2KGRA

Solution structure of protein itsn1 from homo sapiens. northeast structural genomics consortium target hr5524a
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
111
structure length
111
Chain Sequence
PPVAEWAVPQSSRLKYRQLFNSHDKTMSGHLTGPQARTILMQSSLPQAQLASIWNLSDIDQDGKLTAEEFILAMHLIDVAMSGQPLPPVLPPEYIPPSFRRVRLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of protein ITSN1 from Homo sapiens. Northeast Structural Genomics Consortium target HR5524A
rcsb
source organism Homo sapiens
molecule tags Protein binding
molecule keywords Intersectin-1
total genus 26
structure length 111
sequence length 111
ec nomenclature
pdb deposition date 2009-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12763 EF-hand_4 Cytoskeletal-regulatory complex EF hand
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2kgrA00
2BCAA 1AJ5A 1JF2A 1F4QA 4PE0A 3SIAA 1FI6A 1EG3A 3EKJA 1DGVA 1BLQA 2BKHB 4TNCA 1BU3A 3FIAA 3SIBA 1C7VA 2FCEA 3PM8A 4I5KA 2K2AA 2K7BA 2M49B 2ZN9A 4YGDB 1IH0A 3CR2A 4R1EA 3TS5C 1MF8B 2L5XB 2OTGC 1CDLA 2ISDA 2IS9A 1TNXA 3BQ3A 3EK4A 1TOPA 1B1GA 1B9AA 2JNFA 1SKTA 1KK7Z 1S5GZ 1WLMA 2QACA 3IQOA 2M7NA 3F45A 4I5NB 1RROA 1AVSA 1SBJA 1QVIZ 1L2OC 1B47A 1JUOA 2MJWB 1YX8A 4MRXA 4DIRA 1XFYO 4YRUA 4UPGA 1OMRA 4PDZA 2KFFA 4CPVA 3JVTB 1Y0VH 1S26D 1RK9A 2ZRTA 1M39A 3CR5X 2L98A 2LUXA 1CFPA 4MN0A 3GK1A 3O6BA 1PULA 1V1FA 2ZFDA 3ZNIA 2LVJA 1G33A 3TDZA 2CTNA 2JC2A 2LVVA 1TNQA 1EH2A 5I8NA 1NYAA 2DOQA 2LC5A 2LMUA 1W7JB 1DJXA 2Y1NA 1BJFA 3VGOA 1KQVA 5IBWA 3BYAA 1TCFA 4GGFC 2LHLA 3I5GB 1C7WA 3DVJA 4XYNA 1N0YA 3GOFA 3TDUA 1CDNA 4L9MA 2HETA 3PALA 1OSAA 2OS8C 4A4CA 4GGNA 4HRGA 3EVUA 1K93D 1J7RA 1QTXA 3WXAA 1OQPA 1HQVA 3A8RA 5ER4X 4ZCUA 2JU0A 2JNXA 1DJWA 2JXLA 3ZWHA 1JBAA 1ALVA 3CLNA 3PFVA 1QV0A 5HLOA 1FW4A 2COLB 1L7ZA 4HSZA 1A4PA 3PN7C 4HRHA 4GGFA 1UHNA 2LUCA 4WQ2A 1DF0B 2M0RA 3EK7A 1MXEA 1NP8A 3VROA 2GGMA 2MHHA 2HQWA 4E68A 1PSBA 1N65A 1KCYA 4P2YB 1VRKA 3OB2B 4M2OA 1J55A 2LLUA 1FF1A 1AHRA 3VRPA 4WQ3A 3LK1A 3WHTB 1R2UA 2BL0C 2KAYA 5HYDA 3AAJA 1SW8A 4BY4A 1NX2A 4N1GA 3OB1B 1CM4A 1BF5A 5ER5A 2LMTA 4XJKB 3VRQA 1B8RA 1U5IB 3KF9A 1GGZA 1QX7A 2HPSA 1QATA 1XYDA 1AP4A 2LNKA 1SCVA 2KDHA 1BODA 1JFJA 2GGZA 2KGRA 1BR1B 2ZKMX 1NIWA 5AEQA 1YR5A 3RLZA 2KFHA 3PLFB 5AFPA 1SY9A 1SNLA 4PE4A 1F55A 2L50A 1CFFA 4GUKA 3HX4A 1LVCD 1NX1A 1AJ4A 1NX0A 4PHJA 3FWCA 4PHNA 3SG4A 4QJ5B 4Q04A 3I5GC 2L4HA 1EL4A 5G08A 2K7CA 1TRFA 3TDIA 3C1VA 1K95A 1A29A 1TIZA 1IQ3A 1SRAA 1M46A 1KFUS 2EHBA 3M0WA 2LAPA 1YX7A 4N1FA 2F8PA 2RGIA 2KBMA 1S6IA 2P6BB 3O4YA 5CSNA 1KK8C 1SR6B 3I5HC 3EVVA 5PALA 2CNPA 2BBMA 3JTDC 1KFUL 4DUQA 4MSPA 3TUYC 2SCPA 2Y1MA 1XA5A 3K21A 1XFUO 2ZN8A 4M2QA 4YI9A 4FQOA 3KPXA 3DVMA 1QLSA 2BL0B 1Y1AA 4NDDA 1GGWA 1K9UA 1LA3A 1F4OA 3CR4X 1PVBA 3BUWB 4ETOA 1EXRA 1DMOA 3DVKA 2MLEC 5HKWA 2M7LA 4YGAA 3BXKA 1K9PA 2M3WA 1DJYA 4DRWA 2JXCA 2LLSA 3I5HB 4XJKA 1YUUA 2KSPA 2H2KA 3HCMA 5AXIA 4NDBA 4OVNF 2PVBA 3KO0A 5TNCA 2K8MB 2BE4A 1F70A 1NSHA 3A4UB 1NCYA 5HLVA 1XVJA 2MAZA 3OP0A 1B8CA 1IQ5A 1W7IB 2D8NA 1SL9A 3CWGA 4QJ4B 4GNKB 1BG1A 2OPOA 2M1KB 2LVKA 3LL8B 1YUTA 4MBEA 2NLNA 2OS8B 2B1UA 1QLKA 4M2PA 3KEVA 3GK2A 2Y5IA 4ORBB 3DF0B 2KI4C 2V53A 1XFXO 1G4YR 3MSEB 2I18A 3ICBA 4OCIA 2KOTA 1HT9A 1S5GY 2FOTA 2KAXA 1KWOB 2KYCA 2VRGA 4YGEB 1S6CA 5DKNA 1CDPA 4A4BA 1WLZA 1YUSA 3OX6A 1WDCB 1EJ3A 4MLWA 1K90D 2JRFA 1SYMA 3OHMB 2L0PA 2KQYA 1PK0D 2WOSA 3EKHA 4USLA 2LE9B 2MRDA 2E30A 1BR4B 1CKKA 3D0YA 1YURA 3NSIA 3SG7A 1S36A 2KHNA 4GAOA 1GQMA 2R2IA 4YGCB 2A4JA 4D1EA 1IKUA 1RECA 2KAVA 1JSAA 3JVTC 2O5GA 1R6PA 4ORCB 1OZOA 2KGBC 2LP2A 3KHEA 4HREE 3TS5B 2Y4QA 3SG2A 1QX2A 1A75B 1K2HA 5F6TA 4OR9B 3EK8A 1SCMB 2I94A 4NQGA 2O60A 1B7TZ 1TN4A 3FWBA 5I2OA 1QS7A 3GK4X 2HF5A 2Q91A 1NUBA 2KQ6A 2WCFA 3D0YB 2ZNEA 1G8IA 2LM5A 1CDMA 4CFQA 2K2FA 1QX5B 2MLFC 5KTYA 3NSKA 1S6JA 4PHKA 1KK7Y 1LKJA 2SASA 1NCXA 2JPTA 2CT9A 1WRZA 1UURA 1KQMB 2L2EA 1J7OA 3NXAA 2KFGA 4AOMA 1XFWO 2JTZA 4U8DA 2CCMA 2K7DA 3I5FB 1AK8A 5AANA 2LV7A 1IGVA 1EG4A 4PCWA 1C07A 1YRTB 1SPYA 4C0LA 1SL8A 3NSOA 4NDCA 2HQ8A 1PSRA 2AAOA 2PASA 5CSFA 1LINA 4JQ0D 2F33A 1K9KA 1ZMZA 1UUSA 4YGBB 2F2PA 3QRXA 1QJTA 1IJ5A 1GJYA 3I5FC 3LCPC 2E6WA 1BOCA 2WCEA 5DKRA 5DKQA 2KNEA 1L2OB 4OV2A 4ICBA 1NPQA 4CFRA 5CSJA 1UHKA 2G2BA 2PMYA 4IL1A 2PALA 2Q4UA 4GPLB 2KI6D 1M63B 2WNDA 1QIWA 1PRWA 1WRLA 1YVHA 2EC6C 2BBNA 1OMDA 2LVIA 3D10A 5I2LA 1RFJA 2FCDA 1K8UA 3BOWB 1DVIA 3AKBA 1DJGA 3PATA 5KU1A 4JPZB 5FYXA 1WY9A 5HKYA 1IWQA 1J1DA 1XFVO 4JWQA 3O2PA 5D7FA 3WNXB 4FTGA 1CLMA 3RM1A 1SCMC 3NSLA 5J3XA 4BY5A 3SG5A 3EVRA 1KFXS 2LLTA 3CGAA 2BKIB 3DD4A 1UHJA 4PHMA 2BCXA 1ZUZA 2FJUB 1S1EA 1B7TY 1N2DA 3O78A 2LANA 4PE7A 1CFDA 4MEWA 2ZNDA 2M97A 2AUCA 3AKAA 4GBAA 3BUMB 5D69A 4AQJA 1KWOC 2JT8A 1A03A 1JC2A 2GV5A 3I5IC 2BCBA 2JT3A 1ALWA 1OOJA 3IQQA 4CLNA 2WORA 2NCOA 1DTLA 1WDCC 5K89A 1CMFA 2MBXA 2F3YA 2H61C 1RTP1 2LCPA 3LLEA 1DF0A 5CPVA 1A75A 1SK6D 1F71A 1IRJA 5JOLA 3VRRA 1B8LA 3VRNA 2M1UA 3PN7B 4MZJA 1B4CA 2BE6A 1XK4A 1UP5A 1TNWA 1Q80A 4YI8A 1UHIA 2I7AA 2LMVA 4ZCVA 2LHIA 1MUXA 1CLLA 2KI6C 3LK0A 1JWDA 3BUXB 3SG6A 1YRUB 1ZOTB 1MXLC 2AMIA 4YBHB 2NXQA 2WC8A 1DJHA 2F3ZA 4CIDA 1OE9B 3SJSA 3H4SE 2K7OA 1XFZO 1OMVA 1WRKA 1DGUA 1JF0A 4WRIA 1CFCA 1Y6WA 1TTXA 1BMOA 1AUIB 1CMGA 1UWOA 1K94A 3DF0A 1IG5A 3CTNA 4I5JA 5JJGA 1SL7A 1YVLA 3SG3A 1NX3A 2M8UA 1V1GA 1CM1A 1NWDA 1F8HA 3E3RA 5AERA 3DVEA 1KQMC 2PRUA 1RWYA 2JZIA 4AQIA 1FBVA 3BUOB 4MZLA 4DS7A 1XK4C 5KSZA 1KFXL 1KSMA 1CB1A 1QIVA 3IF7A 5CSIA 2JOJA 4I5LB 2ZRSA 4PE1A 1OZSA 5B8IB 1QV1A 1JFKA 3OX5A 1F54A 1A2XA 2F2OA 1ZFSA 2CXJA 1DJIA 3FS7A 2M9GA 1CLBA 4ORAB 4MZKA 1UHHA 2H61A 1BT6A 1TCOB 5GQQC 2WCBA 1QASA 2PSRA 3PSRA 1CNPA 2JT0A 2OTGB 5I2QA 1MHOA 3BOWA 1J1EA 2TN4A 1E8AA 1YTZC 4GFTA 1S3PA 1J7PA 1NCZA 2EC6B 2I2RE 4F0ZB 1H4BA 4P5OE 3BUNB 2CBLA 1M31A 1U5IA 3AAKA 2JQ6A 3I5IB 4OKHA 2BECA 2L4IA 4C0KA 1MWNA 2G9BA 1FI5A 2LP3A 2M29A 1SMGA 1Y1UA 1H8BA 2NZ0A 1PVAA 1PALA 3TZ1A 2QPTA 3TUYB 1LXFC 1FPWA 2K0JA 1K96A 1D1OA 3JTDB 4QJ3B 4C0JA 2L51A 1DT7B 1KSOA 1X02A 2JWWA 1XO5A 1MR8A 2KI4B 1QVIY 1ODBA 2JULA 1J7QA 2NCPA 1ZACA 2KBIA 1TNPA 4MRYA 2K61A 4MVFA 2KYFA 4DCKA 5BPJA 1DJZA 1M45A 1Y1XA 1CTRA 2JTTA 1LA0A 2EGDA 3CS1A 1IJ6A 1MQ1A 3CZTX 5HKZA 1KK8B 1RJVA 1SR6C 2MA2A 4PALA 3WHUB 1QXPA 4N5XA
