2KGRA

Solution structure of protein itsn1 from homo sapiens. northeast structural genomics consortium target hr5524a
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
111
structure length
111
Chain Sequence
PPVAEWAVPQSSRLKYRQLFNSHDKTMSGHLTGPQARTILMQSSLPQAQLASIWNLSDIDQDGKLTAEEFILAMHLIDVAMSGQPLPPVLPPEYIPPSFRRVRLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Intersectin-1
publication title Solution structure of protein ITSN1 from Homo sapiens. Northeast Structural Genomics Consortium target HR5524A
rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 26
structure length 111
sequence length 111
ec nomenclature
pdb deposition date 2009-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12763 EF-hand_4 Cytoskeletal-regulatory complex EF hand
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2kgrA00
2ZRTA 5ER5A 2LVKA 1YUSA 4D1EA 1CDMA 1ZOTB 1B1GA 1A2XA 4CFQA 2L98A 1B47A 1XFZO 4GGNA 1J7QA 4UPGA 2LV7A 2I2RE 3EVVA 3I5HB 1BR4B 4JPZB 1AJ4A 3SG5A 2Q91A 1TTXA 3AAJA 4OV2A 2LNKA 1JF0A 3CR5X 3CLNA 4PHNA 1DF0A 1XVJA 3OB2B 5I2QA 1NIWA 2KGRA 1M31A 1L7ZA 2LLTA 1S6CA 1WRLA 2PASA 4YBHB 1BOCA 1PALA 3PLFB 2AMIA 3DVJA 2BCAA 1CM4A 2LLUA 2FJUB 2KFHA 2CT9A 1ODBA 1IKUA 2DOQA 1U5IB 3OX6A 1DJWA 5FYXA 2HQ8A 1JC2A 3WNXB 1A03A 3VRPA 1V1FA 3BOWA 3LLEA 1KFXL 2KYFA 1CTRA 3FWCA 4GPLB 1CMFA 1SL7A 2KAVA 2CTNA 2F8PA 2M1KB 2PSRA 1WY9A 4U8DA 4DUQA 1LINA 2BECA 2MAZA 2LVIA 1LA3A 1PK0D 2ZNEA 3FIAA 1YRUB 2H61C 4MBEA 5KU1A 1TOPA 1H4BA 2TN4A 4PE4A 2CXJA 2ZNDA 5AEQA 1B4CA 3SG6A 2I94A 4AQIA 1CFFA 1CFDA 1F8HA 1IQ5A 1D1OA 1PSBA 2VRGA 2E30A 4XJKB 2F2OA 3JVTB 3LCPC 1RWYA 1SL8A 2WORA 4OCIA 1KK7Z 1OE9B 1TNXA 3H4SE 2RGIA 4QJ3B 3SG3A 2M7NA 1M45A 4QJ4B 2KI4C 1KQMC 2HF5A 3O6BA 1LXFC 1M39A 1OQPA 2JT0A 3I5GB 1MR8A 1S5GZ 3CWGA 5F6TA 2GGZA 5CSFA 1NP8A 4USLA 1YURA 4GBAA 3TDIA 4MEWA 1DMOA 1QLKA 1BMOA 3LL8B 1ALWA 2LANA 2F33A 3LK1A 3IQQA 4ICBA 1KQVA 3PALA 1QVIZ 1NX2A 2JTZA 2OTGC 2LAPA 2BCXA 2WC8A 3BUMB 3TS5B 1J1EA 1U5IA 4GNKB 3CS1A 2LHIA 1FW4A 1XYDA 3PFVA 3EKHA 2F3YA 2LP2A 4MLWA 3SJSA 3TUYC 2M0RA 1QATA 4CLNA 1MXLC 1KFUS 2BL0B 2ZN9A 1TIZA 1WDCB 4MZJA 4GAOA 4ORCB 5J3XA 4DIRA 2HQWA 1L2OC 2K61A 3AAKA 3DVMA 1IRJA 2KBIA 4MN0A 1QXPA 1K94A 3KHEA 1BJFA 2D8NA 1YUTA 2MA2A 1MUXA 2JRFA 2P6BB 4HRGA 1CB1A 4I5LB 1YR5A 5AXIA 1AP4A 1RK9A 4PHMA 3I5IC 3VRRA 1J1DA 3RM1A 1N2DA 1Y1AA 2SCPA 2O60A 3IQOA 1OMRA 1YTZC 1FI5A 2BBNA 3BOWB 4OR9B 4XJKA 1JWDA 4I5NB 4NDBA 5HLVA 2JNFA 1V1GA 2L4HA 3VRNA 2LUCA 3D0YA 4PHJA 3PN7C 2A4JA 5CSIA 1OOJA 1GQMA 1QLSA 4AOMA 5DKQA 2KFFA 2JULA 2JTTA 1UHNA 3IF7A 2NCOA 2CBLA 4YGBB 5TNCA 2BKHB 2B1UA 1S6JA 3ZWHA 4YI8A 1DJIA 1S6IA 4PE0A 1XFYO 2KDHA 4PCWA 1UUSA 1B8CA 4WQ3A 1IJ6A 4MRYA 3JTDC 4N1FA 1W7IB 1RECA 1SKTA 1SMGA 1QX2A 1E8AA 1NPQA 1CKKA 2BE6A 3F45A 3E3RA 1EXRA 1TCFA 3CZTX 1NCZA 2MJWB 1SW8A 1KWOB 1GGZA 2Q4UA 1EG4A 4CFRA 2JOJA 1BODA 1NSHA 1UHJA 2IS9A 4ORBB 3SIAA 1LKJA 2ZKMX 1CDLA 2LC5A 2ZFDA 2WCFA 5DKRA 1KCYA 3NSIA 1IJ5A 2LVJA 1S26D 1B8LA 1MWNA 2NZ0A 1R2UA 1Q80A 4AQJA 3TZ1A 1OSAA 1MF8B 1PULA 2H2KA 1ZUZA 3D10A 2BKIB 1EG3A 4R1EA 3DD4A 1NCYA 3EVUA 2KAYA 4A4BA 2O5GA 1X02A 5AERA 2CCMA 2JXCA 4OKHA 2WOSA 1G33A 1NX1A 2G2BA 1TNPA 2OS8B 5I2LA 2JT3A 1K90D 5ER4X 1XFXO 1CFCA 4HSZA 1B7TZ 4GGFA 1Y0VH 1SPYA 1K95A 2GV5A 3M0WA 4ZCVA 1QV0A 2KNEA 1XK4A 1M63B 5DKNA 1DJXA 1N65A 4F0ZB 4M2PA 1S36A 1PVAA 2LP3A 2KSPA 1WLZA 1MHOA 2M97A 3NSLA 5CSNA 3JVTC 1F70A 1SR6C 1F71A 3CR2A 2M1UA 4MZLA 1A75B 4PE1A 2I7AA 5JJGA 3NSKA 3D0YB 2SASA 3MSEB 1GGWA 2K7DA 3I5GC 4HREE 1B8RA 1K93D 3FS7A 3FWBA 3OB1B 1YVLA 1HQVA 1IG5A 1SCVA 1JF2A 2LMTA 2NCPA 1NUBA 1G8IA 1TN4A 2JNXA 1OMDA 3OHMB 1KK7Y 2R2IA 1MXEA 2OPOA 1OZOA 2F2PA 5I2OA 1UP5A 2I18A 5I8NA 3QRXA 1SCMC 1TCOB 3O4YA 2MLEC 4ZCUA 2M7LA 5CPVA 1S5GY 1BF5A 1PVBA 2FCDA 4NDDA 1HT9A 2K0JA 1K8UA 2EC6B 1DJZA 1YUUA 2KI6D 1QIWA 2M8UA 2KQ6A 2Y5IA 2Y4QA 1N0YA 1AVSA 1KQMB 2ISDA 1G4YR 4MZKA 1S1EA 1PSRA 2QACA 3K21A 1WDCC 3HX4A 1QVIY 3BXKA 1OMVA 1IWQA 1SBJA 2BE4A 4ORAB 4PHKA 1BR1B 2L0PA 4GFTA 1SRAA 3EKJA 3VROA 3OP0A 1QJTA 1EJ3A 2LMUA 3OX5A 2HETA 3ZNIA 5AFPA 3O2PA 1CNPA 1ZMZA 3BUNB 3DF0B 2COLB 1CLMA 2KGBC 2NLNA 4Q04A 1JFKA 1KK8C 4P2YB 5HKWA 1FPWA 1A75A 1M46A 1Y6WA 1WLMA 3AKBA 2M49B 1CDPA 3TUYB 2Y1MA 4YGAA 4M2QA 4YGCB 2WCEA 1J7OA 1XFUO 2L51A 4C0LA 1L2OB 3SG2A 2H61A 2LUXA 3WHUB 2WNDA 1C07A 3HCMA 1RROA 2JPTA 1KFXS 1LVCD 2M9GA 3I5FC 2KOTA 3I5IB 1J55A 1DVIA 2PMYA 4BY4A 1FF1A 3NSOA 4QJ5B 2JZIA 4XYNA 2MRDA 1XA5A 1BG1A 2EHBA 1AHRA 1C7VA 4E68A 5AANA 2K7BA 3PN7B 3I5HC 4WRIA 2MBXA 3LK0A 1B9AA 2KFGA 1NWDA 2GGMA 2KYCA 2FOTA 4PDZA 1XO5A 1IQ3A 5IBWA 4WQ2A 2PRUA 2AAOA 3DVEA 1Y1UA 1NCXA 3GK4X 3EK4A 2MLFC 1QX5B 2LLSA 1AK8A 1GJYA 2LHLA 1KFUL 2M29A 3JTDB 3VRQA 1YRTB 2M3WA 4NQGA 3SIBA 3KPXA 3DF0A 4IL1A 4P5OE 4MSPA 4DRWA 1EH2A 2ZN8A 3AKAA 3PM8A 3SG7A 2JXLA 4MRXA 4PALA 1AUIB 2OS8C 1SNLA 1FI6A 2LVVA 1BLQA 2JT8A 4DCKA 1TNQA 1VRKA 4A4CA 1UURA 1KSOA 5D69A 3TDUA 1K9KA 3BYAA 3GK2A 4MVFA 1FBVA 1WRKA 1NYAA 5D7FA 2CNPA 4FQOA 1UHIA 4N5XA 1YX7A 2MHHA 4CIDA 1DJYA 2KI6C 1TNWA 2BCBA 1XFWO 2FCEA 1K9UA 4DS7A 5JOLA 5KSZA 3EVRA 1B7TY 2KBMA 3SG4A 1SL9A 3KEVA 2PALA 3KO0A 2BBMA 2V53A 5G08A 1DGUA 2JU0A 4YGDB 1CLLA 5PALA 5HKZA 3BQ3A 2PVBA 3BUOB 4CPVA 4N1GA 1DGVA 1QTXA 4FTGA 3CTNA 2WCBA 1ALVA 1CM1A 1ZACA 1CDNA 1ZFSA 1K2HA 5K89A 1F4OA 3A8RA 1SR6B 1LA0A 2LCPA 2K2FA 2EC6C 3ICBA 1YVHA 3TS5C 1MQ1A 2JWWA 1KSMA 5BPJA 1QS7A 1Y1XA 1BT6A 1SYMA 4JWQA 4BY5A 4PE7A 1A29A 2KI4B 4NDCA 3CR4X 2K2AA 1NX0A 2LMVA 2BL0C 2F3ZA 4C0KA 2E6WA 2QPTA 3EK7A 1UHKA 2K7CA 4L9MA 4YI9A 1TRFA 2AUCA 4I5JA 1IGVA 1QIVA 1IH0A 4JQ0D 1JFJA 1F4QA 2L4IA 2JQ6A 3DVKA 4TNCA 4YGEB 4OVNF 1SCMB 3WHTB 5CSJA 2G9BA 2OTGB 1DJGA 1QX7A 1DT7B 1DJHA 5HKYA 1DTLA 2K8MB 2HPSA 1NX3A 1RTP1 3CGAA 3TDZA 1YX8A 3O78A 1EL4A 1F55A 2LM5A 2JC2A 1XFVO 2L2EA 3GOFA 1QASA 1OZSA 4GGFC 1DF0B 1SK6D 1WRZA 4GUKA 2L5XB 1JUOA 5HLOA 1JSAA 4ETOA 1XK4C 4YRUA 5KTYA 5GQQC 1RFJA 2KAXA 1JBAA 1C7WA 1AJ5A 2LE9B 2NXQA 1UWOA 1UHHA 4HRHA 1F54A 5B8IB 2EGDA 1S3PA 2KQYA 3A4UB 1R6PA 2K7OA 3VGOA 1KK8B 3KF9A 1K96A 4I5KA 1KWOC 1J7RA 2KHNA 3BUXB 2Y1NA 3NXAA 1A4PA 3RLZA 1BU3A 1RJVA 2L50A 3EK8A 1CMGA 1CLBA 1H8BA 1K9PA 1CFPA 3PATA 3WXAA 1QV1A 3C1VA 3PSRA 4C0JA 5HYDA 2ZRSA 3I5FB 1PRWA 3GK1A 3BUWB 1SY9A 1W7JB 4M2OA 1J7PA
