1QJTA 1QX7A 3KEVA 5KU1A 1KFXL 2SASA 3LL8B 3DF0B 1XVJA 3VRPA 2WC8A 4NDCA 4MRXA 3EKJA 1EXRA 1UUSA 4MZJA 2K7OA 2Y1NA 1QVIY 4ORAB 3OB1B 2AMIA 1PULA 1TCOB 2TN4A 3JVTC 4NDBA 1WRKA 2BE6A 1G33A 1GGZA 2L50A 1DJXA 4BY4A 2HF5A 1B9AA 2WCFA 1W7JB 2L5XB 1X02A 2V53A 4GPLB 3JVTB 1DGUA 1TCFA 2KYCA 1DT7B 2K7BA 3E3RA 3ZNIA 2KQYA 3CR2A 1NCXA 1UWOA 3CGAA 1L2OC 2F2PA 2M1KB 1M63B 4OCIA 4YI8A 1SCMC 1BODA 3SJSA 2KBIA 4YGBB 3WNXB 2Y5IA 4I5KA 2LC5A 3GK1A 1SPYA 2GV5A 1V1GA 2KNEA 2Y1MA 3OHMB 1R2UA 2L0PA 4MRYA 1BMOA 2LMVA 2LVVA 1YRTB 3SG6A 1SBJA 1C07A 2MLFC 1L2OB 4BY5A 2JOJA 1U5IB 1MHOA 2KAXA 1AK8A 2OS8B 5D69A 2LHLA 1BG1A 3WXAA 1F4QA 3DF0A 1GJYA 3JTDC 2L2EA 3D0YB 1IQ5A 2JT0A 1GGWA 2JU0A 1SL8A 4UPGA 1K96A 4HREE 2LLUA 1MF8B 1MQ1A 1TNXA 1RECA 1KFUL 3TS5C 1IH0A 2KGRA 1TIZA 3C1VA 3EK8A 3D10A 4NDDA 4PHJA 1BR1B 4AQJA 1XYDA 1DJGA 4OVNF 1DJYA 2L4HA 1FI5A 4USLA 2LAPA 4DS7A 2L98A 1C7WA 4WRIA 2KHNA 3TDUA 1WDCC 1XK4C 2CT9A 2FOTA 2LLSA 2A4JA 3TS5B 4QJ4B 1XFYO 3PSRA 1JC2A 1FW4A 3SG5A 2LVJA 2JTZA 4XJKA 1ZUZA 2PMYA 1H4BA 4JPZB 2MA2A 3PFVA 1WDCB 1KK7Z 4XYNA 1OMVA 2BCBA 1R6PA 3BYAA 2L51A 2NZ0A 3I5HC 1S3PA 4HRGA 4M2OA 1UHKA 4ORBB 2MRDA 3BUXB 2MJWB 4P5OE 3EVRA 4A4CA 1K2HA 2CCMA 2O5GA 1CB1A 2JXLA 3NSKA 1NX3A 3TUYC 1U5IA 2JPTA 1SYMA 1CFDA 1CNPA 3I5HB 2ZRSA 2JNFA 4HRHA 1AJ5A 4PHKA 1F71A 4C0KA 2M9GA 1S26D 3LLEA 1LVCD 1BU3A 4MBEA 1SL9A 1M46A 1K9KA 1QLKA 1Q80A 2HQWA 2K61A 3ICBA 4IL1A 1A4PA 3D0YA 3BUNB 3TUYB 5K89A 3EKHA 1RK9A 2WOSA 4PHMA 1IKUA 2OTGC 1F4OA 1F54A 1SR6C 1OOJA 5D7FA 1DF0B 3I5IC 1WY9A 1IGVA 1WLZA 2KYFA 2I94A 1NX2A 2I7AA 5DKNA 1BJFA 2EC6B 1CDNA 1ODBA 2ZN9A 5KSZA 3AAJA 2JZIA 3EVUA 2PSRA 2OTGB 4PDZA 1SR6B 1W7IB 5I2QA 3NSLA 3I5IB 3SG7A 4DUQA 1XO5A 4E68A 1A03A 2GGMA 1YVHA 3PN7B 1B4CA 2M49B 3SG2A 1XK4A 1BOCA 3BUWB 1XFWO 1ZFSA 1AUIB 2O60A 2VRGA 1J7OA 3OP0A 3O2PA 1CLMA 1KK7Y 2CBLA 1CM4A 2LUXA 2QACA 2ZRTA 1CFCA 3VRRA 4MEWA 2L4IA 3KO0A 4MLWA 1QIVA 2JXCA 3CZTX 1A2XA 2BE4A 2EGDA 5TNCA 3I5FC 1B7TY 3DVMA 3TDZA 3EVVA 5ER5A 1YURA 3IQOA 4AOMA 2M3WA 1SCVA 1CDLA 1CLLA 2CXJA 2K7DA 4YBHB 4YGCB 1J7QA 1JUOA 3I5FB 4WQ2A 1KCYA 1K94A 2LMTA 2WCBA 2ZN8A 1G4YR 2D8NA 2F2OA 3AKBA 3KHEA 2KOTA 4ETOA 2G9BA 1LXFC 1NCZA 2KSPA 2PRUA 1S6IA 3BUMB 1SY9A 1J55A 3KPXA 5PALA 2BBNA 1AVSA 3O4YA 1OZOA 5HYDA 2OS8C 1QS7A 1EL4A 2LP2A 4A4BA 1QV1A 1KQMC 4ZCUA 2PASA 1YUTA 3DVKA 1BLQA 4MSPA 1DJIA 2LVIA 1M39A 2KGBC 2M7NA 2F3ZA 1A75B 2LE9B 4NQGA 2LNKA 4PE1A 1KQMB 5HLOA 2LM5A 1Y0VH 3VGOA 3TZ1A 1BT6A 1OQPA 1CM1A 3O78A 2JC2A 4GFTA 2QPTA 1YRUB 1IG5A 1VRKA 1S5GZ 1N2DA 3TDIA 3FIAA 2M29A 1K9PA 1PALA 3GK4X 3LK1A 2JT3A 2K0JA 2M97A 3LCPC 2KAVA 2K2FA 2KBMA 5F6TA 4YI9A 2KI6C 1ZMZA 1IJ6A 3PALA 4GAOA 5J3XA 1B8RA 3PLFB 4C0JA 1MXEA 2G2BA 3WHUB 2EHBA 3BUOB 1F70A 1YX7A 4JQ0D 2FJUB 1QATA 1NCYA 1KWOC 1CTRA 1EH2A 3CS1A 2I2RE 2BECA 1EJ3A 3IQQA 1RFJA 1TNWA 1ZOTB 1NYAA 1TRFA 2H61C 1OMRA 3A4UB 1CFPA 5BPJA 1NPQA 1KWOB 1TOPA 2GGZA 4ICBA 3VROA 2LVKA 4PE4A 4WQ3A 1LINA 5ER4X 2FCDA 5HKYA 1NP8A 1SL7A 3PATA 5HKWA 1Y6WA 4QJ5B 1B7TZ 2F3YA 1YUUA 5CSFA 5AEQA 1PSRA 1XFZO 5B8IB 1CMGA 1V1FA 4ZCVA 1HT9A 2AAOA 2M7LA 1JBAA 3ZWHA 4L9MA 4MVFA 1G8IA 2IS9A 4FTGA 4I5LB 1J7PA 2ISDA 1KSMA 3OX5A 2NCPA 3O6BA 1K8UA 1CLBA 2EC6C 3RLZA 2Q91A 1XFVO 4GNKB 2M8UA 1CDMA 1TTXA 4QJ3B 1CKKA 2MLEC 4MZKA 4TNCA 1KFXS 1S5GY 1UURA 2HETA 1TNPA 1D1OA 2WCEA 3PN7C 4M2PA 3NXAA 5CSNA 3SIBA 1HQVA 2WORA 4CFRA 1IQ3A 2CNPA 2KQ6A 2F33A 4DCKA 2LP3A 1IJ5A 1JF0A 1EG3A 1TN4A 1A29A 1NX1A 3FWBA 4DIRA 1IWQA 3CTNA 3FS7A 2ZNEA 1S36A 1CDPA 3MSEB 1UHIA 1K90D 1JFKA 1PK0D 1UHHA 4PE0A 4U8DA 4YGEB 1ALWA 1YVLA 1OE9B 1TNQA 5KTYA 1DJHA 2ZFDA 2H61A 3VRNA 4MZLA 2JWWA 1RJVA 4YGDB 2BL0C 1MUXA 3NSIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1J7R A;  4I5J A;  1Y1X A;  1PSB A;  2NLN A;  1MWN A;  4CPV A;  2H2K A;  1LA3 A;  2PAL A;  1OZS A;  5IBW A;  1PVB A;  2BL0 B;  2MHH A;  3F45 A;  1DTL A;  1PVA A;  4GBA A;  1RWY A;  2CTN A;  1YTZ C;  1DF0 A;  4I5N B;  2BCX A;  1SRA A;  2NCO A;  4CID A;  4MN0 A;  2B1U A;  1NUB A;  5I8N A;  3CR4 X;  1QIW A;  1QLS A;  1K95 A;  1KFU S;  1NWD A;  1BF5 A;  2K8M B;  1S6C A;  2KFH A;  2ZKM X;  3GOF A;  1C7V A;  4FQO A;  1M31 A;  1XA5 A;  2JTT A;  4YRU A;  1S1E A;  4OV2 A;  2ZND A;  3I5G C;  5AER A;  2PVB A;  1ALV A;  2R2I A;  5DKQ A;  3CLN A;  2KI4 C;  1DJW A;  1K93 D;  1QXP A;  4XJK B;  1AHR A;  1LA0 A;  2LAN A;  1B8C A;  3BOW B;  3M0W A;  2KI6 D;  4N5X A;  3LK0 A;  1DJZ A;  1F55 A;  1DVI A;  4YGA A;  3I5G B;  2JQ6 A;  1JF2 A;  2LLT A;  2M0R A;  4GUK A;  5JOL A;  1JWD A;  2BCA A;  3WHT B;  3CWG A;  2KI4 B;  2Y4Q A;  3FWC A;  3KF9 A;  2KFG A;  1JFJ A;  4N1F A;  1Y1U A;  1OSA A;  4M2Q A;  1WLM A;  1PRW A;  1YR5 A;  2BBM A;  2NXQ A;  2F8P A;  2LUC A;  3GK2 A;  1SMG A;  3OX6 A;  1CMF A;  2E30 A;  1SCM B;  1S6J A;  4Q04 A;  5HLV A;  1WRZ A;  2LHI A;  4OKH A;  1QTX A;  2LV7 A;  1BR4 B;  2MBX A;  4PHN A;  2SCP A;  4HSZ A;  5AXI A;  1E8A A;  1WRL A;  1B47 A;  1J1D A;  3SG3 A;  1QV0 A;  1FPW A;  1OMD A;  1SK6 D;  1RRO A;  2WND A;  2E6W A;  1QAS A;  5G08 A;  5I2O A;  2HQ8 A;  2BKI B;  1B8L A;  1YX8 A;  1KSO A;  3JTD B;  3EK4 A;  2KDH A;  3EK7 A;  3CR5 X;  2AUC A;  4ORC B;  4PCW A;  3SG4 A;  1AJ4 A;  1ZAC A;  1MXL C;  2I18 A;  2MAZ A;  1FBV A;  1XFU O;  2KAY A;  4GGF C;  4PE7 A;  1A75 A;  1GQM A;  3HX4 A;  1SNL A;  2K2A A;  1B1G A;  5DKR A;  3BOW A;  1CFF A;  2LCP A;  4C0L A;  1SW8 A;  4OR9 B;  3SIA A;  4AQI A;  1QX2 A;  1F8H A;  2FCE A;  1EG4 A;  4CLN A;  1NIW A;  2RGI A;  1QX5 B;  3DD4 A;  4GGN A;  5HKZ A;  2JT8 A;  3QRX A;  1YUS A;  4CFQ A;  2COL B;  1NSH A;  3AAK A;  2M1U A;  2P6B B;  1DMO A;  1KK8 C;  1QVI Z;  1KQV A;  4P2Y B;  1MR8 A;  2LMU A;  5AFP A;  1L7Z A;  1H8B A;  2Q4U A;  5JJG A;  5CPV A;  5I2L A;  1UHN A;  1SKT A;  2BKH B;  2JUL A;  4D1E A;  2K7C A;  5CSI A;  1KK8 B;  4DRW A;  3DVJ A;  3RM1 A;  3A8R A;  2KFF A;  1IRJ A;  1UP5 A;  2DOQ A;  1K9U A;  3VRQ A;  2JNX A;  3DVE A;  4N1G A;  1J1E A;  3AKA A;  1LKJ A;  1NX0 A;  1M45 A;  3H4S E;  1DGV A;  3PM8 A;  4R1E A;  1FI6 A;  5AAN A;  3K21 A;  2HPS A;  3BQ3 A;  3BXK A;  1N65 A;  1AP4 A;  1FF1 A;  1JSA A;  4PAL A;  5GQQ C;  2JRF A;  1N0Y A;  1Y1A A;  4JWQ A;  3NSO A;  5CSJ A;  3HCM A;  1RTP 1;  4F0Z B;  4GGF A;  1XFX O;  2OPO A;  3OB2 B;  3IF7 A;  1UHJ A;  5FYX A;  1QJT A;  1QX7 A;  3KEV A;  5KU1 A;  1KFX L;  2SAS A;  3LL8 B;  3DF0 B;  1XVJ A;  3VRP A;  2WC8 A;  4NDC A;  4MRX A;  3EKJ A;  1EXR A;  1UUS A;  4MZJ A;  2K7O A;  2Y1N A;  1QVI Y;  4ORA B;  3OB1 B;  2AMI A;  1PUL A;  1TCO B;  2TN4 A;  3JVT C;  4NDB A;  1WRK A;  2BE6 A;  1G33 A;  1GGZ A;  2L50 A;  1DJX A;  4BY4 A;  2HF5 A;  1B9A A;  2WCF A;  1W7J B;  2L5X B;  1X02 A;  2V53 A;  4GPL B;  3JVT B;  1DGU A;  1TCF A;  2KYC A;  1DT7 B;  2K7B A;  3E3R A;  3ZNI A;  2KQY A;  3CR2 A;  1NCX A;  1UWO A;  3CGA A;  1L2O C;  2F2P A;  2M1K B;  1M63 B;  4OCI A;  4YI8 A;  1SCM C;  1BOD A;  3SJS A;  2KBI A;  4YGB B;  3WNX B;  2Y5I A;  4I5K A;  2LC5 A;  3GK1 A;  1SPY A;  2GV5 A;  1V1G A;  2KNE A;  2Y1M A;  3OHM B;  1R2U A;  2L0P A;  4MRY A;  1BMO A;  2LMV A;  2LVV A;  1YRT B;  3SG6 A;  1SBJ A;  1C07 A;  2MLF C;  1L2O B;  4BY5 A;  2JOJ A;  1U5I B;  1MHO A;  2KAX A;  1AK8 A;  2OS8 B;  5D69 A;  2LHL A;  1BG1 A;  3WXA A;  1F4Q A;  3DF0 A;  1GJY A;  3JTD C;  2L2E A;  3D0Y B;  1IQ5 A;  2JT0 A;  1GGW A;  2JU0 