1K9PA

Crystal structure of calcium free (or apo) human s100a6
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
89
structure length
89
Chain Sequence
b'ACPLDQAIGLLVAIFHKYSGREGDKHTLSKKELKELIQKELTIGSKLQDAEIARLMEDLDRNKDQEVNFQEYVTFLGALALIYNEALKG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords S100A6
molecule tags Signaling protein
source organism Homo sapiens
publication title Crystal structures of S100A6 in the Ca(2+)-free and Ca(2+)-bound states: the calcium sensor mechanism of S100 proteins revealed at atomic resolution.
pubmed doi rcsb
total genus 30
structure length 89
sequence length 89
ec nomenclature
pdb deposition date 2001-10-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1k9pA00
1KK7Z 1DGVA 1BT6A 2MBXA 2F33A 2ZRTA 1SYMA 3EK8A 3SG7A 2LE9B 5AXIA 2M1KB 1N0YA 4D1EA 2BL0B 1DJHA 1B8CA 2H61A 1KWOC 1KK8C 1QXPA 3LK0A 2ZN8A 4MEWA 3EVVA 2KDHA 3IQQA 4TNCA 2LVIA 1IG5A 3VROA 1KSOA 4MZJA 1K90D 1RROA 1MWNA 1YUSA 3CGAA 1GQMA 1EXRA 1K8UA 2JNFA 1J1DA 1BJFA 4M2OA 4DCKA 2SCPA 1YX8A 2Y5IA 1L7ZA 2OTGC 2LCPA 2ZNEA 3AKAA 3ZWHA 4PE0A 1PRWA 2K7CA 2K8MB 4ZCUA 3IQOA 1CM4A 2WC8A 1PVBA 2G9BA 2K2FA 2JXLA 1MF8B 2K7DA 1K9PA 3PN7C 5BPJA 1YRTB 3BOWB 3TUYC 2LMVA 5AANA 1NX3A 1XK4C 1SNLA 4GFTA 2OPOA 2D8NA 1QATA 2LVJA 3QRXA 4L9MA 2WORA 3HCMA 1SMGA 1SBJA 1EL4A 5ER5A 1B9AA 2KFHA 4FQOA 4YRUA 1N2DA 1M45A 4MBEA 1SR6B 2DOQA 2KI6C 1R6PA 2K61A 3M0WA 4YGBB 4XJKA 3BQ3A 3GK4X 1CFCA 1OZOA 1QVIY 1SL7A 1B8RA 1XFVO 2AUCA 3EK7A 2M29A 2I2RE 3KHEA 3WHTB 3EKJA 1LVCD 1S6JA 1OMDA 1ALVA 2OTGB 1J7PA 1CLLA 1PSRA 3DVJA 4PCWA 1K2HA 3KPXA 5HKYA 1G8IA 1CM1A 2LNKA 2HQWA 1H4BA 1E8AA 3PALA 3PATA 3BOWA 1BR4B 3BXKA 4ORBB 5ER4X 1AP4A 1TTXA 4WQ3A 4N5XA 1A75A 3TDZA 1M46A 1AVSA 2WCEA 4CFQA 2MJWB 1J7OA 2Q4UA 4C0LA 2KI4B 1B7TZ 1TNWA 5DKQA 4JPZB 2H2KA 5AFPA 1SKTA 1AHRA 3I5FC 1ZACA 2L5XB 4HREE 4AOMA 2ZKMX 1G4YR 3O6BA 1DMOA 4AQJA 1QV1A 1QTXA 3BUMB 3OX6A 2G2BA 3BUOB 1Y1XA 1TNXA 1Y1AA 2JTZA 3KEVA 1K94A 1NX1A 1TNPA 3JTDC 1DVIA 4U8DA 3SG5A 2JT3A 3WNXB 1UP5A 1QJTA 4WRIA 4I5LB 1NSHA 2JT8A 1DGUA 1DJIA 1DJYA 1UHJA 4MSPA 1NX2A 2F2PA 3OP0A 1MXLC 5DKRA 3VRNA 3TDIA 3WXAA 4ZCVA 1KFUS 4M2QA 3DVKA 5JOLA 1NP8A 1JFKA 1LXFC 3NSOA 1BU3A 2WOSA 1SCMB 3PM8A 1KSMA 2GV5A 3NXAA 1UHHA 1ZOTB 3EK4A 2HETA 3PFVA 1C7VA 1S26D 3BUXB 1BG1A 1DJWA 1Y1UA 2NZ0A 1KFXS 2EGDA 2JT0A 2KFFA 5CSIA 3GK2A 2LMTA 3DVMA 1NPQA 1ZFSA 2LAPA 1JBAA 1J7RA 1KQMC 4E68A 2BE6A 1NX0A 1NCZA 4ORAB 1S6CA 1FPWA 4Q04A 1MHOA 4MRYA 5KSZA 1QV0A 1F54A 1DJXA 5AEQA 4F0ZB 1CNPA 1WLZA 5HLOA 1AJ4A 2BKHB 2P6BB 1TIZA 5HKZA 3EVUA 2Y1MA 1QLSA 1SW8A 2R2IA 2ZFDA 5CSJA 1KK7Y 1IWQA 3VRPA 1S6IA 5I2LA 2L98A 4DS7A 4I5NB 3TDUA 4QJ4B 1CMFA 2A4JA 1TOPA 3NSLA 2PASA 3TUYB 1SY9A 3MSEB 5FYXA 4P2YB 3PSRA 2CCMA 3SG3A 4R1EA 2JU0A 5I2OA 4P5OE 2KQYA 4AQIA 4PHKA 1V1GA 2JWWA 3IF7A 3LCPC 1QS7A 1J55A 3O4YA 2LP3A 1UURA 1LINA 1J1EA 1S1EA 2F2OA 1TRFA 1YVHA 1G33A 1OSAA 1RK9A 1SR6C 2Q91A 1AJ5A 4MZLA 5K89A 3AAJA 2MLFC 4C0KA 2FJUB 1GGZA 3A4UB 2M0RA 2MRDA 1CDLA 1CFDA 1KK8B 4QJ3B 4OKHA 4QJ5B 1A2XA 1JF2A 1Q80A 3AKBA 1PALA 2FCDA 1K9KA 1IGVA 4PE1A 3I5HB 1HT9A 1W7JB 3C1VA 2M3WA 2MA2A 1R2UA 2F3ZA 3D10A 1NCYA 2EC6B 2KQ6A 1GGWA 5D7FA 1EG3A 2L4IA 1DF0B 1CFPA 2BCXA 2SASA 1F71A 1AK8A 1DTLA 2TN4A 2FOTA 3O2PA 1BF5A 2K7OA 2ZRSA 1ZUZA 1EH2A 1IH0A 1OQPA 2M9GA 2OS8C 4OVNF 2HPSA 2BBNA 1WRLA 3OB1B 4HSZA 3PN7B 1JC2A 5GQQC 4PHMA 1IQ5A 1S5GZ 2AMIA 4YI9A 2HQ8A 2V53A 4ETOA 3SG4A 4NQGA 4MVFA 1JFJA 4FTGA 2M49B 4PHNA 5B8IB 3SIAA 1CB1A 2I94A 1KCYA 1ZMZA 2L2EA 2NLNA 1XFUO 2BECA 1A29A 2ZNDA 3OB2B 4ORCB 5HYDA 4MRXA 5CSFA 5JJGA 1F55A 4UPGA 1YTZC 2CTNA 4PALA 4XJKB 5CPVA 5J3XA 1YX7A 2BE4A 4GUKA 1K9UA 4I5JA 1NYAA 2LVVA 2MHHA 2KI6D 3LL8B 2AAOA 2NCPA 2F3YA 1BLQA 1K95A 1SCVA 3JVTC 2ZN9A 4NDBA 2JNXA 1WRZA 3TZ1A 1ODBA 4PE7A 1QX5B 3KF9A 3RLZA 1BOCA 1NUBA 1S3PA 4N1FA 1A75B 4GNKB 4M2PA 1A4PA 1BR1B 2KAVA 1TCFA 2PVBA 2BKIB 2L0PA 1UUSA 1CDPA 4HRHA 1L2OB 1FI6A 2JPTA 5CSNA 2E6WA 2LLSA 3K21A 1B1GA 1SPYA 1PVAA 3DVEA 1IKUA 1YR5A 1U5IB 2JOJA 2KYFA 3DF0B 2M1UA 1CDNA 1BODA 4ICBA 4MZKA 2K2AA 1QLKA 1NWDA 2JQ6A 4A4CA 1Y0VH 1B4CA 4DIRA 3CS1A 1OZSA 4YGAA 1YVLA 1J7QA 2LMUA 1MXEA 1XVJA 2JTTA 2HF5A 2PRUA 3NSIA 4MLWA 3ICBA 1KFUL 2B1UA 3FIAA 4JQ0D 3PLFB 1YUTA 2LVKA 4N1GA 4GGFA 3TS5B 2LM5A 1AUIB 1B8LA 1CLMA 1H8BA 5TNCA 4OR9B 4XYNA 3FWCA 3BUNB 2NCOA 2WCFA 1DJGA 1UWOA 1XFZO 3NSKA 1KWOB 1V1FA 3SJSA 1KFXL 1S5GY 1LA0A 1RECA 2CXJA 2H61C 1ALWA 3GOFA 1F8HA 3BYAA 5HLVA 2L4HA 4BY5A 1RJVA 1WLMA 2QPTA 2BCAA 2F8PA 2GGMA 3RM1A 4CIDA 4HRGA 5IBWA 1NIWA 1RWYA 1CTRA 2LC5A 1DF0A 