chains in the Genus database with same CATH superfamily
1XFRA 2BCAA 1AJ5A 1JF2A 1F4QA 4PE0A 3SIAA 1FI6A 1EG3A 3EKJA 1DGVA 1BLQA 2BKHB 4TNCA 1BU3A 3FIAA 3SIBA 1C7VA 2FCEA 3PM8A 4I5KA 2K2AA 2K7BA 2M49B 2WC6A 2ZN9A 4YGDB 1IH0A 1DC1A 3CR2A 4R1EA 3TS5C 1MF8B 2L5XB 2OTGC 3CDNA 1CDLA 2ISDA 2IS9A 1TNXA 3BQ3A 3EK4A 1TOPA 1B1GA 1B9AA 2JNFA 1SKTA 1KK7Z 1S5GZ 1WLMA 2QACA 3IQOA 2M7NA 3F45A 4I5NB 1RROA 1AVSA 1SBJA 1QVIZ 1L2OC 4JD9A 1TUJA 1B47A 1JUOA 2MJWB 1YX8A 4MRXA 4DIRA 1XFYO 4YRUA 4UPGA 1C3ZA 1OMRA 3OBVA 2KFFA 4PDZA 3JVTB 4CPVA 1Y0VH 1S26D 1RK9A 2ZRTA 1M39A 3CR5X 2L98A 2LUXA 1CFPA 4MN0A 3GK1A 3O6BA 1PULA 1V1FA 2K60A 2ZFDA 3ZNIA 2LVJA 1G33A 3TDZA 2CTNA 2JC2A 2LVVA 1TNQA 1EH2A 5I8NA 4INWA 1NYAA 2DOQA 2LC5A 2LMUA 1W7JB 1DJXA 2Y1NA 1BJFA 3VGOA 1KQVA 5IBWA 3BYAA 2WCJA 4INXA 1TCFA 4GGFC 2LHLA 3I5GB 1C7WA 3CZ1A 3DVJA 4XYNA 1N0YA 3NGVA 3GOFA 3BFHA 3NHIA 4L9MA 2HETA 3TDUA 1CDNA 3PALA 1OSAA 2OS8C 4A4CA 4GGNA 4HRGA 3EVUA 1K93D 1J7RA 1QTXA 2QEBA 3WXAA 1OQPA 3BJHA 2P70A 1HQVA 3A8RA 1Z2CB 5ER4X 4ZCUA 2JU0A 2JNXA 1DJWA 2JXLA 3ZWHA 1JBAA 1ALVA 3CLNA 3PFVA 1QV0A 3PJIA 5HLOA 1FW4A 2QEHA 2COLB 1L7ZA 4HSZA 1A4PA 3PN7C 4HRHA 3NHTA 4GGFA 1UHNA 2LUCA 4WQ2A 1DF0B 2M0RA 3EK7A 1MXEA 1NP8A 3VROA 2GGMA 2MHHA 2HQWA 3FE8A 4E68A 1PSBA 1N65A 3CZTX 1CNPA 1KCYA 4P2YB 1VRKA 3CABA 3OB2B 4M2OA 1J55A 2LLUA 1FF1A 1AHRA 3VRPA 4WQ3A 3LK1A 3V2LA 3WHTB 1R2UA 2BL0C 2KAYA 4F7FA 3AAJA 1SW8A 5HYDA 4BY4A 1NX2A 4N1GA 3OB1B 1CM4A 1BF5A 5ER5A 2LMTA 4XJKB 3VRQA 1B8RA 1U5IB 3BFBA 1GGZA 1QX7A 3KF9A 2HPSA 1QATA 1XYDA 1AP4A 2LNKA 1SCVA 2KDHA 1BODA 1JFJA 2GGZA 2KGRA 1BR1B 2ZKMX 1NIWA 5AEQA 4FQTA 1YR5A 3RLZA 2KFHA 3R1PA 3PLFB 5AFPA 1SY9A 1SNLA 4PE4A 1F55A 1W9ZA 2L50A 3B86A 4GUKA 1CFFA 3HX4A 3UNWA 1LVCD 1NX1A 1AJ4A 2L2CA 1NX0A 3BFAA 3O4XA 4PHJA 3FWCA 4PHNA 3SG4A 4QJ5B 4Q04A 3I5GC 2L4HA 1EL4A 3D75A 5G08A 5FI6A 2K7CA 1TRFA 5I94A 1OOFA 3C1VA 4JKTA 1K95A 3TDIA 1A29A 1TIZA 1IQ3A 1SRAA 1M46A 1KFUS 2EHBA 3M0WA 2LAPA 1YX7A 4N1FA 2F8PA 2RGIA 2KBMA 1S6IA 2P6BB 3O4YA 5CSNA 2YGUA 1KK8C 1SR6B 3I5HC 3EVVA 5PALA 3S0BA 2CNPA 2BBMA 3JTDC 1KFUL 2WCLA 4DUQA 4MSPA 5EL2A 3TUYC 2SCPA 2Y1MA 1XA5A 3K21A 1XFUO 1GM0A 2ZN8A 4M2QA 4YI9A 4FQOA 3KPXA 3DVMA 1QLSA 2BL0B 1Y1AA 4NDDA 1GGWA 1K9UA 1LA3A 1F4OA 3CR4X 1PVBA 3BUWB 4ETOA 1EXRA 1DMOA 3DVKA 2MLEC 3CZ0A 5HKWA 4YGAA 2M7LA 3BXKA 1K9PA 2M3WA 1DJYA 2WCHA 1DQEA 2JXCA 2LLSA 4DRWA 3I5HB 4XJKA 1IIOA 1YUUA 2KSPA 2H2KA 3B6XA 3HCMA 4NDBA 4OVNF 5AXIA 2PVBA 3KO0A 1C3YA 5TNCA 2K8MB 2BE4A 3FE9A 2JPOA 1F70A 1NSHA 3A4UB 1NCYA 5HLVA 1XVJA 2MAZA 3OP0A 1B8CA 1IQ5A 1W7IB 2D8NA 3CYZA 3S0GA 1SL9A 3CWGA 4QJ4B 4GNKB 1BG1A 2OPOA 2M1KB 2LVKA 3LL8B 1YUTA 4MBEA 2NLNA 2OS8B 2B1UA 1QLKA 4M2PA 3KEVA 3GK2A 2Y5IA 4ORBB 1T14A 3DF0B 2KI4C 2V53A 1XFXO 1G4YR 3MSEB 2I18A 2WC5A 3DY9A 2KOTA 3ICBA 4OCIA 1HT9A 1S5GY 2FOTA 2KAXA 1KWOB 2KYCA 2VRGA 4YGEB 1S6CA 5DKNA 1CDPA 4A4BA 1WLZA 1YUSA 3OX6A 1WDCB 1EJ3A 4MLWA 1K90D 2JRFA 1SYMA 1DELA 3OHMB 2L0PA 3R1VA 2KQYA 1PK0D 2WOSA 3EKHA 3L47A 2LE9B 2MRDA 2E30A 4USLA 1BR4B 1CKKA 3D0YA 3N7HA 1YURA 3NSIA 5D3OA 1S36A 2KHNA 4GAOA 1GQMA 2R2IA 4YGCB 2A4JA 3SG7A 4D1EA 1RECA 1IKUA 2KAVA 1JSAA 3JVTC 2O5GA 1R6PA 4ORCB 1OZOA 2KGBC 2LP2A 3KHEA 4HREE 3D74A 3TS5B 3IVTA 1ORGA 2Y4QA 2PQLA 2BAPA 3R1OA 3SG2A 1QX2A 1A75B 1K2HA 5F6TA 3FE6A 3EK8A 4OR9B 1SCMB 2I94A 4NQGA 2O60A 1B7TZ 1TN4A 3FWBA 5I2OA 1QS7A 3S0EA 3GK4X 2HF5A 2Q91A 1LS8A 1NUBA 2KQ6A 2WCFA 3D0YB 2QDIA 2ZNEA 1G8IA 2LM5A 1CDMA 4CFQA 2K2FA 1QX5B 2MLFC 5KTYA 3DXLA 3NSKA 1S6JA 4PHKA 1KK7Y 1LKJA 2SASA 1NCXA 2JPTA 2CT9A 1WRZA 1UURA 1KQMB 2L2EA 1J7OA 3NXAA 3D77A 2KFGA 2PYQA 4AOMA 1XFWO 2JTZA 4U8DA 2BNXA 2CCMA 2K7DA 3I5FB 1AK8A 5AANA 2LV7A 1IGVA 1EG4A 4PCWA 1C07A 1YRTB 1SPYA 4C0LA 1SL8A 3NSOA 4NDCA 2HQ8A 1PSRA 2AAOA 2PASA 5CSFA 1TWOA 1LINA 2KLEA 4JQ0D 2F33A 1K9KA 1ZMZA 1UUSA 4YGBB 2F2PA 3QRXA 1QJTA 1GJYA 1IJ5A 3I5FC 3LCPC 2E6WA 2KLDA 1BOCA 3UO9A 2WCEA 5DKRA 5DKQA 2KNEA 1L2OB 4OV2A 3RZSA 4ICBA 1NPQA 4CFRA 5CSJA 1UHKA 2G2BA 2PMYA 4IL1A 2PALA 3Q8IA 2Q4UA 4GPLB 2KI6D 1M63B 2WNDA 2FJYA 1QIWA 1PRWA 1WRLA 1YVHA 2EC6C 2BBNA 1OMDA 2LVIA 3D10A 4PT1A 2L5YA 1RFJA 5I2LA 2FCDA 1K8UA 3BOWB 3L4LA 3SS4A 1DVIA 3AKBA 1DJGA 3PATA 5KU1A 4JPZB 5FYXA 1WY9A 5HKYA 1IWQA 1J1DA 1XFVO 3B7AA 3O2PA 4JWQA 5D7FA 4FTGA 3WNXB 1CLMA 5FI2A 3RM1A 1SCMC 3NSLA 5J3XA 4BY5A 3SG5A 3EVRA 1KFXS 3D73A 2LLTA 3CGAA 2BKIB 3DD4A 1UHJA 4PHMA 2BCXA 1ZUZA 2FJUB 1S1EA 2ERBA 3SS3A 1B7TY 1N2DA 3O78A 2LANA 3B87A 4PE7A 2KPHA 1CFDA 4MEWA 2ZNDA 2M97A 2AUCA 3AKAA 4GBAA 3BUMB 5D69A 3SS5A 4OZDA 1P28A 4AQJA 2QEOA 1KWOC 2WCKA 2JT8A 1A03A 1JC2A 2GV5A 3I5IC 2BCBA 2JT3A 1ALWA 1OOJA 3IQQA 4CLNA 2WORA 2NCOA 1DTLA 1WDCC 5K89A 1CMFA 