chains in the Genus database with same CATH superfamily
2ZRTA 5ER5A 2LVKA 1YUSA 3VB1A 4D1EA 1CDMA 1ZOTB 1B1GA 1A2XA 4CFQA 2L98A 1B47A 1XFZO 4GGNA 1J7QA 3QMEA 4UPGA 2LV7A 2I2RE 3EVVA 1XFRA 1BR4B 3I5HB 3K1EA 1AJ4A 4JPZB 2Q91A 1TTXA 3AAJA 4OV2A 3SG5A 3PM2A 2LNKA 1JF0A 3CR5X 3CLNA 4PHNA 3NHIA 1DF0A 1XVJA 3OB2B 5I2QA 1NIWA 2KGRA 1M31A 1L7ZA 2LLTA 1S6CA 1WRLA 2PASA 3D77A 4YBHB 1PALA 1BOCA 3PLFB 2AMIA 4GUKA 3DVJA 2BCAA 1CM4A 2LLUA 2FJUB 2KFHA 3DYEA 2CT9A 1ODBA 1IKUA 2DOQA 1U5IB 3CYZA 1DJWA 3OX6A 5FYXA 2HQ8A 1JC2A 3WNXB 1A03A 3VRPA 1V1FA 3BOWA 3LLEA 1KFXL 3S0GA 2KYFA 1CTRA 3FWCA 2JPOA 4GPLB 1SL7A 2KAVA 2CTNA 2F8PA 2M1KB 2PSRA 1WY9A 4U8DA 4DUQA 1LINA 2BECA 2MAZA 2LVIA 1LA3A 1PK0D 2ZNEA 4JKTA 3FIAA 4FQTA 1YRUB 2H61C 4MBEA 5KU1A 1TOPA 1H4BA 2TN4A 4PE4A 2CXJA 2ZNDA 3L4AA 2QEBA 5AEQA 1B4CA 3SG6A 2I94A 4AQIA 1CFFA 1CFDA 3DXLA 1F8HA 1IQ5A 1D1OA 1PSBA 2VRGA 2E30A 4XJKB 2F2OA 3JVTB 3LCPC 1RWYA 1SL8A 2WORA 4OCIA 1KK7Z 1OE9B 1TNXA 3H4SE 5FI6A 2RGIA 4QJ3B 3SG3A 2M7NA 1M45A 4QJ4B 2KI4C 1KQMC 2HF5A 3O6BA 2WC5A 1LXFC 3B86A 3NHTA 1M39A 1OQPA 2JT0A 3I5GB 1MR8A 1S5GZ 3CWGA 3B88A 5F6TA 2GGZA 5CSFA 1NP8A 4USLA 2PQLA 1YURA 4GBAA 3TDIA 4MEWA 3S0FA 1DMOA 1QLKA 1BMOA 3CABA 3LL8B 1ALWA 2LANA 2F33A 3LK1A 3IQQA 4ICBA 1KQVA 3OGNA 3PALA 1QVIZ 1NX2A 2JTZA 2OTGC 4OZDA 2LAPA 2BCXA 2WC8A 3BUMB 3TS5B 1J1EA 1U5IA 4GNKB 3CS1A 2LHIA 1FW4A 1XYDA 3PFVA 3EKHA 2F3YA 2LP2A 1ORGA 4MLWA 3SJSA 3TUYC 2M0RA 1QATA 4CLNA 1MXLC 1KFUS 2BL0B 2ZN9A 1TIZA 1WDCB 4MZJA 4GAOA 4ORCB 5J3XA 4DIRA 2HQWA 1L2OC 2K61A 3AAKA 3DVMA 1IRJA 2KBIA 4MN0A 1QXPA 1K94A 3KHEA 1BJFA 2D8NA 1YUTA 2MA2A 1MUXA 2JRFA 2P6BB 4HRGA 1CB1A 4I5LB 1YR5A 5AXIA 3B7AA 1AP4A 1RK9A 3R1VA 3I5IC 4PHMA 3VRRA 1J1DA 3RM1A 1N2DA 1Y1AA 2SCPA 2O60A 3IQOA 1OMRA 1YTZC 2WC6A 1FI5A 2BBNA 3BOWB 3D74A 4OR9B 4XJKA 1JWDA 4I5NB 4NDBA 5HLVA 2JNFA 1V1GA 2KLEA 2L4HA 4IJ7A 3VRNA 2LUCA 3D0YA 4PHJA 3PN7C 2A4JA 2K60A 5CSIA 1OOJA 1GQMA 1QLSA 4AOMA 5DKQA 2KFFA 2JULA 2JTTA 1UHNA 3IF7A 1OW4A 3UNWA 2NCOA 2CBLA 4YGBB 5TNCA 2BKHB 2B1UA 1S6JA 3ZWHA 4YI8A 1DJIA 1S6IA 4PE0A 1XFYO 2KDHA 4PCWA 1UUSA 2ERBA 1B8CA 4WQ3A 1IJ6A 1TWOA 4MRYA 3JTDC 4N1FA 4INXA 1W7IB 1RECA 1SKTA 1SMGA 1QX2A 1E8AA 1DC1A 1NPQA 1CKKA 2BE6A 3F45A 3E3RA 2P70A 1EXRA 1TCFA 3CZTX 1NCZA 4INWA 2MJWB 3RZSA 1SW8A 2WCJA 1KWOB 1GGZA 2Q4UA 1EG4A 4CFRA 2JOJA 1BODA 1NSHA 1UHJA 2IS9A 4ORBB 3SIAA 1LKJA 2ZKMX 1CDLA 2LC5A 2ZFDA 2WCFA 5DKRA 1KCYA 3NSIA 1IJ5A 3S0AA 2LVJA 1S26D 1B8LA 1DEKA 1MWNA 1R2UA 2NZ0A 1Q80A 2P71A 4AQJA 3TZ1A 1OSAA 1MF8B 1PULA 3B6XA 2H2KA 1ZUZA 3D10A 2BKIB 1EG3A 4R1EA 3DD4A 1NCYA 3EVUA 2KAYA 4A4BA 2O5GA 1X02A 5AERA 2CCMA 2JXCA 2WCLA 3SS3A 4OKHA 2WOSA 1G33A 1NX1A 2L5YA 2G2BA 3Q8IA 1TNPA 2OS8B 5I2LA 2JT3A 1K90D 5ER4X 2BNXA 1XFXO 1CFCA 4HSZA 1T14A 1B7TZ 3CZ0A 3D78A 4GGFA 1Y0VH 1SPYA 1K95A 2GV5A 3M0WA 4ZCVA 1QV0A 2KNEA 1XK4A 1M63B 5DKNA 1DJXA 1N65A 3L47A 4F0ZB 4M2PA 1S36A 1PVAA 2LP3A 2FJYA 1WLZA 2KSPA 1MHOA 2M97A 3NSLA 5CSNA 3JVTC 2GTEA 1SR6C 3UO9A 2QDIA 3CR2A 1F71A 1F70A 3O4XA 2M1UA 4MZLA 1A75B 4PE1A 2I7AA 3CZ1A 5JJGA 3NSKA 3D0YB 2SASA 3MSEB 1GGWA 1W9ZA 2K7DA 2WCMA 3I5GC 1B8RA 1K93D 3FS7A 3FWBA 4HREE 3OB1B 1YVLA 1HQVA 1IG5A 1SCVA 1JF2A 2LMTA 2NCPA 1NUBA 1G8IA 1TN4A 2JNXA 1OMDA 3OHMB 1KK7Y 3OBVA 2R2IA 1MXEA 1TUJA 1OZOA 2F2PA 2OPOA 3B87A 1UP5A 2I18A 5I2OA 5I8NA 3QRXA 1SCMC 1TCOB 3O4YA 2MLEC 4ZCUA 2M7LA 5CPVA 1S5GY 1BF5A 1PVBA 2FCDA 4NDDA 1HT9A 2K0JA 1K8UA 2EC6B 1DJZA 1YUUA 5FI2A 2KI6D 1QIWA 2M8UA 2KQ6A 2QEOA 2Y4QA 2Y5IA 3CDNA 1N0YA 1AVSA 1KQMB 2ISDA 1G4YR 4MZKA 1S1EA 1PSRA 2QACA 2QEVA 3K21A 1WDCC 3HX4A 1QVIY 3FE8A 3BXKA 1OMVA 1IWQA 1SBJA 1C3ZA 2BE4A 3S0BA 1C3YA 3BFHA 4ORAB 4PHKA 1BR1B 2L0PA 3L4LA 3CZ2A 1Z2CB 4GFTA 1SRAA 3EKJA 3VROA 3OP0A 5EL2A 1QJTA 1EJ3A 2LMUA 3OX5A 2HETA 3FE9A 3ZNIA 3O2PA 5AFPA 1CNPA 1ZMZA 3BUNB 3DF0B 2COLB 1GM0A 1CLMA 2KGBC 2NLNA 4Q04A 1JFKA 1KK8C 4P2YB 5HKWA 1FPWA 1A75A 1M46A 1Y6WA 1WLMA 3AKBA 1TUZA 2M49B 1CDPA 3TUYB 2Y1MA 4YGAA 4M2QA 1SSEB 4YGCB 2QEHA 2WCEA 1J7OA 1XFUO 2L51A 1OOGA 4C0LA 3PJIA 1L2OB 3SG2A 1OOIX 2BAPA 2H61A 2LUXA 3WHUB 2WNDA 1C07A 3HCMA 1RROA 2JPTA 1KFXS 1LVCD 2M9GA 3I5FC 2KOTA 3I5IB 1J55A 1DVIA 2PMYA 4BY4A 1FF1A 3NSOA 4QJ5B 3R1PA 2JZIA 4XYNA 2MRDA 1XA5A 1BG1A 2H8VA 2EHBA 1AHRA 2PYQA 1C7VA 4E68A 5AANA 2K7BA 3PN7B 3I5HC 4WRIA 2MBXA 3V2LA 3LK0A 1B9AA 2KFGA 1NWDA 1DELA 2GGMA 3EG5B 2KYCA 2FOTA 3DY9A 1XO5A 4PDZA 1IQ3A 5IBWA 4WQ2A 2PRUA 2AAOA 3DVEA 1Y1UA 1NCXA 3N7HA 3GK4X 3EK4A 2MLFC 1QX5B 2LLSA 1AK8A 1CMFA 1GJYA 2LHLA 1KFUL 2M29A 3JTDB 3VRQA 1YRTB 2M3WA 4NQGA 3SIBA 3KPXA 3DF0A 4IL1A 4P5OE 4MSPA 4DRWA 1EH2A 2ZN8A 1DQEA 3AKAA 3BJHA 3PM8A 2JXLA 3SG7A 4MRXA 4PALA 1AUIB 2OS8C 1SNLA 1FI6A 3D75A 