1FW4A 1BMOA 1OOJA 2PALA 2LHIA 1FF1A 4A4BA 2BBMA 1LKJA 4CLNA 1XK4A 1K96A 2O60A 4YGDB 1F70A 3H4SE 2KSPA 3D0YA 1SL9A 3EVRA 2I18A 3CR5X 1SL8A 3VGOA 2KAYA 1HQVA 3CTNA 4NDDA 4USLA 5G08A 2QACA 2GGZA 3LLEA 4OCIA 1GJYA 2LV7A 3VRRA 1SK6D 1IQ3A 2VRGA 3ZNIA 1EJ3A 2LHLA 1CKKA 1C07A 2I7AA 1PK0D 1X02A 1K93D 2EHBA 1F4QA 2JZIA 3VRQA 2LP2A 1WRKA 4JWQA 2LLUA 1IJ6A 3AAKA 3I5GC 2LUCA 1QVIZ 2KFGA 1A03A 1CFFA 1CDMA 2LUXA 1FI5A 3I5HC 1B47A 1XO5A 2K7BA 1D1OA 2M97A 3O78A 2KAXA 2MAZA 2KBIA 2Y4QA 2LANA 2NXQA 1QASA 5KU1A 1QIWA 1SRAA 1IRJA 2WCBA 4YBHB 3I5GB 1WY9A 2L50A 2KHNA 2E30A 3WHUB 1M31A 1U5IA 4C0JA 4CFRA 1Y6WA 3SIBA 3I5IB 2L51A 1WDCC 5AERA 2Y1NA 2OS8B 4GGNA 1QX7A 1DT7B 1B7TY 1MR8A 1OMVA 2CT9A 1XA5A 4PDZA 1C7WA 2JC2A 3I5IC 3GK1A 1YUUA 2CNPA 4GPLB 3E3RA 4BY4A 4MN0A 1WDCB 2ISDA 2M7NA 1M39A 2EC6C 4GGFC 5I2QA 3HX4A 3I5FB 2MLEC 1UHIA 1JSAA 4PHJA 3EKHA 1TN4A 4OV2A 1YRUB 2KNEA 3JTDB 2KOTA 2JULA 3F45A 5HKWA 1JUOA 1DJZA 1F4OA 3CLNA 1OE9B 3D0YB 3CWGA 2LLTA 2BL0C 2JXCA 2BCBA 1KQMB 1RTP1 5KTYA 1JWDA 3DF0A 3FS7A 1QIVA 2M8UA 1KQVA 3FWBA 3LK1A 4PE4A 1N65A 2KI4C 1LA3A 2KBMA 5F6TA 4CPVA 1IJ5A 1S36A 3OX5A 3TS5C 3CR2A 5DKNA 2JRFA 2CBLA 2KGBC 1MUXA 3CZTX 2COLB 1CLBA 4I5KA 1L2OC 2FCEA 1PSBA 1UHKA 3SG6A 1SCMC 3BUWB 1UHNA 2O5GA 1YURA 1XFYO 3OHMB 2KGRA 2PMYA 1CMGA 1NCXA 4IL1A 4WQ2A 1FBVA 1VRKA 2K0JA 1M63B 3SG2A 1TCOB 4GBAA 3KO0A 4GAOA 4YGEB 1TNQA 2KYCA 4DRWA 1W7IB 1QX2A 1MQ1A 1PULA 1XFXO 3DD4A 1XFWO 2WNDA 3JVTB 1EG4A 4YGCB 2M7LA 5I8NA 1RFJA 3CR4X 2IS9A 1JF0A 1XYDA 3A8RA 4NDCA 4DUQA 5PALA 4YI8A 2PSRA 5D69A 1OMRA 2RGIA
chains in the Genus database with same CATH superfamily
1DC1A 1KK7Z 3FE8A 1DGVA 1BT6A 2MBXA 2F33A 2ZRTA 1SYMA 3EK8A 3SG7A 2LE9B 5AXIA 2M1KB 1N0YA 4D1EA 2BL0B 1DJHA 1B8CA 2H61A 1KWOC 3D76A 1KK8C 1QXPA 3LK0A 3S0AA 2ZN8A 4MEWA 3EVVA 2KDHA 3IQQA 4TNCA 2LVIA 1IG5A 3VROA 1OOFA 1KSOA 4MZJA 3SS5A 1K90D 1RROA 1MWNA 1YUSA 3CGAA 1GQMA 1GM0A 1IIOA 2PYQA 1EXRA 1TUJA 1K8UA 2JNFA 1J1DA 1BJFA 4M2OA 4DCKA 2SCPA 1YX8A 2Y5IA 3L47A 1L7ZA 2OTGC 2LCPA 2ZNEA 3AKAA 3ZWHA 4PE0A 1PRWA 2K7CA 2K8MB 4ZCUA 3IQOA 1CM4A 2WC8A 1PVBA 2G9BA 2K2FA 2JXLA 1MF8B 2K7DA 5EL2A 1K9PA 3PN7C 5BPJA 1YRTB 3BOWB 3TUYC 2LMVA 3B87A 5AANA 1NX3A 1XK4C 1T14A 1SNLA 4GFTA 2OPOA 2D8NA 1QATA 2LVJA 3QRXA 4L9MA 2WORA 3HCMA 1SMGA 1SBJA 1EL4A 5ER5A 1XFRA 1B9AA 2ERBA 2KFHA 4FQOA 4YRUA 1N2DA 1M45A 1OW4A 4MBEA 1SR6B 2DOQA 3PJIA 4KYNA 2KI6C 1R6PA 2K61A 3M0WA 2WCLA 4YGBB 2BNXA 3O4XA 3DZTA 3NHIA 4XJKA 3BQ3A 3GK4X 1CFCA 1OZOA 1QVIY 1SL7A 3IVTA 4F7FA 1B8RA 1XFVO 2AUCA 3EK7A 2M29A 2I2RE 3KHEA 3WHTB 3EKJA 1LVCD 1S6JA 1OMDA 1ALVA 2OTGB 1J7PA 1CLLA 1PSRA 3DVJA 4PCWA 1K2HA 3KPXA 5HKYA 1G8IA 1CM1A 2LNKA 3CZ0A 2HQWA 1H4BA 1E8AA 3PALA 4IJ7A 3OBVA 3PATA 3BOWA 1BR4B 3BXKA 4ORBB 5ER4X 1AP4A 1TTXA 4WQ3A 4N5XA 1A75A 3TDZA 1M46A 1AVSA 2WCEA 4CFQA 2MJWB 1J7OA 2Q4UA 4C0LA 2KI4B 1B7TZ 1TNWA 3K1EA 5DKQA 4JPZB 2WCKA 2H2KA 5AFPA 1SKTA 1AHRA 3I5FC 1ZACA 2L5XB 3CZ2A 4HREE 2ZKMX 1G4YR 4AOMA 3O6BA 3NGVA 1DMOA 4AQJA 1QV1A 1QTXA 3BUMB 3OX6A 2G2BA 3BUOB 1Y1XA 1TNXA 1Y1AA 2JTZA 3KEVA 1K94A 1NX1A 1ORGA 1TNPA 3JTDC 1DVIA 4U8DA 3SG5A 2JT3A 3WNXB 1UP5A 1QJTA 3CZ1A 4I5LB 4WRIA 1NSHA 2JT8A 1DGUA 1DJIA 4JD9A 3FE9A 1DJYA 1UHJA 4MSPA 3CYZA 3RZSA 1NX2A 2F2PA 2JPOA 1MXLC 3D73A 3OP0A 3PM2A 5DKRA 3VRNA 3TDIA 3WXAA 4ZCVA 1KFUS 4M2QA 3DVKA 5JOLA 3R1OA 1NP8A 1JFKA 1LXFC 3NSOA 1BU3A 2WOSA 1SCMB 3PM8A 5FI6A 1KSMA 2GV5A 3DXLA 1UHHA 3L4AA 1ZOTB 3NXAA 3VB1A 3EK4A 2HETA 3N7HA 2QEBA 3PFVA 1C7VA 1S26D 3BUXB 1BG1A 1DJWA 1Y1UA 2NZ0A 1KFXS 2EGDA 2JT0A 2KFFA 5CSIA 2K60A 3GK2A 2LMTA 3DVMA 1NPQA 1ZFSA 2LAPA 1JBAA 1J7RA 1KQMC 3SS4A 4E68A 2BE6A 1NX0A 1NCZA 2QEVA 4ORAB 1S6CA 1FPWA 4Q04A 1MHOA 4MRYA 5KSZA 1QV0A 1F54A 1DJXA 3V2LA 5AEQA 3B88A 4F0ZB 1CNPA 1WLZA 5HLOA 1AJ4A 2BKHB 2P6BB 1TIZA 5HKZA 3EVUA 2Y1MA 1QLSA 1SW8A 2R2IA 2ZFDA 5CSJA 1KK7Y 1IWQA 3VRPA 1S6IA 5I2LA 2L98A 4DS7A 4I5NB 3TDUA 4QJ4B 1CMFA 2A4JA 1TOPA 3NSLA 2PASA 3TUYB 1SY9A 3MSEB 5FYXA 4P2YB 3EG5B 3PSRA 2CCMA 3SG3A 4R1EA 2JU0A 5I2OA 4P5OE 2KQYA 4AQIA 4PHKA 1V1GA 2JWWA 3IF7A 3LCPC 1QS7A 1J55A 3O4YA 2LP3A 1UURA 1LINA 1J1EA 1S1EA 1TRFA 1YVHA 1SR6C 1G33A 1OSAA 1RK9A 2F2OA 2Q91A 2QEOA 1AJ5A 1Z4HA 4MZLA 5K89A 3AAJA 2MLFC 4C0KA 2FJUB 1GGZA 3A4UB 2M0RA 2MRDA 1CDLA 1CFDA 1KK8B 4QJ3B 4OKHA 4QJ5B 1A2XA 1JF2A 1Q80A 3AKBA 1PALA 2WCHA 3B6XA 2FCDA 1K9KA 1IGVA 4PE1A 4OZDA 3I5HB 1HT9A 1W7JB 3C1VA 2M3WA 2MA2A 1C3YA 1R2UA 2F3ZA 2GTEA 3D10A 1NCYA 3L4LA 2EC6B 2KQ6A 3D78A 1GGWA 2BAPA 5D7FA 1EG3A 2L4IA 1DF0B 1CFPA 2BCXA 2SASA 2L2CA 1F71A 1AK8A 1DTLA 2TN4A 2FOTA 