2MBXA 2F3YA 2H61C 1RTP1 2LCPA 3D78A 3LLEA 1DF0A 3VB1A 5CPVA 1A75A 1SK6D 1F71A 1IRJA 5JOLA 3VRRA 1B8LA 3VRNA 2M1UA 3PN7B 4MZJA 2GTEA 5FI7A 2BE6A 1B4CA 1XK4A 1UP5A 1TNWA 1Q80A 1TUZA 4YI8A 1UHIA 2I7AA 2LMVA 4ZCVA 2LHIA 1MUXA 1CLLA 2KI6C 3LK0A 3S0AA 1JWDA 5DICA 5HL1A 3BUXB 3SG6A 3D76A 1YRUB 1ZOTB 1MXLC 2AMIA 4YBHB 2NXQA 2WC8A 1DJHA 2F3ZA 4CIDA 1OE9B 3SJSA 3H4SE 2K7OA 1XFZO 1OMVA 1WRKA 1DGUA 1JF0A 4WRIA 1CFCA 1Y6WA 1TTXA 1BMOA 2WCMA 1AUIB 1CMGA 1UWOA 1K94A 3DF0A 3R72A 1IG5A 3CTNA 4I5JA 5JJGA 1SL7A 1YVLA 3SG3A 1NX3A 2M8UA 1V1GA 1OOGA 1CM1A 2H8VA 1NWDA 1F8HA 3E3RA 5AERA 3DVEA 1KQMC 2PRUA 1RWYA 2JZIA 4AQIA 1FBVA 1OOHA 3BUOB 4MZLA 4DS7A 1XK4C 5KSZA 1KFXL 1KSMA 1CB1A 2QEVA 1QIVA 3IF7A 3DYEA 5CSIA 2JOJA 4I5LB 2ZRSA 4PE1A 1OZSA 5B8IB 1QV1A 1JFKA 3S0FA 3OX5A 1F54A 1A2XA 2F2OA 1ZFSA 2CXJA 1DJIA 3FS7A 2M9GA 3OGNA 4ORAB 1CLBA 4MZKA 1UHHA 2H61A 1BT6A 1TCOB 5GQQC 2WCBA 1QASA 2PSRA 3B88A 3PSRA 2JT0A 2OTGB 5I2QA 3CZ2A 1MHOA 3BOWA 1J1EA 2TN4A 1SSEB 1E8AA 1YTZC 1OW4A 3K1EA 4GFTA 1S3PA 1J7PA 1NCZA 2EC6B 2I2RE 4F0ZB 1H4BA 4P5OE 3BUNB 2CBLA 2P71A 1M31A 1U5IA 3AAKA 3EG5B 2JQ6A 3I5IB 4OKHA 2BECA 2L4IA 4C0KA 3S0DA 1MWNA 2G9BA 1FI5A 2LP3A 2M29A 1SMGA 1Y1UA 1H8BA 2NZ0A 1PVAA 1DEKA 1PALA 2QPTA 3TUYB 1LXFC 3TZ1A 1FPWA 2K0JA 1K96A 3DZTA 1D1OA 1Z4HA 3JTDB 4QJ3B 4C0JA 4KYNA 3QMEA 2L51A 1OOIX 1DT7B 3PM2A 1KSOA 1X02A 2JWWA 1XO5A 4IJ7A 1MR8A 2KI4B 1QVIY 1ODBA 2JULA 1J7QA 2NCPA 1ZACA 2KBIA 1TNPA 4MRYA 2K61A 4MVFA 2KYFA 4DCKA 5BPJA 1DJZA 1M45A 1Y1XA 1CTRA 2JTTA 1LA0A 2EGDA 1QWVA 1IJ6A 1MQ1A 3CS1A 5HKZA 1KK8B 1RJVA 1SR6C 2MA2A 4PALA 3WHUB 1QXPA 4N5XA 3L4AA
chains in the Genus database with same CATH topology
2BCAA 1AJ5A 1JF2A 1F4QA 4PE0A 3SIAA 1FI6A 1EG3A 3EKJA 1DGVA 1BLQA 2BKHB 4TNCA 1BU3A 3FIAA 3SIBA 1C7VA 2FCEA 3PM8A 4I5KA 2K2AA 2K7BA 2M49B 2ZN9A 4YGDB 1IH0A 3CR2A 4R1EA 3TS5C 1MF8B 2L5XB 2OTGC 1CDLA 2ISDA 2IS9A 1TNXA 3BQ3A 3EK4A 1TOPA 1B1GA 1B9AA 2JNFA 1SKTA 1KK7Z 1S5GZ 1WLMA 2QACA 3IQOA 2M7NA 3F45A 4I5NB 1RROA 1AVSA 1SBJA 1QVIZ 1L2OC 1B47A 1JUOA 2MJWB 1YX8A 4MRXA 4DIRA 1XFYO 4YRUA 4UPGA 1OMRA 4PDZA 2KFFA 4CPVA 3JVTB 1Y0VH 1S26D 1RK9A 2ZRTA 1M39A 3CR5X 2L98A 2LUXA 1CFPA 4MN0A 3GK1A 3O6BA 1PULA 1V1FA 2ZFDA 3ZNIA 2LVJA 1G33A 3TDZA 2CTNA 2JC2A 2LVVA 1TNQA 1EH2A 5I8NA 1NYAA 2DOQA 2LC5A 2LMUA 1W7JB 1DJXA 2Y1NA 1BJFA 3VGOA 1KQVA 5IBWA 3BYAA 1TCFA 4GGFC 2LHLA 3I5GB 1C7WA 3DVJA 4XYNA 1N0YA 3GOFA 3TDUA 1CDNA 4L9MA 2HETA 3PALA 1OSAA 2OS8C 4A4CA 4GGNA 4HRGA 3EVUA 1K93D 1J7RA 1QTXA 3WXAA 1OQPA 1HQVA 3A8RA 5ER4X 4ZCUA 2JU0A 2JNXA 1DJWA 2JXLA 3ZWHA 1JBAA 1ALVA 3CLNA 3PFVA 1QV0A 5HLOA 1FW4A 2COLB 1L7ZA 4HSZA 1A4PA 3PN7C 4HRHA 4GGFA 1UHNA 2LUCA 4WQ2A 1DF0B 2M0RA 3EK7A 1MXEA 1NP8A 3VROA 2GGMA 2MHHA 2HQWA 4E68A 1PSBA 1N65A 1KCYA 4P2YB 1VRKA 3OB2B 4M2OA 1J55A 2LLUA 1FF1A 1AHRA 3VRPA 4WQ3A 3LK1A 3WHTB 1R2UA 2BL0C 2KAYA 5HYDA 3AAJA 1SW8A 4BY4A 1NX2A 4N1GA 3OB1B 1CM4A 1BF5A 5ER5A 2LMTA 4XJKB 3VRQA 1B8RA 1U5IB 3KF9A 1GGZA 1QX7A 2HPSA 1QATA 1XYDA 1AP4A 2LNKA 1SCVA 2KDHA 1BODA 1JFJA 2GGZA 2KGRA 1BR1B 2ZKMX 1NIWA 5AEQA 1YR5A 3RLZA 2KFHA 3PLFB 5AFPA 1SY9A 1SNLA 4PE4A 1F55A 2L50A 1CFFA 4GUKA 3HX4A 1LVCD 1NX1A 1AJ4A 1NX0A 4PHJA 3FWCA 4PHNA 3SG4A 4QJ5B 4Q04A 3I5GC 2L4HA 1EL4A 5G08A 2K7CA 1TRFA 3TDIA 3C1VA 1K95A 1A29A 1TIZA 1IQ3A 1SRAA 1M46A 1KFUS 2EHBA 3M0WA 2LAPA 1YX7A 4N1FA 2F8PA 2RGIA 2KBMA 1S6IA 2P6BB 3O4YA 5CSNA 1KK8C 1SR6B 3I5HC 3EVVA 5PALA 2CNPA 2BBMA 3JTDC 1KFUL 4DUQA 4MSPA 3TUYC 2SCPA 2Y1MA 1XA5A 3K21A 1XFUO 2ZN8A 4M2QA 4YI9A 4FQOA 3KPXA 3DVMA 1QLSA 2BL0B 1Y1AA 4NDDA 1GGWA 1K9UA 1LA3A 1F4OA 3CR4X 1PVBA 3BUWB 4ETOA 1EXRA 1DMOA 3DVKA 2MLEC 5HKWA 2M7LA 4YGAA 3BXKA 1K9PA 2M3WA 1DJYA 4DRWA 2JXCA 2LLSA 3I5HB 4XJKA 1YUUA 2KSPA 2H2KA 3HCMA 5AXIA 4NDBA 4OVNF 2PVBA 3KO0A 5TNCA 2K8MB 2BE4A 1F70A 1NSHA 3A4UB 1NCYA 5HLVA 1XVJA 2MAZA 3OP0A 1B8CA 1IQ5A 1W7IB 2D8NA 1SL9A 3CWGA 4QJ4B 4GNKB 1BG1A 2OPOA 2M1KB 2LVKA 3LL8B 1YUTA 4MBEA 2NLNA 2OS8B 2B1UA 1QLKA 4M2PA 3KEVA 3GK2A 2Y5IA 4ORBB 3DF0B 2KI4C 2V53A 1XFXO 1G4YR 3MSEB 2I18A 3ICBA 4OCIA 2KOTA 1HT9A 1S5GY 2FOTA 2KAXA 1KWOB 2KYCA 2VRGA 4YGEB 1S6CA 5DKNA 1CDPA 4A4BA 1WLZA 1YUSA 3OX6A 1WDCB 1EJ3A 4MLWA 1K90D 2JRFA 1SYMA 3OHMB 2L0PA 2KQYA 1PK0D 2WOSA 3EKHA 4USLA 2LE9B 2MRDA 2E30A 1BR4B 1CKKA 3D0YA 1YURA 3NSIA 3SG7A 1S36A 2KHNA 4GAOA 1GQMA 2R2IA 4YGCB 2A4JA 4D1EA 1IKUA 1RECA 2KAVA 1JSAA 3JVTC 2O5GA 1R6PA 4ORCB 1OZOA 2KGBC 2LP2A 3KHEA 4HREE 3TS5B 2Y4QA 3SG2A 1QX2A 1A75B 1K2HA 5F6TA 4OR9B 3EK8A 1SCMB 2I94A 4NQGA 2O60A 1B7TZ 1TN4A 3FWBA 5I2OA 1QS7A 3GK4X 2HF5A 2Q91A 1NUBA 2KQ6A 2WCFA 3D0YB 2ZNEA 1G8IA 2LM5A 1CDMA 4CFQA 2K2FA 1QX5B 2MLFC 5KTYA 3NSKA 1S6JA 4PHKA 1KK7Y 1LKJA 2SASA 1NCXA 2JPTA 2CT9A 1WRZA 1UURA 1KQMB 2L2EA 1J7OA 3NXAA 2KFGA 4AOMA 1XFWO 2JTZA 4U8DA 2CCMA 2K7DA 3I5FB 1AK8A 5AANA 2LV7A 1IGVA 1EG4A 4PCWA 1C07A 1YRTB 1SPYA 4C0LA 1SL8A 3NSOA 4NDCA 2HQ8A 1PSRA 2AAOA 2PASA 5CSFA 1LINA 4JQ0D 2F33A 1K9KA 1ZMZA 1UUSA 4YGBB 2F2PA 3QRXA 1QJTA 1IJ5A 1GJYA 3I5FC 3LCPC 2E6WA 1BOCA 2WCEA 5DKRA 5DKQA 2KNEA 1L2OB 4OV2A 4ICBA 1NPQA 4CFRA 5CSJA 1UHKA 2G2BA 2PMYA 4IL1A 2PALA 2Q4UA 4GPLB 2KI6D 1M63B 2WNDA 1QIWA 1PRWA 1WRLA 1YVHA 2EC6C 2BBNA 1OMDA 2LVIA 3D10A 5I2LA 1RFJA 2FCDA 1K8UA 3BOWB 1DVIA 3AKBA 1DJGA 3PATA 5KU1A 4JPZB 5FYXA 1WY9A 5HKYA 1IWQA 1J1DA 1XFVO 4JWQA 3O2PA 5D7FA 3WNXB 4FTGA 1CLMA 3RM1A 1SCMC 3NSLA 5J3XA 4BY5A 3SG5A 3EVRA 1KFXS 2LLTA 3CGAA 2BKIB 3DD4A 1UHJA 4PHMA 2BCXA 1ZUZA 2FJUB 1S1EA 1B7TY 1N2DA 3O78A 2LANA 