2LVVA 1BLQA 2JT8A 4DCKA 2KLDA 1TNQA 1VRKA 4A4CA 1OOHA 1QWVA 1UURA 1KSOA 5D69A 3TDUA 1K9KA 3BYAA 3GK2A 4MVFA 1FBVA 1WRKA 1NYAA 5D7FA 2CNPA 4FQOA 1UHIA 4N5XA 1YX7A 2MHHA 4CIDA 1DJYA 2KI6C 1IIOA 1TNWA 2BCBA 1XFWO 2FCEA 1K9UA 4DS7A 5JOLA 5KSZA 4JD9A 3EVRA 1B7TY 2KBMA 5HL1A 3SG4A 2WCHA 1SL9A 3KEVA 2PALA 3KO0A 2BBMA 2V53A 5G08A 1DGUA 1LS8A 2JU0A 4YGDB 1CLLA 5PALA 5HKZA 3BQ3A 2PVBA 3BUOB 4CPVA 3FE6A 4N1GA 1DGVA 1QTXA 4FTGA 3CTNA 2WCBA 3D73A 1ALVA 1Z4HA 1CM1A 1ZACA 1CDNA 1ZFSA 1K2HA 1OOFA 5K89A 3R1OA 1F4OA 3DZTA 3A8RA 1SR6B 1LA0A 2LCPA 2K2FA 2EC6C 3ICBA 1YVHA 3TS5C 1MQ1A 2JWWA 1KSMA 3IVTA 5BPJA 1QS7A 1Y1XA 1BT6A 1SYMA 3BFAA 4JWQA 4BY5A 4PE7A 1A29A 2KI4B 4NDCA 3SS4A 3CR4X 2K2AA 1NX0A 2LMVA 2BL0C 2F3ZA 4C0KA 2E6WA 2QPTA 3EK7A 1UHKA 2K7CA 5FI7A 3BFBA 4L9MA 4YI9A 1TRFA 2AUCA 4I5JA 3S0EA 1IGVA 1QIVA 1IH0A 4JQ0D 1JFJA 4KYNA 1F4QA 2L4IA 2JQ6A 3DVKA 4TNCA 4YGEB 4OVNF 1SCMB 3WHTB 5CSJA 2G9BA 2OTGB 2KPHA 1DJGA 1QX7A 2YGUA 1DT7B 1DJHA 5HKYA 1DTLA 2K8MB 2HPSA 3SS5A 1NX3A 1RTP1 3CGAA 3TDZA 1YX8A 3O78A 1EL4A 1F55A 2LM5A 2JC2A 3D76A 1XFVO 2L2EA 3GOFA 3NGVA 1QASA 1OZSA 2L2CA 1DF0B 1SK6D 1WRZA 2WCKA 2L5XB 1JUOA 4GGFC 5HLOA 1JSAA 4ETOA 1XK4C 4YRUA 5KTYA 5GQQC 1RFJA 2KAXA 1JBAA 1C7WA 1AJ5A 2LE9B 2NXQA 1UWOA 1UHHA 4HRHA 4PT1A 1F54A 5B8IB 1P28A 2EGDA 1S3PA 2KQYA 3A4UB 1R6PA 2K7OA 3R72A 3VGOA 5I94A 1KK8B 3KF9A 5DICA 1K96A 4I5KA 4F7FA 1KWOC 1J7RA 2KHNA 3BUXB 2Y1NA 3NXAA 1A4PA 3RLZA 1BU3A 1RJVA 2L50A 3EK8A 3S0DA 1CMGA 1CLBA 1H8BA 1K9PA 1CFPA 3PATA 3WXAA 1QV1A 5D3OA 3C1VA 3PSRA 4C0JA 5HYDA 2ZRSA 3I5FB 1PRWA 3GK1A 3BUWB 1SY9A 1W7JB 4M2OA 1J7PA
chains in the Genus database with same CATH topology
2ZRTA 5ER5A 2LVKA 1YUSA 4D1EA 1CDMA 1ZOTB 1B1GA 1A2XA 4CFQA 2L98A 1B47A 1XFZO 4GGNA 1J7QA 4UPGA 2LV7A 2I2RE 3EVVA 3I5HB 1BR4B 4JPZB 1AJ4A 3SG5A 2Q91A 1TTXA 3AAJA 4OV2A 2LNKA 1JF0A 3CR5X 3CLNA 4PHNA 1DF0A 1XVJA 3OB2B 5I2QA 1NIWA 2KGRA 1M31A 1L7ZA 2LLTA 1S6CA 1WRLA 2PASA 4YBHB 1BOCA 1PALA 3PLFB 2AMIA 3DVJA 2BCAA 1CM4A 2LLUA 2FJUB 2KFHA 2CT9A 1ODBA 1IKUA 2DOQA 1U5IB 3OX6A 1DJWA 5FYXA 2HQ8A 1JC2A 3WNXB 1A03A 3VRPA 1V1FA 3BOWA 3LLEA 1KFXL 2KYFA 1CTRA 3FWCA 4GPLB 1CMFA 1SL7A 2KAVA 2CTNA 2F8PA 2M1KB 2PSRA 1WY9A 4U8DA 4DUQA 1LINA 2BECA 2MAZA 2LVIA 1LA3A 1PK0D 2ZNEA 3FIAA 1YRUB 2H61C 4MBEA 5KU1A 1TOPA 1H4BA 2TN4A 4PE4A 2CXJA 2ZNDA 5AEQA 1B4CA 3SG6A 2I94A 4AQIA 1CFFA 1CFDA 1F8HA 1IQ5A 1D1OA 1PSBA 2VRGA 2E30A 4XJKB 2F2OA 3JVTB 3LCPC 1RWYA 1SL8A 2WORA 4OCIA 1KK7Z 1OE9B 1TNXA 3H4SE 2RGIA 4QJ3B 3SG3A 2M7NA 1M45A 4QJ4B 2KI4C 1KQMC 2HF5A 3O6BA 1LXFC 1M39A 1OQPA 2JT0A 3I5GB 1MR8A 1S5GZ 3CWGA 5F6TA 2GGZA 5CSFA 1NP8A 4USLA 1YURA 4GBAA 3TDIA 4MEWA 1DMOA 1QLKA 1BMOA 3LL8B 1ALWA 2LANA 2F33A 3LK1A 3IQQA 4ICBA 1KQVA 3PALA 1QVIZ 1NX2A 2JTZA 2OTGC 2LAPA 2BCXA 2WC8A 3BUMB 3TS5B 1J1EA 1U5IA 4GNKB 3CS1A 2LHIA 1FW4A 1XYDA 3PFVA 3EKHA 2F3YA 2LP2A 4MLWA 3SJSA 3TUYC 2M0RA 1QATA 4CLNA 1MXLC 1KFUS 2BL0B 2ZN9A 1TIZA 1WDCB 4MZJA 4GAOA 4ORCB 5J3XA 4DIRA 2HQWA 1L2OC 2K61A 3AAKA 3DVMA 1IRJA 2KBIA 4MN0A 1QXPA 1K94A 3KHEA 1BJFA 2D8NA 1YUTA 2MA2A 1MUXA 2JRFA 2P6BB 4HRGA 1CB1A 4I5LB 1YR5A 5AXIA 1AP4A 1RK9A 4PHMA 3I5IC 3VRRA 1J1DA 3RM1A 1N2DA 1Y1AA 2SCPA 2O60A 3IQOA 1OMRA 1YTZC 1FI5A 2BBNA 3BOWB 4OR9B 4XJKA 1JWDA 4I5NB 4NDBA 5HLVA 2JNFA 1V1GA 2L4HA 3VRNA 2LUCA 3D0YA 4PHJA 3PN7C 2A4JA 5CSIA 1OOJA 1GQMA 1QLSA 4AOMA 5DKQA 2KFFA 2JULA 2JTTA 1UHNA 3IF7A 2NCOA 2CBLA 4YGBB 5TNCA 2BKHB 2B1UA 1S6JA 3ZWHA 4YI8A 1DJIA 1S6IA 4PE0A 1XFYO 2KDHA 4PCWA 1UUSA 1B8CA 4WQ3A 1IJ6A 4MRYA 3JTDC 4N1FA 1W7IB 1RECA 1SKTA 1SMGA 1QX2A 1E8AA 1NPQA 1CKKA 2BE6A 3F45A 3E3RA 1EXRA 1TCFA 3CZTX 1NCZA 2MJWB 1SW8A 1KWOB 1GGZA 2Q4UA 1EG4A 4CFRA 2JOJA 1BODA 1NSHA 1UHJA 2IS9A 4ORBB 3SIAA 1LKJA 2ZKMX 1CDLA 2LC5A 2ZFDA 2WCFA 5DKRA 1KCYA 3NSIA 1IJ5A 2LVJA 1S26D 1B8LA 1MWNA 2NZ0A 1R2UA 1Q80A 4AQJA 3TZ1A 1OSAA 1MF8B 1PULA 2H2KA 1ZUZA 3D10A 2BKIB 1EG3A 4R1EA 3DD4A 1NCYA 3EVUA 2KAYA 4A4BA 2O5GA 1X02A 5AERA 2CCMA 2JXCA 4OKHA 2WOSA 1G33A 1NX1A 2G2BA 1TNPA 2OS8B 5I2LA 2JT3A 1K90D 5ER4X 1XFXO 1CFCA 4HSZA 1B7TZ 4GGFA 1Y0VH 1SPYA 1K95A 2GV5A 3M0WA 4ZCVA 1QV0A 2KNEA 1XK4A 1M63B 5DKNA 1DJXA 1N65A 4F0ZB 4M2PA 1S36A 1PVAA 2LP3A 2KSPA 1WLZA 1MHOA 2M97A 3NSLA 5CSNA 3JVTC 1F70A 1SR6C 1F71A 3CR2A 2M1UA 4MZLA 1A75B 4PE1A 2I7AA 5JJGA 3NSKA 3D0YB 2SASA 3MSEB 1GGWA 2K7DA 3I5GC 4HREE 1B8RA 1K93D 3FS7A 3FWBA 3OB1B 1YVLA 1HQVA 1IG5A 1SCVA 1JF2A 2LMTA 2NCPA 1NUBA 1G8IA 1TN4A 2JNXA 1OMDA 3OHMB 1KK7Y 2R2IA 1MXEA 2OPOA 1OZOA 2F2PA 5I2OA 1UP5A 2I18A 5I8NA 3QRXA 1SCMC 1TCOB 3O4YA 2MLEC 4ZCUA 2M7LA 5CPVA 1S5GY 1BF5A 1PVBA 2FCDA 4NDDA 1HT9A 2K0JA 1K8UA 2EC6B 1DJZA 1YUUA 2KI6D 1QIWA 2M8UA 2KQ6A 2Y5IA 2Y4QA 1N0YA 1AVSA 1KQMB 2ISDA 1G4YR 4MZKA 1S1EA 1PSRA 2QACA 3K21A 1WDCC 3HX4A 1QVIY 3BXKA 1OMVA 1IWQA 1SBJA 2BE4A 4ORAB 4PHKA 1BR1B 2L0PA 4GFTA 1SRAA 3EKJA 3VROA 3OP0A 1QJTA 1EJ3A 2LMUA 3OX5A 2HETA 3ZNIA 5AFPA 3O2PA 1CNPA 1ZMZA 3BUNB 3DF0B 2COLB 1CLMA 2KGBC 2NLNA 4Q04A 1JFKA 1KK8C 4P2YB 5HKWA 1FPWA 1A75A 1M46A 1Y6WA 1WLMA 3AKBA 2M49B 1CDPA 3TUYB 2Y1MA 4YGAA 4M2QA 4YGCB 2WCEA 1J7OA 1XFUO 2L51A 4C0LA 1L2OB 3SG2A 2H61A 2LUXA 3WHUB 2WNDA 1C07A 3HCMA 1RROA 2JPTA 1KFXS 1LVCD 2M9GA 3I5FC 2KOTA 3I5IB 1J55A 1DVIA 2PMYA 4BY4A 1FF1A 3NSOA 4QJ5B 2JZIA 4XYNA 2MRDA 1XA5A 1BG1A 2EHBA 1AHRA 1C7VA 4E68A 5AANA 2K7BA 3PN7B 3I5HC 4WRIA 2MBXA 3LK0A 1B9AA 2KFGA 1NWDA 2GGMA 2KYCA 2FOTA 4PDZA 1XO5A 1IQ3A 5IBWA 4WQ2A 2PRUA 2AAOA 3DVEA 1Y1UA 1NCXA 3GK4X 3EK4A 2MLFC 