1K9PA

Crystal structure of calcium free (or apo) human s100a6
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
89
structure length
89
Chain Sequence
ACPLDQAIGLLVAIFHKYSGREGDKHTLSKKELKELIQKELTIGSKLQDAEIARLMEDLDRNKDQEVNFQEYVTFLGALALIYNEALKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of S100A6 in the Ca(2+)-free and Ca(2+)-bound states: the calcium sensor mechanism of S100 proteins revealed at atomic resolution.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords S100A6
total genus 30
structure length 89
sequence length 89
ec nomenclature
pdb deposition date 2001-10-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1k9pA00
1AUIB 4ZCVA 1J1EA 1KQMC 3I5FC 4WQ3A 1DMOA 1NX3A 2JPTA 1GJYA 4N1GA 1TOPA 5CPVA 3DVEA 1CM1A 2AAOA 3SG5A 1CFPA 2B1UA 2COLB 1SL7A 3BYAA 5D69A 1JC2A 1C07A 2WCEA 1UP5A 1R6PA 2Y5IA 2F2OA 2Y1NA 1YVHA 1L7ZA 1TIZA 5I2LA 1XFXO 1Y1AA 5DKQA 4C0JA 1OZOA 5I2QA 2KI6D 2LANA 2K7OA 5DKRA 1SKTA 3EVVA 3DVJA 1YRTB 2PRUA 4PE7A 2LE9B 1L2OC 2ZRSA 3OX6A 2FCEA 2LVJA 5CSFA 1QTXA 4JQ0D 4MRXA 1F8HA 3SIBA 3NSKA 2KOTA 4GUKA 1KWOC 1MWNA 2HPSA 2L50A 1S6CA 1FI5A 5DKNA 1K8UA 1K94A 1PK0D 1KK7Y 1MXLC 3CTNA 4YGAA 2R2IA 3ZNIA 1W7IB 2BECA 2ZN9A 1VRKA 4HREE 3TDZA 1Y1XA 1DJGA 1K93D 5HYDA 1PVAA 1NCYA 1NIWA 1V1GA 1ALVA 2BCAA 1K9PA 1OZSA 1KQMB 4PHMA 1M31A 1XK4C 1TNWA 4MZLA 2A4JA 1XFZO 2JOJA 3DVMA 2CNPA 2KI4B 1QV0A 2H61C 2HETA 2JC2A 3D0YA 3A4UB 2KQ6A 3FWCA 3LCPC 3I5IB 1HT9A 1C7VA 3KEVA 4I5KA 1OQPA 2KBMA 1YUSA 4QJ5B 1F70A 1LA3A 4OKHA 4MN0A 2ZNEA 4I5LB 4I5NB 1NYAA 1F55A 1B7TY 4PHNA 5HKYA 1K2HA 2LVVA 3GK2A 4MVFA 3BXKA 2L2EA 4DS7A 2KSPA 1PULA 1WLMA 3HCMA 1PSBA 3VRRA 1PALA 2LP3A 1ALWA 5B8IB 1KK7Z 1L2OB 2SCPA 1F54A 1DTLA 1BODA 1D1OA 2PVBA 3VGOA 1QX7A 2K2AA 1J7OA 1B1GA 1SYMA 1NUBA 2P6BB 2Y4QA 1H8BA 2DOQA 2ZRTA 2MRDA 4PHKA 1F71A 1S5GY 2BE4A 1EG4A 1GGWA 5ER4X 1M45A 1K9UA 3AAKA 2CTNA 3C1VA 1JFJA 1NX1A 1XK4A 1RK9A 2LLTA 2JT3A 4I5JA 4ORAB 3KO0A 3NSOA 2CXJA 4OVNF 1XO5A 5I2OA 2WNDA 2M0RA 5CSIA 2SASA 1S6JA 4AOMA 1RECA 1UHIA 2CBLA 5HLVA 1TTXA 1IQ3A 4USLA 3CR5X 1BR1B 3DF0B 1N65A 3RLZA 4CLNA 1CTRA 1A75A 5AEQA 3HX4A 1AJ4A 4C0LA 1UHHA 4ZCUA 1QASA 2F8PA 1QX5B 1UHKA 3I5FB 2MBXA 2K0JA 2QACA 3OHMB 3H4SE 1DF0B 1JF0A 1NCZA 2KNEA 1DJIA 1R2UA 1WRLA 3TDUA 1S6IA 1SNLA 5AXIA 2KGRA 1B8RA 4MBEA 2MHHA 1CDNA 1WY9A 3PLFB 4TNCA 1N0YA 2BCXA 2EC6B 2KHNA 1MHOA 2ZN8A 4PDZA 4PALA 2Q4UA 5AERA 1XVJA 1PVBA 2EHBA 2LLSA 3O6BA 1KFXL 4JPZB 3WHUB 1ODBA 1QVIZ 3AKAA 1DJHA 1NWDA 3FWBA 5KTYA 1MR8A 4A4BA 4ORCB 3SG3A 1F4OA 2LUXA 4NQGA 2L5XB 2LV7A 2RGIA 4PE0A 1J1DA 4OR9B 1KWOB 1YURA 1CDPA 1SBJA 3LL8B 2KFFA 1G33A 1Y0VH 3KHEA 1FBVA 3RM1A 5BPJA 3TUYC 1LINA 3TS5C 2JULA 2LVIA 4PE4A 4XYNA 2L98A 2MLFC 5J3XA 1K96A 3GOFA 1KCYA 1M46A 2CT9A 1OMDA 1F4QA 1TN4A 2F3YA 3AAJA 3NSLA 3FIAA 4NDDA 3I5IC 4YGCB 3EVUA 2L4HA 1TNQA 4GFTA 1TNXA 2VRGA 2G9BA 3DD4A 1QJTA 2F33A 1QXPA 3QRXA 1IKUA 3OP0A 2EGDA 1J7PA 1UURA 1U5IA 1JBAA 1WLZA 2CCMA 4YGDB 3I5HB 2GGMA 5G08A 2LHIA 4GAOA 4DRWA 1CNPA 1SW8A 2Q91A 1FI6A 2PMYA 1QV1A 3VRNA 1GGZA 1QIVA 4OCIA 4IL1A 3JTDC 4Q04A 1BJFA 1UHJA 3K21A 3CS1A 1B9AA 1S3PA 2JNFA 2OTGC 3EK7A 1OMRA 1KSMA 1OOJA 1Q80A 1AHRA 2M49B 4WQ2A 1CMGA 1DJZA 1QX2A 2BBNA 3SIAA 4YGEB 3WNXB 3ZWHA 3VROA 1NX2A 2K61A 1BF5A 2LM5A 2V53A 1IQ5A 2KI6C 1A4PA 1XFYO 2FCDA 1XFWO 1A29A 1E8AA 1ZFSA 2LLUA 2NCPA 4GBAA 2Y1MA 1BLQA 4GGFC 1BU3A 1WRZA 1K90D 2KFGA 5FYXA 3BUWB 1M63B 1QLKA 1SR6C 1EG3A 1RFJA 4PHJA 2QPTA 2L4IA 2MLEC 4QJ4B 2NXQA 4E68A 3CLNA 1CLLA 1DVIA 3BUNB 1UWOA 4R1EA 4CFRA 1CLMA 5CSNA 4MEWA 1JWDA 1A75B 3A8RA 1QLSA 1IWQA 3PFVA 3VRPA 1KFUL 3BOWB 3CGAA 1UHNA 3EKJA 1M39A 2JXLA 4A4CA 1BOCA 1XFVO 2LMUA 4MZJA 2PALA 5AFPA 4M2OA 2AUCA 4QJ3B 4AQJA 2K8MB 4WRIA 1CFCA 2BE6A 1NX0A 2EC6C 2JWWA 1NP8A 2KQYA 2I18A 2IS9A 1MUXA 2K7DA 1OE9B 1DGUA 1MQ1A 1PSRA 2G2BA 2WC8A 3OB1B 1YUUA 4XJKA 1EH2A 3IF7A 1FPWA 4MSPA 1RWYA 1S5GZ 4CIDA 2BKIB 3NSIA 4F0ZB 4YBHB 4HRGA 2H2KA 4ETOA 3GK1A 4JWQA 5HLOA 1CLBA 1KFXS 1SR6B 3LK0A 2M29A 1SL9A 3SG2A 3IQQA 5HKWA 1NPQA 2M3WA 2E6WA 1DGVA 2M97A 3TDIA 2KDHA 1WDCB 3BUOB 1JF2A 1QIWA 4YGBB 5F6TA 3LK1A 1S36A 3DVKA 4P2YB 1DJXA 3JVTB 1PRWA 3TUYB 4OV2A 1OSAA 3TS5B 1SK6D 1ZUZA 2KYFA 4DCKA 1YRUB 2KAXA 2M8UA 5GQQC 1IGVA 1YX8A 1B7TZ 2ISDA 1IJ5A 2NCOA 1ZOTB 1K95A 1IG5A 3FS7A 3WHTB 3BQ3A 3CR2A 1WRKA 2L51A 1TCFA 2TN4A 1V1FA 5PALA 2ZKMX 2FJUB 2M1KB 5ER5A 4FTGA 3SG6A 1B47A 4DIRA 5KU1A 4C0KA 1JSAA 4U8DA 3I5HC 3BOWA 3F45A 2LMTA 2JTTA 4PE1A 5TNCA 1SCMB 5HKZA 1B8CA 2OS8B 4N5XA 1CFFA 1DJWA 1C7WA 1J55A 4L9MA 1KK8B 2F3ZA 1QATA 4YRUA 2OTGB 2LNKA 3VRQA 1AP4A 2LHLA 1KSOA 3PALA 1S1EA 3PSRA 1Y6WA 1NSHA 4MZKA 2MA2A 1FW4A 4D1EA 3CWGA 5KSZA 2JNXA 1KFUS 4P5OE 1H4BA 1CDMA 4GGNA 1TRFA 2JXCA 1GQMA 2K2FA 1CMFA 3ICBA 1HQVA 1DJYA 1XYDA 2I94A 1CFDA 2KBIA 2O5GA 3EKHA 3O4YA 3PATA 3PN7C 3EK8A 2LUCA 2PSRA 1YTZC 1MXEA 4N1FA 2ZNDA 1AJ5A 3D0YB 1SPYA 5I8NA 1W7JB 4BY4A 3M0WA 2BL0C 2JQ6A 5K89A 3JTDB 3KPXA 2K7BA 4UPGA 2M1UA 2KGBC 2ZFDA 4ORBB 5D7FA 2GV5A 2PASA 1IRJA 2LCPA 4FQOA 1J7RA 2K7CA 3WXAA 1CKKA 1ZMZA 3DF0A 3KF9A 1LA0A 1CM4A 2WOSA 4MLWA 2WCFA 1U5IB 4YI8A 4GNKB 2H61A 3SJSA 3I5GB 2D8NA 1S26D 2BCBA 2LMVA 3O2PA 1AK8A 4CPVA 4GGFA 2OPOA 2M7LA 2JTZA 2KI4C 2JT0A 2I7AA 4AQIA 2LP2A 3IQOA 1EXRA 2HQ8A 3SG4A 1AVSA 1CB1A 2LVKA 1JUOA 1NCXA 2M9GA 3OX5A 4M2PA 4DUQA 2NZ0A 1UUSA 3PM8A 4GPLB 2KFHA 1BMOA 1N2DA 1ZACA 2I2RE 1BR4B 3EVRA 4BY5A 2JU0A 2JZIA 1XA5A 1SRAA 3O78A 3OB2B 3PN7B 4PCWA 2NLNA 1JFKA 4CFQA 1FF1A 2BBMA 2L0PA 1TNPA 2O60A 2KAYA 4ICBA 1SL8A 2BL0B 1SMGA 2F2PA 1OMVA 4MRYA 2M7NA 3TZ1A 4HSZA 1BG1A 1A03A 2WORA 1SY9A 3GK4X 4M2QA 1K9KA 1RROA 2AMIA 1TCOB 1J7QA 3JVTC 1WDCC 1EL4A 1LXFC 2KAVA 1YX7A 2LAPA 2E30A 5JOLA 4NDCA 1DT7B 2JT8A 3D10A 1G4YR 3BUXB 4YI9A 1KQVA 3CZTX 2HF5A 1X02A 1SCVA 3I5GC 4XJKB 2FOTA 1BT6A 1G8IA 1B4CA 1QVIY 5JJGA 5IBWA 5AANA 1B8LA 2BKHB 2GGZA 1IH0A 1DF0A 1RTP1 3MSEB 2HQWA 1CDLA 1RJVA 1MF8B 1XFUO 1YUTA 1LVCD 3AKBA 3SG7A 1LKJA 3LLEA 1QS7A 2WCBA 2MJWB 1YR5A 5CSJA 1A2XA 4NDBA 1SCMC 3NXAA 4HRHA 2OS8C 2JRFA 3BUMB 1EJ3A 1IJ6A 1YVLA 1KK8C 1Y1UA 2LC5A 2KYCA 2MAZA 3CR4X 3E3RA 3EK4A