4PE7A 1CFDA 4MEWA 2ZNDA 2M97A 2AUCA 3AKAA 4GBAA 3BUMB 5D69A 4AQJA 1KWOC 2JT8A 1A03A 1JC2A 2GV5A 3I5IC 2BCBA 2JT3A 1ALWA 1OOJA 3IQQA 4CLNA 2WORA 2NCOA 1DTLA 1WDCC 5K89A 1CMFA 2MBXA 2F3YA 2H61C 1RTP1 2LCPA 3LLEA 1DF0A 5CPVA 1A75A 1SK6D 1F71A 1IRJA 5JOLA 3VRRA 1B8LA 3VRNA 2M1UA 3PN7B 4MZJA 1B4CA 2BE6A 1XK4A 1UP5A 1TNWA 1Q80A 4YI8A 1UHIA 2I7AA 2LMVA 4ZCVA 2LHIA 1MUXA 1CLLA 2KI6C 3LK0A 1JWDA 3BUXB 3SG6A 1YRUB 1ZOTB 1MXLC 2AMIA 4YBHB 2NXQA 2WC8A 1DJHA 2F3ZA 4CIDA 1OE9B 3SJSA 3H4SE 2K7OA 1XFZO 1OMVA 1WRKA 1DGUA 1JF0A 4WRIA 1CFCA 1Y6WA 1TTXA 1BMOA 1AUIB 1CMGA 1UWOA 1K94A 3DF0A 1IG5A 3CTNA 4I5JA 5JJGA 1SL7A 1YVLA 3SG3A 1NX3A 2M8UA 1V1GA 1CM1A 1NWDA 1F8HA 3E3RA 5AERA 3DVEA 1KQMC 2PRUA 1RWYA 2JZIA 4AQIA 1FBVA 3BUOB 4MZLA 4DS7A 1XK4C 5KSZA 1KFXL 1KSMA 1CB1A 1QIVA 3IF7A 5CSIA 2JOJA 4I5LB 2ZRSA 4PE1A 1OZSA 5B8IB 1QV1A 1JFKA 3OX5A 1F54A 1A2XA 2F2OA 1ZFSA 2CXJA 1DJIA 3FS7A 2M9GA 1CLBA 4ORAB 4MZKA 1UHHA 2H61A 1BT6A 1TCOB 5GQQC 2WCBA 1QASA 2PSRA 3PSRA 1CNPA 2JT0A 2OTGB 5I2QA 1MHOA 3BOWA 1J1EA 2TN4A 1E8AA 1YTZC 4GFTA 1S3PA 1J7PA 1NCZA 2EC6B 2I2RE 4F0ZB 1H4BA 4P5OE 3BUNB 2CBLA 1M31A 1U5IA 3AAKA 2JQ6A 3I5IB 4OKHA 2BECA 2L4IA 4C0KA 1MWNA 2G9BA 1FI5A 2LP3A 2M29A 1SMGA 1Y1UA 1H8BA 2NZ0A 1PVAA 1PALA 3TZ1A 2QPTA 3TUYB 1LXFC 1FPWA 2K0JA 1K96A 1D1OA 3JTDB 4QJ3B 4C0JA 2L51A 1DT7B 1KSOA 1X02A 2JWWA 1XO5A 1MR8A 2KI4B 1QVIY 1ODBA 2JULA 1J7QA 2NCPA 1ZACA 2KBIA 1TNPA 4MRYA 2K61A 4MVFA 2KYFA 4DCKA 5BPJA 1DJZA 1M45A 1Y1XA 1CTRA 2JTTA 1LA0A 2EGDA 3CS1A 1IJ6A 1MQ1A 3CZTX 5HKZA 1KK8B 1RJVA 1SR6C 2MA2A 4PALA 3WHUB 1QXPA 4N5XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BCA A;  1AJ5 A;  1JF2 A;  1F4Q A;  4PE0 A;  3SIA A;  1FI6 A;  1EG3 A;  3EKJ A;  1DGV A;  1BLQ A;  2BKH B;  4TNC A;  1BU3 A;  3FIA A;  3SIB A;  1C7V A;  2FCE A;  3PM8 A;  4I5K A;  2K2A A;  2K7B A;  2M49 B;  2ZN9 A;  4YGD B;  1IH0 A;  3CR2 A;  4R1E A;  3TS5 C;  1MF8 B;  2L5X B;  2OTG C;  1CDL A;  2ISD A;  2IS9 A;  1TNX A;  3BQ3 A;  3EK4 A;  1TOP A;  1B1G A;  1B9A A;  2JNF A;  1SKT A;  1KK7 Z;  1S5G Z;  1WLM A;  2QAC A;  3IQO A;  2M7N A;  3F45 A;  4I5N B;  1RRO A;  1AVS A;  1SBJ A;  1QVI Z;  1L2O C;  1B47 A;  1JUO A;  2MJW B;  1YX8 A;  4MRX A;  4DIR A;  1XFY O;  4YRU A;  4UPG A;  1OMR A;  4PDZ A;  2KFF A;  4CPV A;  3JVT B;  1Y0V H;  1S26 D;  1RK9 A;  2ZRT A;  1M39 A;  3CR5 X;  2L98 A;  2LUX A;  1CFP A;  4MN0 A;  3GK1 A;  3O6B A;  1PUL A;  1V1F A;  2ZFD A;  3ZNI A;  2LVJ A;  1G33 A;  3TDZ A;  2CTN A;  2JC2 A;  2LVV A;  1TNQ A;  1EH2 A;  5I8N A;  1NYA A;  2DOQ A;  2LC5 A;  2LMU A;  1W7J B;  1DJX A;  2Y1N A;  1BJF A;  3VGO A;  1KQV A;  5IBW A;  3BYA A;  1TCF A;  4GGF C;  2LHL A;  3I5G B;  1C7W A;  3DVJ A;  4XYN A;  1N0Y A;  3GOF A;  3TDU A;  1CDN A;  4L9M A;  2HET A;  3PAL A;  1OSA A;  2OS8 C;  4A4C A;  4GGN A;  4HRG A;  3EVU A;  1K93 D;  1J7R A;  1QTX A;  3WXA A;  1OQP A;  1HQV A;  3A8R A;  5ER4 X;  4ZCU A;  2JU0 A;  2JNX A;  1DJW A;  2JXL A;  3ZWH A;  1JBA A;  1ALV A;  3CLN A;  3PFV A;  1QV0 A;  5HLO A;  1FW4 A;  2COL B;  1L7Z A;  4HSZ A;  1A4P A;  3PN7 C;  4HRH A;  4GGF A;  1UHN A;  2LUC A;  4WQ2 A;  1DF0 B;  2M0R A;  3EK7 A;  1MXE A;  1NP8 A;  3VRO A;  2GGM A;  2MHH A;  2HQW A;  4E68 A;  1PSB A;  1N65 A;  1KCY A;  4P2Y B;  1VRK A;  3OB2 B;  4M2O A;  1J55 A;  2LLU A;  1FF1 A;  1AHR A;  3VRP A;  4WQ3 A;  3LK1 A;  3WHT B;  1R2U A;  2BL0 C;  2KAY A;  5HYD A;  3AAJ A;  1SW8 A;  4BY4 A;  1NX2 A;  4N1G A;  3OB1 B;  1CM4 A;  1BF5 A;  5ER5 A;  2LMT A;  4XJK B;  3VRQ A;  1B8R A;  1U5I B;  3KF9 A;  1GGZ A;  1QX7 A;  2HPS A;  1QAT A;  1XYD A;  1AP4 A;  2LNK A;  1SCV A;  2KDH A;  1BOD A;  1JFJ A;  2GGZ A;  2KGR A;  1BR1 B;  2ZKM X;  1NIW A;  5AEQ A;  1YR5 A;  3RLZ A;  2KFH A;  3PLF B;  5AFP A;  1SY9 A;  1SNL A;  4PE4 A;  1F55 A;  2L50 A;  1CFF A;  4GUK A;  3HX4 A;  1LVC D;  1NX1 A;  1AJ4 A;  1NX0 A;  4PHJ A;  3FWC A;  4PHN A;  3SG4 A;  4QJ5 B;  4Q04 A;  3I5G C;  2L4H A;  1EL4 A;  5G08 A;  2K7C A;  1TRF A;  3TDI A;  3C1V A;  1K95 A;  1A29 A;  1TIZ A;  1IQ3 A;  1SRA A;  1M46 A;  1KFU S;  2EHB A;  3M0W A;  2LAP A;  1YX7 A;  4N1F A;  2F8P A;  2RGI A;  2KBM A;  1S6I A;  2P6B B;  3O4Y A;  5CSN A;  1KK8 C;  1SR6 B;  3I5H C;  3EVV A;  5PAL A;  2CNP A;  2BBM A;  3JTD C;  1KFU L;  4DUQ A;  4MSP A;  3TUY C;  2SCP A;  2Y1M A;  1XA5 A;  3K21 A;  1XFU O;  2ZN8 A;  4M2Q A;  4YI9 A;  4FQO A;  3KPX A;  3DVM A;  1QLS A;  2BL0 B;  1Y1A A;  4NDD A;  1GGW A;  1K9U A;  1LA3 A;  1F4O A;  3CR4 X;  1PVB A;  3BUW B;  4ETO A;  1EXR A;  1DMO A;  3DVK A;  2MLE C;  5HKW A;  2M7L A;  4YGA A;  3BXK A;  1K9P A;  2M3W A;  1DJY A;  4DRW A;  2JXC A;  2LLS A;  3I5H B;  4XJK A;  1YUU A;  2KSP A;  2H2K A;  3HCM A;  5AXI A;  4NDB A;  4OVN F;  2PVB A;  3KO0 A;  5TNC A;  2K8M B;  2BE4 A;  1F70 A;  1NSH A;  3A4U B;  1NCY A;  5HLV A;  1XVJ A;  2MAZ A;  3OP0 A;  1B8C A;  1IQ5 A;  1W7I B;  2D8N A;  1SL9 A;  3CWG A;  4QJ4 B;  4GNK B;  1BG1 A;  2OPO A;  2M1K B;  2LVK A;  3LL8 B;  1YUT A;  4MBE A;  2NLN A;  2OS8 B;  2B1U A;  1QLK A;  4M2P A;  3KEV A;  3GK2 A;  2Y5I A;  4ORB B;  3DF0 B;  2KI4 C;  2V53 A;  1XFX O;  1G4Y R;  3MSE B;  2I18 A;  3ICB A;  4OCI A;  2KOT A;  1HT9 A;  1S5G Y;  2FOT A;  2KAX A;  1KWO B;  2KYC A;  2VRG A;  4YGE B;  1S6C A;  5DKN A;  1CDP A;  4A4B A;  1WLZ A;  1YUS A;  3OX6 A;  1WDC B;  1EJ3 A;  4MLW A;  1K90 D;  2JRF A;  1SYM A;  3OHM B;  2L0P A;  2KQY A;  1PK0 D;  2WOS A;  3EKH A;  4USL