1QX5B 2LLSA 1AK8A 1GJYA 2LHLA 1KFUL 2M29A 3JTDB 3VRQA 1YRTB 2M3WA 4NQGA 3SIBA 3KPXA 3DF0A 4IL1A 4P5OE 4MSPA 4DRWA 1EH2A 2ZN8A 3AKAA 3PM8A 3SG7A 2JXLA 4MRXA 4PALA 1AUIB 2OS8C 1SNLA 1FI6A 2LVVA 1BLQA 2JT8A 4DCKA 1TNQA 1VRKA 4A4CA 1UURA 1KSOA 5D69A 3TDUA 1K9KA 3BYAA 3GK2A 4MVFA 1FBVA 1WRKA 1NYAA 5D7FA 2CNPA 4FQOA 1UHIA 4N5XA 1YX7A 2MHHA 4CIDA 1DJYA 2KI6C 1TNWA 2BCBA 1XFWO 2FCEA 1K9UA 4DS7A 5JOLA 5KSZA 3EVRA 1B7TY 2KBMA 3SG4A 1SL9A 3KEVA 2PALA 3KO0A 2BBMA 2V53A 5G08A 1DGUA 2JU0A 4YGDB 1CLLA 5PALA 5HKZA 3BQ3A 2PVBA 3BUOB 4CPVA 4N1GA 1DGVA 1QTXA 4FTGA 3CTNA 2WCBA 1ALVA 1CM1A 1ZACA 1CDNA 1ZFSA 1K2HA 5K89A 1F4OA 3A8RA 1SR6B 1LA0A 2LCPA 2K2FA 2EC6C 3ICBA 1YVHA 3TS5C 1MQ1A 2JWWA 1KSMA 5BPJA 1QS7A 1Y1XA 1BT6A 1SYMA 4JWQA 4BY5A 4PE7A 1A29A 2KI4B 4NDCA 3CR4X 2K2AA 1NX0A 2LMVA 2BL0C 2F3ZA 4C0KA 2E6WA 2QPTA 3EK7A 1UHKA 2K7CA 4L9MA 4YI9A 1TRFA 2AUCA 4I5JA 1IGVA 1QIVA 1IH0A 4JQ0D 1JFJA 1F4QA 2L4IA 2JQ6A 3DVKA 4TNCA 4YGEB 4OVNF 1SCMB 3WHTB 5CSJA 2G9BA 2OTGB 1DJGA 1QX7A 1DT7B 1DJHA 5HKYA 1DTLA 2K8MB 2HPSA 1NX3A 1RTP1 3CGAA 3TDZA 1YX8A 3O78A 1EL4A 1F55A 2LM5A 2JC2A 1XFVO 2L2EA 3GOFA 1QASA 1OZSA 4GGFC 1DF0B 1SK6D 1WRZA 4GUKA 2L5XB 1JUOA 5HLOA 1JSAA 4ETOA 1XK4C 4YRUA 5KTYA 5GQQC 1RFJA 2KAXA 1JBAA 1C7WA 1AJ5A 2LE9B 2NXQA 1UWOA 1UHHA 4HRHA 1F54A 5B8IB 2EGDA 1S3PA 2KQYA 3A4UB 1R6PA 2K7OA 3VGOA 1KK8B 3KF9A 1K96A 4I5KA 1KWOC 1J7RA 2KHNA 3BUXB 2Y1NA 3NXAA 1A4PA 3RLZA 1BU3A 1RJVA 2L50A 3EK8A 1CMGA 1CLBA 1H8BA 1K9PA 1CFPA 3PATA 3WXAA 1QV1A 3C1VA 3PSRA 4C0JA 5HYDA 2ZRSA 3I5FB 1PRWA 3GK1A 3BUWB 1SY9A 1W7JB 4M2OA 1J7PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZRT A;  5ER5 A;  2LVK A;  1YUS A;  4D1E A;  1CDM A;  1ZOT B;  1B1G A;  1A2X A;  4CFQ A;  2L98 A;  1B47 A;  1XFZ O;  4GGN A;  1J7Q A;  4UPG A;  2LV7 A;  2I2R E;  3EVV A;  3I5H B;  1BR4 B;  4JPZ B;  1AJ4 A;  3SG5 A;  2Q91 A;  1TTX A;  3AAJ A;  4OV2 A;  2LNK A;  1JF0 A;  3CR5 X;  3CLN A;  4PHN A;  1DF0 A;  1XVJ A;  3OB2 B;  5I2Q A;  1NIW A;  2KGR A;  1M31 A;  1L7Z A;  2LLT A;  1S6C A;  1WRL A;  2PAS A;  4YBH B;  1BOC A;  1PAL A;  3PLF B;  2AMI A;  3DVJ A;  2BCA A;  1CM4 A;  2LLU A;  2FJU B;  2KFH A;  2CT9 A;  1ODB A;  1IKU A;  2DOQ A;  1U5I B;  3OX6 A;  1DJW A;  5FYX A;  2HQ8 A;  1JC2 A;  3WNX B;  1A03 A;  3VRP A;  1V1F A;  3BOW A;  3LLE A;  1KFX L;  2KYF A;  1CTR A;  3FWC A;  4GPL B;  1CMF A;  1SL7 A;  2KAV A;  2CTN A;  2F8P A;  2M1K B;  2PSR A;  1WY9 A;  4U8D A;  4DUQ A;  1LIN A;  2BEC A;  2MAZ A;  2LVI A;  1LA3 A;  1PK0 D;  2ZNE A;  3FIA A;  1YRU B;  2H61 C;  4MBE A;  5KU1 A;  1TOP A;  1H4B A;  2TN4 A;  4PE4 A;  2CXJ A;  2ZND A;  5AEQ A;  1B4C A;  3SG6 A;  2I94 A;  4AQI A;  1CFF A;  1CFD A;  1F8H A;  1IQ5 A;  1D1O A;  1PSB A;  2VRG A;  2E30 A;  4XJK B;  2F2O A;  3JVT B;  3LCP C;  1RWY A;  1SL8 A;  2WOR A;  4OCI A;  1KK7 Z;  1OE9 B;  1TNX A;  3H4S E;  2RGI A;  4QJ3 B;  3SG3 A;  2M7N A;  1M45 A;  4QJ4 B;  2KI4 C;  1KQM C;  2HF5 A;  3O6B A;  1LXF C;  1M39 A;  1OQP A;  2JT0 A;  3I5G B;  1MR8 A;  1S5G Z;  3CWG A;  5F6T A;  2GGZ A;  5CSF A;  1NP8 A;  4USL A;  1YUR A;  4GBA A;  3TDI A;  4MEW A;  1DMO A;  1QLK A;  1BMO A;  3LL8 B;  1ALW A;  2LAN A;  2F33 A;  3LK1 A;  3IQQ A;  4ICB A;  1KQV A;  3PAL A;  1QVI Z;  1NX2 A;  2JTZ A;  2OTG C;  2LAP A;  2BCX A;  2WC8 A;  3BUM B;  3TS5 B;  1J1E A;  1U5I A;  4GNK B;  3CS1 A;  2LHI A;  1FW4 A;  1XYD A;  3PFV A;  3EKH A;  2F3Y A;  2LP2 A;  4MLW A;  3SJS A;  3TUY C;  2M0R A;  1QAT A;  4CLN A;  1MXL C;  1KFU S;  2BL0 B;  2ZN9 A;  1TIZ A;  1WDC B;  4MZJ A;  4GAO A;  4ORC B;  5J3X A;  4DIR A;  2HQW A;  1L2O C;  2K61 A;  3AAK A;  3DVM A;  1IRJ A;  2KBI A;  4MN0 A;  1QXP A;  1K94 A;  3KHE A;  1BJF A;  2D8N A;  1YUT A;  2MA2 A;  1MUX A;  2JRF A;  2P6B B;  4HRG A;  1CB1 A;  4I5L B;  1YR5 A;  5AXI A;  1AP4 A;  1RK9 A;  4PHM A;  3I5I C;  3VRR A;  1J1D A;  3RM1 A;  1N2D A;  1Y1A A;  2SCP A;  2O60 A;  3IQO A;  1OMR A;  1YTZ C;  1FI5 A;  2BBN A;  3BOW B;  4OR9 B;  4XJK A;  1JWD A;  4I5N B;  4NDB A;  5HLV A;  2JNF A;  1V1G A;  2L4H A;  3VRN A;  2LUC A;  3D0Y A;  4PHJ A;  3PN7 C;  2A4J A;  5CSI A;  1OOJ A;  1GQM A;  1QLS A;  4AOM A;  5DKQ A;  2KFF A;  2JUL A;  2JTT A;  1UHN A;  3IF7 A;  2NCO A;  2CBL A;  4YGB B;  5TNC A;  2BKH B;  2B1U A;  1S6J A;  3ZWH A;  4YI8 A;  1DJI A;  1S6I A;  4PE0 A;  1XFY O;  2KDH A;  4PCW A;  1UUS A;  1B8C A;  4WQ3 A;  1IJ6 A;  4MRY A;  3JTD C;  4N1F A;  1W7I B;  1REC A;  1SKT A;  1SMG A;  1QX2 A;  1E8A A;  1NPQ A;  1CKK A;  2BE6 A;  3F45 A;  3E3R A;  1EXR A;  1TCF A;  3CZT X;  1NCZ A;  2MJW B;  1SW8 A;  1KWO B;  1GGZ A;  2Q4U A;  1EG4 A;  4CFR A;  2JOJ A;  1BOD A;  1NSH A;  1UHJ A;  2IS9 A;  4ORB B;  3SIA A;  1LKJ A;  2ZKM X;  1CDL A;  2LC5 A;  2ZFD A;  2WCF A;  5DKR A;  1KCY A;  3NSI A;  1IJ5 A;  2LVJ A;  1S26 D;  1B8L A;  1MWN A;  2NZ0 A;  1R2U A;  1Q80 A;  4AQJ A;  3TZ1 A;  1OSA A;  1MF8 B;  1PUL A;  2H2K A;  1ZUZ A;  3D10 A;  2BKI B;  1EG3 A;  4R1E A;  3DD4 A;  1NCY A;  3EVU A;  2KAY A;  4A4B A;  2O5G A;  1X02 A;  5AER A;  2CCM A;  2JXC A;  4OKH A;  2WOS A;  1G33 A;  1NX1 A;  2G2B A;  1TNP A;  2OS8 B;  5I2L A;  2JT3 A;  1K90 D;  5ER4 X;  1XFX O;  1CFC A;  4HSZ A;  1B7T Z;  4GGF A;  1Y0V H;  1SPY A;  1K95 A;  2GV5 A;  3M0W A;  4ZCV A;  1QV0 A;  2KNE A;  1XK4 A;  1M63 B;  5DKN A;  1DJX A;  1N65 A;  4F0Z B;  4M2P A;  1S36 A;  1PVA A;  2LP3 A;  2KSP A;  1WLZ A;  1MHO A;  2M97 A;  3NSL A;  5CSN A;  3JVT