chains in the Genus database with same CATH superfamily
1AUIB 4ZCVA 1J1EA 1KQMC 3VB1A 3I5FC 4WQ3A 1DMOA 1NX3A 2JPTA 3D75A 1GJYA 4N1GA 1TOPA 5CPVA 3DVEA 1CM1A 2AAOA 3SG5A 1TUZA 2B1UA 2COLB 1CFPA 1C3ZA 1SL7A 3BYAA 3OGNA 5D69A 1JC2A 1C07A 2WCEA 3CZ0A 3FE8A 1UP5A 1R6PA 2Y5IA 2F2OA 2H8VA 2Y1NA 1YVHA 1L7ZA 1TIZA 3CYZA 5I2LA 1XFXO 1Y1AA 5DKQA 4C0JA 1OZOA 5I2QA 2KLDA 2KI6D 2LANA 2K7OA 5DKRA 2L5YA 3R1PA 1SKTA 3EVVA 1QWVA 1YRTB 2PRUA 1SSEB 2LE9B 3DVJA 3L4AA 1L2OC 2ZRSA 4PE7A 3OX6A 2FCEA 2LVJA 5CSFA 3B88A 1QTXA 4JQ0D 4MRXA 1OW4A 1F8HA 3SIBA 3NSKA 2KOTA 4GUKA 1KWOC 1IIOA 1MWNA 2HPSA 2L50A 1S6CA 1FI5A 5DKNA 1K8UA 1K94A 1PK0D 1KK7Y 1MXLC 3CTNA 4YGAA 2R2IA 3ZNIA 1W7IB 2BECA 2ZN9A 1VRKA 4HREE 3TDZA 1Y1XA 1DJGA 1K93D 5HYDA 1PVAA 1NCYA 1NIWA 1V1GA 1ALVA 2BCAA 1K9PA 1OZSA 1KQMB 4PHMA 1M31A 1XK4C 1TNWA 4MZLA 2A4JA 1XFZO 2JOJA 3DVMA 2CNPA 2KI4B 1QV0A 2H61C 2HETA 2JC2A 3D0YA 3A4UB 2KQ6A 3FWCA 3LCPC 3UO9A 3I5IB 1HT9A 2BNXA 1C7VA 3KEVA 4I5KA 1OQPA 2KBMA 2KPHA 1YUSA 3D74A 4QJ5B 1F70A 1LA3A 4OKHA 4MN0A 2ZNEA 4I5LB 4I5NB 1NYAA 3SS5A 1B7TY 4PHNA 5HKYA 1DC1A 1F55A 3CABA 1K2HA 2LVVA 3GK2A 4MVFA 3BXKA 2L2EA 4DS7A 2KSPA 1PULA 1WLMA 3HCMA 1PSBA 3VRRA 1PALA 2LP3A 1ALWA 5B8IB 1KK7Z 1L2OB 1C3YA 2SCPA 1OOFA 1F54A 1GM0A 1DTLA 3UNWA 1BODA 1D1OA 2PVBA 3VGOA 1QX7A 2K2AA 1J7OA 3B6XA 1B1GA 1SYMA 1NUBA 2P6BB 2Y4QA 1H8BA 2DOQA 2ZRTA 2MRDA 4PHKA 1F71A 1S5GY 2BE4A 3S0FA 1EG4A 1GGWA 5ER4X 2L2CA 1M45A 1K9UA 3AAKA 2CTNA 3QMEA 3C1VA 1JFJA 1NX1A 5I94A 1XK4A 3NHIA 4IJ7A 1RK9A 2LLTA 2JT3A 2K60A 3D76A 4I5JA 4ORAB 3S0AA 3O4XA 3KO0A 3NSOA 2CXJA 4OVNF 1XO5A 4JD9A 5I2OA 2WNDA 2M0RA 5CSIA 2SASA 1S6JA 4AOMA 1RECA 1UHIA 2CBLA 5HLVA 1TTXA 1IQ3A 4USLA 3CR5X 1BR1B 3DF0B 1N65A 3RLZA 4CLNA 1CTRA 1A75A 5AEQA 3HX4A 1AJ4A 4C0LA 1UHHA 4INXA 1QASA 2F8PA 4ZCUA 1QX5B 1UHKA 3I5FB 2MBXA 2K0JA 2QACA 3NGVA 3OHMB 3H4SE 1DF0B 2PYQA 1JF0A 1NCZA 2KNEA 3DZTA 1DJIA 1R2UA 1WRLA 3TDUA 1LS8A 1S6IA 1SNLA 5AXIA 2KGRA 1B8RA 4MBEA 2MHHA 1CDNA 1WY9A 3PLFB 2WCKA 4TNCA 1N0YA 2BCXA 2EC6B 2KHNA 3S0DA 1MHOA 2ZN8A 4PDZA 4PALA 2Q4UA 5AERA 1XVJA 1PVBA 2EHBA 2LLSA 3O6BA 1KFXL 4JPZB 3WHUB 1ODBA 1QVIZ 3AKAA 1DJHA 1NWDA 4JKTA 3FWBA 3R1VA 5KTYA 1MR8A 4A4BA 4ORCB 3SG3A 1F4OA 2LUXA 4NQGA 2L5XB 2LV7A 2RGIA 4PE0A 1J1DA 4OR9B 1KWOB 1YURA 4F7FA 1CDPA 3BJHA 2WCMA 1SBJA 3LL8B 2KFFA 1Z2CB 1G33A 1Y0VH 3KHEA 1FBVA 3RM1A 5BPJA 3TUYC 1LINA 3TS5C 2JULA 2LVIA 4PE4A 4XYNA 3S0EA 2L98A 2MLFC 5J3XA 1K96A 3GOFA 3B87A 1KCYA 1M46A 2CT9A 1OMDA 1F4QA 1TN4A 2F3YA 3AAJA 3NSLA 3FIAA 4NDDA 1DQEA 3I5IC 4YGCB 3EVUA 2GTEA 2L4HA 1TNQA 4GFTA 1TNXA 2VRGA 2G9BA 3DD4A 1QJTA 2F33A 1QXPA 3QRXA 1IKUA 3OP0A 2EGDA 1J7PA 1UURA 1U5IA 1JBAA 1WLZA 2CCMA 4YGDB 3I5HB 2GGMA 5G08A 2LHIA 4GAOA 4DRWA 1CNPA 1SW8A 2Q91A 1FI6A 2PMYA 3BFAA 1QV1A 3SS3A 3VRNA 1GGZA 1QIVA 4OCIA 4OZDA 4IL1A 3JTDC 2QEHA 4Q04A 1BJFA 1UHJA 3K21A 3CS1A 1B9AA 1S3PA 2YGUA 2JNFA 2OTGC 3EK7A 1OMRA 1KSMA 1OOJA 3CZ2A 3CDNA 2WCJA 1Q80A 1AHRA 2M49B 1TWOA 4WQ2A 1DJZA 1QX2A 2BBNA 1CMGA 3SIAA 4YGEB 3WNXB 3ZWHA 3VROA 1NX2A 3BFBA 4PT1A 2K61A 1BF5A 2LM5A 2V53A 3K1EA 1IQ5A 3OBVA 5D3OA 2KI6C 1A4PA 1XFYO 2FCDA 1XFWO 1A29A 1E8AA 1ZFSA 2LLUA 2NCPA 4GBAA 2Y1MA 1BLQA 4GGFC 1BU3A 1WRZA 1K90D 2KFGA 5FYXA 3BUWB 1M63B 1QLKA 1SR6C 1TUJA 1EG3A 1RFJA 2WC5A 4PHJA 2QPTA 2L4IA 2MLEC 4QJ4B 2NXQA 4E68A 3CLNA 1CLLA 1DVIA 3BUNB 1UWOA 4R1EA 4CFRA 1CLMA 5CSNA 4MEWA 1JWDA 1A75B 3A8RA 1QLSA 1IWQA 3PFVA 3VRPA 1KFUL 3BOWB 3CGAA 1UHNA 3EKJA 1M39A 2JXLA 4A4CA 1BOCA 3D77A 1XFVO 2LMUA 4MZJA 2PALA 5AFPA 4M2OA 2AUCA 4QJ3B 4AQJA 2K8MB 4WRIA 1CFCA 2QEOA 2BE6A 1NX0A 2EC6C 2JWWA 1NP8A 2KQYA 4KYNA 2I18A 1OOIX 2IS9A 1MUXA 2K7DA 1OE9B 2P71A 1DGUA 1MQ1A 1PSRA 2G2BA 2WC8A 3OB1B 1YUUA 3IVTA 4XJKA 1EH2A 3IF7A 5FI6A 1FPWA 4MSPA 1RWYA 3D73A 1S5GZ 4CIDA 2BKIB 3NSIA 4F0ZB 4YBHB 3DY9A 4HRGA 2H2KA 4ETOA 3GK1A 4JWQA 1P28A 5HLOA 1CLBA 1KFXS 1SR6B 1DELA 3LK0A 3B7AA 2M29A 1SL9A 3SG2A 3IQQA 5HKWA 1NPQA 2M3WA 2E6WA 1DGVA 2M97A 3TDIA 4INWA 2KDHA 1WDCB 3BUOB 1JF2A 1QIWA 4YGBB 5F6TA 3LK1A 1S36A 3DVKA 4P2YB 1DJXA 3CZ1A 3JVTB 3RZSA 1PRWA 3TUYB 4OV2A 1OSAA 3TS5B 1W9ZA 1SK6D 1ZUZA 2KYFA 4DCKA 1YRUB 2KAXA 2M8UA 5GQQC 1IGVA 1YX8A 1B7TZ 2ISDA 1IJ5A 2NCOA 2WCLA 1ZOTB 1K95A 1IG5A 2QDIA 3FS7A 3WHTB 3BQ3A 3CR2A 3FE9A 3N7HA 1WRKA 1OOGA 3L47A 2KLEA 2L51A 1TCFA 2TN4A 1V1FA 5PALA 2ZKMX 2FJUB 2M1KB 5ER5A 4FTGA 3SG6A 1B47A 4DIRA 5KU1A 4C0KA 1JSAA 4U8DA 3I5HC 3BOWA 3F45A 2LMTA 2JTTA 4PE1A 3D78A 5TNCA 5HL1A 1SCMB 5HKZA 1B8CA 2OS8B 4N5XA 1CFFA 1DJWA 1C7WA 1J55A 4L9MA 3FE6A 3DYEA 1KK8B 2F3ZA 1QATA 4YRUA 2OTGB 2LNKA 3VRQA 1AP4A 2LHLA 1KSOA 3PALA 1S1EA 3PSRA 1Y6WA 1NSHA 5FI2A 2WCHA 4MZKA 2MA2A 1FW4A 4D1EA 3CWGA 5KSZA 2JNXA 1KFUS 4P5OE 1H4BA 1CDMA 4GGNA 3B86A 4FQTA 1TRFA 2JXCA 1GQMA 1OOHA 2K2FA 3ICBA 1HQVA 1CMFA 1DJYA 1XYDA 2I94A 1CFDA 2KBIA 2O5GA 3EKHA 