3O2PA 1BF5A 2QEHA 2K7OA 3FE6A 2ZRSA 1ZUZA 1EH2A 1IH0A 1OQPA 2M9GA 2OS8C 4OVNF 2HPSA 2BBNA 1WRLA 3OB1B 4HSZA 3PN7B 1JC2A 4INXA 5GQQC 4PHMA 1IQ5A 1S5GZ 2AMIA 4YI9A 2HQ8A 2V53A 4ETOA 3SG4A 4NQGA 4MVFA 1LS8A 1JFJA 4FTGA 2M49B 4PHNA 5B8IB 3SIAA 1CB1A 2I94A 4PT1A 1KCYA 1ZMZA 2L2EA 2NLNA 1XFUO 2BECA 1A29A 2ZNDA 3OB2B 4ORCB 3S0DA 4MRXA 1SSEB 5CSFA 5HYDA 5JJGA 4UPGA 1DEKA 1YTZC 2CTNA 4PALA 4XJKB 5CPVA 5J3XA 1YX7A 2BE4A 4GUKA 1K9UA 1C3ZA 4I5JA 1NYAA 2LVVA 2MHHA 2KI6D 3LL8B 2AAOA 2NCPA 2F3YA 5FI7A 1BLQA 1K95A 5DICA 1SCVA 3JVTC 2ZN9A 4NDBA 2JNXA 1WRZA 3TZ1A 1ODBA 4PE7A 1QX5B 3KF9A 3RLZA 1BOCA 1NUBA 3Q8IA 3QMEA 3BFAA 1S3PA 4N1FA 1QWVA 1A75B 4GNKB 4M2PA 1A4PA 1BR1B 2KAVA 3R72A 1TCFA 2PVBA 1F55A 2BKIB 3S0FA 2L0PA 1UUSA 1CDPA 4HRHA 1L2OB 1FI6A 2JPTA 5CSNA 2E6WA 2LLSA 5FI2A 3SS3A 3K21A 1B1GA 1SPYA 1PVAA 3DVEA 2KPHA 1IKUA 1YR5A 1U5IB 2JOJA 2KYFA 3DF0B 2M1UA 1CDNA 1BODA 4ICBA 4MZKA 1OOGA 2K2AA 1QLKA 1NWDA 2JQ6A 2WC6A 4A4CA 1Y0VH 1B4CA 4DIRA 3CS1A 1OZSA 4YGAA 1YVLA 1J7QA 2LMUA 1MXEA 1XVJA 2JTTA 2HF5A 2PRUA 3NSIA 3S0BA 1OOIX 4MLWA 3ICBA 1KFUL 2B1UA 3FIAA 2H8VA 4JQ0D 3PLFB 1YUTA 2LVKA 4N1GA 4GGFA 3TS5B 2LM5A 1AUIB 1B8LA 1CLMA 2WCMA 3D75A 3R1PA 1H8BA 5TNCA 4OR9B 4XYNA 5HL1A 3FWCA 3BUNB 2NCOA 2WCFA 1DJGA 1UWOA 1XFZO 3NSKA 1KWOB 3BFHA 1V1FA 3SJSA 1KFXL 1S5GY 1LA0A 1RECA 3DY9A 2WCJA 2CXJA 2H61C 1ALWA 3GOFA 1F8HA 3BYAA 5HLVA 3CABA 2L4HA 4BY5A 1RJVA 1WLMA 2QPTA 2WC5A 1DELA 2BCAA 2F8PA 2GGMA 3RM1A 4CIDA 4HRGA 5IBWA 1NIWA 1RWYA 1CTRA 2LC5A 1DF0A 1FW4A 1BMOA 1OOJA 2PALA 2LHIA 1FF1A 4A4BA 2BBMA 1LKJA 4CLNA 1XK4A 1K96A 2O60A 4YGDB 1F70A 3H4SE 2KSPA 1TWOA 3DYEA 3D0YA 3NHTA 1SL9A 3EVRA 2I18A 3CR5X 1SL8A 3D77A 3VGOA 2KAYA 1HQVA 3CTNA 4NDDA 4USLA 5G08A 2QACA 2GGZA 3LLEA 4OCIA 1GJYA 1TUZA 2LV7A 1OOHA 3VRRA 1SK6D 3B7AA 1IQ3A 2VRGA 3ZNIA 1EJ3A 2LHLA 1CKKA 1C07A 2I7AA 1PK0D 1X02A 1K93D 2EHBA 2PQLA 1F4QA 2JZIA 3OGNA 2LP2A 3VRQA 1WRKA 4JWQA 2LLUA 1IJ6A 3AAKA 3I5GC 2LUCA 1QVIZ 2KFGA 1A03A 1CFFA 1CDMA 2LUXA 1FI5A 3I5HC 1B47A 1XO5A 2K7BA 1D1OA 2M97A 3O78A 2KAXA 2MAZA 2KBIA 2Y4QA 2LANA 2NXQA 1QASA 2QDIA 1DQEA 5KU1A 1QIWA 1SRAA 4FQTA 1IRJA 2WCBA 4YBHB 2YGUA 3I5GB 1WY9A 2L50A 2KHNA 2E30A 3WHUB 1M31A 1U5IA 4C0JA 4CFRA 1Y6WA 2KLEA 3SIBA 3I5IB 2L51A 1WDCC 5AERA 2Y1NA 2OS8B 4GGNA 1QX7A 2P71A 2FJYA 1DT7B 1B7TY 1MR8A 1OMVA 2CT9A 1XA5A 4PDZA 1C7WA 2JC2A 3I5IC 3BFBA 5D3OA 3GK1A 1YUUA 2CNPA 4GPLB 3E3RA 4BY4A 4MN0A 1WDCB 2ISDA 2M7NA 1M39A 3R1VA 2EC6C 4GGFC 5I2QA 3HX4A 3I5FB 2MLEC 1UHIA 1JSAA 4PHJA 4INWA 3EKHA 1TN4A 4OV2A 1YRUB 2KNEA 3JTDB 2KOTA 3D74A 2JULA 3F45A 5HKWA 1JUOA 1DJZA 1F4OA 3CLNA 1OE9B 1P28A 3D0YB 2L5YA 3CWGA 2LLTA 1Z2CB 2BL0C 2JXCA 2BCBA 1KQMB 1RTP1 3BJHA 5KTYA 3DF0A 3FS7A 1QIVA 2M8UA 1JWDA 1KQVA 3FWBA 3LK1A 3CDNA 4PE4A 1N65A 2KI4C 1LA3A 2KBMA 5F6TA 4CPVA 1IJ5A 1S36A 3OX5A 3TS5C 3CR2A 5DKNA 2JRFA 2CBLA 2KGBC 1MUXA 3CZTX 2KLDA 2COLB 1CLBA 4I5KA 2P70A 1L2OC 2FCEA 1PSBA 1UHKA 3SG6A 1SCMC 3S0GA 3BUWB 1UHNA 2O5GA 1YURA 1XFYO 3OHMB 2KGRA 2PMYA 1CMGA 3B86A 1NCXA 4IL1A 4WQ2A 1FBVA 1VRKA 2K0JA 1M63B 3SG2A 1TCOB 4GBAA 3KO0A 4GAOA 4YGEB 1TNQA 2KYCA 4DRWA 1W7IB 5I94A 1QX2A 1MQ1A 1PULA 3UNWA 1XFXO 3S0EA 3DD4A 1XFWO 4JKTA 2WNDA 3JVTB 1EG4A 4YGCB 2M7LA 3UO9A 5I8NA 1RFJA 3CR4X 2IS9A 1JF0A 1XYDA 3A8RA 4NDCA 4DUQA 1W9ZA 5PALA 4YI8A 2PSRA 5D69A 1OMRA 2RGIA
chains in the Genus database with same CATH topology
1KK7Z 1DGVA 1BT6A 2MBXA 2F33A 2ZRTA 1SYMA 3EK8A 3SG7A 2LE9B 5AXIA 2M1KB 1N0YA 4D1EA 2BL0B 1DJHA 1B8CA 2H61A 1KWOC 1KK8C 1QXPA 3LK0A 2ZN8A 4MEWA 3EVVA 2KDHA 3IQQA 4TNCA 2LVIA 1IG5A 3VROA 1KSOA 4MZJA 1K90D 1RROA 1MWNA 1YUSA 3CGAA 1GQMA 1EXRA 1K8UA 2JNFA 1J1DA 1BJFA 4M2OA 4DCKA 2SCPA 1YX8A 2Y5IA 1L7ZA 2OTGC 2LCPA 2ZNEA 3AKAA 3ZWHA 4PE0A 1PRWA 2K7CA 2K8MB 4ZCUA 3IQOA 1CM4A 2WC8A 1PVBA 2G9BA 2K2FA 2JXLA 1MF8B 2K7DA 1K9PA 3PN7C 5BPJA 1YRTB 3BOWB 3TUYC 2LMVA 5AANA 1NX3A 1XK4C 1SNLA 4GFTA 2OPOA 2D8NA 1QATA 2LVJA 3QRXA 4L9MA 2WORA 3HCMA 1SMGA 1SBJA 1EL4A 5ER5A 1B9AA 2KFHA 4FQOA 4YRUA 1N2DA 1M45A 4MBEA 1SR6B 2DOQA 2KI6C 1R6PA 2K61A 3M0WA 4YGBB 4XJKA 3BQ3A 3GK4X 1CFCA 1OZOA 1QVIY 1SL7A 1B8RA 1XFVO 2AUCA 3EK7A 2M29A 2I2RE 3KHEA 3WHTB 3EKJA 1LVCD 1S6JA 1OMDA 1ALVA 2OTGB 1J7PA 1CLLA 1PSRA 3DVJA 4PCWA 1K2HA 3KPXA 5HKYA 1G8IA 1CM1A 2LNKA 2HQWA 1H4BA 1E8AA 3PALA 3PATA 3BOWA 1BR4B 3BXKA 4ORBB 5ER4X 1AP4A 1TTXA 4WQ3A 4N5XA 1A75A 3TDZA 1M46A 1AVSA 2WCEA 4CFQA 2MJWB 1J7OA 2Q4UA 4C0LA 2KI4B 1B7TZ 1TNWA 5DKQA 4JPZB 2H2KA 5AFPA 1SKTA 1AHRA 3I5FC 1ZACA 2L5XB 4HREE 4AOMA 2ZKMX 1G4YR 3O6BA 1DMOA 4AQJA 1QV1A 1QTXA 3BUMB 3OX6A 