C;  1F70 A;  1SR6 C;  1F71 A;  3CR2 A;  2M1U A;  4MZL A;  1A75 B;  4PE1 A;  2I7A A;  5JJG A;  3NSK A;  3D0Y B;  2SAS A;  3MSE B;  1GGW A;  2K7D A;  3I5G C;  4HRE E;  1B8R A;  1K93 D;  3FS7 A;  3FWB A;  3OB1 B;  1YVL A;  1HQV A;  1IG5 A;  1SCV A;  1JF2 A;  2LMT A;  2NCP A;  1NUB A;  1G8I A;  1TN4 A;  2JNX A;  1OMD A;  3OHM B;  1KK7 Y;  2R2I A;  1MXE A;  2OPO A;  1OZO A;  2F2P A;  5I2O A;  1UP5 A;  2I18 A;  5I8N A;  3QRX A;  1SCM C;  1TCO B;  3O4Y A;  2MLE C;  4ZCU A;  2M7L A;  5CPV A;  1S5G Y;  1BF5 A;  1PVB A;  2FCD A;  4NDD A;  1HT9 A;  2K0J A;  1K8U A;  2EC6 B;  1DJZ A;  1YUU A;  2KI6 D;  1QIW A;  2M8U A;  2KQ6 A;  2Y5I A;  2Y4Q A;  1N0Y A;  1AVS A;  1KQM B;  2ISD A;  1G4Y R;  4MZK A;  1S1E A;  1PSR A;  2QAC A;  3K21 A;  1WDC C;  3HX4 A;  1QVI Y;  3BXK A;  1OMV A;  1IWQ A;  1SBJ A;  2BE4 A;  4ORA B;  4PHK A;  1BR1 B;  2L0P A;  4GFT A;  1SRA A;  3EKJ A;  3VRO A;  3OP0 A;  1QJT A;  1EJ3 A;  2LMU A;  3OX5 A;  2HET A;  3ZNI A;  5AFP A;  3O2P A;  1CNP A;  1ZMZ A;  3BUN B;  3DF0 B;  2COL B;  1CLM A;  2KGB C;  2NLN A;  4Q04 A;  1JFK A;  1KK8 C;  4P2Y B;  5HKW A;  1FPW A;  1A75 A;  1M46 A;  1Y6W A;  1WLM A;  3AKB A;  2M49 B;  1CDP A;  3TUY B;  2Y1M A;  4YGA A;  4M2Q A;  4YGC B;  2WCE A;  1J7O A;  1XFU O;  2L51 A;  4C0L A;  1L2O B;  3SG2 A;  2H61 A;  2LUX A;  3WHU B;  2WND A;  1C07 A;  3HCM A;  1RRO A;  2JPT A;  1KFX S;  1LVC D;  2M9G A;  3I5F C;  2KOT A;  3I5I B;  1J55 A;  1DVI A;  2PMY A;  4BY4 A;  1FF1 A;  3NSO A;  4QJ5 B;  2JZI A;  4XYN A;  2MRD A;  1XA5 A;  1BG1 A;  2EHB A;  1AHR A;  1C7V A;  4E68 A;  5AAN A;  2K7B A;  3PN7 B;  3I5H C;  4WRI A;  2MBX A;  3LK0 A;  1B9A A;  2KFG A;  1NWD A;  2GGM A;  2KYC A;  2FOT A;  4PDZ A;  1XO5 A;  1IQ3 A;  5IBW A;  4WQ2 A;  2PRU A;  2AAO A;  3DVE A;  1Y1U A;  1NCX A;  3GK4 X;  3EK4 A;  2MLF C;  1QX5 B;  2LLS A;  1AK8 A;  1GJY A;  2LHL A;  1KFU L;  2M29 A;  3JTD B;  3VRQ A;  1YRT B;  2M3W A;  4NQG A;  3SIB A;  3KPX A;  3DF0 A;  4IL1 A;  4P5O E;  4MSP A;  4DRW A;  1EH2 A;  2ZN8 A;  3AKA A;  3PM8 A;  3SG7 A;  2JXL A;  4MRX A;  4PAL A;  1AUI B;  2OS8 C;  1SNL A;  1FI6 A;  2LVV A;  1BLQ A;  2JT8 A;  4DCK A;  1TNQ A;  1VRK A;  4A4C A;  1UUR A;  1KSO A;  5D69 A;  3TDU A;  1K9K A;  3BYA A;  3GK2 A;  4MVF A;  1FBV A;  1WRK A;  1NYA A;  5D7F A;  2CNP A;  4FQO A;  1UHI A;  4N5X A;  1YX7 A;  2MHH A;  4CID A;  1DJY A;  2KI6 C;  1TNW A;  2BCB A;  1XFW O;  2FCE A;  1K9U A;  4DS7 A;  5JOL A;  5KSZ A;  3EVR A;  1B7T Y;  2KBM A;  3SG4 A;  1SL9 A;  3KEV A;  2PAL A;  3KO0 A;  2BBM A;  2V53 A;  5G08 A;  1DGU A;  2JU0 A;  4YGD B;  1CLL A;  5PAL A;  5HKZ A;  3BQ3 A;  2PVB A;  3BUO B;  4CPV A;  4N1G A;  1DGV A;  1QTX A;  4FTG A;  3CTN A;  2WCB A;  1ALV A;  1CM1 A;  1ZAC A;  1CDN A;  1ZFS A;  1K2H A;  5K89 A;  1F4O A;  3A8R A;  1SR6 B;  1LA0 A;  2LCP A;  2K2F A;  2EC6 C;  3ICB A;  1YVH A;  3TS5 C;  1MQ1 A;  2JWW A;  1KSM A;  5BPJ A;  1QS7 A;  1Y1X A;  1BT6 A;  1SYM A;  4JWQ A;  4BY5 A;  4PE7 A;  1A29 A;  2KI4 B;  4NDC A;  3CR4 X;  2K2A A;  1NX0 A;  2LMV A;  2BL0 C;  2F3Z A;  4C0K A;  2E6W A;  2QPT A;  3EK7 A;  1UHK A;  2K7C A;  4L9M A;  4YI9 A;  1TRF A;  2AUC A;  4I5J A;  1IGV A;  1QIV A;  1IH0 A;  4JQ0 D;  1JFJ A;  1F4Q A;  2L4I A;  2JQ6 A;  3DVK A;  4TNC A;  4YGE B;  4OVN F;  1SCM B;  3WHT B;  5CSJ A;  2G9B A;  2OTG B;  1DJG A;  1QX7 A;  1DT7 B;  1DJH A;  5HKY A;  1DTL A;  2K8M B;  2HPS A;  1NX3 A;  1RTP 1;  3CGA A;  3TDZ A;  1YX8 A;  3O78 A;  1EL4 A;  1F55 A;  2LM5 A;  2JC2 A;  1XFV O;  2L2E A;  3GOF A;  1QAS A;  1OZS A;  4GGF C;  1DF0 B;  1SK6 D;  1WRZ A;  4GUK A;  2L5X B;  1JUO A;  5HLO A;  1JSA A;  4ETO A;  1XK4 C;  4YRU A;  5KTY A;  5GQQ C;  1RFJ A;  2KAX A;  1JBA A;  1C7W A;  1AJ5 A;  2LE9 B;  2NXQ A;  1UWO A;  1UHH A;  4HRH A;  1F54 A;  5B8I B;  2EGD A;  1S3P A;  2KQY A;  3A4U B;  1R6P A;  2K7O A;  3VGO A;  1KK8 B;  3KF9 A;  1K96 A;  4I5K A;  1KWO C;  1J7R A;  2KHN A;  3BUX B;  2Y1N A;  3NXA A;  1A4P A;  3RLZ A;  1BU3 A;  1RJV A;  2L50 A;  3EK8 A;  1CMG A;  1CLB A;  1H8B A;  1K9P A;  1CFP A;  3PAT A;  3WXA A;  1QV1 A;  3C1V A;  3PSR A;  4C0J A;  5HYD A;  2ZRS A;  3I5F B;  1PRW A;  3GK1 A;  3BUW B;  1SY9 A;  1W7J B;  4M2O A;  1J7P A; 
#chains in the Genus database with same CATH topology
 2ZRT A;  5ER5 A;  2LVK A;  1YUS A;  3VB1 A;  4D1E A;  1CDM A;  1ZOT B;  1B1G A;  1A2X A;  4CFQ A;  2L98 A;  1B47 A;  1XFZ O;  4GGN A;  1J7Q A;  3QME A;  4UPG A;  2LV7 A;  2I2R E;  3EVV A;  1XFR A;  1BR4 B;  3I5H B;  3K1E A;  1AJ4 A;  4JPZ B;  2Q91 A;  1TTX A;  3AAJ A;  4OV2 A;  3SG5 A;  3PM2 A;  2LNK A;  1JF0 A;  3CR5 X;  3CLN A;  4PHN A;  3NHI A;  1DF0 A;  1XVJ A;  3OB2 B;  5I2Q A;  1NIW A;  2KGR A;  1M31 A;  1L7Z A;  2LLT A;  1S6C A;  1WRL A;  2PAS A;  3D77 A;  4YBH B;  1PAL A;  1BOC A;  3PLF B;  2AMI A;  4GUK A;  3DVJ A;  2BCA A;  1CM4 A;  2LLU A;  2FJU B;  2KFH A;  3DYE A;  2CT9 A;  1ODB A;  1IKU A;  2DOQ A;  1U5I B;  3CYZ A;  1DJW A;  3OX6 A;  5FYX A;  2HQ8 A;  1JC2 A;  3WNX B;  1A03 A;  3VRP A;  1V1F A;  3BOW A;  3LLE A;  1KFX L;  3S0G A;  2KYF A;  1CTR A;  3FWC A;  2JPO A;  4GPL B;  1SL7 A;  2KAV A;  2CTN A;  2F8P A;  2M1K B;  2PSR A;  1WY9 A;  4U8D A;  4DUQ A;  1LIN A;  2BEC A;  2MAZ A;  2LVI A;  1LA3 A;  1PK0 D;  2ZNE A;  4JKT A;  3FIA A;  4FQT A;  1YRU B;  2H61 C;  4MBE A;  5KU1 A;  1TOP A;  1H4B A;  2TN4 A;  4PE4 A;  2CXJ A;  2ZND A;  3L4A A;  2QEB A;  5AEQ A;  1B4C