3O4YA 3PATA 3PN7C 3EK8A 3V2LA 2LUCA 2PSRA 1YTZC 1MXEA 4N1FA 2ZNDA 1AJ5A 3D0YB 1SPYA 5I8NA 1W7JB 4BY4A 3M0WA 2BL0C 2JQ6A 5K89A 3S0GA 3JTDB 3KPXA 2K7BA 2PQLA 4UPGA 2M1UA 2KGBC 2ZFDA 2JPOA 4ORBB 5D7FA 2GV5A 2PASA 1IRJA 2LCPA 4FQOA 3PJIA 1J7RA 2K7CA 3WXAA 1CKKA 1ZMZA 3DF0A 3DXLA 3KF9A 1LA0A 1CM4A 2WOSA 4MLWA 2WCFA 1U5IB 4YI8A 4GNKB 2H61A 3SJSA 3I5GB 5DICA 2D8NA 1S26D 2BCBA 2LMVA 2BAPA 2QEBA 3O2PA 1AK8A 4CPVA 4GGFA 2OPOA 2M7LA 2JTZA 2KI4C 2FJYA 2JT0A 2I7AA 4AQIA 2LP2A 3IQOA 1EXRA 2HQ8A 1T14A 3SG4A 1AVSA 1CB1A 2LVKA 1JUOA 1NCXA 2M9GA 3OX5A 4M2PA 4DUQA 2NZ0A 1UUSA 3PM8A 4GPLB 2KFHA 1BMOA 1N2DA 1ZACA 2I2RE 1BR4B 3PM2A 3EVRA 4BY5A 2JU0A 2JZIA 1XA5A 1SRAA 3O78A 3OB2B 3PN7B 3S0BA 4PCWA 3EG5B 3BFHA 2NLNA 3R72A 1JFKA 4CFQA 1FF1A 2BBMA 2L0PA 1TNPA 2O60A 2ERBA 2KAYA 4ICBA 1SL8A 2BL0B 1SMGA 1ORGA 2F2PA 1OMVA 4MRYA 2M7NA 3TZ1A 4HSZA 1BG1A 1A03A 5EL2A 2WORA 1SY9A 3GK4X 4M2QA 1K9KA 1RROA 2AMIA 1TCOB 1J7QA 3JVTC 1WDCC 1EL4A 1LXFC 2KAVA 1YX7A 2LAPA 2E30A 5JOLA 1DEKA 2QEVA 4NDCA 1DT7B 1Z4HA 2JT8A 3D10A 1XFRA 1G4YR 3BUXB 4YI9A 1KQVA 3CZTX 3L4LA 2HF5A 1X02A 1SCVA 3I5GC 4XJKB 2FOTA 1BT6A 1G8IA 1B4CA 1QVIY 5JJGA 5IBWA 5AANA 3R1OA 1B8LA 2BKHB 2GGZA 1IH0A 1DF0A 1RTP1 3NHTA 3SS4A 3MSEB 1CDLA 1RJVA 1XFUO 1MF8B 2HQWA 1YUTA 1LVCD 3AKBA 3SG7A 1LKJA 3LLEA 1QS7A 2WCBA 2MJWB 1YR5A 2WC6A 5CSJA 1A2XA 4NDBA 5FI7A 1SCMC 3NXAA 4HRHA 2OS8C 2JRFA 3BUMB 1EJ3A 1IJ6A 1YVLA 1KK8C 1Y1UA 2P70A 2LC5A 2KYCA 2MAZA 3CR4X 3E3RA 3Q8IA 3EK4A
chains in the Genus database with same CATH topology
1AUIB 4ZCVA 1J1EA 1KQMC 3I5FC 4WQ3A 1DMOA 1NX3A 2JPTA 1GJYA 4N1GA 1TOPA 5CPVA 3DVEA 1CM1A 2AAOA 3SG5A 1CFPA 2B1UA 2COLB 1SL7A 3BYAA 5D69A 1JC2A 1C07A 2WCEA 1UP5A 1R6PA 2Y5IA 2F2OA 2Y1NA 1YVHA 1L7ZA 1TIZA 5I2LA 1XFXO 1Y1AA 5DKQA 4C0JA 1OZOA 5I2QA 2KI6D 2LANA 2K7OA 5DKRA 1SKTA 3EVVA 3DVJA 1YRTB 2PRUA 4PE7A 2LE9B 1L2OC 2ZRSA 3OX6A 2FCEA 2LVJA 5CSFA 1QTXA 4JQ0D 4MRXA 1F8HA 3SIBA 3NSKA 2KOTA 4GUKA 1KWOC 1MWNA 2HPSA 2L50A 1S6CA 1FI5A 5DKNA 1K8UA 1K94A 1PK0D 1KK7Y 1MXLC 3CTNA 4YGAA 2R2IA 3ZNIA 1W7IB 2BECA 2ZN9A 1VRKA 4HREE 3TDZA 1Y1XA 1DJGA 1K93D 5HYDA 1PVAA 1NCYA 1NIWA 1V1GA 1ALVA 2BCAA 1K9PA 1OZSA 1KQMB 4PHMA 1M31A 1XK4C 1TNWA 4MZLA 2A4JA 1XFZO 2JOJA 3DVMA 2CNPA 2KI4B 1QV0A 2H61C 2HETA 2JC2A 3D0YA 3A4UB 2KQ6A 3FWCA 3LCPC 3I5IB 1HT9A 1C7VA 3KEVA 4I5KA 1OQPA 2KBMA 1YUSA 4QJ5B 1F70A 1LA3A 4OKHA 4MN0A 2ZNEA 4I5LB 4I5NB 1NYAA 1F55A 1B7TY 4PHNA 5HKYA 1K2HA 2LVVA 3GK2A 4MVFA 3BXKA 2L2EA 4DS7A 2KSPA 1PULA 1WLMA 3HCMA 1PSBA 3VRRA 1PALA 2LP3A 1ALWA 5B8IB 1KK7Z 1L2OB 2SCPA 1F54A 1DTLA 1BODA 1D1OA 2PVBA 3VGOA 1QX7A 2K2AA 1J7OA 1B1GA 1SYMA 1NUBA 2P6BB 2Y4QA 1H8BA 2DOQA 2ZRTA 2MRDA 4PHKA 1F71A 1S5GY 2BE4A 1EG4A 1GGWA 5ER4X 1M45A 1K9UA 3AAKA 2CTNA 3C1VA 1JFJA 1NX1A 1XK4A 1RK9A 2LLTA 2JT3A 4I5JA 4ORAB 3KO0A 3NSOA 2CXJA 4OVNF 1XO5A 5I2OA 2WNDA 2M0RA 5CSIA 2SASA 1S6JA 4AOMA 1RECA 1UHIA 2CBLA 5HLVA 1TTXA 1IQ3A 4USLA 3CR5X 1BR1B 3DF0B 1N65A 3RLZA 4CLNA 1CTRA 1A75A 5AEQA 3HX4A 1AJ4A 4C0LA 1UHHA 4ZCUA 1QASA 2F8PA 1QX5B 1UHKA 3I5FB 2MBXA 2K0JA 2QACA 3OHMB 3H4SE 1DF0B 1JF0A 1NCZA 2KNEA 1DJIA 1R2UA 1WRLA 3TDUA 1S6IA 1SNLA 5AXIA 2KGRA 1B8RA 4MBEA 2MHHA 1CDNA 1WY9A 3PLFB 4TNCA 1N0YA 2BCXA 2EC6B 2KHNA 1MHOA 2ZN8A 4PDZA 4PALA 2Q4UA 5AERA 1XVJA 1PVBA 2EHBA 2LLSA 3O6BA 1KFXL 4JPZB 3WHUB 1ODBA 1QVIZ 3AKAA 1DJHA 1NWDA 3FWBA 5KTYA 1MR8A 4A4BA 4ORCB 3SG3A 1F4OA 2LUXA 4NQGA 2L5XB 2LV7A 2RGIA 4PE0A 1J1DA 4OR9B 1KWOB 1YURA 1CDPA 1SBJA 3LL8B 2KFFA 1G33A 1Y0VH 3KHEA 1FBVA 3RM1A 5BPJA 3TUYC 1LINA 3TS5C 2JULA 2LVIA 4PE4A 4XYNA 2L98A 2MLFC 5J3XA 1K96A 3GOFA 1KCYA 1M46A 2CT9A 1OMDA 1F4QA 1TN4A 2F3YA 3AAJA 3NSLA 3FIAA 4NDDA 3I5IC 4YGCB 3EVUA 2L4HA 1TNQA 4GFTA 1TNXA 2VRGA 2G9BA 3DD4A 1QJTA 2F33A 1QXPA 3QRXA 1IKUA 3OP0A 2EGDA 1J7PA 1UURA 1U5IA 1JBAA 1WLZA 2CCMA 4YGDB 3I5HB 2GGMA 5G08A 2LHIA 4GAOA 4DRWA 1CNPA 1SW8A 2Q91A 1FI6A 2PMYA 1QV1A 3VRNA 1GGZA 1QIVA 4OCIA 4IL1A 3JTDC 4Q04A 1BJFA 1UHJA 3K21A 3CS1A 1B9AA 1S3PA 2JNFA 2OTGC 3EK7A 1OMRA 1KSMA 1OOJA 1Q80A 1AHRA 2M49B 4WQ2A 1CMGA 1DJZA 1QX2A 2BBNA 3SIAA 4YGEB 3WNXB 3ZWHA 3VROA 1NX2A 2K61A 1BF5A 2LM5A 2V53A 1IQ5A 2KI6C 1A4PA 1XFYO 2FCDA 1XFWO 1A29A 1E8AA 1ZFSA 2LLUA 2NCPA 4GBAA 2Y1MA 1BLQA 4GGFC 1BU3A 1WRZA 1K90D 2KFGA 5FYXA 3BUWB 1M63B 1QLKA 1SR6C 1EG3A 1RFJA 4PHJA 2QPTA 2L4IA 2MLEC 4QJ4B 2NXQA 4E68A 3CLNA 1CLLA 1DVIA 3BUNB 1UWOA 4R1EA 4CFRA 1CLMA 5CSNA 4MEWA 1JWDA 1A75B 3A8RA 1QLSA 1IWQA 3PFVA 3VRPA 1KFUL 3BOWB 3CGAA 1UHNA 3EKJA 1M39A 2JXLA 4A4CA 1BOCA 1XFVO 2LMUA 4MZJA 2PALA 5AFPA 4M2OA 2AUCA 4QJ3B 4AQJA 2K8MB 4WRIA 1CFCA 2BE6A 1NX0A 2EC6C 2JWWA 1NP8A 2KQYA 2I18A 2IS9A 1MUXA 2K7DA 1OE9B 1DGUA 1MQ1A 1PSRA 2G2BA 2WC8A 3OB1B 1YUUA 4XJKA 1EH2A 3IF7A 1FPWA 4MSPA 1RWYA 1S5GZ 4CIDA 2BKIB 3NSIA 4F0ZB 4YBHB 4HRGA 2H2KA 4ETOA 3GK1A 4JWQA 5HLOA 1CLBA 1KFXS 1SR6B 3LK0A 2M29A 1SL9A 3SG2A 3IQQA 5HKWA 1NPQA 2M3WA 2E6WA 1DGVA 2M97A 3TDIA 2KDHA 1WDCB 3BUOB 1JF2A 1QIWA 4YGBB 5F6TA 3LK1A 1S36A 3DVKA 4P2YB 1DJXA 3JVTB 1PRWA 3TUYB 4OV2A 1OSAA 3TS5B 1SK6D 1ZUZA 2KYFA 4DCKA 1YRUB 2KAXA 2M8UA 5GQQC 1IGVA 1YX8A 1B7TZ 2ISDA 1IJ5A 2NCOA 1ZOTB 1K95A 1IG5A 3FS7A 3WHTB 3BQ3A 3CR2A 1WRKA 2L51A 1TCFA 2TN4A 1V1FA 5PALA 2ZKMX 2FJUB 2M1KB 5ER5A 4FTGA 3SG6A 1B47A 4DIRA 5KU1A 4C0KA 1JSAA 4U8DA 3I5HC 3BOWA 3F45A 2LMTA 2JTTA 4PE1A 5TNCA 1SCMB 5HKZA 1B8CA 2OS8B 4N5XA 1CFFA 1DJWA 1C7WA 1J55A 4L9MA 1KK8B 2F3ZA 1QATA 4YRUA 2OTGB 2LNKA 3VRQA 1AP4A 2LHLA 1KSOA 3PALA 