2G2BA 3BUOB 1Y1XA 1TNXA 1Y1AA 2JTZA 3KEVA 1K94A 1NX1A 1TNPA 3JTDC 1DVIA 4U8DA 3SG5A 2JT3A 3WNXB 1UP5A 1QJTA 4WRIA 4I5LB 1NSHA 2JT8A 1DGUA 1DJIA 1DJYA 1UHJA 4MSPA 1NX2A 2F2PA 3OP0A 1MXLC 5DKRA 3VRNA 3TDIA 3WXAA 4ZCVA 1KFUS 4M2QA 3DVKA 5JOLA 1NP8A 1JFKA 1LXFC 3NSOA 1BU3A 2WOSA 1SCMB 3PM8A 1KSMA 2GV5A 3NXAA 1UHHA 1ZOTB 3EK4A 2HETA 3PFVA 1C7VA 1S26D 3BUXB 1BG1A 1DJWA 1Y1UA 2NZ0A 1KFXS 2EGDA 2JT0A 2KFFA 5CSIA 3GK2A 2LMTA 3DVMA 1NPQA 1ZFSA 2LAPA 1JBAA 1J7RA 1KQMC 4E68A 2BE6A 1NX0A 1NCZA 4ORAB 1S6CA 1FPWA 4Q04A 1MHOA 4MRYA 5KSZA 1QV0A 1F54A 1DJXA 5AEQA 4F0ZB 1CNPA 1WLZA 5HLOA 1AJ4A 2BKHB 2P6BB 1TIZA 5HKZA 3EVUA 2Y1MA 1QLSA 1SW8A 2R2IA 2ZFDA 5CSJA 1KK7Y 1IWQA 3VRPA 1S6IA 5I2LA 2L98A 4DS7A 4I5NB 3TDUA 4QJ4B 1CMFA 2A4JA 1TOPA 3NSLA 2PASA 3TUYB 1SY9A 3MSEB 5FYXA 4P2YB 3PSRA 2CCMA 3SG3A 4R1EA 2JU0A 5I2OA 4P5OE 2KQYA 4AQIA 4PHKA 1V1GA 2JWWA 3IF7A 3LCPC 1QS7A 1J55A 3O4YA 2LP3A 1UURA 1LINA 1J1EA 1S1EA 2F2OA 1TRFA 1YVHA 1G33A 1OSAA 1RK9A 1SR6C 2Q91A 1AJ5A 4MZLA 5K89A 3AAJA 2MLFC 4C0KA 2FJUB 1GGZA 3A4UB 2M0RA 2MRDA 1CDLA 1CFDA 1KK8B 4QJ3B 4OKHA 4QJ5B 1A2XA 1JF2A 1Q80A 3AKBA 1PALA 2FCDA 1K9KA 1IGVA 4PE1A 3I5HB 1HT9A 1W7JB 3C1VA 2M3WA 2MA2A 1R2UA 2F3ZA 3D10A 1NCYA 2EC6B 2KQ6A 1GGWA 5D7FA 1EG3A 2L4IA 1DF0B 1CFPA 2BCXA 2SASA 1F71A 1AK8A 1DTLA 2TN4A 2FOTA 3O2PA 1BF5A 2K7OA 2ZRSA 1ZUZA 1EH2A 1IH0A 1OQPA 2M9GA 2OS8C 4OVNF 2HPSA 2BBNA 1WRLA 3OB1B 4HSZA 3PN7B 1JC2A 5GQQC 4PHMA 1IQ5A 1S5GZ 2AMIA 4YI9A 2HQ8A 2V53A 4ETOA 3SG4A 4NQGA 4MVFA 1JFJA 4FTGA 2M49B 4PHNA 5B8IB 3SIAA 1CB1A 2I94A 1KCYA 1ZMZA 2L2EA 2NLNA 1XFUO 2BECA 1A29A 2ZNDA 3OB2B 4ORCB 5HYDA 4MRXA 5CSFA 5JJGA 1F55A 4UPGA 1YTZC 2CTNA 4PALA 4XJKB 5CPVA 5J3XA 1YX7A 2BE4A 4GUKA 1K9UA 4I5JA 1NYAA 2LVVA 2MHHA 2KI6D 3LL8B 2AAOA 2NCPA 2F3YA 1BLQA 1K95A 1SCVA 3JVTC 2ZN9A 4NDBA 2JNXA 1WRZA 3TZ1A 1ODBA 4PE7A 1QX5B 3KF9A 3RLZA 1BOCA 1NUBA 1S3PA 4N1FA 1A75B 4GNKB 4M2PA 1A4PA 1BR1B 2KAVA 1TCFA 2PVBA 2BKIB 2L0PA 1UUSA 1CDPA 4HRHA 1L2OB 1FI6A 2JPTA 5CSNA 2E6WA 2LLSA 3K21A 1B1GA 1SPYA 1PVAA 3DVEA 1IKUA 1YR5A 1U5IB 2JOJA 2KYFA 3DF0B 2M1UA 1CDNA 1BODA 4ICBA 4MZKA 2K2AA 1QLKA 1NWDA 2JQ6A 4A4CA 1Y0VH 1B4CA 4DIRA 3CS1A 1OZSA 4YGAA 1YVLA 1J7QA 2LMUA 1MXEA 1XVJA 2JTTA 2HF5A 2PRUA 3NSIA 4MLWA 3ICBA 1KFUL 2B1UA 3FIAA 4JQ0D 3PLFB 1YUTA 2LVKA 4N1GA 4GGFA 3TS5B 2LM5A 1AUIB 1B8LA 1CLMA 1H8BA 5TNCA 4OR9B 4XYNA 3FWCA 3BUNB 2NCOA 2WCFA 1DJGA 1UWOA 1XFZO 3NSKA 1KWOB 1V1FA 3SJSA 1KFXL 1S5GY 1LA0A 1RECA 2CXJA 2H61C 1ALWA 3GOFA 1F8HA 3BYAA 5HLVA 2L4HA 4BY5A 1RJVA 1WLMA 2QPTA 2BCAA 2F8PA 2GGMA 3RM1A 4CIDA 4HRGA 5IBWA 1NIWA 1RWYA 1CTRA 2LC5A 1DF0A 1FW4A 1BMOA 1OOJA 2PALA 2LHIA 1FF1A 4A4BA 2BBMA 1LKJA 4CLNA 1XK4A 1K96A 2O60A 4YGDB 1F70A 3H4SE 2KSPA 3D0YA 1SL9A 3EVRA 2I18A 3CR5X 1SL8A 3VGOA 2KAYA 1HQVA 3CTNA 4NDDA 4USLA 5G08A 2QACA 2GGZA 3LLEA 4OCIA 1GJYA 2LV7A 3VRRA 1SK6D 1IQ3A 2VRGA 3ZNIA 1EJ3A 2LHLA 1CKKA 1C07A 2I7AA 1PK0D 1X02A 1K93D 2EHBA 1F4QA 2JZIA 3VRQA 2LP2A 1WRKA 4JWQA 2LLUA 1IJ6A 3AAKA 3I5GC 2LUCA 1QVIZ 2KFGA 1A03A 1CFFA 1CDMA 2LUXA 1FI5A 3I5HC 1B47A 1XO5A 2K7BA 1D1OA 2M97A 3O78A 2KAXA 2MAZA 2KBIA 2Y4QA 2LANA 2NXQA 1QASA 5KU1A 1QIWA 1SRAA 1IRJA 2WCBA 4YBHB 3I5GB 1WY9A 2L50A 2KHNA 2E30A 3WHUB 1M31A 1U5IA 4C0JA 4CFRA 1Y6WA 3SIBA 3I5IB 2L51A 1WDCC 5AERA 2Y1NA 2OS8B 4GGNA 1QX7A 1DT7B 1B7TY 1MR8A 1OMVA 2CT9A 1XA5A 4PDZA 1C7WA 2JC2A 3I5IC 3GK1A 1YUUA 2CNPA 4GPLB 3E3RA 4BY4A 4MN0A 1WDCB 2ISDA 2M7NA 1M39A 2EC6C 4GGFC 5I2QA 3HX4A 3I5FB 2MLEC 1UHIA 1JSAA 4PHJA 3EKHA 1TN4A 4OV2A 1YRUB 2KNEA 3JTDB 2KOTA 2JULA 3F45A 5HKWA 1JUOA 1DJZA 1F4OA 3CLNA 1OE9B 3D0YB 3CWGA 2LLTA 2BL0C 2JXCA 2BCBA 1KQMB 1RTP1 5KTYA 1JWDA 3DF0A 3FS7A 1QIVA 2M8UA 1KQVA 3FWBA 3LK1A 4PE4A 1N65A 2KI4C 1LA3A 2KBMA 5F6TA 4CPVA 1IJ5A 1S36A 3OX5A 3TS5C 3CR2A 5DKNA 2JRFA 2CBLA 2KGBC 1MUXA 3CZTX 2COLB 1CLBA 4I5KA 1L2OC 2FCEA 1PSBA 1UHKA 3SG6A 1SCMC 3BUWB 1UHNA 2O5GA 1YURA 1XFYO 3OHMB 2KGRA 2PMYA 1CMGA 1NCXA 4IL1A 4WQ2A 1FBVA 1VRKA 2K0JA 1M63B 3SG2A 1TCOB 4GBAA 3KO0A 4GAOA 4YGEB 1TNQA 2KYCA 4DRWA 1W7IB 1QX2A 1MQ1A 1PULA 1XFXO 3DD4A 1XFWO 2WNDA 3JVTB 1EG4A 4YGCB 2M7LA 5I8NA 1RFJA 3CR4X 2IS9A 1JF0A 1XYDA 3A8RA 4NDCA 4DUQA 5PALA 4YI8A 2PSRA 5D69A 1OMRA 2RGIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KK7 Z;  1DGV A;  1BT6 A;  2MBX A;  2F33 A;  2ZRT A;  1SYM A;  3EK8 A;  3SG7 A;  2LE9 B;  5AXI A;  2M1K B;  1N0Y A;  4D1E A;  2BL0 B;  1DJH A;  1B8C A;  2H61 A;  1KWO C;  1KK8 C;  1QXP A;  3LK0 A;  2ZN8 A;  4MEW A;  3EVV A;  2KDH A;  3IQQ A;  4TNC A;  2LVI A;  1IG5 A;  3VRO A;  1KSO A;  