A;  3SG6 A;  2I94 A;  4AQI A;  1CFF A;  1CFD A;  3DXL A;  1F8H A;  1IQ5 A;  1D1O A;  1PSB A;  2VRG A;  2E30 A;  4XJK B;  2F2O A;  3JVT B;  3LCP C;  1RWY A;  1SL8 A;  2WOR A;  4OCI A;  1KK7 Z;  1OE9 B;  1TNX A;  3H4S E;  5FI6 A;  2RGI A;  4QJ3 B;  3SG3 A;  2M7N A;  1M45 A;  4QJ4 B;  2KI4 C;  1KQM C;  2HF5 A;  3O6B A;  2WC5 A;  1LXF C;  3B86 A;  3NHT A;  1M39 A;  1OQP A;  2JT0 A;  3I5G B;  1MR8 A;  1S5G Z;  3CWG A;  3B88 A;  5F6T A;  2GGZ A;  5CSF A;  1NP8 A;  4USL A;  2PQL A;  1YUR A;  4GBA A;  3TDI A;  4MEW A;  3S0F A;  1DMO A;  1QLK A;  1BMO A;  3CAB A;  3LL8 B;  1ALW A;  2LAN A;  2F33 A;  3LK1 A;  3IQQ A;  4ICB A;  1KQV A;  3OGN A;  3PAL A;  1QVI Z;  1NX2 A;  2JTZ A;  2OTG C;  4OZD A;  2LAP A;  2BCX A;  2WC8 A;  3BUM B;  3TS5 B;  1J1E A;  1U5I A;  4GNK B;  3CS1 A;  2LHI A;  1FW4 A;  1XYD A;  3PFV A;  3EKH A;  2F3Y A;  2LP2 A;  1ORG A;  4MLW A;  3SJS A;  3TUY C;  2M0R A;  1QAT A;  4CLN A;  1MXL C;  1KFU S;  2BL0 B;  2ZN9 A;  1TIZ A;  1WDC B;  4MZJ A;  4GAO A;  4ORC B;  5J3X A;  4DIR A;  2HQW A;  1L2O C;  2K61 A;  3AAK A;  3DVM A;  1IRJ A;  2KBI A;  4MN0 A;  1QXP A;  1K94 A;  3KHE A;  1BJF A;  2D8N A;  1YUT A;  2MA2 A;  1MUX A;  2JRF A;  2P6B B;  4HRG A;  1CB1 A;  4I5L B;  1YR5 A;  5AXI A;  3B7A A;  1AP4 A;  1RK9 A;  3R1V A;  3I5I C;  4PHM A;  3VRR A;  1J1D A;  3RM1 A;  1N2D A;  1Y1A A;  2SCP A;  2O60 A;  3IQO A;  1OMR A;  1YTZ C;  2WC6 A;  1FI5 A;  2BBN A;  3BOW B;  3D74 A;  4OR9 B;  4XJK A;  1JWD A;  4I5N B;  4NDB A;  5HLV A;  2JNF A;  1V1G A;  2KLE A;  2L4H A;  4IJ7 A;  3VRN A;  2LUC A;  3D0Y A;  4PHJ A;  3PN7 C;  2A4J A;  2K60 A;  5CSI A;  1OOJ A;  1GQM A;  1QLS A;  4AOM A;  5DKQ A;  2KFF A;  2JUL A;  2JTT A;  1UHN A;  3IF7 A;  1OW4 A;  3UNW A;  2NCO A;  2CBL A;  4YGB B;  5TNC A;  2BKH B;  2B1U A;  1S6J A;  3ZWH A;  4YI8 A;  1DJI A;  1S6I A;  4PE0 A;  1XFY O;  2KDH A;  4PCW A;  1UUS A;  2ERB A;  1B8C A;  4WQ3 A;  1IJ6 A;  1TWO A;  4MRY A;  3JTD C;  4N1F A;  4INX A;  1W7I B;  1REC A;  1SKT A;  1SMG A;  1QX2 A;  1E8A A;  1DC1 A;  1NPQ A;  1CKK A;  2BE6 A;  3F45 A;  3E3R A;  2P70 A;  1EXR A;  1TCF A;  3CZT X;  1NCZ A;  4INW A;  2MJW B;  3RZS A;  1SW8 A;  2WCJ A;  1KWO B;  1GGZ A;  2Q4U A;  1EG4 A;  4CFR A;  2JOJ A;  1BOD A;  1NSH A;  1UHJ A;  2IS9 A;  4ORB B;  3SIA A;  1LKJ A;  2ZKM X;  1CDL A;  2LC5 A;  2ZFD A;  2WCF A;  5DKR A;  1KCY A;  3NSI A;  1IJ5 A;  3S0A A;  2LVJ A;  1S26 D;  1B8L A;  1DEK A;  1MWN A;  1R2U A;  2NZ0 A;  1Q80 A;  2P71 A;  4AQJ A;  3TZ1 A;  1OSA A;  1MF8 B;  1PUL A;  3B6X A;  2H2K A;  1ZUZ A;  3D10 A;  2BKI B;  1EG3 A;  4R1E A;  3DD4 A;  1NCY A;  3EVU A;  2KAY A;  4A4B A;  2O5G A;  1X02 A;  5AER A;  2CCM A;  2JXC A;  2WCL A;  3SS3 A;  4OKH A;  2WOS A;  1G33 A;  1NX1 A;  2L5Y A;  2G2B A;  3Q8I A;  1TNP A;  2OS8 B;  5I2L A;  2JT3 A;  1K90 D;  5ER4 X;  2BNX A;  1XFX O;  1CFC A;  4HSZ A;  1T14 A;  1B7T Z;  3CZ0 A;  3D78 A;  4GGF A;  1Y0V H;  1SPY A;  1K95 A;  2GV5 A;  3M0W A;  4ZCV A;  1QV0 A;  2KNE A;  1XK4 A;  1M63 B;  5DKN A;  1DJX A;  1N65 A;  3L47 A;  4F0Z B;  4M2P A;  1S36 A;  1PVA A;  2LP3 A;  2FJY A;  1WLZ A;  2KSP A;  1MHO A;  2M97 A;  3NSL A;  5CSN A;  3JVT C;  2GTE A;  1SR6 C;  3UO9 A;  2QDI A;  3CR2 A;  1F71 A;  1F70 A;  3O4X A;  2M1U A;  4MZL A;  1A75 B;  4PE1 A;  2I7A A;  3CZ1 A;  5JJG A;  3NSK A;  3D0Y B;  2SAS A;  3MSE B;  1GGW A;  1W9Z A;  2K7D A;  2WCM A;  3I5G C;  1B8R A;  1K93 D;  3FS7 A;  3FWB A;  4HRE E;  3OB1 B;  1YVL A;  1HQV A;  1IG5 A;  1SCV A;  1JF2 A;  2LMT A;  2NCP A;  1NUB A;  1G8I A;  1TN4 A;  2JNX A;  1OMD A;  3OHM B;  1KK7 Y;  3OBV A;  2R2I A;  1MXE A;  1TUJ A;  1OZO A;  2F2P A;  2OPO A;  3B87 A;  1UP5 A;  2I18 A;  5I2O A;  5I8N A;  3QRX A;  1SCM C;  1TCO B;  3O4Y A;  2MLE C;  4ZCU A;  2M7L A;  5CPV A;  1S5G Y;  1BF5 A;  1PVB A;  2FCD A;  4NDD A;  1HT9 A;  2K0J A;  1K8U A;  2EC6 B;  1DJZ A;  1YUU A;  5FI2 A;  2KI6 D;  1QIW A;  2M8U A;  2KQ6 A;  2QEO A;  2Y4Q A;  2Y5I A;  3CDN A;  1N0Y A;  1AVS A;  1KQM B;  2ISD A;  1G4Y R;  4MZK A;  1S1E A;  1PSR A;  2QAC A;  2QEV A;  3K21 A;  1WDC C;  3HX4 A;  1QVI Y;  3FE8 A;  3BXK A;  1OMV A;  1IWQ A;  1SBJ A;  1C3Z A;  2BE4 A;  3S0B A;  1C3Y A;  3BFH A;  4ORA B;  4PHK A;  1BR1 B;  2L0P A;  3L4L A;  3CZ2 A;  1Z2C B;  4GFT A;  1SRA A;  3EKJ A;  3VRO A;  3OP0 A;  5EL2 A;  1QJT A;  1EJ3 A;  2LMU A;  3OX5 A;  2HET A;  3FE9 A;  3ZNI A;  3O2P A;  5AFP A;  1CNP A;  1ZMZ A;  3BUN B;  3DF0 B;  2COL B;  1GM0 A;  1CLM A;  2KGB C;  2NLN A;  4Q04 A;  1JFK A;  1KK8 C;  4P2Y B;  5HKW A;  1FPW A;  1A75 A;  1M46 A;  1Y6W A;  1WLM A;  3AKB A;  1TUZ A;  2M49 B;  1CDP A;  3TUY B;  2Y1M A;  4YGA A;  4M2Q A;  1SSE B;  4YGC B;  2QEH A;  2WCE A;  1J7O A;  1XFU O;  2L51 A;  1OOG A;  4C0L A;  3PJI A;  1L2O B;  3SG2 A;  1OOI X;  2BAP A;  2H61 A;  2LUX A;  3WHU B;  2WND A;  1C07 A;  3HCM A;  1RRO A;  2JPT A;  1KFX S;  1LVC D;  2M9G A;  3I5F C;  2KOT A;  3I5I B;  1J55 A;  1DVI A;  2PMY A;  4BY4 A;  1FF1 A;  3NSO A;  4QJ5 B;  3R1P A;  2JZI A;  4XYN A;  2MRD A;  1XA5 A;  1BG1 A;  2H8V A;  2EHB A;  1AHR A;  2PYQ A;  1C7V A;  4E68 A;  5AAN A;  2K7B A;  3PN7 B;  3I5H C;  4WRI A;  2MBX A;  3V2L A;  3LK0 A;  1B9A A;  2KFG A;  1NWD A;  1DEL A;  2GGM A;  3EG5 B;  2KYC A;  2FOT A;  3DY9 A;  1XO5 A;  4PDZ A;  1IQ3 A;  5IBW A;  4WQ2 A;  2PRU A;  2AAO A;  3DVE A;  1Y1U A;  1NCX A;  3N7H A;  3GK4 X;  3EK4 A;  2MLF C;  1QX5 B;  2LLS