1S1EA 3PSRA 1Y6WA 1NSHA 4MZKA 2MA2A 1FW4A 4D1EA 3CWGA 5KSZA 2JNXA 1KFUS 4P5OE 1H4BA 1CDMA 4GGNA 1TRFA 2JXCA 1GQMA 2K2FA 1CMFA 3ICBA 1HQVA 1DJYA 1XYDA 2I94A 1CFDA 2KBIA 2O5GA 3EKHA 3O4YA 3PATA 3PN7C 3EK8A 2LUCA 2PSRA 1YTZC 1MXEA 4N1FA 2ZNDA 1AJ5A 3D0YB 1SPYA 5I8NA 1W7JB 4BY4A 3M0WA 2BL0C 2JQ6A 5K89A 3JTDB 3KPXA 2K7BA 4UPGA 2M1UA 2KGBC 2ZFDA 4ORBB 5D7FA 2GV5A 2PASA 1IRJA 2LCPA 4FQOA 1J7RA 2K7CA 3WXAA 1CKKA 1ZMZA 3DF0A 3KF9A 1LA0A 1CM4A 2WOSA 4MLWA 2WCFA 1U5IB 4YI8A 4GNKB 2H61A 3SJSA 3I5GB 2D8NA 1S26D 2BCBA 2LMVA 3O2PA 1AK8A 4CPVA 4GGFA 2OPOA 2M7LA 2JTZA 2KI4C 2JT0A 2I7AA 4AQIA 2LP2A 3IQOA 1EXRA 2HQ8A 3SG4A 1AVSA 1CB1A 2LVKA 1JUOA 1NCXA 2M9GA 3OX5A 4M2PA 4DUQA 2NZ0A 1UUSA 3PM8A 4GPLB 2KFHA 1BMOA 1N2DA 1ZACA 2I2RE 1BR4B 3EVRA 4BY5A 2JU0A 2JZIA 1XA5A 1SRAA 3O78A 3OB2B 3PN7B 4PCWA 2NLNA 1JFKA 4CFQA 1FF1A 2BBMA 2L0PA 1TNPA 2O60A 2KAYA 4ICBA 1SL8A 2BL0B 1SMGA 2F2PA 1OMVA 4MRYA 2M7NA 3TZ1A 4HSZA 1BG1A 1A03A 2WORA 1SY9A 3GK4X 4M2QA 1K9KA 1RROA 2AMIA 1TCOB 1J7QA 3JVTC 1WDCC 1EL4A 1LXFC 2KAVA 1YX7A 2LAPA 2E30A 5JOLA 4NDCA 1DT7B 2JT8A 3D10A 1G4YR 3BUXB 4YI9A 1KQVA 3CZTX 2HF5A 1X02A 1SCVA 3I5GC 4XJKB 2FOTA 1BT6A 1G8IA 1B4CA 1QVIY 5JJGA 5IBWA 5AANA 1B8LA 2BKHB 2GGZA 1IH0A 1DF0A 1RTP1 3MSEB 2HQWA 1CDLA 1RJVA 1MF8B 1XFUO 1YUTA 1LVCD 3AKBA 3SG7A 1LKJA 3LLEA 1QS7A 2WCBA 2MJWB 1YR5A 5CSJA 1A2XA 4NDBA 1SCMC 3NXAA 4HRHA 2OS8C 2JRFA 3BUMB 1EJ3A 1IJ6A 1YVLA 1KK8C 1Y1UA 2LC5A 2KYCA 2MAZA 3CR4X 3E3RA 3EK4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1AUI B;  4ZCV A;  1J1E A;  1KQM C;  3I5F C;  4WQ3 A;  1DMO A;  1NX3 A;  2JPT A;  1GJY A;  4N1G A;  1TOP A;  5CPV A;  3DVE A;  1CM1 A;  2AAO A;  3SG5 A;  1CFP A;  2B1U A;  2COL B;  1SL7 A;  3BYA A;  5D69 A;  1JC2 A;  1C07 A;  2WCE A;  1UP5 A;  1R6P A;  2Y5I A;  2F2O A;  2Y1N A;  1YVH A;  1L7Z A;  1TIZ A;  5I2L A;  1XFX O;  1Y1A A;  5DKQ A;  4C0J A;  1OZO A;  5I2Q A;  2KI6 D;  2LAN A;  2K7O A;  5DKR A;  1SKT A;  3EVV A;  3DVJ A;  1YRT B;  2PRU A;  4PE7 A;  2LE9 B;  1L2O C;  2ZRS A;  3OX6 A;  2FCE A;  2LVJ A;  5CSF A;  1QTX A;  4JQ0 D;  4MRX A;  1F8H A;  3SIB A;  3NSK A;  2KOT A;  4GUK A;  1KWO C;  1MWN A;  2HPS A;  2L50 A;  1S6C A;  1FI5 A;  5DKN A;  1K8U A;  1K94 A;  1PK0 D;  1KK7 Y;  1MXL C;  3CTN A;  4YGA A;  2R2I A;  3ZNI A;  1W7I B;  2BEC A;  2ZN9 A;  1VRK A;  4HRE E;  3TDZ A;  1Y1X A;  1DJG A;  1K93 D;  5HYD A;  1PVA A;  1NCY A;  1NIW A;  1V1G A;  1ALV A;  2BCA A;  1K9P A;  1OZS A;  1KQM B;  4PHM A;  1M31 A;  1XK4 C;  1TNW A;  4MZL A;  2A4J A;  1XFZ O;  2JOJ A;  3DVM A;  2CNP A;  2KI4 B;  1QV0 A;  2H61 C;  2HET A;  2JC2 A;  3D0Y A;  3A4U B;  2KQ6 A;  3FWC A;  3LCP C;  3I5I B;  1HT9 A;  1C7V A;  3KEV A;  4I5K A;  1OQP A;  2KBM A;  1YUS A;  4QJ5 B;  1F70 A;  1LA3 A;  4OKH A;  4MN0 A;  2ZNE A;  4I5L B;  4I5N B;  1NYA A;  1F55 A;  1B7T Y;  4PHN A;  5HKY A;  1K2H A;  2LVV A;  3GK2 A;  4MVF A;  3BXK A;  2L2E A;  4DS7 A;  2KSP A;  1PUL A;  1WLM A;  3HCM A;  1PSB A;  3VRR A;  1PAL A;  2LP3 A;  1ALW A;  5B8I B;  1KK7 Z;  1L2O B;  2SCP A;  1F54 A;  1DTL A;  1BOD A;  1D1O A;  2PVB A;  3VGO A;  1QX7 A;  2K2A A;  1J7O A;  1B1G A;  1SYM A;  1NUB A;  2P6B B;  2Y4Q A;  1H8B A;  2DOQ A;  2ZRT A;  2MRD A;  4PHK A;  1F71 A;  1S5G Y;  2BE4 A;  1EG4 A;  1GGW A;  5ER4 X;  1M45 A;  1K9U A;  3AAK A;  2CTN A;  3C1V A;  1JFJ A;  1NX1 A;  1XK4 A;  1RK9 A;  2LLT A;  2JT3 A;  4I5J A;  4ORA B;  3KO0 A;  3NSO A;  2CXJ A;  4OVN F;  1XO5 A;  5I2O A;  2WND A;  2M0R A;  5CSI A;  2SAS A;  1S6J A;  4AOM A;  1REC A;  1UHI A;  2CBL A;  5HLV A;  1TTX A;  1IQ3 A;  4USL A;  3CR5 X;  1BR1 B;  3DF0 B;  1N65 A;  3RLZ A;  4CLN A;  1CTR A;  1A75 A;  5AEQ A;  3HX4 A;  1AJ4 A;  4C0L A;  1UHH A;  4ZCU A;  1QAS A;  2F8P A;  1QX5 B;  1UHK A;  3I5F B;  2MBX A;  2K0J A;  2QAC A;  3OHM B;  3H4S E;  1DF0 B;  1JF0 A;  1NCZ A;  2KNE A;  1DJI A;  1R2U A;  1WRL A;  3TDU A;  1S6I A;  1SNL A;  5AXI A;  2KGR A;  1B8R A;  4MBE A;  2MHH A;  1CDN A;  1WY9 A;  3PLF B;  4TNC A;  1N0Y A;  2BCX A;  2EC6 B;  2KHN A;  1MHO A;  2ZN8 A;  4PDZ A;  4PAL A;  2Q4U A;  5AER A;  1XVJ A;  1PVB A;  2EHB A;  2LLS A;  3O6B A;  1KFX L;  4JPZ B;  3WHU B;  1ODB A;  1QVI Z;  3AKA A;  1DJH A;  1NWD A;  3FWB A;  5KTY A;  1MR8 A;  4A4B A;  4ORC B;  3SG3 A;  1F4O A;  2LUX A;  4NQG A;  2L5X B;  2LV7 A;  2RGI A;  4PE0 A;  1J1D A;  4OR9 B;  1KWO B;  1YUR A;  1CDP A;  1SBJ A;  3LL8 B;  2KFF A;  1G33 A;  1Y0V H;  3KHE A;  1FBV A;  3RM1 A;  5BPJ A;  3TUY C;  1LIN A;  3TS5 C;  2JUL A;  2LVI A;  4PE4 A;  4XYN A;  2L98 A;  2MLF C;  5J3X A;  1K96 A;  3GOF A;  1KCY A;  1M46 A;  2CT9 A;  1OMD A;  1F4Q A;  1TN4 A;  2F3Y A;  3AAJ A;  3NSL A;  3FIA A;  4NDD A;  3I5I C;  4YGC B;  3EVU A;  2L4H A;  1TNQ A;  4GFT A;  1TNX A;  2VRG A;  2G9B A;  3DD4 A;  1QJT A;  2F33 A;  1QXP A;  3QRX A;  1IKU A;  3OP0 A;  2EGD A;  1J7P A;  1UUR A;  1U5I A;  1JBA A;  1WLZ A;  2CCM A;  4YGD B;  3I5H B;  2GGM A;  5G08 A;  2LHI A;  4GAO A;  4DRW A;  1CNP A;  1SW8 A;  2Q91 A;  1FI6 A;  2PMY A;  1QV1 A;  3VRN A;  1GGZ A;  1QIV A;  4OCI A;  4IL1 A;  3JTD C;  4Q04 A;  1BJF A;  1UHJ A;  3K21 A;  3CS1 A;  1B9A A;  1S3P A;  2JNF A;  2OTG C;  3EK7 A;  1OMR A;  1KSM A;  1OOJ A;  1Q80 A;  1AHR A;  2M49 B;  4WQ2 A;  1CMG A;  1DJZ A;  1QX2 A;  2BBN A;  3SIA A;  4YGE B;  3WNX B;  3ZWH A;  3VRO A;  1NX2 A;  2K61 A;  1BF5 A;  2LM5 A;  2V53 A;  1IQ5 A;  2KI6 C;  1A4P A;  