A;  2LE9 B;  2MRD A;  2E30 A;  1BR4 B;  1CKK A;  3D0Y A;  1YUR A;  3NSI A;  3SG7 A;  1S36 A;  2KHN A;  4GAO A;  1GQM A;  2R2I A;  4YGC B;  2A4J A;  4D1E A;  1IKU A;  1REC A;  2KAV A;  1JSA A;  3JVT C;  2O5G A;  1R6P A;  4ORC B;  1OZO A;  2KGB C;  2LP2 A;  3KHE A;  4HRE E;  3TS5 B;  2Y4Q A;  3SG2 A;  1QX2 A;  1A75 B;  1K2H A;  5F6T A;  4OR9 B;  3EK8 A;  1SCM B;  2I94 A;  4NQG A;  2O60 A;  1B7T Z;  1TN4 A;  3FWB A;  5I2O A;  1QS7 A;  3GK4 X;  2HF5 A;  2Q91 A;  1NUB A;  2KQ6 A;  2WCF A;  3D0Y B;  2ZNE A;  1G8I A;  2LM5 A;  1CDM A;  4CFQ A;  2K2F A;  1QX5 B;  2MLF C;  5KTY A;  3NSK A;  1S6J A;  4PHK A;  1KK7 Y;  1LKJ A;  2SAS A;  1NCX A;  2JPT A;  2CT9 A;  1WRZ A;  1UUR A;  1KQM B;  2L2E A;  1J7O A;  3NXA A;  2KFG A;  4AOM A;  1XFW O;  2JTZ A;  4U8D A;  2CCM A;  2K7D A;  3I5F B;  1AK8 A;  5AAN A;  2LV7 A;  1IGV A;  1EG4 A;  4PCW A;  1C07 A;  1YRT B;  1SPY A;  4C0L A;  1SL8 A;  3NSO A;  4NDC A;  2HQ8 A;  1PSR A;  2AAO A;  2PAS A;  5CSF A;  1LIN A;  4JQ0 D;  2F33 A;  1K9K A;  1ZMZ A;  1UUS A;  4YGB B;  2F2P A;  3QRX A;  1QJT A;  1IJ5 A;  1GJY A;  3I5F C;  3LCP C;  2E6W A;  1BOC A;  2WCE A;  5DKR A;  5DKQ A;  2KNE A;  1L2O B;  4OV2 A;  4ICB A;  1NPQ A;  4CFR A;  5CSJ A;  1UHK A;  2G2B A;  2PMY A;  4IL1 A;  2PAL A;  2Q4U A;  4GPL B;  2KI6 D;  1M63 B;  2WND A;  1QIW A;  1PRW A;  1WRL A;  1YVH A;  2EC6 C;  2BBN A;  1OMD A;  2LVI A;  3D10 A;  5I2L A;  1RFJ A;  2FCD A;  1K8U A;  3BOW B;  1DVI A;  3AKB A;  1DJG A;  3PAT A;  5KU1 A;  4JPZ B;  5FYX A;  1WY9 A;  5HKY A;  1IWQ A;  1J1D A;  1XFV O;  4JWQ A;  3O2P A;  5D7F A;  3WNX B;  4FTG A;  1CLM A;  3RM1 A;  1SCM C;  3NSL A;  5J3X A;  4BY5 A;  3SG5 A;  3EVR A;  1KFX S;  2LLT A;  3CGA A;  2BKI B;  3DD4 A;  1UHJ A;  4PHM A;  2BCX A;  1ZUZ A;  2FJU B;  1S1E A;  1B7T Y;  1N2D A;  3O78 A;  2LAN A;  4PE7 A;  1CFD A;  4MEW A;  2ZND A;  2M97 A;  2AUC A;  3AKA A;  4GBA A;  3BUM B;  5D69 A;  4AQJ A;  1KWO C;  2JT8 A;  1A03 A;  1JC2 A;  2GV5 A;  3I5I C;  2BCB A;  2JT3 A;  1ALW A;  1OOJ A;  3IQQ A;  4CLN A;  2WOR A;  2NCO A;  1DTL A;  1WDC C;  5K89 A;  1CMF A;  2MBX A;  2F3Y A;  2H61 C;  1RTP 1;  2LCP A;  3LLE A;  1DF0 A;  5CPV A;  1A75 A;  1SK6 D;  1F71 A;  1IRJ A;  5JOL A;  3VRR A;  1B8L A;  3VRN A;  2M1U A;  3PN7 B;  4MZJ A;  1B4C A;  2BE6 A;  1XK4 A;  1UP5 A;  1TNW A;  1Q80 A;  4YI8 A;  1UHI A;  2I7A A;  2LMV A;  4ZCV A;  2LHI A;  1MUX A;  1CLL A;  2KI6 C;  3LK0 A;  1JWD A;  3BUX B;  3SG6 A;  1YRU B;  1ZOT B;  1MXL C;  2AMI A;  4YBH B;  2NXQ A;  2WC8 A;  1DJH A;  2F3Z A;  4CID A;  1OE9 B;  3SJS A;  3H4S E;  2K7O A;  1XFZ O;  1OMV A;  1WRK A;  1DGU A;  1JF0 A;  4WRI A;  1CFC A;  1Y6W A;  1TTX A;  1BMO A;  1AUI B;  1CMG A;  1UWO A;  1K94 A;  3DF0 A;  1IG5 A;  3CTN A;  4I5J A;  5JJG A;  1SL7 A;  1YVL A;  3SG3 A;  1NX3 A;  2M8U A;  1V1G A;  1CM1 A;  1NWD A;  1F8H A;  3E3R A;  5AER A;  3DVE A;  1KQM C;  2PRU A;  1RWY A;  2JZI A;  4AQI A;  1FBV A;  3BUO B;  4MZL A;  4DS7 A;  1XK4 C;  5KSZ A;  1KFX L;  1KSM A;  1CB1 A;  1QIV A;  3IF7 A;  5CSI A;  2JOJ A;  4I5L B;  2ZRS A;  4PE1 A;  1OZS A;  5B8I B;  1QV1 A;  1JFK A;  3OX5 A;  1F54 A;  1A2X A;  2F2O A;  1ZFS A;  2CXJ A;  1DJI A;  3FS7 A;  2M9G A;  1CLB A;  4ORA B;  4MZK A;  1UHH A;  2H61 A;  1BT6 A;  1TCO B;  5GQQ C;  2WCB A;  1QAS A;  2PSR A;  3PSR A;  1CNP A;  2JT0 A;  2OTG B;  5I2Q A;  1MHO A;  3BOW A;  1J1E A;  2TN4 A;  1E8A A;  1YTZ C;  4GFT A;  1S3P A;  1J7P A;  1NCZ A;  2EC6 B;  2I2R E;  4F0Z B;  1H4B A;  4P5O E;  3BUN B;  2CBL A;  1M31 A;  1U5I A;  3AAK A;  2JQ6 A;  3I5I B;  4OKH A;  2BEC A;  2L4I A;  4C0K A;  1MWN A;  2G9B A;  1FI5 A;  2LP3 A;  2M29 A;  1SMG A;  1Y1U A;  1H8B A;  2NZ0 A;  1PVA A;  1PAL A;  3TZ1 A;  2QPT A;  3TUY B;  1LXF C;  1FPW A;  2K0J A;  1K96 A;  1D1O A;  3JTD B;  4QJ3 B;  4C0J A;  2L51 A;  1DT7 B;  1KSO A;  1X02 A;  2JWW A;  1XO5 A;  1MR8 A;  2KI4 B;  1QVI Y;  1ODB A;  2JUL A;  1J7Q A;  2NCP A;  1ZAC A;  2KBI A;  1TNP A;  4MRY A;  2K61 A;  4MVF A;  2KYF A;  4DCK A;  5BPJ A;  1DJZ A;  1M45 A;  1Y1X A;  1CTR A;  2JTT A;  1LA0 A;  2EGD A;  3CS1 A;  1IJ6 A;  1MQ1 A;  3CZT X;  5HKZ A;  1KK8 B;  1RJV A;  1SR6 C;  2MA2 A;  4PAL A;  3WHU B;  1QXP A;  4N5X A; 
#chains in the Genus database with same CATH topology
 1XFR A;  2BCA A;  1AJ5 A;  1JF2 A;  1F4Q A;  4PE0 A;  3SIA A;  1FI6 A;  1EG3 A;  3EKJ A;  1DGV A;  1BLQ A;  2BKH B;  4TNC A;  1BU3 A;  3FIA A;  3SIB A;  1C7V A;  2FCE A;  3PM8 A;  4I5K A;  2K2A A;  2K7B A;  2M49 B;  2WC6 A;  2ZN9 A;  4YGD B;  1IH0 A;  1DC1 A;  3CR2 A;  4R1E A;  3TS5 C;  1MF8 B;  2L5X B;  2OTG C;  3CDN A;  1CDL A;  2ISD A;  2IS9 A;  1TNX A;  3BQ3 A;  3EK4 A;  1TOP A;  1B1G A;  1B9A A;  2JNF A;  1SKT A;  1KK7 Z;  1S5G Z;  1WLM A;  2QAC A;  3IQO A;  2M7N A;  3F45 A;  4I5N B;  1RRO A;  1AVS A;  1SBJ A;  1QVI Z;  1L2O C;  4JD9 A;  1TUJ A;  1B47 A;  1JUO A;  2MJW B;  1YX8 A;  4MRX A;  4DIR A;  1XFY O;  4YRU A;  4UPG A;  1C3Z A;  1OMR A;  3OBV A;  2KFF A;  4PDZ A;  3JVT B;  4CPV A;  1Y0V H;  1S26 D;  1RK9 A;  2ZRT A;  1M39 A;  3CR5 X;  2L98 A;  2LUX A;  1CFP A;  4MN0 A;  3GK1 A;  3O6B A;  1PUL A;  1V1F A;  2K60 A;  2ZFD A;  3ZNI A;  2LVJ A;  1G33 A;  3TDZ A;  2CTN A;  2JC2 A;  2LVV A;  1TNQ A;  1EH2 A;  5I8N A;  4INW A;  1NYA A;  2DOQ A;  2LC5 A;  2LMU A;  1W7J B;  1DJX A;  2Y1N A;  1BJF A;  3VGO A;  1KQV A;  5IBW A;  3BYA A;  2WCJ A;  4INX A;  1TCF A;  4GGF C;  2LHL