A;  1AK8 A;  1CMF A;  1GJY A;  2LHL A;  1KFU L;  2M29 A;  3JTD B;  3VRQ A;  1YRT B;  2M3W A;  4NQG A;  3SIB A;  3KPX A;  3DF0 A;  4IL1 A;  4P5O E;  4MSP A;  4DRW A;  1EH2 A;  2ZN8 A;  1DQE A;  3AKA A;  3BJH A;  3PM8 A;  2JXL A;  3SG7 A;  4MRX A;  4PAL A;  1AUI B;  2OS8 C;  1SNL A;  1FI6 A;  3D75 A;  2LVV A;  1BLQ A;  2JT8 A;  4DCK A;  2KLD A;  1TNQ A;  1VRK A;  4A4C A;  1OOH A;  1QWV A;  1UUR A;  1KSO A;  5D69 A;  3TDU A;  1K9K A;  3BYA A;  3GK2 A;  4MVF A;  1FBV A;  1WRK A;  1NYA A;  5D7F A;  2CNP A;  4FQO A;  1UHI A;  4N5X A;  1YX7 A;  2MHH A;  4CID A;  1DJY A;  2KI6 C;  1IIO A;  1TNW A;  2BCB A;  1XFW O;  2FCE A;  1K9U A;  4DS7 A;  5JOL A;  5KSZ A;  4JD9 A;  3EVR A;  1B7T Y;  2KBM A;  5HL1 A;  3SG4 A;  2WCH A;  1SL9 A;  3KEV A;  2PAL A;  3KO0 A;  2BBM A;  2V53 A;  5G08 A;  1DGU A;  1LS8 A;  2JU0 A;  4YGD B;  1CLL A;  5PAL A;  5HKZ A;  3BQ3 A;  2PVB A;  3BUO B;  4CPV A;  3FE6 A;  4N1G A;  1DGV A;  1QTX A;  4FTG A;  3CTN A;  2WCB A;  3D73 A;  1ALV A;  1Z4H A;  1CM1 A;  1ZAC A;  1CDN A;  1ZFS A;  1K2H A;  1OOF A;  5K89 A;  3R1O A;  1F4O A;  3DZT A;  3A8R A;  1SR6 B;  1LA0 A;  2LCP A;  2K2F A;  2EC6 C;  3ICB A;  1YVH A;  3TS5 C;  1MQ1 A;  2JWW A;  1KSM A;  3IVT A;  5BPJ A;  1QS7 A;  1Y1X A;  1BT6 A;  1SYM A;  3BFA A;  4JWQ A;  4BY5 A;  4PE7 A;  1A29 A;  2KI4 B;  4NDC A;  3SS4 A;  3CR4 X;  2K2A A;  1NX0 A;  2LMV A;  2BL0 C;  2F3Z A;  4C0K A;  2E6W A;  2QPT A;  3EK7 A;  1UHK A;  2K7C A;  5FI7 A;  3BFB A;  4L9M A;  4YI9 A;  1TRF A;  2AUC A;  4I5J A;  3S0E A;  1IGV A;  1QIV A;  1IH0 A;  4JQ0 D;  1JFJ A;  4KYN A;  1F4Q A;  2L4I A;  2JQ6 A;  3DVK A;  4TNC A;  4YGE B;  4OVN F;  1SCM B;  3WHT B;  5CSJ A;  2G9B A;  2OTG B;  2KPH A;  1DJG A;  1QX7 A;  2YGU A;  1DT7 B;  1DJH A;  5HKY A;  1DTL A;  2K8M B;  2HPS A;  3SS5 A;  1NX3 A;  1RTP 1;  3CGA A;  3TDZ A;  1YX8 A;  3O78 A;  1EL4 A;  1F55 A;  2LM5 A;  2JC2 A;  3D76 A;  1XFV O;  2L2E A;  3GOF A;  3NGV A;  1QAS A;  1OZS A;  2L2C A;  1DF0 B;  1SK6 D;  1WRZ A;  2WCK A;  2L5X B;  1JUO A;  4GGF C;  5HLO A;  1JSA A;  4ETO A;  1XK4 C;  4YRU A;  5KTY A;  5GQQ C;  1RFJ A;  2KAX A;  1JBA A;  1C7W A;  1AJ5 A;  2LE9 B;  2NXQ A;  1UWO A;  1UHH A;  4HRH A;  4PT1 A;  1F54 A;  5B8I B;  1P28 A;  2EGD A;  1S3P A;  2KQY A;  3A4U B;  1R6P A;  2K7O A;  3R72 A;  3VGO A;  5I94 A;  1KK8 B;  3KF9 A;  5DIC A;  1K96 A;  4I5K A;  4F7F A;  1KWO C;  1J7R A;  2KHN A;  3BUX B;  2Y1N A;  3NXA A;  1A4P A;  3RLZ A;  1BU3 A;  1RJV A;  2L50 A;  3EK8 A;  3S0D A;  1CMG A;  1CLB A;  1H8B A;  1K9P A;  1CFP A;  3PAT A;  3WXA A;  1QV1 A;  5D3O A;  3C1V A;  3PSR A;  4C0J A;  5HYD A;  2ZRS A;  3I5F B;  1PRW A;  3GK1 A;  3BUW B;  1SY9 A;  1W7J B;  4M2O A;  1J7P A; 
#chains in the Genus database with same CATH homology
 2ZRT A;  5ER5 A;  2LVK A;  1YUS A;  4D1E A;  1CDM A;  1ZOT B;  1B1G A;  1A2X A;  4CFQ A;  2L98 A;  1B47 A;  1XFZ O;  4GGN A;  1J7Q A;  4UPG A;  2LV7 A;  2I2R E;  3EVV A;  3I5H B;  1BR4 B;  4JPZ B;  1AJ4 A;  3SG5 A;  2Q91 A;  1TTX A;  3AAJ A;  4OV2 A;  2LNK A;  1JF0 A;  3CR5 X;  3CLN A;  4PHN A;  1DF0 A;  1XVJ A;  3OB2 B;  5I2Q A;  1NIW A;  2KGR A;  1M31 A;  1L7Z A;  2LLT A;  1S6C A;  1WRL A;  2PAS A;  4YBH B;  1BOC A;  1PAL A;  3PLF B;  2AMI A;  3DVJ A;  2BCA A;  1CM4 A;  2LLU A;  2FJU B;  2KFH A;  2CT9 A;  1ODB A;  1IKU A;  2DOQ A;  1U5I B;  3OX6 A;  1DJW A;  5FYX A;  2HQ8 A;  1JC2 A;  3WNX B;  1A03 A;  3VRP A;  1V1F A;  3BOW A;  3LLE A;  1KFX L;  2KYF A;  1CTR A;  3FWC A;  4GPL B;  1CMF A;  1SL7 A;  2KAV A;  2CTN A;  2F8P A;  2M1K B;  2PSR A;  1WY9 A;  4U8D A;  4DUQ A;  1LIN A;  2BEC A;  2MAZ A;  2LVI A;  1LA3 A;  1PK0 D;  2ZNE A;  3FIA A;  1YRU B;  2H61 C;  4MBE A;  5KU1 A;  1TOP A;  1H4B A;  2TN4 A;  4PE4 A;  2CXJ A;  2ZND A;  5AEQ A;  1B4C A;  3SG6 A;  2I94 A;  4AQI A;  1CFF A;  1CFD A;  1F8H A;  1IQ5 A;  1D1O A;  1PSB A;  2VRG A;  2E30 A;  4XJK B;  2F2O A;  3JVT B;  3LCP C;  1RWY A;  1SL8 A;  2WOR A;  4OCI A;  1KK7 Z;  1OE9 B;  1TNX A;  3H4S E;  2RGI A;  4QJ3 B;  3SG3 A;  2M7N A;  1M45 A;  4QJ4 B;  2KI4 C;  1KQM C;  2HF5 A;  3O6B A;  1LXF C;  1M39 A;  1OQP A;  2JT0 A;  3I5G B;  1MR8 A;  1S5G Z;  3CWG A;  5F6T A;  2GGZ A;  5CSF A;  1NP8 A;  4USL A;  1YUR A;  4GBA A;  3TDI A;  4MEW A;  1DMO A;  1QLK A;  1BMO A;  3LL8 B;  1ALW A;  2LAN A;  2F33 A;  3LK1 A;  3IQQ A;  4ICB A;  1KQV A;  3PAL A;  1QVI Z;  1NX2 A;  2JTZ A;  2OTG C;  2LAP A;  2BCX A;  2WC8 A;  3BUM B;  3TS5 B;  1J1E A;  1U5I A;  4GNK B;  3CS1 A;  2LHI A;  1FW4 A;  1XYD A;  3PFV A;  3EKH A;  2F3Y A;  2LP2 A;  4MLW A;  3SJS A;  3TUY C;  2M0R A;  1QAT A;  4CLN A;  1MXL C;  1KFU S;  2BL0 B;  2ZN9 A;  1TIZ A;  1WDC B;  4MZJ A;  4GAO A;  4ORC B;  5J3X A;  4DIR A;  2HQW A;  1L2O C;  2K61 A;  3AAK A;  3DVM A;  1IRJ A;  2KBI A;  4MN0 A;  1QXP A;  1K94 A;  3KHE A;  1BJF A;  2D8N A;  1YUT A;  2MA2 A;  1MUX A;  2JRF A;  2P6B B;  4HRG A;  1CB1 A;  4I5L B;  1YR5 A;  5AXI A;  1AP4 A;  1RK9 A;  4PHM A;  3I5I C;  3VRR A;  1J1D A;  3RM1 A;  1N2D A;  1Y1A A;  2SCP A;  2O60 A;  3IQO A;  1OMR A;  1YTZ C;  1FI5 A;  2BBN A;  3BOW B;  4OR9 B;  4XJK A;  1JWD A;  4I5N B;  4NDB A;  5HLV A;  2JNF A;  1V1G A;  2L4H A;  3VRN A;  2LUC A;  3D0Y A;  4PHJ A;  3PN7 C;  2A4J A;  5CSI A;  1OOJ A;  1GQM A;  1QLS A;  4AOM A;  5DKQ A;  2KFF A;  2JUL A;  2JTT A;  1UHN A;  3IF7 A;  2NCO A;  2CBL A;  4YGB B;  5TNC A;  2BKH B;  2B1U A;  1S6J A;  3ZWH