A;  1SL8 A;  4UPG A;  1K96 A;  4HRE E;  2LLU A;  1MF8 B;  1MQ1 A;  1TNX A;  1REC A;  1KFU L;  3TS5 C;  1IH0 A;  2KGR A;  1TIZ A;  3C1V A;  3EK8 A;  3D10 A;  4NDD A;  4PHJ A;  1BR1 B;  4AQJ A;  1XYD A;  1DJG A;  4OVN F;  1DJY A;  2L4H A;  1FI5 A;  4USL A;  2LAP A;  4DS7 A;  2L98 A;  1C7W A;  4WRI A;  2KHN A;  3TDU A;  1WDC C;  1XK4 C;  2CT9 A;  2FOT A;  2LLS A;  2A4J A;  3TS5 B;  4QJ4 B;  1XFY O;  3PSR A;  1JC2 A;  1FW4 A;  3SG5 A;  2LVJ A;  2JTZ A;  4XJK A;  1ZUZ A;  2PMY A;  1H4B A;  4JPZ B;  2MA2 A;  3PFV A;  1WDC B;  1KK7 Z;  4XYN A;  1OMV A;  2BCB A;  1R6P A;  3BYA A;  2L51 A;  2NZ0 A;  3I5H C;  1S3P A;  4HRG A;  4M2O A;  1UHK A;  4ORB B;  2MRD A;  3BUX B;  2MJW B;  4P5O E;  3EVR A;  4A4C A;  1K2H A;  2CCM A;  2O5G A;  1CB1 A;  2JXL A;  3NSK A;  1NX3 A;  3TUY C;  1U5I A;  2JPT A;  1SYM A;  1CFD A;  1CNP A;  3I5H B;  2ZRS A;  2JNF A;  4HRH A;  1AJ5 A;  4PHK A;  1F71 A;  4C0K A;  2M9G A;  1S26 D;  3LLE A;  1LVC D;  1BU3 A;  4MBE A;  1SL9 A;  1M46 A;  1K9K A;  1QLK A;  1Q80 A;  2HQW A;  2K61 A;  3ICB A;  4IL1 A;  1A4P A;  3D0Y A;  3BUN B;  3TUY B;  5K89 A;  3EKH A;  1RK9 A;  2WOS A;  4PHM A;  1IKU A;  2OTG C;  1F4O A;  1F54 A;  1SR6 C;  1OOJ A;  5D7F A;  1DF0 B;  3I5I C;  1WY9 A;  1IGV A;  1WLZ A;  2KYF A;  2I94 A;  1NX2 A;  2I7A A;  5DKN A;  1BJF A;  2EC6 B;  1CDN A;  1ODB A;  2ZN9 A;  5KSZ A;  3AAJ A;  2JZI A;  3EVU A;  2PSR A;  2OTG B;  4PDZ A;  1SR6 B;  1W7I B;  5I2Q A;  3NSL A;  3I5I B;  3SG7 A;  4DUQ A;  1XO5 A;  4E68 A;  1A03 A;  2GGM A;  1YVH A;  3PN7 B;  1B4C A;  2M49 B;  3SG2 A;  1XK4 A;  1BOC A;  3BUW B;  1XFW O;  1ZFS A;  1AUI B;  2O60 A;  2VRG A;  1J7O A;  3OP0 A;  3O2P A;  1CLM A;  1KK7 Y;  2CBL A;  1CM4 A;  2LUX A;  2QAC A;  2ZRT A;  1CFC A;  3VRR A;  4MEW A;  2L4I A;  3KO0 A;  4MLW A;  1QIV A;  2JXC A;  3CZT X;  1A2X A;  2BE4 A;  2EGD A;  5TNC A;  3I5F C;  1B7T Y;  3DVM A;  3TDZ A;  3EVV A;  5ER5 A;  1YUR A;  3IQO A;  4AOM A;  2M3W A;  1SCV A;  1CDL A;  1CLL A;  2CXJ A;  2K7D A;  4YBH B;  4YGC B;  1J7Q A;  1JUO A;  3I5F B;  4WQ2 A;  1KCY A;  1K94 A;  2LMT A;  2WCB A;  2ZN8 A;  1G4Y R;  2D8N A;  2F2O A;  3AKB A;  3KHE A;  2KOT A;  4ETO A;  2G9B A;  1LXF C;  1NCZ A;  2KSP A;  2PRU A;  1S6I A;  3BUM B;  1SY9 A;  1J55 A;  3KPX A;  5PAL A;  2BBN A;  1AVS A;  3O4Y A;  1OZO A;  5HYD A;  2OS8 C;  1QS7 A;  1EL4 A;  2LP2 A;  4A4B A;  1QV1 A;  1KQM C;  4ZCU A;  2PAS A;  1YUT A;  3DVK A;  1BLQ A;  4MSP A;  1DJI A;  2LVI A;  1M39 A;  2KGB C;  2M7N A;  2F3Z A;  1A75 B;  2LE9 B;  4NQG A;  2LNK A;  4PE1 A;  1KQM B;  5HLO A;  2LM5 A;  1Y0V H;  3VGO A;  3TZ1 A;  1BT6 A;  1OQP A;  1CM1 A;  3O78 A;  2JC2 A;  4GFT A;  2QPT A;  1YRU B;  1IG5 A;  1VRK A;  1S5G Z;  1N2D A;  3TDI A;  3FIA A;  2M29 A;  1K9P A;  1PAL A;  3GK4 X;  3LK1 A;  2JT3 A;  2K0J A;  2M97 A;  3LCP C;  2KAV A;  2K2F A;  2KBM A;  5F6T A;  4YI9 A;  2KI6 C;  1ZMZ A;  1IJ6 A;  3PAL A;  4GAO A;  5J3X A;  1B8R A;  3PLF B;  4C0J A;  1MXE A;  2G2B A;  3WHU B;  2EHB A;  3BUO B;  1F70 A;  1YX7 A;  4JQ0 D;  2FJU B;  1QAT A;  1NCY A;  1KWO C;  1CTR A;  1EH2 A;  3CS1 A;  2I2R E;  2BEC A;  1EJ3 A;  3IQQ A;  1RFJ A;  1TNW A;  1ZOT B;  1NYA A;  1TRF A;  2H61 C;  1OMR A;  3A4U B;  1CFP A;  5BPJ A;  1NPQ A;  1KWO B;  1TOP A;  2GGZ A;  4ICB A;  3VRO A;  2LVK A;  4PE4 A;  4WQ3 A;  1LIN A;  5ER4 X;  2FCD A;  5HKY A;  1NP8 A;  1SL7 A;  3PAT A;  5HKW A;  1Y6W A;  4QJ5 B;  1B7T Z;  2F3Y A;  1YUU A;  5CSF A;  5AEQ A;  1PSR A;  1XFZ O;  5B8I B;  1CMG A;  1V1F A;  4ZCV A;  1HT9 A;  2AAO A;  2M7L A;  1JBA A;  3ZWH A;  4L9M A;  4MVF A;  1G8I A;  2IS9 A;  4FTG A;  4I5L B;  1J7P A;  