A;  3I5G B;  1C7W A;  3CZ1 A;  3DVJ A;  4XYN A;  1N0Y A;  3NGV A;  3GOF A;  3BFH A;  3NHI A;  4L9M A;  2HET A;  3TDU A;  1CDN A;  3PAL A;  1OSA A;  2OS8 C;  4A4C A;  4GGN A;  4HRG A;  3EVU A;  1K93 D;  1J7R A;  1QTX A;  2QEB A;  3WXA A;  1OQP A;  3BJH A;  2P70 A;  1HQV A;  3A8R A;  1Z2C B;  5ER4 X;  4ZCU A;  2JU0 A;  2JNX A;  1DJW A;  2JXL A;  3ZWH A;  1JBA A;  1ALV A;  3CLN A;  3PFV A;  1QV0 A;  3PJI A;  5HLO A;  1FW4 A;  2QEH A;  2COL B;  1L7Z A;  4HSZ A;  1A4P A;  3PN7 C;  4HRH A;  3NHT A;  4GGF A;  1UHN A;  2LUC A;  4WQ2 A;  1DF0 B;  2M0R A;  3EK7 A;  1MXE A;  1NP8 A;  3VRO A;  2GGM A;  2MHH A;  2HQW A;  3FE8 A;  4E68 A;  1PSB A;  1N65 A;  3CZT X;  1CNP A;  1KCY A;  4P2Y B;  1VRK A;  3CAB A;  3OB2 B;  4M2O A;  1J55 A;  2LLU A;  1FF1 A;  1AHR A;  3VRP A;  4WQ3 A;  3LK1 A;  3V2L A;  3WHT B;  1R2U A;  2BL0 C;  2KAY A;  4F7F A;  3AAJ A;  1SW8 A;  5HYD A;  4BY4 A;  1NX2 A;  4N1G A;  3OB1 B;  1CM4 A;  1BF5 A;  5ER5 A;  2LMT A;  4XJK B;  3VRQ A;  1B8R A;  1U5I B;  3BFB A;  1GGZ A;  1QX7 A;  3KF9 A;  2HPS A;  1QAT A;  1XYD A;  1AP4 A;  2LNK A;  1SCV A;  2KDH A;  1BOD A;  1JFJ A;  2GGZ A;  2KGR A;  1BR1 B;  2ZKM X;  1NIW A;  5AEQ A;  4FQT A;  1YR5 A;  3RLZ A;  2KFH A;  3R1P A;  3PLF B;  5AFP A;  1SY9 A;  1SNL A;  4PE4 A;  1F55 A;  1W9Z A;  2L50 A;  3B86 A;  4GUK A;  1CFF A;  3HX4 A;  3UNW A;  1LVC D;  1NX1 A;  1AJ4 A;  2L2C A;  1NX0 A;  3BFA A;  3O4X A;  4PHJ A;  3FWC A;  4PHN A;  3SG4 A;  4QJ5 B;  4Q04 A;  3I5G C;  2L4H A;  1EL4 A;  3D75 A;  5G08 A;  5FI6 A;  2K7C A;  1TRF A;  5I94 A;  1OOF A;  3C1V A;  4JKT A;  1K95 A;  3TDI A;  1A29 A;  1TIZ A;  1IQ3 A;  1SRA A;  1M46 A;  1KFU S;  2EHB A;  3M0W A;  2LAP A;  1YX7 A;  4N1F A;  2F8P A;  2RGI A;  2KBM A;  1S6I A;  2P6B B;  3O4Y A;  5CSN A;  2YGU A;  1KK8 C;  1SR6 B;  3I5H C;  3EVV A;  5PAL A;  3S0B A;  2CNP A;  2BBM A;  3JTD C;  1KFU L;  2WCL A;  4DUQ A;  4MSP A;  5EL2 A;  3TUY C;  2SCP A;  2Y1M A;  1XA5 A;  3K21 A;  1XFU O;  1GM0 A;  2ZN8 A;  4M2Q A;  4YI9 A;  4FQO A;  3KPX A;  3DVM A;  1QLS A;  2BL0 B;  1Y1A A;  4NDD A;  1GGW A;  1K9U A;  1LA3 A;  1F4O A;  3CR4 X;  1PVB A;  3BUW B;  4ETO A;  1EXR A;  1DMO A;  3DVK A;  2MLE C;  3CZ0 A;  5HKW A;  4YGA A;  2M7L A;  3BXK A;  1K9P A;  2M3W A;  1DJY A;  2WCH A;  1DQE A;  2JXC A;  2LLS A;  4DRW A;  3I5H B;  4XJK A;  1IIO A;  1YUU A;  2KSP A;  2H2K A;  3B6X A;  3HCM A;  4NDB A;  4OVN F;  5AXI A;  2PVB A;  3KO0 A;  1C3Y A;  5TNC A;  2K8M B;  2BE4 A;  3FE9 A;  2JPO A;  1F70 A;  1NSH A;  3A4U B;  1NCY A;  5HLV A;  1XVJ A;  2MAZ A;  3OP0 A;  1B8C A;  1IQ5 A;  1W7I B;  2D8N A;  3CYZ A;  3S0G A;  1SL9 A;  3CWG A;  4QJ4 B;  4GNK B;  1BG1 A;  2OPO A;  2M1K B;  2LVK A;  3LL8 B;  1YUT A;  4MBE A;  2NLN A;  2OS8 B;  2B1U A;  1QLK A;  4M2P A;  3KEV A;  3GK2 A;  2Y5I A;  4ORB B;  1T14 A;  3DF0 B;  2KI4 C;  2V53 A;  1XFX O;  1G4Y R;  3MSE B;  2I18 A;  2WC5 A;  3DY9 A;  2KOT A;  3ICB A;  4OCI A;  1HT9 A;  1S5G Y;  2FOT A;  2KAX A;  1KWO B;  2KYC A;  2VRG A;  4YGE B;  1S6C A;  5DKN A;  1CDP A;  4A4B A;  1WLZ A;  1YUS A;  3OX6 A;  1WDC B;  1EJ3 A;  4MLW A;  1K90 D;  2JRF A;  1SYM A;  1DEL A;  3OHM B;  2L0P A;  3R1V A;  2KQY A;  1PK0 D;  2WOS A;  3EKH A;  3L47 A;  2LE9 B;  2MRD A;  2E30 A;  4USL A;  1BR4 B;  1CKK A;  3D0Y A;  3N7H A;  1YUR A;  3NSI A;  5D3O A;  1S36 A;  2KHN A;  4GAO A;  1GQM A;  2R2I A;  4YGC B;  2A4J A;  3SG7 A;  4D1E A;  1REC A;  1IKU A;  2KAV A;  1JSA A;  3JVT C;  2O5G A;  1R6P A;  4ORC B;  1OZO A;  2KGB C;  2LP2 A;  3KHE A;  4HRE E;  3D74 A;  3TS5 B;  3IVT A;  1ORG A;  2Y4Q A;  2PQL A;  2BAP A;  3R1O A;  3SG2 A;  1QX2 A;  1A75 B;  1K2H A;  5F6T A;  3FE6 A;  3EK8 A;  4OR9 B;  1SCM B;  2I94 A;  4NQG A;  2O60 A;  1B7T Z;  1TN4 A;  3FWB A;  5I2O A;  1QS7 A;  3S0E A;  3GK4 X;  2HF5 A;  2Q91 A;  1LS8 A;  1NUB A;  2KQ6 A;  2WCF A;  3D0Y B;  2QDI A;  2ZNE A;  1G8I A;  2LM5 A;  1CDM A;  4CFQ A;  2K2F A;  1QX5 B;  2MLF C;  5KTY A;  3DXL A;  3NSK A;  1S6J A;  4PHK A;  1KK7 Y;  1LKJ A;  2SAS A;  1NCX A;  2JPT A;  2CT9 A;  1WRZ A;  1UUR A;  1KQM B;  2L2E A;  1J7O A;  3NXA A;  3D77 A;  2KFG A;  2PYQ A;  4AOM A;  1XFW O;  2JTZ A;  4U8D A;  2BNX A;  2CCM A;  2K7D A;  3I5F B;  1AK8 A;  5AAN A;  2LV7 A;  1IGV A;  1EG4 A;  4PCW A;  1C07 A;  1YRT B;  1SPY A;  4C0L A;  1SL8 A;  3NSO A;  4NDC A;  2HQ8 A;  1PSR A;  2AAO A;  2PAS A;  5CSF A;  1TWO A;  1LIN A;  2KLE A;  4JQ0 D;  2F33 A;  1K9K A;  1ZMZ A;  1UUS A;  4YGB B;  2F2P A;  3QRX A;  1QJT A;  1GJY A;  1IJ5 A;  3I5F C;  3LCP C;  2E6W A;  2KLD A;  1BOC A;  3UO9 A;  2WCE A;  5DKR A;  5DKQ A;  2KNE A;  1L2O B;  4OV2 A;  3RZS A;  4ICB A;  1NPQ A;  4CFR A;  5CSJ A;  1UHK A;  2G2B A;  2PMY A;  4IL1 A;  2PAL A;  3Q8I A;  2Q4U A;  4GPL B;  2KI6 D;  1M63 B;  2WND A;  2FJY A;  1QIW A;  1PRW A;  1WRL A;  1YVH A;  2EC6 C;  2BBN A;  1OMD A;  2LVI A;  3D10 A;  4PT1 A;  2L5Y A;  1RFJ A;  5I2L A;  2FCD A;  1K8U A;  3BOW B;  3L4L A;  3SS4 A;  1DVI A;  3AKB A;  1DJG A;  3PAT A;  5KU1 A;  4JPZ B;  5FYX A;  1WY9 A;  5HKY A;  1IWQ A;  1J1D A;  1XFV O;  3B7A A;  3O2P A;  4JWQ A;  5D7F A;  4FTG A;  3WNX B;  1CLM A;  5FI2 A;  3RM1 A;  1SCM C;  3NSL A;  5J3X A;  4BY5 A;  3SG5 A;  3EVR A;  1KFX S;  3D73 A;  2LLT A;  3CGA A;  2BKI B;  3DD4 A;  1UHJ A;  4PHM A;  2BCX A;  1ZUZ A;  2FJU B;  1S1E A;  2ERB A;  3SS3 A;  1B7T Y;  1N2D A;  3O78 A;  2LAN A;  3B87 A;  4PE7 A;  2KPH A;  1CFD