A;  4YI8 A;  1DJI A;  1S6I A;  4PE0 A;  1XFY O;  2KDH A;  4PCW A;  1UUS A;  1B8C A;  4WQ3 A;  1IJ6 A;  4MRY A;  3JTD C;  4N1F A;  1W7I B;  1REC A;  1SKT A;  1SMG A;  1QX2 A;  1E8A A;  1NPQ A;  1CKK A;  2BE6 A;  3F45 A;  3E3R A;  1EXR A;  1TCF A;  3CZT X;  1NCZ A;  2MJW B;  1SW8 A;  1KWO B;  1GGZ A;  2Q4U A;  1EG4 A;  4CFR A;  2JOJ A;  1BOD A;  1NSH A;  1UHJ A;  2IS9 A;  4ORB B;  3SIA A;  1LKJ A;  2ZKM X;  1CDL A;  2LC5 A;  2ZFD A;  2WCF A;  5DKR A;  1KCY A;  3NSI A;  1IJ5 A;  2LVJ A;  1S26 D;  1B8L A;  1MWN A;  2NZ0 A;  1R2U A;  1Q80 A;  4AQJ A;  3TZ1 A;  1OSA A;  1MF8 B;  1PUL A;  2H2K A;  1ZUZ A;  3D10 A;  2BKI B;  1EG3 A;  4R1E A;  3DD4 A;  1NCY A;  3EVU A;  2KAY A;  4A4B A;  2O5G A;  1X02 A;  5AER A;  2CCM A;  2JXC A;  4OKH A;  2WOS A;  1G33 A;  1NX1 A;  2G2B A;  1TNP A;  2OS8 B;  5I2L A;  2JT3 A;  1K90 D;  5ER4 X;  1XFX O;  1CFC A;  4HSZ A;  1B7T Z;  4GGF A;  1Y0V H;  1SPY A;  1K95 A;  2GV5 A;  3M0W A;  4ZCV A;  1QV0 A;  2KNE A;  1XK4 A;  1M63 B;  5DKN A;  1DJX A;  1N65 A;  4F0Z B;  4M2P A;  1S36 A;  1PVA A;  2LP3 A;  2KSP A;  1WLZ A;  1MHO A;  2M97 A;  3NSL A;  5CSN A;  3JVT C;  1F70 A;  1SR6 C;  1F71 A;  3CR2 A;  2M1U A;  4MZL A;  1A75 B;  4PE1 A;  2I7A A;  5JJG A;  3NSK A;  3D0Y B;  2SAS A;  3MSE B;  1GGW A;  2K7D A;  3I5G C;  4HRE E;  1B8R A;  1K93 D;  3FS7 A;  3FWB A;  3OB1 B;  1YVL A;  1HQV A;  1IG5 A;  1SCV A;  1JF2 A;  2LMT A;  2NCP A;  1NUB A;  1G8I A;  1TN4 A;  2JNX A;  1OMD A;  3OHM B;  1KK7 Y;  2R2I A;  1MXE A;  2OPO A;  1OZO A;  2F2P A;  5I2O A;  1UP5 A;  2I18 A;  5I8N A;  3QRX A;  1SCM C;  1TCO B;  3O4Y A;  2MLE C;  4ZCU A;  2M7L A;  5CPV A;  1S5G Y;  1BF5 A;  1PVB A;  2FCD A;  4NDD A;  1HT9 A;  2K0J A;  1K8U A;  2EC6 B;  1DJZ A;  1YUU A;  2KI6 D;  1QIW A;  2M8U A;  2KQ6 A;  2Y5I A;  2Y4Q A;  1N0Y A;  1AVS A;  1KQM B;  2ISD A;  1G4Y R;  4MZK A;  1S1E A;  1PSR A;  2QAC A;  3K21 A;  1WDC C;  3HX4 A;  1QVI Y;  3BXK A;  1OMV A;  1IWQ A;  1SBJ A;  2BE4 A;  4ORA B;  4PHK A;  1BR1 B;  2L0P A;  4GFT A;  1SRA A;  3EKJ A;  3VRO A;  3OP0 A;  1QJT A;  1EJ3 A;  2LMU A;  3OX5 A;  2HET A;  3ZNI A;  5AFP A;  3O2P A;  1CNP A;  1ZMZ A;  3BUN B;  3DF0 B;  2COL B;  1CLM A;  2KGB C;  2NLN A;  4Q04 A;  1JFK A;  1KK8 C;  4P2Y B;  5HKW A;  1FPW A;  1A75 A;  1M46 A;  1Y6W A;  1WLM A;  3AKB A;  2M49 B;  1CDP A;  3TUY B;  2Y1M A;  4YGA A;  4M2Q A;  4YGC B;  2WCE A;  1J7O A;  1XFU O;  2L51 A;  4C0L A;  1L2O B;  3SG2 A;  2H61 A;  2LUX A;  3WHU B;  2WND A;  1C07 A;  3HCM A;  1RRO A;  2JPT A;  1KFX S;  1LVC D;  2M9G A;  3I5F C;  2KOT A;  3I5I B;  1J55 A;  1DVI A;  2PMY A;  4BY4 A;  1FF1 A;  3NSO A;  4QJ5 B;  2JZI A;  4XYN A;  2MRD A;  1XA5 A;  1BG1 A;  2EHB A;  1AHR A;  1C7V A;  4E68 A;  5AAN A;  2K7B A;  3PN7 B;  3I5H C;  4WRI A;  2MBX A;  3LK0 A;  1B9A A;  2KFG A;  1NWD A;  2GGM A;  2KYC A;  2FOT A;  4PDZ A;  1XO5 A;  1IQ3 A;  5IBW A;  4WQ2 A;  2PRU A;  2AAO A;  3DVE A;  1Y1U A;  1NCX A;  3GK4 X;  3EK4 A;  2MLF C;  1QX5 B;  2LLS A;  1AK8 A;  1GJY A;  2LHL A;  1KFU L;  2M29 A;  3JTD B;  3VRQ A;  1YRT B;  2M3W A;  4NQG A;  3SIB A;  3KPX A;  3DF0 A;  4IL1 A;  4P5O E;  4MSP A;  4DRW A;  1EH2 A;  2ZN8 A;  3AKA A;  3PM8 A;  3SG7 A;  2JXL A;  4MRX A;  4PAL A;  1AUI B;  2OS8 C;  1SNL A;  1FI6 A;  2LVV A;  1BLQ A;  2JT8 A;  4DCK A;  1TNQ A;  1VRK A;  4A4C A;  1UUR A;  1KSO A;  5D69 A;  3TDU A;  1K9K A;  3BYA A;  3GK2 A;  4MVF A;  1FBV A;  1WRK A;  1NYA A;  5D7F A;  2CNP A;  4FQO A;  1UHI A;  4N5X A;  1YX7 A;  2MHH A;  4CID A;  1DJY A;  2KI6 C;  1TNW A;  2BCB A;  1XFW O;  2FCE A;  1K9U A;  4DS7 A;  5JOL A;  5KSZ A;  3EVR A;  1B7T Y;  2KBM A;  3SG4 A;  1SL9 A;  3KEV A;  2PAL A;  3KO0 A;  2BBM A;  2V53 A;  5G08 A;  1DGU A;  2JU0 A;  4YGD B;  1CLL A;  5PAL A;  5HKZ A;  3BQ3 A;  2PVB A;  3BUO B;  4CPV A;  4N1G A;  1DGV A;  1QTX A;  4FTG A;  3CTN A;  2WCB A;  1ALV A;  1CM1 A;  1ZAC A;  1CDN A;  1ZFS A;  1K2H A;  5K89 A;  1F4O A;  3A8R A;  1SR6 B;  1LA0 A;  2LCP A;  2K2F A;  2EC6 C;  3ICB A;  1YVH A;  3TS5 C;  1MQ1 A;  2JWW A;  1KSM A;  5BPJ A;  1QS7 A;  1Y1X A;  1BT6 A;  1SYM A;  4JWQ A;  4BY5 A;  4PE7 A;  1A29 A;  2KI4 B;  4NDC A;  3CR4 X;  2K2A A;  1NX0 A;  2LMV A;  2BL0 C;  2F3Z A;  4C0K A;  2E6W A;  2QPT A;  3EK7 A;  1UHK A;  2K7C A;  4L9M A;  4YI9 A;  1TRF A;  2AUC A;  4I5J A;  1IGV A;  1QIV A;  1IH0 A;  4JQ0 D;  1JFJ A;  1F4Q A;  2L4I A;  2JQ6 A;  3DVK A;  4TNC A;  4YGE B;  4OVN F;  1SCM B;  3WHT B;  5CSJ A;  2G9B A;  2OTG B;  1DJG A;  1QX7 A;  1DT7 B;  1DJH A;  5HKY A;  1DTL A;  2K8M B;  2HPS A;  1NX3 A;  1RTP 1;  3CGA A;  3TDZ A;  1YX8 A;  3O78 A;  1EL4 A;  1F55 A;  2LM5 A;  2JC2 A;  1XFV O;  2L2E A;  3GOF A;  1QAS A;  1OZS A;  4GGF C;  1DF0 B;  1SK6 D;  1WRZ A;  4GUK A;  2L5X B;  1JUO A;  5HLO A;  1JSA A;  4ETO A;  1XK4 C;  4YRU A;  5KTY A;  5GQQ C;  1RFJ A;  2KAX A;  1JBA A;  1C7W A;  1AJ5 A;  2LE9 B;  2NXQ A;  1UWO A;  1UHH A;  4HRH A;  1F54 A;  5B8I B;  2EGD A;  1S3P A;  2KQY A;  3A4U B;  1R6P A;  2K7O A;  3VGO A;  1KK8 B;  3KF9 A;  1K96 A;  4I5K A;  1KWO C;  1J7R A;  2KHN A;  3BUX B;  2Y1N A;  3NXA A;  1A4P A;  3RLZ A;  1BU3 A;  1RJV A;  2L50 A;  3EK8 A;  1CMG A;  1CLB A;  1H8B A;  1K9P A;  1CFP A;  3PAT A;  3WXA A;  1QV1 A;  3C1V A;  3PSR A;  4C0J A;  5HYD A;  2ZRS A;  3I5F B;  1PRW A;  3GK1 A;  3BUW B;  1SY9 A;  1W7J B;  4M2O A;  1J7P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...