4MZJ A;  1K90 D;  1RRO A;  1MWN A;  1YUS A;  3CGA A;  1GQM A;  1EXR A;  1K8U A;  2JNF A;  1J1D A;  1BJF A;  4M2O A;  4DCK A;  2SCP A;  1YX8 A;  2Y5I A;  1L7Z A;  2OTG C;  2LCP A;  2ZNE A;  3AKA A;  3ZWH A;  4PE0 A;  1PRW A;  2K7C A;  2K8M B;  4ZCU A;  3IQO A;  1CM4 A;  2WC8 A;  1PVB A;  2G9B A;  2K2F A;  2JXL A;  1MF8 B;  2K7D A;  1K9P A;  3PN7 C;  5BPJ A;  1YRT B;  3BOW B;  3TUY C;  2LMV A;  5AAN A;  1NX3 A;  1XK4 C;  1SNL A;  4GFT A;  2OPO A;  2D8N A;  1QAT A;  2LVJ A;  3QRX A;  4L9M A;  2WOR A;  3HCM A;  1SMG A;  1SBJ A;  1EL4 A;  5ER5 A;  1B9A A;  2KFH A;  4FQO A;  4YRU A;  1N2D A;  1M45 A;  4MBE A;  1SR6 B;  2DOQ A;  2KI6 C;  1R6P A;  2K61 A;  3M0W A;  4YGB B;  4XJK A;  3BQ3 A;  3GK4 X;  1CFC A;  1OZO A;  1QVI Y;  1SL7 A;  1B8R A;  1XFV O;  2AUC A;  3EK7 A;  2M29 A;  2I2R E;  3KHE A;  3WHT B;  3EKJ A;  1LVC D;  1S6J A;  1OMD A;  1ALV A;  2OTG B;  1J7P A;  1CLL A;  1PSR A;  3DVJ A;  4PCW A;  1K2H A;  3KPX A;  5HKY A;  1G8I A;  1CM1 A;  2LNK A;  2HQW A;  1H4B A;  1E8A A;  3PAL A;  3PAT A;  3BOW A;  1BR4 B;  3BXK A;  4ORB B;  5ER4 X;  1AP4 A;  1TTX A;  4WQ3 A;  4N5X A;  1A75 A;  3TDZ A;  1M46 A;  1AVS A;  2WCE A;  4CFQ A;  2MJW B;  1J7O A;  2Q4U A;  4C0L A;  2KI4 B;  1B7T Z;  1TNW A;  5DKQ A;  4JPZ B;  2H2K A;  5AFP A;  1SKT A;  1AHR A;  3I5F C;  1ZAC A;  2L5X B;  4HRE E;  4AOM A;  2ZKM X;  1G4Y R;  3O6B A;  1DMO A;  4AQJ A;  1QV1 A;  1QTX A;  3BUM B;  3OX6 A;  2G2B A;  3BUO B;  1Y1X A;  1TNX A;  1Y1A A;  2JTZ A;  3KEV A;  1K94 A;  1NX1 A;  1TNP A;  3JTD C;  1DVI A;  4U8D A;  3SG5 A;  2JT3 A;  3WNX B;  1UP5 A;  1QJT A;  4WRI A;  4I5L B;  1NSH A;  2JT8 A;  1DGU A;  1DJI A;  1DJY A;  1UHJ A;  4MSP A;  1NX2 A;  2F2P A;  3OP0 A;  1MXL C;  5DKR A;  3VRN A;  3TDI A;  3WXA A;  4ZCV A;  1KFU S;  4M2Q A;  3DVK A;  5JOL A;  1NP8 A;  1JFK A;  1LXF C;  3NSO A;  1BU3 A;  2WOS A;  1SCM B;  3PM8 A;  1KSM A;  2GV5 A;  3NXA A;  1UHH A;  1ZOT B;  3EK4 A;  2HET A;  3PFV A;  1C7V A;  1S26 D;  3BUX B;  1BG1 A;  1DJW A;  1Y1U A;  2NZ0 A;  1KFX S;  2EGD A;  2JT0 A;  2KFF A;  5CSI A;  3GK2 A;  2LMT A;  3DVM A;  1NPQ A;  1ZFS A;  2LAP A;  1JBA A;  1J7R A;  1KQM C;  4E68 A;  2BE6 A;  1NX0 A;  1NCZ A;  4ORA B;  1S6C A;  1FPW A;  4Q04 A;  1MHO A;  4MRY A;  5KSZ A;  1QV0 A;  1F54 A;  1DJX A;  5AEQ A;  4F0Z B;  1CNP A;  1WLZ A;  5HLO A;  1AJ4 A;  2BKH B;  2P6B B;  1TIZ A;  5HKZ A;  3EVU A;  2Y1M A;  1QLS A;  1SW8 A;  2R2I A;  2ZFD A;  5CSJ A;  1KK7 Y;  1IWQ A;  3VRP A;  1S6I A;  5I2L A;  2L98 A;  4DS7 A;  4I5N B;  3TDU A;  4QJ4 B;  1CMF A;  2A4J A;  1TOP A;  3NSL A;  2PAS A;  3TUY B;  1SY9 A;  3MSE B;  5FYX A;  4P2Y B;  3PSR A;  2CCM A;  3SG3 A;  4R1E A;  2JU0 A;  5I2O A;  4P5O E;  2KQY A;  4AQI A;  4PHK A;  1V1G A;  2JWW A;  3IF7 A;  3LCP C;  1QS7 A;  1J55 A;  3O4Y A;  2LP3 A;  1UUR A;  1LIN A;  1J1E A;  1S1E A;  2F2O A;  1TRF A;  1YVH A;  1G33 A;  1OSA A;  1RK9 A;  1SR6 C;  2Q91 A;  1AJ5 A;  4MZL A;  5K89 A;  3AAJ A;  2MLF C;  4C0K A;  2FJU B;  1GGZ A;  3A4U B;  2M0R A;  2MRD A;  1CDL A;  1CFD A;  1KK8 B;  4QJ3 B;  4OKH A;  4QJ5 B;  1A2X A;  1JF2 A;  1Q80 A;  3AKB A;  1PAL A;  2FCD A;  1K9K A;  1IGV A;  4PE1 A;  3I5H B;  1HT9 A;  1W7J B;  3C1V A;  2M3W A;  2MA2 A;  1R2U A;  2F3Z A;  3D10 A;  1NCY A;  2EC6 B;  2KQ6 A;  1GGW A;  5D7F A;  1EG3 A;  2L4I A;  1DF0 B;  1CFP A;  2BCX A;  2SAS A;  1F71 A;  1AK8 A;  1DTL A;  2TN4 A;  2FOT A;  3O2P A;  1BF5 A;  2K7O A;  2ZRS A;  1ZUZ A;  1EH2 A;  1IH0 A;  1OQP A;  2M9G A;  2OS8 C;  4OVN F;  2HPS A;  2BBN A;  1WRL A;  3OB1 B;  4HSZ A;  3PN7 B;  1JC2 A;  5GQQ C;  4PHM A;  1IQ5 A;  1S5G Z;  2AMI A;  4YI9 A;  2HQ8 A;  2V53 A;  4ETO A;  3SG4 A;  4NQG A;  4MVF A;  1JFJ A;  4FTG A;  2M49 B;  4PHN A;  5B8I B;  3SIA A;  1CB1 A;  2I94 A;  1KCY A;  1ZMZ A;  2L2E A;  2NLN A;  1XFU O;  2BEC A;  1A29 A;  2ZND A;  3OB2 B;  4ORC B;  5HYD A;  4MRX A;  5CSF A;  5JJG A;  1F55 A;  4UPG A;  1YTZ C;  2CTN A;  4PAL A;  4XJK B;  5CPV A;  5J3X A;  1YX7 A;  2BE4 A;  4GUK A;  1K9U A;  4I5J A;  1NYA A;  2LVV A;  2MHH A;  2KI6 D;  3LL8 B;  2AAO A;  2NCP A;  2F3Y A;  1BLQ A;  1K95 A;  1SCV A;  3JVT C;  2ZN9 A;  4NDB A;  2JNX A;  1WRZ A;  3TZ1 A;  1ODB A;  4PE7 A;  1QX5 B;  3KF9 A;  3RLZ A;  1BOC A;  1NUB A;  1S3P A;  4N1F A;  1A75 B;  4GNK B;  4M2P A;  1A4P A;  1BR1 B;  2KAV A;  1TCF A;  2PVB A;  2BKI B;  2L0P A;  1UUS A;  1CDP A;  4HRH A;  1L2O B;  1FI6 A;  2JPT A;  5CSN A;  2E6W A;  2LLS A;  3K21 A;  1B1G A;  1SPY A;  1PVA A;  3DVE A;  1IKU A;  1YR5 