2ISD A;  1KSM A;  3OX5 A;  2NCP A;  3O6B A;  1K8U A;  1CLB A;  2EC6 C;  3RLZ A;  2Q91 A;  1XFV O;  4GNK B;  2M8U A;  1CDM A;  1TTX A;  4QJ3 B;  1CKK A;  2MLE C;  4MZK A;  4TNC A;  1KFX S;  1S5G Y;  1UUR A;  2HET A;  1TNP A;  1D1O A;  2WCE A;  3PN7 C;  4M2P A;  3NXA A;  5CSN A;  3SIB A;  1HQV A;  2WOR A;  4CFR A;  1IQ3 A;  2CNP A;  2KQ6 A;  2F33 A;  4DCK A;  2LP3 A;  1IJ5 A;  1JF0 A;  1EG3 A;  1TN4 A;  1A29 A;  1NX1 A;  3FWB A;  4DIR A;  1IWQ A;  3CTN A;  3FS7 A;  2ZNE A;  1S36 A;  1CDP A;  3MSE B;  1UHI A;  1K90 D;  1JFK A;  1PK0 D;  1UHH A;  4PE0 A;  4U8D A;  4YGE B;  1ALW A;  1YVL A;  1OE9 B;  1TNQ A;  5KTY A;  1DJH A;  2ZFD A;  2H61 A;  3VRN A;  4MZL A;  2JWW A;  1RJV A;  4YGD B;  2BL0 C;  1MUX A;  3NSI A; 
#chains in the Genus database with same CATH topology
 1J7R A;  4I5J A;  1Y1X A;  2QEB A;  1PSB A;  2NLN A;  1MWN A;  4CPV A;  3V2L A;  2H2K A;  1LA3 A;  3R72 A;  2PAL A;  1OZS A;  5IBW A;  5FI6 A;  1PVB A;  2BL0 B;  2MHH A;  3F45 A;  1DTL A;  1PVA A;  4GBA A;  1RWY A;  2CTN A;  1YTZ C;  1DF0 A;  4I5N B;  2BCX A;  1SRA A;  2NCO A;  2WCJ A;  3EG5 B;  4CID A;  4MN0 A;  2B1U A;  1NUB A;  5I8N A;  3CR4 X;  1QIW A;  3B88 A;  1QLS A;  3PJI A;  1K95 A;  1KFU S;  1NWD A;  1BF5 A;  2K8M B;  1S6C A;  2KFH A;  2ZKM X;  3GOF A;  1DEL A;  2GTE A;  1C7V A;  4FQO A;  1M31 A;  1XA5 A;  2JTT A;  4YRU A;  1S1E A;  4OV2 A;  2ZND A;  3I5G C;  5AER A;  2PVB A;  1ALV A;  1OOF A;  2R2I A;  5DKQ A;  3N7H A;  3CLN A;  2KI4 C;  1DJW A;  1K93 D;  1QXP A;  4XJK B;  1AHR A;  1LA0 A;  2LAN A;  1B8C A;  3BOW B;  3M0W A;  2KI6 D;  4N5X A;  3LK0 A;  3UNW A;  1DJZ A;  1F55 A;  1DVI A;  4YGA A;  3I5G B;  2JQ6 A;  1JF2 A;  2LLT A;  2M0R A;  4GUK A;  5JOL A;  1JWD A;  2BCA A;  3WHT B;  3OBV A;  3CWG A;  2KI4 B;  2Y4Q A;  3IVT A;  3FWC A;  3KF9 A;  2KFG A;  1JFJ A;  4N1F A;  1Y1U A;  1OSA A;  4M2Q A;  2P70 A;  1WLM A;  2L2C A;  1PRW A;  1YR5 A;  2BBM A;  2NXQ A;  2F8P A;  2LUC A;  3B86 A;  3GK2 A;  4FQT A;  1SMG A;  3OX6 A;  1CMF A;  2E30 A;  1SCM B;  1S6J A;  4Q04 A;  5HLV A;  1WRZ A;  2LHI A;  4OKH A;  1QTX A;  2LV7 A;  1BR4 B;  2MBX A;  1P28 A;  4PHN A;  2SCP A;  4HSZ A;  5AXI A;  3D77 A;  1E8A A;  1WRL A;  4JKT A;  1B47 A;  1J1D A;  3SG3 A;  1QV0 A;  1FPW A;  1OMD A;  1SK6 D;  1RRO A;  2WND A;  2E6W A;  1QAS A;  5G08 A;  5I2O A;  2HQ8 A;  2BKI B;  1B8L A;  1YX8 A;  1KSO A;  2KLD A;  3JTD B;  3EK4 A;  2KDH A;  3EK7 A;  3CR5 X;  2AUC A;  4ORC B;  4PCW A;  3DY9 A;  3SG4 A;  1AJ4 A;  1ZAC A;  5I94 A;  1MXL C;  2I18 A;  2WCM A;  2MAZ A;  1FBV A;  1XFU O;  2KAY A;  4GGF C;  4PE7 A;  1A75 A;  1GQM A;  3HX4 A;  2WC5 A;  1SNL A;  2K2A A;  1B1G A;  5DKR A;  3BOW A;  1CFF A;  1C3Z A;  2LCP A;  4C0L A;  1SW8 A;  4OR9 B;  3SIA A;  4AQI A;  1QX2 A;  1F8H A;  2FCE A;  1EG4 A;  4CLN A;  1NIW A;  2RGI A;  3S0D A;  1QX5 B;  3DD4 A;  4GGN A;  5HKZ A;  2JT8 A;  3QRX A;  1YUS A;  4CFQ A;  2COL B;  1NSH A;  3AAK A;  2M1U A;  2P6B B;  1DMO A;  1KK8 C;  1QVI Z;  1KQV A;  4P2Y B;  1MR8 A;  2LMU A;  5AFP A;  1L7Z A;  1H8B A;  2Q4U A;  5JJG A;  5CPV A;  5I2L A;  3CYZ A;  1UHN A;  1SKT A;  2BKH B;  2JUL A;  2ERB A;  2K7C A;  4D1E A;  5CSI A;  1KK8 B;  4DRW A;  5EL2 A;  3DVJ A;  3OGN A;  3RM1 A;  3A8R A;  3SS5 A;  2KFF A;  1IRJ A;  1UP5 A;  2DOQ A;  1K9U A;  3S0F A;  3VRQ A;  2JNX A;  3DVE A;  1OOI X;  4N1G A;  1J1E A;  3AKA A;  1LKJ A;  1NX0 A;  1M45 A;  3H4S E;  1DGV A;  3PM8 A;  4R1E A;  1FI6 A;  5AAN A;  3K21 A;  2HPS A;  3BQ3 A;  3BXK A;  1N65 A;  1AP4 A;  1DC1 A;  2WCH A;  1FF1 A;  1JSA A;  3NHT A;  4PAL A;  3BFA A;  5GQQ C;  2JRF A;  3NGV A;  1N0Y A;  1Y1A A;  1DQE