1XFY O;  2FCD A;  1XFW O;  1A29 A;  1E8A A;  1ZFS A;  2LLU A;  2NCP A;  4GBA A;  2Y1M A;  1BLQ A;  4GGF C;  1BU3 A;  1WRZ A;  1K90 D;  2KFG A;  5FYX A;  3BUW B;  1M63 B;  1QLK A;  1SR6 C;  1EG3 A;  1RFJ A;  4PHJ A;  2QPT A;  2L4I A;  2MLE C;  4QJ4 B;  2NXQ A;  4E68 A;  3CLN A;  1CLL A;  1DVI A;  3BUN B;  1UWO A;  4R1E A;  4CFR A;  1CLM A;  5CSN A;  4MEW A;  1JWD A;  1A75 B;  3A8R A;  1QLS A;  1IWQ A;  3PFV A;  3VRP A;  1KFU L;  3BOW B;  3CGA A;  1UHN A;  3EKJ A;  1M39 A;  2JXL A;  4A4C A;  1BOC A;  1XFV O;  2LMU A;  4MZJ A;  2PAL A;  5AFP A;  4M2O A;  2AUC A;  4QJ3 B;  4AQJ A;  2K8M B;  4WRI A;  1CFC A;  2BE6 A;  1NX0 A;  2EC6 C;  2JWW A;  1NP8 A;  2KQY A;  2I18 A;  2IS9 A;  1MUX A;  2K7D A;  1OE9 B;  1DGU A;  1MQ1 A;  1PSR A;  2G2B A;  2WC8 A;  3OB1 B;  1YUU A;  4XJK A;  1EH2 A;  3IF7 A;  1FPW A;  4MSP A;  1RWY A;  1S5G Z;  4CID A;  2BKI B;  3NSI A;  4F0Z B;  4YBH B;  4HRG A;  2H2K A;  4ETO A;  3GK1 A;  4JWQ A;  5HLO A;  1CLB A;  1KFX S;  1SR6 B;  3LK0 A;  2M29 A;  1SL9 A;  3SG2 A;  3IQQ A;  5HKW A;  1NPQ A;  2M3W A;  2E6W A;  1DGV A;  2M97 A;  3TDI A;  2KDH A;  1WDC B;  3BUO B;  1JF2 A;  1QIW A;  4YGB B;  5F6T A;  3LK1 A;  1S36 A;  3DVK A;  4P2Y B;  1DJX A;  3JVT B;  1PRW A;  3TUY B;  4OV2 A;  1OSA A;  3TS5 B;  1SK6 D;  1ZUZ A;  2KYF A;  4DCK A;  1YRU B;  2KAX A;  2M8U A;  5GQQ C;  1IGV A;  1YX8 A;  1B7T Z;  2ISD A;  1IJ5 A;  2NCO A;  1ZOT B;  1K95 A;  1IG5 A;  3FS7 A;  3WHT B;  3BQ3 A;  3CR2 A;  1WRK A;  2L51 A;  1TCF A;  2TN4 A;  1V1F A;  5PAL A;  2ZKM X;  2FJU B;  2M1K B;  5ER5 A;  4FTG A;  3SG6 A;  1B47 A;  4DIR A;  5KU1 A;  4C0K A;  1JSA A;  4U8D A;  3I5H C;  3BOW A;  3F45 A;  2LMT A;  2JTT A;  4PE1 A;  5TNC A;  1SCM B;  5HKZ A;  1B8C A;  2OS8 B;  4N5X A;  1CFF A;  1DJW A;  1C7W A;  1J55 A;  4L9M A;  1KK8 B;  2F3Z A;  1QAT A;  4YRU A;  2OTG B;  2LNK A;  3VRQ A;  1AP4 A;  2LHL A;  1KSO A;  3PAL A;  1S1E A;  3PSR A;  1Y6W A;  1NSH A;  4MZK A;  2MA2 A;  1FW4 A;  4D1E A;  3CWG A;  5KSZ A;  2JNX A;  1KFU S;  4P5O E;  1H4B A;  1CDM A;  4GGN A;  1TRF A;  2JXC A;  1GQM A;  2K2F A;  1CMF A;  3ICB A;  1HQV A;  1DJY A;  1XYD A;  2I94 A;  1CFD A;  2KBI A;  2O5G A;  3EKH A;  3O4Y A;  3PAT A;  3PN7 C;  3EK8 A;  2LUC A;  2PSR A;  1YTZ C;  1MXE A;  4N1F A;  2ZND A;  1AJ5 A;  3D0Y B;  1SPY A;  5I8N A;  1W7J B;  4BY4 A;  3M0W A;  2BL0 C;  2JQ6 A;  5K89 A;  3JTD B;  3KPX A;  2K7B A;  4UPG A;  2M1U A;  2KGB C;  2ZFD A;  4ORB B;  5D7F A;  2GV5 A;  2PAS A;  1IRJ A;  2LCP A;  4FQO A;  1J7R A;  2K7C A;  3WXA A;  1CKK A;  1ZMZ A;  3DF0 A;  3KF9 A;  1LA0 A;  1CM4 A;  2WOS A;  4MLW A;  2WCF A;  1U5I B;  4YI8 A;  4GNK B;  2H61 A;  3SJS A;  3I5G B;  2D8N A;  1S26 D;  2BCB A;  2LMV A;  3O2P A;  1AK8 A;  4CPV A;  4GGF A;  2OPO A;  2M7L A;  2JTZ A;  2KI4 C;  2JT0 A;  2I7A A;  4AQI A;  2LP2 A;  3IQO A;  1EXR A;  2HQ8 A;  3SG4 A;  1AVS A;  1CB1 A;  2LVK A;  1JUO A;  1NCX A;  2M9G A;  3OX5 A;  4M2P A;  4DUQ A;  2NZ0 A;  1UUS A;  3PM8 A;  4GPL B;  2KFH A;  1BMO A;  1N2D A;  1ZAC A;  2I2R E;  1BR4 B;  3EVR A;  4BY5 A;  2JU0 A;  2JZI A;  1XA5 A;  1SRA A;  3O78 A;  3OB2 B;  3PN7 B;  4PCW A;  2NLN A;  1JFK A;  4CFQ A;  1FF1 A;  2BBM A;  2L0P A;  1TNP A;  2O60 A;  2KAY A;  4ICB A;  1SL8 A;  2BL0 B;  1SMG A;  2F2P A;  1OMV A;  4MRY A;  2M7N A;  3TZ1 A;  4HSZ A;  1BG1 A;  1A03 A;  2WOR A;  1SY9 A;  3GK4 X;  4M2Q A;  1K9K A;  1RRO A;  2AMI A;  1TCO B;  1J7Q A;  3JVT C;  1WDC C;  1EL4 A;  1LXF C;  2KAV A;  1YX7 A;  2LAP A;  2E30 A;  5JOL A;  4NDC A;  1DT7 B;  2JT8 A;  3D10 A;  1G4Y R;  3BUX B;  4YI9 A;  1KQV A;  3CZT X;  2HF5 A;  1X02 A;  1SCV A;  3I5G C;  4XJK B;  2FOT A;  1BT6 A;  1G8I A;  1B4C A;  1QVI Y;  5JJG A;  5IBW A;  5AAN A;  1B8L A;  2BKH B;  2GGZ A;  1IH0 A;  1DF0 A;  1RTP 1;  3MSE B;  2HQW A;  1CDL A;  1RJV A;  1MF8 B;  1XFU O;  1YUT A;  1LVC D;  3AKB A;  3SG7 A;  1LKJ A;  3LLE A;  1QS7 A;  2WCB A;  2MJW B;  1YR5 A;  5CSJ A;  1A2X A;  4NDB A;  1SCM C;  3NXA A;  4HRH A;  2OS8 C;  2JRF A;  3BUM B;  1EJ3 A;  1IJ6 A;  1YVL A;  1KK8 C;  1Y1U A;  2LC5 A;  2KYC A;  2MAZ A;  3CR4 X;  3E3R A;  3EK4 A; 
#chains in the Genus database with same CATH topology
 1AUI B;  4ZCV A;  1J1E A;  1KQM C;  3VB1 A;  3I5F C;  4WQ3 A;  1DMO A;  1NX3 A;  2JPT A;  3D75 A;  1GJY A;  4N1G A;  1TOP A;  5CPV A;  3DVE A;  1CM1 A;  2AAO A;  3SG5 A;  1TUZ A;  2B1U A;  2COL B;  1CFP A;  1C3Z A;  1SL7 A;  3BYA A;  3OGN A;  5D69 A;  1JC2 A;  1C07 A;  2WCE A;  3CZ0 A;  3FE8 A;  1UP5 A;  1R6P A;  2Y5I A;  2F2O A;  2H8V A;  2Y1N A;  1YVH A;  1L7Z A;  1TIZ A;  3CYZ A;  5I2L A;  1XFX O;  1Y1A A;  5DKQ A;  4C0J A;  1OZO A;  5I2Q A;  2KLD A;  2KI6 D;  2LAN A;  2K7O A;  5DKR A;  2L5Y A;  3R1P A;  1SKT A;  3EVV A;  1QWV A;  1YRT B;  2PRU A;  1SSE B;  2LE9 B;  3DVJ A;  3L4A A;  1L2O C;  2ZRS A;  4PE7 A;  3OX6 A;  2FCE A;  2LVJ A;  5CSF A;  3B88 A;  1QTX A;  4JQ0 D;  4MRX A;  1OW4 A;  1F8H A;  3SIB A;  3NSK A;  2KOT A;  4GUK A;  1KWO C;  1IIO A;  1MWN A;  2HPS A;  2L50 A;  1S6C A;  1FI5 A;  5DKN A;  1K8U A;  1K94 A;  1PK0 D;  1KK7 Y;  1MXL C;  3CTN A;  4YGA A;  2R2I A;  3ZNI A;  1W7I B;  2BEC A;  2ZN9 A;  1VRK A;  4HRE E;  3TDZ A;  1Y1X A;  1DJG A;  1K93 D;  5HYD A;  1PVA A;  1NCY A;  1NIW A;  1V1G A;  1ALV A;  2BCA A;  1K9P A;  1OZS A;  1KQM B;  4PHM A;  1M31 A;  1XK4 C;  1TNW A;  4MZL A;  2A4J A;  1XFZ O;  2JOJ A;  3DVM A;  2CNP A;  