A;  1U5I B;  2JOJ A;  2KYF A;  3DF0 B;  2M1U A;  1CDN A;  1BOD A;  4ICB A;  4MZK A;  2K2A A;  1QLK A;  1NWD A;  2JQ6 A;  4A4C A;  1Y0V H;  1B4C A;  4DIR A;  3CS1 A;  1OZS A;  4YGA A;  1YVL A;  1J7Q A;  2LMU A;  1MXE A;  1XVJ A;  2JTT A;  2HF5 A;  2PRU A;  3NSI A;  4MLW A;  3ICB A;  1KFU L;  2B1U A;  3FIA A;  4JQ0 D;  3PLF B;  1YUT A;  2LVK A;  4N1G A;  4GGF A;  3TS5 B;  2LM5 A;  1AUI B;  1B8L A;  1CLM A;  1H8B A;  5TNC A;  4OR9 B;  4XYN A;  3FWC A;  3BUN B;  2NCO A;  2WCF A;  1DJG A;  1UWO A;  1XFZ O;  3NSK A;  1KWO B;  1V1F A;  3SJS A;  1KFX L;  1S5G Y;  1LA0 A;  1REC A;  2CXJ A;  2H61 C;  1ALW A;  3GOF A;  1F8H A;  3BYA A;  5HLV A;  2L4H A;  4BY5 A;  1RJV A;  1WLM A;  2QPT A;  2BCA A;  2F8P A;  2GGM A;  3RM1 A;  4CID A;  4HRG A;  5IBW A;  1NIW A;  1RWY A;  1CTR A;  2LC5 A;  1DF0 A;  1FW4 A;  1BMO A;  1OOJ A;  2PAL A;  2LHI A;  1FF1 A;  4A4B A;  2BBM A;  1LKJ A;  4CLN A;  1XK4 A;  1K96 A;  2O60 A;  4YGD B;  1F70 A;  3H4S E;  2KSP A;  3D0Y A;  1SL9 A;  3EVR A;  2I18 A;  3CR5 X;  1SL8 A;  3VGO A;  2KAY A;  1HQV A;  3CTN A;  4NDD A;  4USL A;  5G08 A;  2QAC A;  2GGZ A;  3LLE A;  4OCI A;  1GJY A;  2LV7 A;  3VRR A;  1SK6 D;  1IQ3 A;  2VRG A;  3ZNI A;  1EJ3 A;  2LHL A;  1CKK A;  1C07 A;  2I7A A;  1PK0 D;  1X02 A;  1K93 D;  2EHB A;  1F4Q A;  2JZI A;  3VRQ A;  2LP2 A;  1WRK A;  4JWQ A;  2LLU A;  1IJ6 A;  3AAK A;  3I5G C;  2LUC A;  1QVI Z;  2KFG A;  1A03 A;  1CFF A;  1CDM A;  2LUX A;  1FI5 A;  3I5H C;  1B47 A;  1XO5 A;  2K7B A;  1D1O A;  2M97 A;  3O78 A;  2KAX A;  2MAZ A;  2KBI A;  2Y4Q A;  2LAN A;  2NXQ A;  1QAS A;  5KU1 A;  1QIW A;  1SRA A;  1IRJ A;  2WCB A;  4YBH B;  3I5G B;  1WY9 A;  2L50 A;  2KHN A;  2E30 A;  3WHU B;  1M31 A;  1U5I A;  4C0J A;  4CFR A;  1Y6W A;  3SIB A;  3I5I B;  2L51 A;  1WDC C;  5AER A;  2Y1N A;  2OS8 B;  4GGN A;  1QX7 A;  1DT7 B;  1B7T Y;  1MR8 A;  1OMV A;  2CT9 A;  1XA5 A;  4PDZ A;  1C7W A;  2JC2 A;  3I5I C;  3GK1 A;  1YUU A;  2CNP A;  4GPL B;  3E3R A;  4BY4 A;  4MN0 A;  1WDC B;  2ISD A;  2M7N A;  1M39 A;  2EC6 C;  4GGF C;  5I2Q A;  3HX4 A;  3I5F B;  2MLE C;  1UHI A;  1JSA A;  4PHJ A;  3EKH A;  1TN4 A;  4OV2 A;  1YRU B;  2KNE A;  3JTD B;  2KOT A;  2JUL A;  3F45 A;  5HKW A;  1JUO A;  1DJZ A;  1F4O A;  3CLN A;  1OE9 B;  3D0Y B;  3CWG A;  2LLT A;  2BL0 C;  2JXC A;  2BCB A;  1KQM B;  1RTP 1;  5KTY A;  1JWD A;  3DF0 A;  3FS7 A;  1QIV A;  2M8U A;  1KQV A;  3FWB A;  3LK1 A;  4PE4 A;  1N65 A;  2KI4 C;  1LA3 A;  2KBM A;  5F6T A;  4CPV A;  1IJ5 A;  1S36 A;  3OX5 A;  3TS5 C;  3CR2 A;  5DKN A;  2JRF A;  2CBL A;  2KGB C;  1MUX A;  3CZT X;  2COL B;  1CLB A;  4I5K A;  1L2O C;  2FCE A;  1PSB A;  1UHK A;  3SG6 A;  1SCM C;  3BUW B;  1UHN A;  2O5G A;  1YUR A;  1XFY O;  3OHM B;  2KGR A;  2PMY A;  1CMG A;  1NCX A;  4IL1 A;  4WQ2 A;  1FBV A;  1VRK A;  2K0J A;  1M63 B;  3SG2 A;  1TCO B;  4GBA A;  3KO0 A;  4GAO A;  4YGE B;  1TNQ A;  2KYC A;  4DRW A;  1W7I B;  1QX2 A;  1MQ1 A;  1PUL A;  1XFX O;  3DD4 A;  1XFW O;  2WND A;  3JVT B;  1EG4 A;  4YGC B;  2M7L A;  5I8N A;  1RFJ A;  3CR4 X;  2IS9 A;  1JF0 A;  1XYD A;  3A8R A;  4NDC A;  4DUQ A;  5PAL A;  4YI8 A;  2PSR A;  5D69 A;  1OMR A;  2RGI A; 
#chains in the Genus database with same CATH topology
 1DC1 A;  1KK7 Z;  3FE8 A;  1DGV A;  1BT6 A;  2MBX A;  2F33 A;  2ZRT A;  1SYM A;  3EK8 A;  3SG7 A;  2LE9 B;  5AXI A;  2M1K B;  1N0Y A;  4D1E A;  2BL0 B;  1DJH A;  1B8C A;  2H61 A;  1KWO C;  3D76 A;  1KK8 C;  1QXP A;  3LK0 A;  3S0A A;  2ZN8 A;  4MEW A;  3EVV A;  2KDH A;  3IQQ A;  4TNC A;  2LVI A;  1IG5 A;  3VRO A;  1OOF A;  1KSO A;  4MZJ A;  3SS5 A;  1K90 D;  1RRO A;  1MWN A;  1YUS A;  3CGA A;  1GQM A;  1GM0 A;  1IIO A;  2PYQ A;  1EXR A;  1TUJ A;  1K8U A;  2JNF A;  1J1D A;  1BJF A;  4M2O A;  4DCK A;  2SCP A;  1YX8 A;  2Y5I A;  3L47 A;  1L7Z A;  2OTG C;  2LCP A;  2ZNE A;  3AKA A;  3ZWH A;  4PE0 A;  1PRW A;  2K7C A;  2K8M B;  4ZCU A;  3IQO A;  1CM4 A;  2WC8 A;  1PVB A;  2G9B A;  2K2F A;  2JXL A;  1MF8 B;  2K7D A;  5EL2 A;  1K9P A;  3PN7 C;  5BPJ A;  1YRT B;  3BOW B;  3TUY C;  2LMV A;  3B87 A;  5AAN A;  1NX3 A;  1XK4 C;  1T14 A;  1SNL A;  4GFT A;  2OPO A;  2D8N A;  1QAT A;  2LVJ A;  3QRX A;  4L9M A;  2WOR A;  3HCM A;  1SMG A;  1SBJ A;  1EL4 A;  5ER5 A;  1XFR A;  1B9A A;  2ERB A;  2KFH A;  4FQO A;  4YRU A;  1N2D A;  1M45 A;  1OW4 A;  4MBE A;  1SR6 B;  2DOQ A;  3PJI A;  4KYN A;  2KI6 C;  1R6P A;  2K61 A;  3M0W A;  2WCL A;  4YGB B;  2BNX A;  3O4X A;  3DZT A;  3NHI A;  4XJK A;  3BQ3 A;  3GK4 X;  1CFC A;  1OZO A;  