A;  4JWQ A;  3NSO A;  5CSJ A;  3HCM A;  1RTP 1;  4F0Z B;  2QEH A;  1XFX O;  2OPO A;  4GGF A;  3SS3 A;  3OB2 B;  3IF7 A;  1UHJ A;  5FYX A;  1QJT A;  1QX7 A;  3KEV A;  5KU1 A;  1KFX L;  2SAS A;  1QWV A;  3LL8 B;  3DF0 B;  1SSE B;  1XVJ A;  3VRP A;  2WC8 A;  4NDC A;  4MRX A;  3EKJ A;  1EXR A;  1UUS A;  4MZJ A;  2K7O A;  1TUZ A;  2Y1N A;  4F7F A;  1QVI Y;  3D78 A;  3VB1 A;  4ORA B;  3OB1 B;  2AMI A;  1PUL A;  1TCO B;  2TN4 A;  3JVT C;  4NDB A;  1WRK A;  2BE6 A;  3K1E A;  1G33 A;  1GGZ A;  2L50 A;  1DJX A;  4BY4 A;  2HF5 A;  1OOH A;  1B9A A;  2WCF A;  1W7J B;  2L5X B;  1X02 A;  2V53 A;  4GPL B;  3JVT B;  2BNX A;  1DGU A;  1TCF A;  2KYC A;  1OOG A;  3B7A A;  2K7B A;  1DT7 B;  3E3R A;  3ZNI A;  2KQY A;  3CR2 A;  1NCX A;  1UWO A;  3CGA A;  1L2O C;  2F2P A;  2M1K B;  1M63 B;  4OCI A;  4YI8 A;  1SCM C;  1BOD A;  3SJS A;  2KBI A;  4YGB B;  3WNX B;  2Y5I A;  2BAP A;  3R1V A;  4I5K A;  2LC5 A;  3GK1 A;  1SPY A;  5HL1 A;  2GV5 A;  1V1G A;  2KNE A;  2Y1M A;  3OHM B;  1R2U A;  2L0P A;  4MRY A;  1BMO A;  2LMV A;  2LVV A;  1YRT B;  4JD9 A;  1SBJ A;  5DIC A;  3SG6 A;  2MLF C;  3TDU A;  1L2O B;  4BY5 A;  3CZ2 A;  2JOJ A;  1U5I B;  1MHO A;  2KAX A;  1LS8 A;  1AK8 A;  2OS8 B;  5D69 A;  2LHL A;  1BG1 A;  3WXA A;  1F4Q A;  3DF0 A;  1GJY A;  3JTD C;  2L2E A;  3D0Y B;  1IQ5 A;  2JT0 A;  1GGW A;  2JU0 A;  1SL8 A;  4PT1 A;  4UPG A;  1K96 A;  4HRE E;  2LLU A;  1MF8 B;  1MQ1 A;  2QDI A;  2WCK A;  2KPH A;  1TNX A;  3O4X A;  1REC A;  1KFU L;  3TS5 C;  1IH0 A;  3D73 A;  2KGR A;  1TIZ A;  3C1V A;  3EK8 A;  3D10 A;  4NDD A;  4PHJ A;  1BR1 B;  4AQJ A;  1XYD A;  1DJG A;  4OVN F;  1DJY A;  2L4H A;  5D3O A;  4USL A;  2LAP A;  1FI5 A;  4DS7 A;  2L98 A;  1C7W A;  3R1P A;  2KHN A;  4WRI A;  1WDC C;  1XK4 C;  2CT9 A;  2FOT A;  2LLS A;  3BJH A;  2A4J A;  3TS5 B;  4QJ4 B;  1XFY O;  3PSR A;  1JC2 A;  1GM0 A;  1FW4 A;  3SG5 A;  2LVJ A;  2JTZ A;  4XJK A;  1ZUZ A;  2PMY A;  1H4B A;  4JPZ B;  3S0G A;  2MA2 A;  4IJ7 A;  3PFV A;  1WDC B;  1KK7 Z;  4XYN A;  1OMV A;  3S0A A;  2BCB A;  1R6P A;  3BYA A;  2L51 A;  2NZ0 A;  3I5H C;  1S3P A;  4HRG A;  4M2O A;  1UHK A;  3DZT A;  4ORB B;  1Z2C B;  2MRD A;  3BUX B;  2MJW B;  4P5O E;  3EVR A;  4A4C A;  1K2H A;  1W9Z A;  2CCM A;  2O5G A;  2JXL A;  3NSK A;  1CB1 A;  1NX3 A;  3TUY C;  1U5I A;  2JPT A;  1SYM A;  1CFD A;  1CNP A;  3I5H B;  2ZRS A;  2JNF A;  4HRH A;  1AJ5 A;  4PHK A;  1F71 A;  4C0K A;  2M9G A;  1S26 D;  3LLE A;  1LVC D;  1BU3 A;  3L4L A;  1SL9 A;  1M46 A;  4MBE A;  1K9K A;  1QLK A;  1Q80 A;  2HQW A;  2K61 A;  3ICB A;  4IL1 A;  1A4P A;  3D0Y A;  3BUN B;  3TUY B;  5K89 A;  3EKH A;  1C07 A;  1OW4 A;  1RK9 A;  2WOS A;  4PHM A;  1IKU A;  2OTG C;  1F4O A;  1F54 A;  1SR6 C;  1OOJ A;  3PM2 A;  4INW A;  5D7F A;  1DF0 B;  3I5I C;  1WY9 A;  1IGV A;  1WLZ A;  3SS4 A;  2KYF A;  2I94 A;  1NX2 A;  2I7A A;  5DKN A;  1BJF A;  2EC6 B;  1CDN A;  1ODB A;  2ZN9 A;  2QEO A;  5KSZ A;  3AAJ A;  3Q8I A;  2JZI A;  3EVU A;  2PSR A;  2K60 A;  2OTG B;  4PDZ A;  1SR6 B;  1W7I B;  5I2Q A;  3NSL A;  1ORG A;  3I5I B;  3SG7 A;  4DUQ A;  1XO5 A;  4E68 A;  1A03 A;  2GGM A;  1YVH A;  3PN7 B;  1B4C A;  2M49 B;  3SG2 A;  1XK4 A;  1BOC A;  3BUW B;  1XFW O;  1ZFS A;  1AUI B;  2O60 A;  2VRG A;  1J7O A;  1T14 A;  3OP0 A;  3O2P A;  1CLM A;  1KK7 Y;  2CBL A;  1CM4 A;  2LUX A;  2QAC A;  2ZRT A;  1CFC A;  3VRR A;  4MEW A;  2L4I A;  5FI2 A;  3KO0 A;  4MLW A;  1QIV A;  2JXC A;  3CZT X;  1A2X A;  2BE4 A;  3S0B A;  2EGD A;  2WCL A;  5TNC A;  3I5F C;  1B7T Y;  3DVM A;  3R1O A;  3TDZ A;  3EVV A;  5ER5 A;  1YUR A;  2KLE A;  3IQO A;  4AOM A;  2M3W A;  1SCV A;  1CDL A;  