2KI4 B;  1QV0 A;  2H61 C;  2HET A;  2JC2 A;  3D0Y A;  3A4U B;  2KQ6 A;  3FWC A;  3LCP C;  3UO9 A;  3I5I B;  1HT9 A;  2BNX A;  1C7V A;  3KEV A;  4I5K A;  1OQP A;  2KBM A;  2KPH A;  1YUS A;  3D74 A;  4QJ5 B;  1F70 A;  1LA3 A;  4OKH A;  4MN0 A;  2ZNE A;  4I5L B;  4I5N B;  1NYA A;  3SS5 A;  1B7T Y;  4PHN A;  5HKY A;  1DC1 A;  1F55 A;  3CAB A;  1K2H A;  2LVV A;  3GK2 A;  4MVF A;  3BXK A;  2L2E A;  4DS7 A;  2KSP A;  1PUL A;  1WLM A;  3HCM A;  1PSB A;  3VRR A;  1PAL A;  2LP3 A;  1ALW A;  5B8I B;  1KK7 Z;  1L2O B;  1C3Y A;  2SCP A;  1OOF A;  1F54 A;  1GM0 A;  1DTL A;  3UNW A;  1BOD A;  1D1O A;  2PVB A;  3VGO A;  1QX7 A;  2K2A A;  1J7O A;  3B6X A;  1B1G A;  1SYM A;  1NUB A;  2P6B B;  2Y4Q A;  1H8B A;  2DOQ A;  2ZRT A;  2MRD A;  4PHK A;  1F71 A;  1S5G Y;  2BE4 A;  3S0F A;  1EG4 A;  1GGW A;  5ER4 X;  2L2C A;  1M45 A;  1K9U A;  3AAK A;  2CTN A;  3QME A;  3C1V A;  1JFJ A;  1NX1 A;  5I94 A;  1XK4 A;  3NHI A;  4IJ7 A;  1RK9 A;  2LLT A;  2JT3 A;  2K60 A;  3D76 A;  4I5J A;  4ORA B;  3S0A A;  3O4X A;  3KO0 A;  3NSO A;  2CXJ A;  4OVN F;  1XO5 A;  4JD9 A;  5I2O A;  2WND A;  2M0R A;  5CSI A;  2SAS A;  1S6J A;  4AOM A;  1REC A;  1UHI A;  2CBL A;  5HLV A;  1TTX A;  1IQ3 A;  4USL A;  3CR5 X;  1BR1 B;  3DF0 B;  1N65 A;  3RLZ A;  4CLN A;  1CTR A;  1A75 A;  5AEQ A;  3HX4 A;  1AJ4 A;  4C0L A;  1UHH A;  4INX A;  1QAS A;  2F8P A;  4ZCU A;  1QX5 B;  1UHK A;  3I5F B;  2MBX A;  2K0J A;  2QAC A;  3NGV A;  3OHM B;  3H4S E;  1DF0 B;  2PYQ A;  1JF0 A;  1NCZ A;  2KNE A;  3DZT A;  1DJI A;  1R2U A;  1WRL A;  3TDU A;  1LS8 A;  1S6I A;  1SNL A;  5AXI A;  2KGR A;  1B8R A;  4MBE A;  2MHH A;  1CDN A;  1WY9 A;  3PLF B;  2WCK A;  4TNC A;  1N0Y A;  2BCX A;  2EC6 B;  2KHN A;  3S0D A;  1MHO A;  2ZN8 A;  4PDZ A;  4PAL A;  2Q4U A;  5AER A;  1XVJ A;  1PVB A;  2EHB A;  2LLS A;  3O6B A;  1KFX L;  4JPZ B;  3WHU B;  1ODB A;  1QVI Z;  3AKA A;  1DJH A;  1NWD A;  4JKT A;  3FWB A;  3R1V A;  5KTY A;  1MR8 A;  4A4B A;  4ORC B;  3SG3 A;  1F4O A;  2LUX A;  4NQG A;  2L5X B;  2LV7 A;  2RGI A;  4PE0 A;  1J1D A;  4OR9 B;  1KWO B;  1YUR A;  4F7F A;  1CDP A;  3BJH A;  2WCM A;  1SBJ A;  3LL8 B;  2KFF A;  1Z2C B;  1G33 A;  1Y0V H;  3KHE A;  1FBV A;  3RM1 A;  5BPJ A;  3TUY C;  1LIN A;  3TS5 C;  2JUL A;  2LVI A;  4PE4 A;  4XYN A;  3S0E A;  2L98 A;  2MLF C;  5J3X A;  1K96 A;  3GOF A;  3B87 A;  1KCY A;  1M46 A;  2CT9 A;  1OMD A;  1F4Q A;  1TN4 A;  2F3Y A;  3AAJ A;  3NSL A;  3FIA A;  4NDD A;  1DQE A;  3I5I C;  4YGC B;  3EVU A;  2GTE A;  2L4H A;  1TNQ A;  4GFT A;  1TNX A;  2VRG A;  2G9B A;  3DD4 A;  1QJT A;  2F33 A;  1QXP A;  3QRX A;  1IKU A;  3OP0 A;  2EGD A;  1J7P A;  1UUR A;  1U5I A;  1JBA A;  1WLZ A;  2CCM A;  4YGD B;  3I5H B;  2GGM A;  5G08 A;  2LHI A;  4GAO A;  4DRW A;  1CNP A;  1SW8 A;  2Q91 A;  1FI6 A;  2PMY A;  3BFA A;  1QV1 A;  3SS3 A;  3VRN A;  1GGZ A;  1QIV A;  4OCI A;  4OZD A;  4IL1 A;  3JTD C;  2QEH A;  4Q04 A;  1BJF A;  1UHJ A;  3K21 A;  3CS1 A;  1B9A A;  1S3P A;  2YGU A;  2JNF A;  2OTG C;  3EK7 A;  1OMR A;  1KSM A;  1OOJ A;  3CZ2 A;  3CDN A;  2WCJ A;  1Q80 A;  1AHR A;  2M49 B;  1TWO A;  4WQ2 A;  1DJZ A;  1QX2 A;  2BBN A;  1CMG A;  3SIA A;  4YGE B;  3WNX B;  3ZWH A;  3VRO A;  1NX2 A;  3BFB A;  4PT1 A;  2K61 A;  1BF5 A;  2LM5 A;  2V53 A;  3K1E A;  1IQ5 A;  3OBV A;  5D3O A;  2KI6 C;  1A4P A;  1XFY O;  2FCD A;  1XFW O;  1A29 A;  1E8A A;  1ZFS A;  2LLU A;  2NCP A;  4GBA A;  2Y1M A;  1BLQ A;  4GGF C;  1BU3 A;  1WRZ A;  1K90 D;  2KFG A;  5FYX A;  3BUW B;  1M63 B;  1QLK A;  1SR6 C;  1TUJ A;  1EG3 A;  1RFJ A;  2WC5 A;  4PHJ A;  2QPT A;  2L4I A;  2MLE C;  4QJ4 B;  2NXQ A;  4E68 A;  3CLN A;  1CLL A;  1DVI A;  3BUN B;  1UWO A;  4R1E A;  4CFR A;  1CLM A;  5CSN A;  4MEW A;  1JWD A;  1A75 B;  3A8R A;  1QLS A;  1IWQ A;  3PFV A;  3VRP A;  1KFU L;  3BOW B;  3CGA A;  1UHN A;  3EKJ A;  1M39 A;  2JXL A;  4A4C A;  1BOC A;  3D77 A;  1XFV O;  2LMU A;  4MZJ A;  2PAL A;  5AFP A;  4M2O A;  2AUC A;  4QJ3 B;  4AQJ A;  2K8M B;  4WRI A;  1CFC A;  2QEO A;  2BE6 A;  1NX0 A;  2EC6 C;  2JWW A;  1NP8 A;  2KQY A;  4KYN A;  2I18 A;  1OOI X;  2IS9 A;  1MUX A;  2K7D A;  1OE9 B;  2P71 A;  1DGU A;  1MQ1 A;  1PSR A;  2G2B A;  2WC8 A;  3OB1 B;  1YUU A;  3IVT A;  4XJK A;  1EH2 A;  3IF7 A;  5FI6 A;  1FPW A;  4MSP A;  1RWY A;  3D73 A;  1S5G Z;  4CID A;  2BKI B;  3NSI A;  4F0Z B;  4YBH B;  3DY9 A;  4HRG A;  2H2K A;  4ETO A;  3GK1 A;  4JWQ A;  1P28 A;  5HLO A;  1CLB A;  1KFX S;  1SR6 B;  1DEL A;  3LK0 A;  3B7A A;  2M29 A;  1SL9 A;  3SG2 A;  3IQQ A;  5HKW A;  1NPQ A;  2M3W A;  2E6W A;  1DGV A;  2M97 A;  3TDI A;  4INW A;  2KDH A;  1WDC B;  3BUO B;  1JF2 A;  1QIW A;  4YGB B;  5F6T A;  3LK1 A;  1S36 A;  3DVK A;  4P2Y B;  1DJX A;  3CZ1 A;  3JVT B;  3RZS A;  1PRW A;  3TUY B;  4OV2 A;  1OSA A;  3TS5 B;  1W9Z A;  1SK6 D;  1ZUZ A;  2KYF A;  4DCK A;  1YRU B;  2KAX A;  2M8U A;  5GQQ C;  1IGV A;  1YX8 A;  1B7T Z;  2ISD A;  1IJ5 A;  2NCO A;  2WCL A;  1ZOT B;  1K95 A;  1IG5 A;  2QDI A;  3FS7 A;  3WHT B;  3BQ3 A;  3CR2 A;  3FE9 A;  3N7H A;  1WRK A;  1OOG A;  3L47 A;  2KLE A;  2L51 A;  1TCF A;  2TN4 A;  1V1F A;  5PAL A;  2ZKM X;  2FJU B;  2M1K B;  5ER5 A;  4FTG A;  3SG6 A;  1B47 A;  4DIR A;  5KU1 A;  4C0K A;  1JSA A;  4U8D A;  3I5H C;  3BOW A;  3F45 A;  2LMT A;  2JTT A;  4PE1 A;  3D78 A;  5TNC A;  5HL1 A;  1SCM B;  5HKZ A;  1B8C A;  2OS8 B;  4N5X A;  1CFF A;  1DJW A;  1C7W A;  1J55 