A;  4MEW A;  2ZND A;  2M97 A;  2AUC A;  3AKA A;  4GBA A;  3BUM B;  5D69 A;  3SS5 A;  4OZD A;  1P28 A;  4AQJ A;  2QEO A;  1KWO C;  2WCK A;  2JT8 A;  1A03 A;  1JC2 A;  2GV5 A;  3I5I C;  2BCB A;  2JT3 A;  1ALW A;  1OOJ A;  3IQQ A;  4CLN A;  2WOR A;  2NCO A;  1DTL A;  1WDC C;  5K89 A;  1CMF A;  2MBX A;  2F3Y A;  2H61 C;  1RTP 1;  2LCP A;  3D78 A;  3LLE A;  1DF0 A;  3VB1 A;  5CPV A;  1A75 A;  1SK6 D;  1F71 A;  1IRJ A;  5JOL A;  3VRR A;  1B8L A;  3VRN A;  2M1U A;  3PN7 B;  4MZJ A;  2GTE A;  5FI7 A;  2BE6 A;  1B4C A;  1XK4 A;  1UP5 A;  1TNW A;  1Q80 A;  1TUZ A;  4YI8 A;  1UHI A;  2I7A A;  2LMV A;  4ZCV A;  2LHI A;  1MUX A;  1CLL A;  2KI6 C;  3LK0 A;  3S0A A;  1JWD A;  5DIC A;  5HL1 A;  3BUX B;  3SG6 A;  3D76 A;  1YRU B;  1ZOT B;  1MXL C;  2AMI A;  4YBH B;  2NXQ A;  2WC8 A;  1DJH A;  2F3Z A;  4CID A;  1OE9 B;  3SJS A;  3H4S E;  2K7O A;  1XFZ O;  1OMV A;  1WRK A;  1DGU A;  1JF0 A;  4WRI A;  1CFC A;  1Y6W A;  1TTX A;  1BMO A;  2WCM A;  1AUI B;  1CMG A;  1UWO A;  1K94 A;  3DF0 A;  3R72 A;  1IG5 A;  3CTN A;  4I5J A;  5JJG A;  1SL7 A;  1YVL A;  3SG3 A;  1NX3 A;  2M8U A;  1V1G A;  1OOG A;  1CM1 A;  2H8V A;  1NWD A;  1F8H A;  3E3R A;  5AER A;  3DVE A;  1KQM C;  2PRU A;  1RWY A;  2JZI A;  4AQI A;  1FBV A;  1OOH A;  3BUO B;  4MZL A;  4DS7 A;  1XK4 C;  5KSZ A;  1KFX L;  1KSM A;  1CB1 A;  2QEV A;  1QIV A;  3IF7 A;  3DYE A;  5CSI A;  2JOJ A;  4I5L B;  2ZRS A;  4PE1 A;  1OZS A;  5B8I B;  1QV1 A;  1JFK A;  3S0F A;  3OX5 A;  1F54 A;  1A2X A;  2F2O A;  1ZFS A;  2CXJ A;  1DJI A;  3FS7 A;  2M9G A;  3OGN A;  4ORA B;  1CLB A;  4MZK A;  1UHH A;  2H61 A;  1BT6 A;  1TCO B;  5GQQ C;  2WCB A;  1QAS A;  2PSR A;  3B88 A;  3PSR A;  2JT0 A;  2OTG B;  5I2Q A;  3CZ2 A;  1MHO A;  3BOW A;  1J1E A;  2TN4 A;  1SSE B;  1E8A A;  1YTZ C;  1OW4 A;  3K1E A;  4GFT A;  1S3P A;  1J7P A;  1NCZ A;  2EC6 B;  2I2R E;  4F0Z B;  1H4B A;  4P5O E;  3BUN B;  2CBL A;  2P71 A;  1M31 A;  1U5I A;  3AAK A;  3EG5 B;  2JQ6 A;  3I5I B;  4OKH A;  2BEC A;  2L4I A;  4C0K A;  3S0D A;  1MWN A;  2G9B A;  1FI5 A;  2LP3 A;  2M29 A;  1SMG A;  1Y1U A;  1H8B A;  2NZ0 A;  1PVA A;  1DEK A;  1PAL A;  2QPT A;  3TUY B;  1LXF C;  3TZ1 A;  1FPW A;  2K0J A;  1K96 A;  3DZT A;  1D1O A;  1Z4H A;  3JTD B;  4QJ3 B;  4C0J A;  4KYN A;  3QME A;  2L51 A;  1OOI X;  1DT7 B;  3PM2 A;  1KSO A;  1X02 A;  2JWW A;  1XO5 A;  4IJ7 A;  1MR8 A;  2KI4 B;  1QVI Y;  1ODB A;  2JUL A;  1J7Q A;  2NCP A;  1ZAC A;  2KBI A;  1TNP A;  4MRY A;  2K61 A;  4MVF A;  2KYF A;  4DCK A;  5BPJ A;  1DJZ A;  1M45 A;  1Y1X A;  1CTR A;  2JTT A;  1LA0 A;  2EGD A;  1QWV A;  1IJ6 A;  1MQ1 A;  3CS1 A;  5HKZ A;  1KK8 B;  1RJV A;  1SR6 C;  2MA2 A;  4PAL A;  3WHU B;  1QXP A;  4N5X A;  3L4A A; 
#chains in the Genus database with same CATH homology
 2BCA A;  1AJ5 A;  1JF2 A;  1F4Q A;  4PE0 A;  3SIA A;  1FI6 A;  1EG3 A;  3EKJ A;  1DGV A;  1BLQ A;  2BKH B;  4TNC A;  1BU3 A;  3FIA A;  3SIB A;  1C7V A;  2FCE A;  3PM8 A;  4I5K A;  2K2A A;  2K7B A;  2M49 B;  2ZN9 A;  4YGD B;  1IH0 A;  3CR2 A;  4R1E A;  3TS5 C;  1MF8 B;  2L5X B;  2OTG C;  1CDL A;  2ISD A;  2IS9 A;  1TNX A;  3BQ3 A;  3EK4 A;  1TOP A;  1B1G A;  1B9A A;  2JNF A;  1SKT A;  1KK7 Z;  1S5G Z;  1WLM A;  2QAC A;  3IQO A;  2M7N A;  3F45 A;  4I5N B;  1RRO A;  1AVS A;  1SBJ A;  1QVI Z;  1L2O C;  1B47 A;  1JUO A;  2MJW B;  1YX8 A;  4MRX A;  4DIR A;  1XFY O;  4YRU A;  4UPG A;  1OMR A;  4PDZ A;  2KFF A;  4CPV A;  3JVT B;  1Y0V H;  1S26 D;  1RK9 A;  2ZRT A;  1M39 A;  3CR5 X;  2L98 A;  2LUX A;  1CFP A;  4MN0 A;  3GK1 A;  3O6B A;  1PUL A;  1V1F A;  2ZFD A;  3ZNI A;  2LVJ A;  1G33 A;  3TDZ A;  2CTN A;  2JC2 A;  2LVV A;  1TNQ A;  1EH2 A;  5I8N A;  1NYA A;  2DOQ A;  2LC5 A;  2LMU A;  1W7J B;  1DJX A;  2Y1N A;  1BJF A;  3VGO A;  1KQV A;  5IBW A;  3BYA A;  1TCF A;  4GGF C;  2LHL A;  3I5G B;  1C7W A;  3DVJ A;  4XYN A;  1N0Y A;  3GOF A;  3TDU A;  1CDN A;  4L9M A;  2HET A;  3PAL A;  1OSA A;  2OS8 C;  4A4C A;  4GGN A;  4HRG A;  3EVU A;  1K93 D;  1J7R A;  1QTX A;  3WXA A;  1OQP A;  1HQV A;  3A8R A;  5ER4 X;  4ZCU A;  2JU0 A;  2JNX A;  1DJW A;  2JXL A;  3ZWH A;  1JBA A;  1ALV A;  3CLN A;  3PFV A;  1QV0 A;  5HLO A;  1FW4 A;  2COL B;  1L7Z A;  4HSZ A;  1A4P A;  3PN7 C;  4HRH A;  4GGF A;  1UHN A;  2LUC A;  4WQ2 A;  1DF0 B;  2M0R A;  3EK7 A;  1MXE A;  1NP8 A;  3VRO A;  2GGM A;  2MHH A;  2HQW A;  4E68 A;  1PSB A;  1N65 A;  1KCY A;  4P2Y B;  1VRK A;  3OB2 B;  4M2O A;  1J55 A;  2LLU A;  1FF1 A;  1AHR A;  3VRP A;  4WQ3 A;  3LK1 A;  3WHT B;  1R2U A;  2BL0 C;  2KAY A;  5HYD A;  3AAJ A;  1SW8 A;  4BY4 A;  1NX2 A;  4N1G A;  3OB1 B;  1CM4 A;  1BF5 A;  5ER5 A;  2LMT A;  4XJK B;  3VRQ A;  1B8R A;  1U5I B;  3KF9 A;  1GGZ A;  1QX7 A;  2HPS A;  1QAT A;  1XYD A;  1AP4 A;  2LNK A;  1SCV A;  2KDH A;  1BOD A;  1JFJ A;  2GGZ A;  2KGR A;  1BR1 B;  2ZKM X;  1NIW A;  5AEQ A;  1YR5 A;  3RLZ A;  2KFH A;  3PLF B;  5AFP A;  1SY9 A;  1SNL A;  4PE4 A;  1F55 A;  2L50 A;  1CFF A;  4GUK A;  3HX4 A;  1LVC D;  1NX1 A;  1AJ4 A;  1NX0 A;  4PHJ A;  3FWC A;  4PHN A;  3SG4 A;  4QJ5 B;  4Q04 A;  3I5G C;  2L4H A;  1EL4 A;  5G08 A;  2K7C A;  1TRF A;  3TDI A;  3C1V A;  1K95 A;  1A29 A;  1TIZ A;  1IQ3 A;  1SRA A;  1M46 A;  1KFU S;  2EHB A;  3M0W A;  2LAP A;  1YX7 A;  4N1F A;  2F8P A;  2RGI A;  2KBM A;  1S6I A;  2P6B B;  3O4Y A;  5CSN A;  1KK8 C;  1SR6 B;  3I5H C;  3EVV A;  5PAL A;  2CNP A;  2BBM A;  3JTD C;  1KFU L;  4DUQ A;  4MSP