1CLL A;  2CXJ A;  2K7D A;  4YBH B;  3FE6 A;  4YGC B;  3L47 A;  1J7Q A;  1JUO A;  3I5F B;  4WQ2 A;  1KCY A;  1K94 A;  2LMT A;  2WCB A;  2ZN8 A;  1G4Y R;  2D8N A;  2F2O A;  3AKB A;  3KHE A;  2KOT A;  4ETO A;  2G9B A;  1LXF C;  1NCZ A;  2KSP A;  2PRU A;  3BFH A;  1S6I A;  3BUM B;  1SY9 A;  1J55 A;  3KPX A;  3NHI A;  5PAL A;  2BBN A;  1AVS A;  3O4Y A;  1OZO A;  5HYD A;  2OS8 C;  1QS7 A;  1EL4 A;  2LP2 A;  2P71 A;  4A4B A;  1QV1 A;  1KQM C;  2JPO A;  1TUJ A;  4ZCU A;  2PAS A;  1YUT A;  3DVK A;  1BLQ A;  4MSP A;  1DJI A;  2LVI A;  3D74 A;  1M39 A;  2KGB C;  2M7N A;  2F3Z A;  1A75 B;  3CDN A;  2LE9 B;  4NQG A;  2LNK A;  4PE1 A;  1KQM B;  5HLO A;  1DEK A;  2LM5 A;  1Y0V H;  3VGO A;  3TZ1 A;  1BT6 A;  1OQP A;  1XFR A;  1CM1 A;  3O78 A;  2JC2 A;  4GFT A;  2QPT A;  1YRU B;  1IG5 A;  1VRK A;  1S5G Z;  1N2D A;  3TDI A;  3FIA A;  2M29 A;  1K9P A;  1PAL A;  3GK4 X;  3LK1 A;  2JT3 A;  2K0J A;  2PYQ A;  3S0E A;  2M97 A;  3LCP C;  2KAV A;  4OZD A;  2K2F A;  2KBM A;  5F6T A;  4YI9 A;  2KI6 C;  1ZMZ A;  1IJ6 A;  3PAL A;  4GAO A;  5J3X A;  3CZ1 A;  3B87 A;  1B8R A;  3PLF B;  4C0J A;  1MXE A;  3BFB A;  2G2B A;  4INX A;  3WHU B;  3FE9 A;  2EHB A;  3DYE A;  3BUO B;  2WC6 A;  1F70 A;  1YX7 A;  4JQ0 D;  2FJU B;  1QAT A;  1NCY A;  1KWO C;  3B6X A;  1CTR A;  1EH2 A;  3CS1 A;  2I2R E;  2BEC A;  1EJ3 A;  3IQQ A;  4KYN A;  1RFJ A;  1TNW A;  2H8V A;  1ZOT B;  1NYA A;  1TRF A;  2H61 C;  1OMR A;  3RZS A;  3A4U B;  1CFP A;  5BPJ A;  1NPQ A;  1KWO B;  1TOP A;  2GGZ A;  4ICB A;  3VRO A;  2LVK A;  4PE4 A;  4WQ3 A;  1LIN A;  5ER4 X;  2FCD A;  5HKY A;  1NP8 A;  1SL7 A;  3PAT A;  5HKW A;  1Y6W A;  4QJ5 B;  1B7T Z;  2F3Y A;  1YUU A;  5CSF A;  5AEQ A;  1PSR A;  1XFZ O;  2FJY A;  5B8I B;  1CMG A;  1V1F A;  4ZCV A;  1HT9 A;  2AAO A;  2M7L A;  1JBA A;  3UO9 A;  3ZWH A;  4L9M A;  4MVF A;  1G8I A;  2IS9 A;  4FTG A;  4I5L B;  1J7P A;  2YGU A;  2ISD A;  1KSM A;  3D76 A;  3DXL A;  3OX5 A;  2NCP A;  5FI7 A;  3O6B A;  1K8U A;  1CLB A;  2EC6 C;  3CZ0 A;  3RLZ A;  1Z4H A;  2Q91 A;  1XFV O;  4GNK B;  2M8U A;  1CDM A;  1TTX A;  4QJ3 B;  1CKK A;  2MLE C;  3QME A;  4MZK A;  3FE8 A;  4TNC A;  1KFX S;  1S5G Y;  1UUR A;  2HET A;  1TNP A;  1D1O A;  2WCE A;  3PN7 C;  4M2P A;  1C3Y A;  3NXA A;  1TWO A;  5CSN A;  3SIB A;  1HQV A;  2WOR A;  4CFR A;  1IQ3 A;  3CAB A;  2CNP A;  2KQ6 A;  2F33 A;  4DCK A;  2LP3 A;  2PQL A;  1IJ5 A;  1JF0 A;  1EG3 A;  1TN4 A;  1A29 A;  1NX1 A;  3FWB A;  4DIR A;  1IWQ A;  3CTN A;  3FS7 A;  3D75 A;  2ZNE A;  1S36 A;  1CDP A;  3MSE B;  1IIO A;  1UHI A;  1K90 D;  2L5Y A;  1JFK A;  1PK0 D;  1UHH A;  4PE0 A;  4U8D A;  4YGE B;  1ALW A;  1YVL A;  1OE9 B;  1TNQ A;  3L4A A;  5KTY A;  2QEV A;  1DJH A;  2ZFD A;  2H61 A;  3VRN A;  4MZL A;  2JWW A;  1RJV A;  4YGD B;  2BL0 C;  1MUX A;  3NSI A; 
#chains in the Genus database with same CATH homology
 1J7R A;  4I5J A;  1Y1X A;  1PSB A;  2NLN A;  1MWN A;  4CPV A;  2H2K A;  1LA3 A;  2PAL A;  1OZS A;  5IBW A;  1PVB A;  2BL0 B;  2MHH A;  3F45 A;  1DTL A;  1PVA A;  4GBA A;  1RWY A;  2CTN A;  1YTZ C;  1DF0 A;  4I5N B;  2BCX A;  1SRA A;  2NCO A;  4CID A;  4MN0 A;  2B1U A;  1NUB A;  5I8N A;  3CR4 X;  1QIW A;  1QLS A;  1K95 A;  1KFU S;  1NWD A;  1BF5 A;  2K8M B;  1S6C A;  2KFH A;  2ZKM X;  3GOF A;  1C7V A;  4FQO A;  1M31 A;  1XA5 A;  2JTT A;  4YRU A;  1S1E A;  4OV2 A;  2ZND A;  3I5G C;  5AER A;  2PVB A;  1ALV A;  2R2I A;  5DKQ A;  3CLN A;  2KI4 C;  1DJW A;  1K93 D;  1QXP A;  4XJK B;  1AHR A;  1LA0 A;  2LAN A;  1B8C A;  3BOW B;  3M0W A;  2KI6 D;  4N5X A;  3LK0 A;  1DJZ A;  1F55 A;  1DVI A;  4YGA A;  3I5G B;  2JQ6 A;  1JF2 A;  2LLT