A;  4L9M A;  3FE6 A;  3DYE A;  1KK8 B;  2F3Z A;  1QAT A;  4YRU A;  2OTG B;  2LNK A;  3VRQ A;  1AP4 A;  2LHL A;  1KSO A;  3PAL A;  1S1E A;  3PSR A;  1Y6W A;  1NSH A;  5FI2 A;  2WCH A;  4MZK A;  2MA2 A;  1FW4 A;  4D1E A;  3CWG A;  5KSZ A;  2JNX A;  1KFU S;  4P5O E;  1H4B A;  1CDM A;  4GGN A;  3B86 A;  4FQT A;  1TRF A;  2JXC A;  1GQM A;  1OOH A;  2K2F A;  3ICB A;  1HQV A;  1CMF A;  1DJY A;  1XYD A;  2I94 A;  1CFD A;  2KBI A;  2O5G A;  3EKH A;  3O4Y A;  3PAT A;  3PN7 C;  3EK8 A;  3V2L A;  2LUC A;  2PSR A;  1YTZ C;  1MXE A;  4N1F A;  2ZND A;  1AJ5 A;  3D0Y B;  1SPY A;  5I8N A;  1W7J B;  4BY4 A;  3M0W A;  2BL0 C;  2JQ6 A;  5K89 A;  3S0G A;  3JTD B;  3KPX A;  2K7B A;  2PQL A;  4UPG A;  2M1U A;  2KGB C;  2ZFD A;  2JPO A;  4ORB B;  5D7F A;  2GV5 A;  2PAS A;  1IRJ A;  2LCP A;  4FQO A;  3PJI A;  1J7R A;  2K7C A;  3WXA A;  1CKK A;  1ZMZ A;  3DF0 A;  3DXL A;  3KF9 A;  1LA0 A;  1CM4 A;  2WOS A;  4MLW A;  2WCF A;  1U5I B;  4YI8 A;  4GNK B;  2H61 A;  3SJS A;  3I5G B;  5DIC A;  2D8N A;  1S26 D;  2BCB A;  2LMV A;  2BAP A;  2QEB A;  3O2P A;  1AK8 A;  4CPV A;  4GGF A;  2OPO A;  2M7L A;  2JTZ A;  2KI4 C;  2FJY A;  2JT0 A;  2I7A A;  4AQI A;  2LP2 A;  3IQO A;  1EXR A;  2HQ8 A;  1T14 A;  3SG4 A;  1AVS A;  1CB1 A;  2LVK A;  1JUO A;  1NCX A;  2M9G A;  3OX5 A;  4M2P A;  4DUQ A;  2NZ0 A;  1UUS A;  3PM8 A;  4GPL B;  2KFH A;  1BMO A;  1N2D A;  1ZAC A;  2I2R E;  1BR4 B;  3PM2 A;  3EVR A;  4BY5 A;  2JU0 A;  2JZI A;  1XA5 A;  1SRA A;  3O78 A;  3OB2 B;  3PN7 B;  3S0B A;  4PCW A;  3EG5 B;  3BFH A;  2NLN A;  3R72 A;  1JFK A;  4CFQ A;  1FF1 A;  2BBM A;  2L0P A;  1TNP A;  2O60 A;  2ERB A;  2KAY A;  4ICB A;  1SL8 A;  2BL0 B;  1SMG A;  1ORG A;  2F2P A;  1OMV A;  4MRY A;  2M7N A;  3TZ1 A;  4HSZ A;  1BG1 A;  1A03 A;  5EL2 A;  2WOR A;  1SY9 A;  3GK4 X;  4M2Q A;  1K9K A;  1RRO A;  2AMI A;  1TCO B;  1J7Q A;  3JVT C;  1WDC C;  1EL4 A;  1LXF C;  2KAV A;  1YX7 A;  2LAP A;  2E30 A;  5JOL A;  1DEK A;  2QEV A;  4NDC A;  1DT7 B;  1Z4H A;  2JT8 A;  3D10 A;  1XFR A;  1G4Y R;  3BUX B;  4YI9 A;  1KQV A;  3CZT X;  3L4L A;  2HF5 A;  1X02 A;  1SCV A;  3I5G C;  4XJK B;  2FOT A;  1BT6 A;  1G8I A;  1B4C A;  1QVI Y;  5JJG A;  5IBW A;  5AAN A;  3R1O A;  1B8L A;  2BKH B;  2GGZ A;  1IH0 A;  1DF0 A;  1RTP 1;  3NHT A;  3SS4 A;  3MSE B;  1CDL A;  1RJV A;  1XFU O;  1MF8 B;  2HQW A;  1YUT A;  1LVC D;  3AKB A;  3SG7 A;  1LKJ A;  3LLE A;  1QS7 A;  2WCB A;  2MJW B;  1YR5 A;  2WC6 A;  5CSJ A;  1A2X A;  4NDB A;  5FI7 A;  1SCM C;  3NXA A;  4HRH A;  2OS8 C;  2JRF A;  3BUM B;  1EJ3 A;  1IJ6 A;  1YVL A;  1KK8 C;  1Y1U A;  2P70 A;  2LC5 A;  2KYC A;  2MAZ A;  3CR4 X;  3E3R A;  3Q8I A;  3EK4 A; 
#chains in the Genus database with same CATH homology
 1AUI B;  4ZCV A;  1J1E A;  1KQM C;  3I5F C;  4WQ3 A;  1DMO A;  1NX3 A;  2JPT A;  1GJY A;  4N1G A;  1TOP A;  5CPV A;  3DVE A;  1CM1 A;  2AAO A;  3SG5 A;  1CFP A;  2B1U A;  2COL B;  1SL7 A;  3BYA A;  5D69 A;  1JC2 A;  1C07 A;  2WCE A;  1UP5 A;  1R6P A;  2Y5I A;  2F2O A;  2Y1N A;  1YVH A;  1L7Z A;  1TIZ A;  5I2L A;  1XFX O;  1Y1A A;  5DKQ A;  4C0J A;  1OZO A;  5I2Q A;  2KI6 D;  2LAN A;  2K7O A;  5DKR A;  1SKT A;  3EVV A;  3DVJ A;  1YRT B;  2PRU A;  4PE7 A;  2LE9 B;  1L2O C;  2ZRS A;  3OX6 A;  2FCE A;  2LVJ A;  5CSF A;  1QTX A;  4JQ0 D;  4MRX A;  1F8H A;  3SIB A;  3NSK A;  2KOT A;  4GUK A;  1KWO C;  1MWN A;  2HPS A;  2L50 A;  1S6C A;  1FI5 A;  5DKN A;  1K8U A;  1K94 A;  1PK0 D;  1KK7 Y;  1MXL C;  3CTN A;  4YGA A;  2R2I A;  3ZNI A;  1W7I B;  2BEC A;  2ZN9 A;  1VRK A;  4HRE E;  3TDZ A;  1Y1X A;  1DJG A;  1K93 D;  5HYD A;  1PVA A;  1NCY A;  1NIW A;  1V1G A;  1ALV A;  2BCA A;  1K9P A;  1OZS A;  1KQM B;  4PHM A;  1M31 A;  1XK4 C;  1TNW A;  4MZL A;  2A4J A;  1XFZ O;  2JOJ A;  3DVM A;  2CNP A;  2KI4 B;  1QV0 A;  2H61 C;  2HET A;  2JC2 A;  3D0Y A;  3A4U B;  2KQ6 A;  3FWC A;  3LCP C;  3I5I B;  1HT9 A;  1C7V A;  3KEV A;  4I5K A;  1OQP A;  2KBM A;  1YUS A;  4QJ5 B;  1F70 A;  1LA3 A;  4OKH A;  4MN0 A;  2ZNE A;  4I5L B;  4I5N B;  1NYA A;  1F55 A;  1B7T Y;  4PHN A;  5HKY A;  1K2H A;  2LVV A;  3GK2 A;  4MVF A;  3BXK A;  2L2E A;  4DS7 A;  2KSP A;  1PUL A;  1WLM A;  3HCM A;  1PSB A;  3VRR A;  1PAL A;  2LP3 A;  1ALW A;  5B8I B;  1KK7 Z;  1L2O B;  2SCP A;  1F54 A;  1DTL A;  1BOD A;  1D1O A;  2PVB A;  3VGO A;  1QX7 A;  2K2A A;  1J7O A;  1B1G A;  1SYM A;  1NUB A;  2P6B B;  2Y4Q A;  1H8B A;  2DOQ A;  2ZRT A;  2MRD A;  4PHK A;  1F71 A;  1S5G Y;  2BE4 A;  1EG4 A;  1GGW A;  5ER4 X;  1M45 A;  1K9U A;  3AAK A;  2CTN A;  3C1V A;  1JFJ A;  1NX1 A;  1XK4 A;  1RK9 A;  2LLT A;  2JT3 A;  4I5J A;  4ORA B;  3KO0 A;  3NSO A;  2CXJ A;  4OVN F;  1XO5 A;  5I2O A;  2WND A;  2M0R A;  5CSI A;  2SAS A;  1S6J A;  4AOM A;  1REC A;  1UHI A;  2CBL A;  5HLV A;  1TTX A;  1IQ3 A;  4USL A;  3CR5 X;  1BR1 B;  3DF0 B;  1N65 A;  3RLZ A;  4CLN A;  1CTR A;  1A75 A;  5AEQ A;  3HX4 A;  1AJ4 A;  4C0L A;  1UHH A;  4ZCU A;  1QAS A;  2F8P A;  1QX5 B;  1UHK A;  3I5F B;  2MBX A;  2K0J A;  2QAC A;  3OHM B;  3H4S E;  1DF0 B;  1JF0 A;  1NCZ A;  2KNE A;  1DJI A;  1R2U A;  1WRL A;  3TDU A;  1S6I A;  1SNL A;  5AXI A;  2KGR A;  1B8R A;  4MBE A;  2MHH A;  1CDN A;  1WY9 A;  3PLF B;  4TNC A;  1N0Y A;  2BCX A;  2EC6 B;  2KHN A;  1MHO A;  2ZN8 A;  4PDZ A;  4PAL A;  2Q4U A;  5AER A;  1XVJ A;  1PVB A;  2EHB A;  2LLS A;  3O6B A;  1KFX L;  4JPZ B;  3WHU B;  1ODB A;  1QVI Z;  