1QVI Y;  1SL7 A;  3IVT A;  4F7F A;  1B8R A;  1XFV O;  2AUC A;  3EK7 A;  2M29 A;  2I2R E;  3KHE A;  3WHT B;  3EKJ A;  1LVC D;  1S6J A;  1OMD A;  1ALV A;  2OTG B;  1J7P A;  1CLL A;  1PSR A;  3DVJ A;  4PCW A;  1K2H A;  3KPX A;  5HKY A;  1G8I A;  1CM1 A;  2LNK A;  3CZ0 A;  2HQW A;  1H4B A;  1E8A A;  3PAL A;  4IJ7 A;  3OBV A;  3PAT A;  3BOW A;  1BR4 B;  3BXK A;  4ORB B;  5ER4 X;  1AP4 A;  1TTX A;  4WQ3 A;  4N5X A;  1A75 A;  3TDZ A;  1M46 A;  1AVS A;  2WCE A;  4CFQ A;  2MJW B;  1J7O A;  2Q4U A;  4C0L A;  2KI4 B;  1B7T Z;  1TNW A;  3K1E A;  5DKQ A;  4JPZ B;  2WCK A;  2H2K A;  5AFP A;  1SKT A;  1AHR A;  3I5F C;  1ZAC A;  2L5X B;  3CZ2 A;  4HRE E;  2ZKM X;  1G4Y R;  4AOM A;  3O6B A;  3NGV A;  1DMO A;  4AQJ A;  1QV1 A;  1QTX A;  3BUM B;  3OX6 A;  2G2B A;  3BUO B;  1Y1X A;  1TNX A;  1Y1A A;  2JTZ A;  3KEV A;  1K94 A;  1NX1 A;  1ORG A;  1TNP A;  3JTD C;  1DVI A;  4U8D A;  3SG5 A;  2JT3 A;  3WNX B;  1UP5 A;  1QJT A;  3CZ1 A;  4I5L B;  4WRI A;  1NSH A;  2JT8 A;  1DGU A;  1DJI A;  4JD9 A;  3FE9 A;  1DJY A;  1UHJ A;  4MSP A;  3CYZ A;  3RZS A;  1NX2 A;  2F2P A;  2JPO A;  1MXL C;  3D73 A;  3OP0 A;  3PM2 A;  5DKR A;  3VRN A;  3TDI A;  3WXA A;  4ZCV A;  1KFU S;  4M2Q A;  3DVK A;  5JOL A;  3R1O A;  1NP8 A;  1JFK A;  1LXF C;  3NSO A;  1BU3 A;  2WOS A;  1SCM B;  3PM8 A;  5FI6 A;  1KSM A;  2GV5 A;  3DXL A;  1UHH A;  3L4A A;  1ZOT B;  3NXA A;  3VB1 A;  3EK4 A;  2HET A;  3N7H A;  2QEB A;  3PFV A;  1C7V A;  1S26 D;  3BUX B;  1BG1 A;  1DJW A;  1Y1U A;  2NZ0 A;  1KFX S;  2EGD A;  2JT0 A;  2KFF A;  5CSI A;  2K60 A;  3GK2 A;  2LMT A;  3DVM A;  1NPQ A;  1ZFS A;  2LAP A;  1JBA A;  1J7R A;  1KQM C;  3SS4 A;  4E68 A;  2BE6 A;  1NX0 A;  1NCZ A;  2QEV A;  4ORA B;  1S6C A;  1FPW A;  4Q04 A;  1MHO A;  4MRY A;  5KSZ A;  1QV0 A;  1F54 A;  1DJX A;  3V2L A;  5AEQ A;  3B88 A;  4F0Z B;  1CNP A;  1WLZ A;  5HLO A;  1AJ4 A;  2BKH B;  2P6B B;  1TIZ A;  5HKZ A;  3EVU A;  2Y1M A;  1QLS A;  1SW8 A;  2R2I A;  2ZFD A;  5CSJ A;  1KK7 Y;  1IWQ A;  3VRP A;  1S6I A;  5I2L A;  2L98 A;  4DS7 A;  4I5N B;  3TDU A;  4QJ4 B;  1CMF A;  2A4J A;  1TOP A;  3NSL A;  2PAS A;  3TUY B;  1SY9 A;  3MSE B;  5FYX A;  4P2Y B;  3EG5 B;  3PSR A;  2CCM A;  3SG3 A;  4R1E A;  2JU0 A;  5I2O A;  4P5O E;  2KQY A;  4AQI A;  4PHK A;  1V1G A;  2JWW A;  3IF7 A;  3LCP C;  1QS7 A;  1J55 A;  3O4Y A;  2LP3 A;  1UUR A;  1LIN A;  1J1E A;  1S1E A;  1TRF A;  1YVH A;  1SR6 C;  1G33 A;  1OSA A;  1RK9 A;  2F2O A;  2Q91 A;  2QEO A;  1AJ5 A;  1Z4H A;  4MZL A;  5K89 A;  3AAJ A;  2MLF C;  4C0K A;  2FJU B;  1GGZ A;  3A4U B;  2M0R A;  2MRD A;  1CDL A;  1CFD A;  1KK8 B;  4QJ3 B;  4OKH A;  4QJ5 B;  1A2X A;  1JF2 A;  1Q80 A;  3AKB A;  1PAL A;  2WCH A;  3B6X A;  2FCD A;  1K9K A;  1IGV A;  4PE1 A;  4OZD A;  3I5H B;  1HT9 A;  1W7J B;  3C1V A;  2M3W A;  2MA2 A;  1C3Y A;  1R2U A;  2F3Z A;  2GTE A;  3D10 A;  1NCY A;  3L4L A;  2EC6 B;  2KQ6 A;  3D78 A;  1GGW A;  2BAP A;  5D7F A;  1EG3 A;  2L4I A;  1DF0 B;  1CFP A;  2BCX A;  2SAS A;  2L2C A;  1F71 A;  1AK8 A;  1DTL A;  2TN4 A;  2FOT A;  3O2P A;  1BF5 A;  2QEH A;  2K7O A;  3FE6 A;  2ZRS A;  1ZUZ A;  1EH2 A;  1IH0 A;  1OQP A;  2M9G A;  2OS8 C;  4OVN F;  2HPS A;  2BBN A;  1WRL A;  3OB1 B;  4HSZ A;  3PN7 B;  1JC2 A;  4INX A;  5GQQ C;  4PHM A;  1IQ5 A;  1S5G Z;  2AMI A;  4YI9 A;  2HQ8 A;  2V53 A;  4ETO A;  3SG4 A;  4NQG A;  4MVF A;  1LS8 A;  1JFJ A;  4FTG A;  2M49 B;  4PHN A;  5B8I B;  3SIA A;  1CB1 A;  2I94 A;  4PT1 A;  1KCY A;  1ZMZ A;  2L2E A;  2NLN A;  1XFU O;  2BEC A;  1A29 A;  2ZND A;  3OB2 B;  4ORC B;  3S0D A;  4MRX A;  1SSE B;  5CSF A;  5HYD A;  5JJG A;  4UPG A;  1DEK A;  1YTZ C;  2CTN A;  4PAL A;  4XJK B;  5CPV A;  5J3X A;  1YX7 A;  2BE4 A;  4GUK A;  1K9U A;  1C3Z A;  4I5J A;  1NYA A;  2LVV A;  2MHH A;  2KI6 D;  3LL8 B;  2AAO A;  2NCP A;  2F3Y A;  5FI7 A;  1BLQ A;  1K95 A;  5DIC A;  1SCV A;  3JVT C;  2ZN9 A;  4NDB A;  2JNX A;  1WRZ A;  3TZ1 A;  1ODB A;  4PE7 A;  1QX5 B;  3KF9 A;  3RLZ A;  1BOC A;  1NUB A;  3Q8I A;  3QME A;  3BFA A;  1S3P A;  4N1F A;  1QWV A;  1A75 B;  4GNK B;  4M2P A;  1A4P A;  1BR1 B;  2KAV A;  3R72 A;  1TCF A;  2PVB A;  1F55 A;  2BKI B;  3S0F A;  2L0P A;  1UUS A;  1CDP A;  4HRH A;  1L2O B;  1FI6 A;  2JPT A;  5CSN A;  2E6W A;  2LLS A;  5FI2 A;  3SS3 A;  3K21 A;  1B1G A;  1SPY A;  1PVA A;  3DVE A;  2KPH A;  1IKU A;  1YR5 A;  1U5I B;  2JOJ A;  2KYF A;  3DF0 B;  2M1U A;  1CDN A;  1BOD A;  4ICB A;  4MZK A;  1OOG A;  2K2A A;  1QLK A;  1NWD A;  2JQ6 A;  2WC6 A;  4A4C A;  1Y0V H;  1B4C