A;  2M0R A;  4GUK A;  5JOL A;  1JWD A;  2BCA A;  3WHT B;  3CWG A;  2KI4 B;  2Y4Q A;  3FWC A;  3KF9 A;  2KFG A;  1JFJ A;  4N1F A;  1Y1U A;  1OSA A;  4M2Q A;  1WLM A;  1PRW A;  1YR5 A;  2BBM A;  2NXQ A;  2F8P A;  2LUC A;  3GK2 A;  1SMG A;  3OX6 A;  1CMF A;  2E30 A;  1SCM B;  1S6J A;  4Q04 A;  5HLV A;  1WRZ A;  2LHI A;  4OKH A;  1QTX A;  2LV7 A;  1BR4 B;  2MBX A;  4PHN A;  2SCP A;  4HSZ A;  5AXI A;  1E8A A;  1WRL A;  1B47 A;  1J1D A;  3SG3 A;  1QV0 A;  1FPW A;  1OMD A;  1SK6 D;  1RRO A;  2WND A;  2E6W A;  1QAS A;  5G08 A;  5I2O A;  2HQ8 A;  2BKI B;  1B8L A;  1YX8 A;  1KSO A;  3JTD B;  3EK4 A;  2KDH A;  3EK7 A;  3CR5 X;  2AUC A;  4ORC B;  4PCW A;  3SG4 A;  1AJ4 A;  1ZAC A;  1MXL C;  2I18 A;  2MAZ A;  1FBV A;  1XFU O;  2KAY A;  4GGF C;  4PE7 A;  1A75 A;  1GQM A;  3HX4 A;  1SNL A;  2K2A A;  1B1G A;  5DKR A;  3BOW A;  1CFF A;  2LCP A;  4C0L A;  1SW8 A;  4OR9 B;  3SIA A;  4AQI A;  1QX2 A;  1F8H A;  2FCE A;  1EG4 A;  4CLN A;  1NIW A;  2RGI A;  1QX5 B;  3DD4 A;  4GGN A;  5HKZ A;  2JT8 A;  3QRX A;  1YUS A;  4CFQ A;  2COL B;  1NSH A;  3AAK A;  2M1U A;  2P6B B;  1DMO A;  1KK8 C;  1QVI Z;  1KQV A;  4P2Y B;  1MR8 A;  2LMU A;  5AFP A;  1L7Z A;  1H8B A;  2Q4U A;  5JJG A;  5CPV A;  5I2L A;  1UHN A;  1SKT A;  2BKH B;  2JUL A;  4D1E A;  2K7C A;  5CSI A;  1KK8 B;  4DRW A;  3DVJ A;  3RM1 A;  3A8R A;  2KFF A;  1IRJ A;  1UP5 A;  2DOQ A;  1K9U A;  3VRQ A;  2JNX A;  3DVE A;  4N1G A;  1J1E A;  3AKA A;  1LKJ A;  1NX0 A;  1M45 A;  3H4S E;  1DGV A;  3PM8 A;  4R1E A;  1FI6 A;  5AAN A;  3K21 A;  2HPS A;  3BQ3 A;  3BXK A;  1N65 A;  1AP4 A;  1FF1 A;  1JSA A;  4PAL A;  5GQQ C;  2JRF A;  1N0Y A;  1Y1A A;  4JWQ A;  3NSO A;  5CSJ A;  3HCM A;  1RTP 1;  4F0Z B;  4GGF A;  1XFX O;  2OPO A;  3OB2 B;  3IF7 A;  1UHJ A;  5FYX A;  1QJT A;  1QX7 A;  3KEV A;  5KU1 A;  1KFX L;  2SAS A;  3LL8 B;  3DF0 B;  1XVJ A;  3VRP A;  2WC8 A;  4NDC A;  4MRX A;  3EKJ A;  1EXR A;  1UUS A;  4MZJ A;  2K7O A;  2Y1N A;  1QVI Y;  4ORA B;  3OB1 B;  2AMI A;  1PUL A;  1TCO B;  2TN4 A;  3JVT C;  4NDB A;  1WRK A;  2BE6 A;  1G33 A;  1GGZ A;  2L50 A;  1DJX A;  4BY4 A;  2HF5 A;  1B9A A;  2WCF A;  1W7J B;  2L5X B;  1X02 A;  2V53 A;  4GPL B;  3JVT B;  1DGU A;  1TCF A;  2KYC A;  1DT7 B;  2K7B A;  3E3R A;  3ZNI A;  2KQY A;  3CR2 A;  1NCX A;  1UWO A;  3CGA A;  1L2O C;  2F2P A;  2M1K B;  1M63 B;  4OCI A;  4YI8 A;  1SCM C;  1BOD A;  3SJS A;  2KBI A;  4YGB B;  3WNX B;  2Y5I A;  4I5K A;  2LC5 A;  3GK1 A;  1SPY A;  2GV5 A;  1V1G A;  2KNE A;  2Y1M A;  3OHM B;  1R2U A;  2L0P A;  4MRY A;  1BMO A;  2LMV A;  2LVV A;  1YRT B;  3SG6 A;  1SBJ A;  1C07 A;  2MLF C;  1L2O B;  4BY5 A;  2JOJ A;  1U5I B;  1MHO A;  2KAX A;  1AK8 A;  2OS8 B;  5D69 A;  2LHL A;  1BG1 A;  3WXA A;  1F4Q A;  3DF0 A;  1GJY A;  3JTD C;  2L2E A;  3D0Y B;  1IQ5 A;  2JT0 A;  1GGW A;  2JU0 A;  1SL8 A;  4UPG A;  1K96 A;  4HRE E;  2LLU A;  1MF8 B;  1MQ1 A;  1TNX A;  1REC A;  1KFU L;  3TS5 C;  1IH0 A;  2KGR A;  1TIZ A;  3C1V A;  3EK8 A;  3D10 A;  4NDD A;  4PHJ A;  1BR1 B;  4AQJ A;  1XYD A;  1DJG A;  4OVN F;  1DJY A;  2L4H A;  1FI5 A;  4USL A;  2LAP A;  4DS7 A;  2L98 A;  1C7W A;  4WRI A;  2KHN A;  3TDU A;  1WDC C;  1XK4 C;  2CT9 A;  2FOT A;  2LLS A;  2A4J A;  3TS5 B;  4QJ4 B;  1XFY O;  3PSR A;  1JC2 A;  1FW4 A;  3SG5 A;  2LVJ A;  2JTZ A;  4XJK A;  1ZUZ A;  2PMY A;  1H4B A;  4JPZ B;  2MA2 A;  3PFV A;  1WDC B;  1KK7 Z;  4XYN A;  1OMV A;  2BCB A;  1R6P A;  3BYA A;  2L51 A;  2NZ0 A;  3I5H C;  1S3P A;  4HRG A;  4M2O A;  1UHK A;  4ORB B;  2MRD A;  3BUX B;  2MJW B;  4P5O E;  3EVR A;  4A4C A;  1K2H A;  2CCM A;  2O5G A;  1CB1 A;  2JXL A;  3NSK A;  1NX3 A;  