3AKA A;  1DJH A;  1NWD A;  3FWB A;  5KTY A;  1MR8 A;  4A4B A;  4ORC B;  3SG3 A;  1F4O A;  2LUX A;  4NQG A;  2L5X B;  2LV7 A;  2RGI A;  4PE0 A;  1J1D A;  4OR9 B;  1KWO B;  1YUR A;  1CDP A;  1SBJ A;  3LL8 B;  2KFF A;  1G33 A;  1Y0V H;  3KHE A;  1FBV A;  3RM1 A;  5BPJ A;  3TUY C;  1LIN A;  3TS5 C;  2JUL A;  2LVI A;  4PE4 A;  4XYN A;  2L98 A;  2MLF C;  5J3X A;  1K96 A;  3GOF A;  1KCY A;  1M46 A;  2CT9 A;  1OMD A;  1F4Q A;  1TN4 A;  2F3Y A;  3AAJ A;  3NSL A;  3FIA A;  4NDD A;  3I5I C;  4YGC B;  3EVU A;  2L4H A;  1TNQ A;  4GFT A;  1TNX A;  2VRG A;  2G9B A;  3DD4 A;  1QJT A;  2F33 A;  1QXP A;  3QRX A;  1IKU A;  3OP0 A;  2EGD A;  1J7P A;  1UUR A;  1U5I A;  1JBA A;  1WLZ A;  2CCM A;  4YGD B;  3I5H B;  2GGM A;  5G08 A;  2LHI A;  4GAO A;  4DRW A;  1CNP A;  1SW8 A;  2Q91 A;  1FI6 A;  2PMY A;  1QV1 A;  3VRN A;  1GGZ A;  1QIV A;  4OCI A;  4IL1 A;  3JTD C;  4Q04 A;  1BJF A;  1UHJ A;  3K21 A;  3CS1 A;  1B9A A;  1S3P A;  2JNF A;  2OTG C;  3EK7 A;  1OMR A;  1KSM A;  1OOJ A;  1Q80 A;  1AHR A;  2M49 B;  4WQ2 A;  1CMG A;  1DJZ A;  1QX2 A;  2BBN A;  3SIA A;  4YGE B;  3WNX B;  3ZWH A;  3VRO A;  1NX2 A;  2K61 A;  1BF5 A;  2LM5 A;  2V53 A;  1IQ5 A;  2KI6 C;  1A4P A;  1XFY O;  2FCD A;  1XFW O;  1A29 A;  1E8A A;  1ZFS A;  2LLU A;  2NCP A;  4GBA A;  2Y1M A;  1BLQ A;  4GGF C;  1BU3 A;  1WRZ A;  1K90 D;  2KFG A;  5FYX A;  3BUW B;  1M63 B;  1QLK A;  1SR6 C;  1EG3 A;  1RFJ A;  4PHJ A;  2QPT A;  2L4I A;  2MLE C;  4QJ4 B;  2NXQ A;  4E68 A;  3CLN A;  1CLL A;  1DVI A;  3BUN B;  1UWO A;  4R1E A;  4CFR A;  1CLM A;  5CSN A;  4MEW A;  1JWD A;  1A75 B;  3A8R A;  1QLS A;  1IWQ A;  3PFV A;  3VRP A;  1KFU L;  3BOW B;  3CGA A;  1UHN A;  3EKJ A;  1M39 A;  2JXL A;  4A4C A;  1BOC A;  1XFV O;  2LMU A;  4MZJ A;  2PAL A;  5AFP A;  4M2O A;  2AUC A;  4QJ3 B;  4AQJ A;  2K8M B;  4WRI A;  1CFC A;  2BE6 A;  1NX0 A;  2EC6 C;  2JWW A;  1NP8 A;  2KQY A;  2I18 A;  2IS9 A;  1MUX A;  2K7D A;  1OE9 B;  1DGU A;  1MQ1 A;  1PSR A;  2G2B A;  2WC8 A;  3OB1 B;  1YUU A;  4XJK A;  1EH2 A;  3IF7 A;  1FPW A;  4MSP A;  1RWY A;  1S5G Z;  4CID A;  2BKI B;  3NSI A;  4F0Z B;  4YBH B;  4HRG A;  2H2K A;  4ETO A;  3GK1 A;  4JWQ A;  5HLO A;  1CLB A;  1KFX S;  1SR6 B;  3LK0 A;  2M29 A;  1SL9 A;  3SG2 A;  3IQQ A;  5HKW A;  1NPQ A;  2M3W A;  2E6W A;  1DGV A;  2M97 A;  3TDI A;  2KDH A;  1WDC B;  3BUO B;  1JF2 A;  1QIW A;  4YGB B;  5F6T A;  3LK1 A;  1S36 A;  3DVK A;  4P2Y B;  1DJX A;  3JVT B;  1PRW A;  3TUY B;  4OV2 A;  1OSA A;  3TS5 B;  1SK6 D;  1ZUZ A;  2KYF A;  4DCK A;  1YRU B;  2KAX A;  2M8U A;  5GQQ C;  1IGV A;  1YX8 A;  1B7T Z;  2ISD A;  1IJ5 A;  2NCO A;  1ZOT B;  1K95 A;  1IG5 A;  3FS7 A;  3WHT B;  3BQ3 A;  3CR2 A;  1WRK A;  2L51 A;  1TCF A;  2TN4 A;  1V1F A;  5PAL A;  2ZKM X;  2FJU B;  2M1K B;  5ER5 A;  4FTG A;  3SG6 A;  1B47 A;  4DIR A;  5KU1 A;  4C0K A;  1JSA A;  4U8D A;  3I5H C;  3BOW A;  3F45 A;  2LMT A;  2JTT A;  4PE1 A;  5TNC A;  1SCM B;  5HKZ A;  1B8C A;  2OS8 B;  4N5X A;  1CFF A;  1DJW A;  1C7W A;  1J55 A;  4L9M A;  1KK8 B;  2F3Z A;  1QAT A;  4YRU A;  2OTG B;  2LNK A;  3VRQ A;  1AP4 A;  2LHL A;  1KSO A;  3PAL A;  1S1E A;  3PSR A;  1Y6W A;  1NSH A;  4MZK A;  2MA2 A;  1FW4 A;  4D1E A;  3CWG A;  5KSZ A;  2JNX A;  1KFU S;  4P5O E;  1H4B A;  1CDM A;  4GGN A;  1TRF A;  2JXC A;  1GQM A;  2K2F A;  1CMF A;  3ICB A;  1HQV A;  1DJY A;  1XYD A;  2I94 A;  1CFD A;  2KBI A;  2O5G A;  3EKH A;  3O4Y A;  3PAT A;  3PN7 C;  3EK8 A;  2LUC A;  2PSR A;  1YTZ C;  1MXE A;  4N1F A;  2ZND A;  1AJ5 A;  3D0Y B;  1SPY A;  5I8N A;  1W7J B;  4BY4 A;  3M0W A;  2BL0 C;  2JQ6 A;  5K89 A;  3JTD B;  3KPX A;  2K7B A;  4UPG A;  2M1U A;  2KGB C;  2ZFD A;  4ORB B;  5D7F A;  2GV5 A;  2PAS A;  1IRJ A;  2LCP A;  4FQO A;  1J7R A;  2K7C A;  3WXA A;  1CKK A;  1ZMZ A;  3DF0 A;  3KF9 A;  1LA0 A;  1CM4 A;  2WOS A;  4MLW A;  2WCF A;  1U5I B;  4YI8 A;  4GNK B;  2H61 A;  3SJS A;  3I5G B;  2D8N A;  1S26 D;  2BCB A;  2LMV A;  3O2P A;  1AK8 A;  4CPV A;  4GGF A;  2OPO A;  2M7L A;  2JTZ A;  2KI4 C;  2JT0 A;  2I7A A;  4AQI A;  2LP2 A;  3IQO A;  1EXR A;  2HQ8 A;  3SG4 A;  1AVS A;  1CB1 A;  2LVK A;  1JUO A;  1NCX A;  2M9G A;  3OX5 A;  4M2P A;  4DUQ A;  2NZ0 A;  1UUS A;  3PM8 A;  4GPL B;  2KFH A;  1BMO A;  1N2D A;  1ZAC A;  2I2R E;  1BR4 B;  3EVR A;  4BY5 A;  2JU0 A;  2JZI A;  1XA5 A;  1SRA A;  3O78 A;  3OB2 B;  3PN7 B;  4PCW A;  2NLN A;  1JFK A;  4CFQ A;  1FF1 A;  2BBM A;  2L0P A;  1TNP A;  2O60 A;  2KAY A;  4ICB A;  1SL8 A;  2BL0 B;  1SMG A;  2F2P A;  1OMV A;  4MRY A;  2M7N A;  3TZ1 A;  4HSZ A;  1BG1 A;  1A03 A;  2WOR A;  1SY9 A;  3GK4 X;  4M2Q A;  1K9K A;  1RRO A;  2AMI A;  1TCO B;  1J7Q A;  3JVT C;  1WDC C;  1EL4 A;  1LXF C;  2KAV A;  1YX7 A;  2LAP A;  2E30 A;  5JOL A;  4NDC A;  1DT7 B;  2JT8 A;  3D10 A;  1G4Y R;  3BUX B;  4YI9 A;  1KQV A;  3CZT X;  2HF5 A;  1X02 A;  1SCV A;  3I5G C;  4XJK B;  2FOT A;  1BT6 A;  1G8I A;  1B4C A;  1QVI Y;  5JJG A;  5IBW A;  5AAN A;  1B8L A;  2BKH B;  2GGZ A;  1IH0 A;  1DF0 A;  1RTP 1;  3MSE B;  2HQW A;  1CDL A;  1RJV A;  1MF8 B;  1XFU O;  1YUT A;  1LVC D;  3AKB A;  3SG7 A;  1LKJ A;  3LLE A;  1QS7 A;  2WCB A;  2MJW B;  1YR5 A;  5CSJ A;  1A2X A;  4NDB A;  1SCM C;  3NXA A;  4HRH A;  2OS8 C;  2JRF A;  3BUM B;  1EJ3 A;  1IJ6 A;  1YVL A;  1KK8 C;  1Y1U A;  2LC5 A;  2KYC A;  2MAZ A;  3CR4 X;  3E3R A;  3EK4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...