A;  3TUY C;  2SCP A;  2Y1M A;  1XA5 A;  3K21 A;  1XFU O;  2ZN8 A;  4M2Q A;  4YI9 A;  4FQO A;  3KPX A;  3DVM A;  1QLS A;  2BL0 B;  1Y1A A;  4NDD A;  1GGW A;  1K9U A;  1LA3 A;  1F4O A;  3CR4 X;  1PVB A;  3BUW B;  4ETO A;  1EXR A;  1DMO A;  3DVK A;  2MLE C;  5HKW A;  2M7L A;  4YGA A;  3BXK A;  1K9P A;  2M3W A;  1DJY A;  4DRW A;  2JXC A;  2LLS A;  3I5H B;  4XJK A;  1YUU A;  2KSP A;  2H2K A;  3HCM A;  5AXI A;  4NDB A;  4OVN F;  2PVB A;  3KO0 A;  5TNC A;  2K8M B;  2BE4 A;  1F70 A;  1NSH A;  3A4U B;  1NCY A;  5HLV A;  1XVJ A;  2MAZ A;  3OP0 A;  1B8C A;  1IQ5 A;  1W7I B;  2D8N A;  1SL9 A;  3CWG A;  4QJ4 B;  4GNK B;  1BG1 A;  2OPO A;  2M1K B;  2LVK A;  3LL8 B;  1YUT A;  4MBE A;  2NLN A;  2OS8 B;  2B1U A;  1QLK A;  4M2P A;  3KEV A;  3GK2 A;  2Y5I A;  4ORB B;  3DF0 B;  2KI4 C;  2V53 A;  1XFX O;  1G4Y R;  3MSE B;  2I18 A;  3ICB A;  4OCI A;  2KOT A;  1HT9 A;  1S5G Y;  2FOT A;  2KAX A;  1KWO B;  2KYC A;  2VRG A;  4YGE B;  1S6C A;  5DKN A;  1CDP A;  4A4B A;  1WLZ A;  1YUS A;  3OX6 A;  1WDC B;  1EJ3 A;  4MLW A;  1K90 D;  2JRF A;  1SYM A;  3OHM B;  2L0P A;  2KQY A;  1PK0 D;  2WOS A;  3EKH A;  4USL A;  2LE9 B;  2MRD A;  2E30 A;  1BR4 B;  1CKK A;  3D0Y A;  1YUR A;  3NSI A;  3SG7 A;  1S36 A;  2KHN A;  4GAO A;  1GQM A;  2R2I A;  4YGC B;  2A4J A;  4D1E A;  1IKU A;  1REC A;  2KAV A;  1JSA A;  3JVT C;  2O5G A;  1R6P A;  4ORC B;  1OZO A;  2KGB C;  2LP2 A;  3KHE A;  4HRE E;  3TS5 B;  2Y4Q A;  3SG2 A;  1QX2 A;  1A75 B;  1K2H A;  5F6T A;  4OR9 B;  3EK8 A;  1SCM B;  2I94 A;  4NQG A;  2O60 A;  1B7T Z;  1TN4 A;  3FWB A;  5I2O A;  1QS7 A;  3GK4 X;  2HF5 A;  2Q91 A;  1NUB A;  2KQ6 A;  2WCF A;  3D0Y B;  2ZNE A;  1G8I A;  2LM5 A;  1CDM A;  4CFQ A;  2K2F A;  1QX5 B;  2MLF C;  5KTY A;  3NSK A;  1S6J A;  4PHK A;  1KK7 Y;  1LKJ A;  2SAS A;  1NCX A;  2JPT A;  2CT9 A;  1WRZ A;  1UUR A;  1KQM B;  2L2E A;  1J7O A;  3NXA A;  2KFG A;  4AOM A;  1XFW O;  2JTZ A;  4U8D A;  2CCM A;  2K7D A;  3I5F B;  1AK8 A;  5AAN A;  2LV7 A;  1IGV A;  1EG4 A;  4PCW A;  1C07 A;  1YRT B;  1SPY A;  4C0L A;  1SL8 A;  3NSO A;  4NDC A;  2HQ8 A;  1PSR A;  2AAO A;  2PAS A;  5CSF A;  1LIN A;  4JQ0 D;  2F33 A;  1K9K A;  1ZMZ A;  1UUS A;  4YGB B;  2F2P A;  3QRX A;  1QJT A;  1IJ5 A;  1GJY A;  3I5F C;  3LCP C;  2E6W A;  1BOC A;  2WCE A;  5DKR A;  5DKQ A;  2KNE A;  1L2O B;  4OV2 A;  4ICB A;  1NPQ A;  4CFR A;  5CSJ A;  1UHK A;  2G2B A;  2PMY A;  4IL1 A;  2PAL A;  2Q4U A;  4GPL B;  2KI6 D;  1M63 B;  2WND A;  1QIW A;  1PRW A;  1WRL A;  1YVH A;  2EC6 C;  2BBN A;  1OMD A;  2LVI A;  3D10 A;  5I2L A;  1RFJ A;  2FCD A;  1K8U A;  3BOW B;  1DVI A;  3AKB A;  1DJG A;  3PAT A;  5KU1 A;  4JPZ B;  5FYX A;  1WY9 A;  5HKY A;  1IWQ A;  1J1D A;  1XFV O;  4JWQ A;  3O2P A;  5D7F A;  3WNX B;  4FTG A;  1CLM A;  3RM1 A;  1SCM C;  3NSL A;  5J3X A;  4BY5 A;  3SG5 A;  3EVR A;  1KFX S;  2LLT A;  3CGA A;  2BKI B;  3DD4 A;  1UHJ A;  4PHM A;  2BCX A;  1ZUZ A;  2FJU B;  1S1E A;  1B7T Y;  1N2D A;  3O78 A;  2LAN A;  4PE7 A;  1CFD A;  4MEW A;  2ZND A;  2M97 A;  2AUC A;  3AKA A;  4GBA A;  3BUM B;  5D69 A;  4AQJ A;  1KWO C;  2JT8 A;  1A03 A;  1JC2 A;  2GV5 A;  3I5I C;  2BCB A;  2JT3 A;  1ALW A;  1OOJ A;  3IQQ A;  4CLN A;  2WOR A;  2NCO A;  1DTL A;  1WDC C;  5K89 A;  1CMF A;  2MBX A;  2F3Y A;  2H61 C;  1RTP 1;  2LCP A;  3LLE A;  1DF0 A;  5CPV A;  1A75 A;  1SK6 D;  1F71 A;  1IRJ A;  5JOL A;  3VRR A;  1B8L A;  3VRN A;  2M1U A;  3PN7 B;  4MZJ A;  1B4C A;  2BE6 A;  1XK4 A;  1UP5 A;  1TNW A;  1Q80 A;  4YI8 A;  1UHI A;  2I7A A;  2LMV A;  4ZCV A;  2LHI A;  1MUX A;  1CLL A;  2KI6 C;  3LK0 A;  1JWD A;  3BUX B;  3SG6 A;  1YRU B;  1ZOT B;  1MXL C;  2AMI A;  4YBH B;  2NXQ A;  2WC8 A;  1DJH A;  2F3Z A;  4CID A;  1OE9 B;  3SJS A;  3H4S E;  2K7O A;  1XFZ O;  1OMV A;  1WRK A;  1DGU A;  1JF0 A;  4WRI A;  1CFC A;  1Y6W A;  1TTX A;  1BMO A;  1AUI B;  1CMG A;  1UWO A;  1K94 A;  3DF0 A;  1IG5 A;  3CTN A;  4I5J A;  5JJG A;  1SL7 A;  1YVL A;  3SG3 A;  1NX3 A;  2M8U A;  1V1G A;  1CM1 A;  1NWD A;  1F8H A;  3E3R A;  5AER A;  3DVE A;  1KQM C;  2PRU A;  1RWY A;  2JZI A;  4AQI A;  1FBV A;  3BUO B;  4MZL A;  4DS7 A;  1XK4 C;  5KSZ A;  1KFX L;  1KSM A;  1CB1 A;  1QIV A;  3IF7 A;  5CSI A;  2JOJ A;  4I5L B;  2ZRS A;  4PE1 A;  1OZS A;  5B8I B;  1QV1 A;  1JFK A;  3OX5 A;  1F54 A;  1A2X A;  2F2O A;  1ZFS A;  2CXJ A;  1DJI A;  3FS7 A;  2M9G A;  1CLB A;  4ORA B;  4MZK A;  1UHH A;  2H61 A;  1BT6 A;  1TCO B;  5GQQ C;  2WCB A;  1QAS A;  2PSR A;  3PSR A;  1CNP A;  2JT0 A;  2OTG B;  5I2Q A;  1MHO A;  3BOW A;  1J1E A;  2TN4 A;  1E8A A;  1YTZ C;  4GFT A;  1S3P A;  1J7P A;  1NCZ A;  2EC6 B;  2I2R E;  4F0Z B;  1H4B A;  4P5O E;  3BUN B;  2CBL A;  1M31 A;  1U5I A;  3AAK A;  2JQ6 A;  3I5I B;  4OKH A;  2BEC A;  2L4I A;  4C0K A;  1MWN A;  2G9B A;  1FI5 A;  2LP3 A;  2M29 A;  1SMG A;  1Y1U A;  1H8B A;  2NZ0 A;  1PVA A;  1PAL A;  3TZ1 A;  2QPT A;  3TUY B;  1LXF C;  1FPW A;  2K0J A;  1K96 A;  1D1O A;  3JTD B;  4QJ3 B;  4C0J A;  2L51 A;  1DT7 B;  1KSO A;  1X02 A;  2JWW A;  1XO5 A;  1MR8 A;  2KI4 B;  1QVI Y;  1ODB A;  2JUL A;  1J7Q A;  2NCP A;  1ZAC A;  2KBI A;  1TNP A;  4MRY A;  2K61 A;  4MVF A;  2KYF A;  4DCK A;  5BPJ A;  1DJZ A;  1M45 A;  1Y1X A;  1CTR A;  2JTT A;  1LA0 A;  2EGD A;  3CS1 A;  1IJ6 A;  1MQ1 A;  3CZT X;  5HKZ A;  1KK8 B;  1RJV A;  1SR6 C;  2MA2 A;  4PAL A;  3WHU B;  1QXP A;  4N5X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...