3TUY C;  1U5I A;  2JPT A;  1SYM A;  1CFD A;  1CNP A;  3I5H B;  2ZRS A;  2JNF A;  4HRH A;  1AJ5 A;  4PHK A;  1F71 A;  4C0K A;  2M9G A;  1S26 D;  3LLE A;  1LVC D;  1BU3 A;  4MBE A;  1SL9 A;  1M46 A;  1K9K A;  1QLK A;  1Q80 A;  2HQW A;  2K61 A;  3ICB A;  4IL1 A;  1A4P A;  3D0Y A;  3BUN B;  3TUY B;  5K89 A;  3EKH A;  1RK9 A;  2WOS A;  4PHM A;  1IKU A;  2OTG C;  1F4O A;  1F54 A;  1SR6 C;  1OOJ A;  5D7F A;  1DF0 B;  3I5I C;  1WY9 A;  1IGV A;  1WLZ A;  2KYF A;  2I94 A;  1NX2 A;  2I7A A;  5DKN A;  1BJF A;  2EC6 B;  1CDN A;  1ODB A;  2ZN9 A;  5KSZ A;  3AAJ A;  2JZI A;  3EVU A;  2PSR A;  2OTG B;  4PDZ A;  1SR6 B;  1W7I B;  5I2Q A;  3NSL A;  3I5I B;  3SG7 A;  4DUQ A;  1XO5 A;  4E68 A;  1A03 A;  2GGM A;  1YVH A;  3PN7 B;  1B4C A;  2M49 B;  3SG2 A;  1XK4 A;  1BOC A;  3BUW B;  1XFW O;  1ZFS A;  1AUI B;  2O60 A;  2VRG A;  1J7O A;  3OP0 A;  3O2P A;  1CLM A;  1KK7 Y;  2CBL A;  1CM4 A;  2LUX A;  2QAC A;  2ZRT A;  1CFC A;  3VRR A;  4MEW A;  2L4I A;  3KO0 A;  4MLW A;  1QIV A;  2JXC A;  3CZT X;  1A2X A;  2BE4 A;  2EGD A;  5TNC A;  3I5F C;  1B7T Y;  3DVM A;  3TDZ A;  3EVV A;  5ER5 A;  1YUR A;  3IQO A;  4AOM A;  2M3W A;  1SCV A;  1CDL A;  1CLL A;  2CXJ A;  2K7D A;  4YBH B;  4YGC B;  1J7Q A;  1JUO A;  3I5F B;  4WQ2 A;  1KCY A;  1K94 A;  2LMT A;  2WCB A;  2ZN8 A;  1G4Y R;  2D8N A;  2F2O A;  3AKB A;  3KHE A;  2KOT A;  4ETO A;  2G9B A;  1LXF C;  1NCZ A;  2KSP A;  2PRU A;  1S6I A;  3BUM B;  1SY9 A;  1J55 A;  3KPX A;  5PAL A;  2BBN A;  1AVS A;  3O4Y A;  1OZO A;  5HYD A;  2OS8 C;  1QS7 A;  1EL4 A;  2LP2 A;  4A4B A;  1QV1 A;  1KQM C;  4ZCU A;  2PAS A;  1YUT A;  3DVK A;  1BLQ A;  4MSP A;  1DJI A;  2LVI A;  1M39 A;  2KGB C;  2M7N A;  2F3Z A;  1A75 B;  2LE9 B;  4NQG A;  2LNK A;  4PE1 A;  1KQM B;  5HLO A;  2LM5 A;  1Y0V H;  3VGO A;  3TZ1 A;  1BT6 A;  1OQP A;  1CM1 A;  3O78 A;  2JC2 A;  4GFT A;  2QPT A;  1YRU B;  1IG5 A;  1VRK A;  1S5G Z;  1N2D A;  3TDI A;  3FIA A;  2M29 A;  1K9P A;  1PAL A;  3GK4 X;  3LK1 A;  2JT3 A;  2K0J A;  2M97 A;  3LCP C;  2KAV A;  2K2F A;  2KBM A;  5F6T A;  4YI9 A;  2KI6 C;  1ZMZ A;  1IJ6 A;  3PAL A;  4GAO A;  5J3X A;  1B8R A;  3PLF B;  4C0J A;  1MXE A;  2G2B A;  3WHU B;  2EHB A;  3BUO B;  1F70 A;  1YX7 A;  4JQ0 D;  2FJU B;  1QAT A;  1NCY A;  1KWO C;  1CTR A;  1EH2 A;  3CS1 A;  2I2R E;  2BEC A;  1EJ3 A;  3IQQ A;  1RFJ A;  1TNW A;  1ZOT B;  1NYA A;  1TRF A;  2H61 C;  1OMR A;  3A4U B;  1CFP A;  5BPJ A;  1NPQ A;  1KWO B;  1TOP A;  2GGZ A;  4ICB A;  3VRO A;  2LVK A;  4PE4 A;  4WQ3 A;  1LIN A;  5ER4 X;  2FCD A;  5HKY A;  1NP8 A;  1SL7 A;  3PAT A;  5HKW A;  1Y6W A;  4QJ5 B;  1B7T Z;  2F3Y A;  1YUU A;  5CSF A;  5AEQ A;  1PSR A;  1XFZ O;  5B8I B;  1CMG A;  1V1F A;  4ZCV A;  1HT9 A;  2AAO A;  2M7L A;  1JBA A;  3ZWH A;  4L9M A;  4MVF A;  1G8I A;  2IS9 A;  4FTG A;  4I5L B;  1J7P A;  2ISD A;  1KSM A;  3OX5 A;  2NCP A;  3O6B A;  1K8U A;  1CLB A;  2EC6 C;  3RLZ A;  2Q91 A;  1XFV O;  4GNK B;  2M8U A;  1CDM A;  1TTX A;  4QJ3 B;  1CKK A;  2MLE C;  4MZK A;  4TNC A;  1KFX S;  1S5G Y;  1UUR A;  2HET A;  1TNP A;  1D1O A;  2WCE A;  3PN7 C;  4M2P A;  3NXA A;  5CSN A;  3SIB A;  1HQV A;  2WOR A;  4CFR A;  1IQ3 A;  2CNP A;  2KQ6 A;  2F33 A;  4DCK A;  2LP3 A;  1IJ5 A;  1JF0 A;  1EG3 A;  1TN4 A;  1A29 A;  1NX1 A;  3FWB A;  4DIR A;  1IWQ A;  3CTN A;  3FS7 A;  2ZNE A;  1S36 A;  1CDP A;  3MSE B;  1UHI A;  1K90 D;  1JFK A;  1PK0 D;  1UHH A;  4PE0 A;  4U8D A;  4YGE B;  1ALW A;  1YVL A;  1OE9 B;  1TNQ A;  5KTY A;  1DJH A;  2ZFD A;  2H61 A;  3VRN A;  4MZL A;  2JWW A;  1RJV A;  4YGD B;  2BL0 C;  1MUX A;  3NSI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...