A;  4DIR A;  3CS1 A;  1OZS A;  4YGA A;  1YVL A;  1J7Q A;  2LMU A;  1MXE A;  1XVJ A;  2JTT A;  2HF5 A;  2PRU A;  3NSI A;  3S0B A;  1OOI X;  4MLW A;  3ICB A;  1KFU L;  2B1U A;  3FIA A;  2H8V A;  4JQ0 D;  3PLF B;  1YUT A;  2LVK A;  4N1G A;  4GGF A;  3TS5 B;  2LM5 A;  1AUI B;  1B8L A;  1CLM A;  2WCM A;  3D75 A;  3R1P A;  1H8B A;  5TNC A;  4OR9 B;  4XYN A;  5HL1 A;  3FWC A;  3BUN B;  2NCO A;  2WCF A;  1DJG A;  1UWO A;  1XFZ O;  3NSK A;  1KWO B;  3BFH A;  1V1F A;  3SJS A;  1KFX L;  1S5G Y;  1LA0 A;  1REC A;  3DY9 A;  2WCJ A;  2CXJ A;  2H61 C;  1ALW A;  3GOF A;  1F8H A;  3BYA A;  5HLV A;  3CAB A;  2L4H A;  4BY5 A;  1RJV A;  1WLM A;  2QPT A;  2WC5 A;  1DEL A;  2BCA A;  2F8P A;  2GGM A;  3RM1 A;  4CID A;  4HRG A;  5IBW A;  1NIW A;  1RWY A;  1CTR A;  2LC5 A;  1DF0 A;  1FW4 A;  1BMO A;  1OOJ A;  2PAL A;  2LHI A;  1FF1 A;  4A4B A;  2BBM A;  1LKJ A;  4CLN A;  1XK4 A;  1K96 A;  2O60 A;  4YGD B;  1F70 A;  3H4S E;  2KSP A;  1TWO A;  3DYE A;  3D0Y A;  3NHT A;  1SL9 A;  3EVR A;  2I18 A;  3CR5 X;  1SL8 A;  3D77 A;  3VGO A;  2KAY A;  1HQV A;  3CTN A;  4NDD A;  4USL A;  5G08 A;  2QAC A;  2GGZ A;  3LLE A;  4OCI A;  1GJY A;  1TUZ A;  2LV7 A;  1OOH A;  3VRR A;  1SK6 D;  3B7A A;  1IQ3 A;  2VRG A;  3ZNI A;  1EJ3 A;  2LHL A;  1CKK A;  1C07 A;  2I7A A;  1PK0 D;  1X02 A;  1K93 D;  2EHB A;  2PQL A;  1F4Q A;  2JZI A;  3OGN A;  2LP2 A;  3VRQ A;  1WRK A;  4JWQ A;  2LLU A;  1IJ6 A;  3AAK A;  3I5G C;  2LUC A;  1QVI Z;  2KFG A;  1A03 A;  1CFF A;  1CDM A;  2LUX A;  1FI5 A;  3I5H C;  1B47 A;  1XO5 A;  2K7B A;  1D1O A;  2M97 A;  3O78 A;  2KAX A;  2MAZ A;  2KBI A;  2Y4Q A;  2LAN A;  2NXQ A;  1QAS A;  2QDI A;  1DQE A;  5KU1 A;  1QIW A;  1SRA A;  4FQT A;  1IRJ A;  2WCB A;  4YBH B;  2YGU A;  3I5G B;  1WY9 A;  2L50 A;  2KHN A;  2E30 A;  3WHU B;  1M31 A;  1U5I A;  4C0J A;  4CFR A;  1Y6W A;  2KLE A;  3SIB A;  3I5I B;  2L51 A;  1WDC C;  5AER A;  2Y1N A;  2OS8 B;  4GGN A;  1QX7 A;  2P71 A;  2FJY A;  1DT7 B;  1B7T Y;  1MR8 A;  1OMV A;  2CT9 A;  1XA5 A;  4PDZ A;  1C7W A;  2JC2 A;  3I5I C;  3BFB A;  5D3O A;  3GK1 A;  1YUU A;  2CNP A;  4GPL B;  3E3R A;  4BY4 A;  4MN0 A;  1WDC B;  2ISD A;  2M7N A;  1M39 A;  3R1V A;  2EC6 C;  4GGF C;  5I2Q A;  3HX4 A;  3I5F B;  2MLE C;  1UHI A;  1JSA A;  4PHJ A;  4INW A;  3EKH A;  1TN4 A;  4OV2 A;  1YRU B;  2KNE A;  3JTD B;  2KOT A;  3D74 A;  2JUL A;  3F45 A;  5HKW A;  1JUO A;  1DJZ A;  1F4O A;  3CLN A;  1OE9 B;  1P28 A;  3D0Y B;  2L5Y A;  3CWG A;  2LLT A;  1Z2C B;  2BL0 C;  2JXC A;  2BCB A;  1KQM B;  1RTP 1;  3BJH A;  5KTY A;  3DF0 A;  3FS7 A;  1QIV A;  2M8U A;  1JWD A;  1KQV A;  3FWB A;  3LK1 A;  3CDN A;  4PE4 A;  1N65 A;  2KI4 C;  1LA3 A;  2KBM A;  5F6T A;  4CPV A;  1IJ5 A;  1S36 A;  3OX5 A;  3TS5 C;  3CR2 A;  5DKN A;  2JRF A;  2CBL A;  2KGB C;  1MUX A;  3CZT X;  2KLD A;  2COL B;  1CLB A;  4I5K A;  2P70 A;  1L2O C;  2FCE A;  1PSB A;  1UHK A;  3SG6 A;  1SCM C;  3S0G A;  3BUW B;  1UHN A;  2O5G A;  1YUR A;  1XFY O;  3OHM B;  2KGR A;  2PMY A;  1CMG A;  3B86 A;  1NCX A;  4IL1 A;  4WQ2 A;  1FBV A;  1VRK A;  2K0J A;  1M63 B;  3SG2 A;  1TCO B;  4GBA A;  3KO0 A;  4GAO A;  4YGE B;  1TNQ A;  2KYC A;  4DRW A;  1W7I B;  5I94 A;  1QX2 A;  1MQ1 A;  1PUL A;  3UNW A;  1XFX O;  3S0E A;  3DD4 A;  1XFW O;  4JKT A;  2WND A;  3JVT B;  1EG4 A;  4YGC B;  2M7L A;  3UO9 A;  5I8N A;  1RFJ A;  3CR4 X;  2IS9 A;  1JF0 A;  1XYD A;  3A8R A;  4NDC A;  4DUQ A;  1W9Z A;  5PAL A;  4YI8 A;  2PSR A;  5D69 A;  1OMR A;  2RGI A; 
#chains in the Genus database with same CATH homology
 1KK7 Z;  1DGV A;  1BT6 A;  2MBX A;  2F33 A;  2ZRT A;  1SYM A;  3EK8 A;  3SG7 A;  2LE9 B;  5AXI A;  2M1K B;  1N0Y A;  4D1E A;  2BL0 B;  1DJH A;  1B8C A;  2H61 A;  1KWO C;  1KK8 C;  1QXP A;  3LK0 A;  2ZN8 A;  4MEW A;  3EVV A;  2KDH A;  3IQQ A;  4TNC A;  2LVI A;  1IG5 A;  3VRO A;  1KSO A;  4MZJ A;  1K90 D;  1RRO A;  1MWN A;  1YUS A;  3CGA A;  1GQM A;  1EXR A;  1K8U A;  2JNF A;  1J1D A;  1BJF A;  4M2O A;  4DCK A;  2SCP A;  1YX8 A;  2Y5I A;  1L7Z A;  2OTG C;  2LCP A;  2ZNE A;  3AKA A;  3ZWH A;  4PE0 A;  1PRW A;  2K7C A;  2K8M B;  4ZCU A;  3IQO A;  1CM4 A;  2WC8 A;  1PVB A;  2G9B A;  2K2F A;  2JXL A;  1MF8 B;  2K7D A;  1K9P A;  3PN7 C;  5BPJ A;  1YRT B;  3BOW B;  3TUY C;  2LMV A;  5AAN A;  1NX3 A;  1XK4 C;  1SNL A;  4GFT A;  2OPO A;  2D8N A;  1QAT A;  2LVJ A;  3QRX A;  4L9M A;  2WOR A;  3HCM A;  1SMG A;  1SBJ A;  1EL4 A;  5ER5 A;  1B9A A;  2KFH A;  4FQO A;  4YRU A;  1N2D A;  1M45 A;  4MBE A;  1SR6 B;  2DOQ A;  2KI6 C;  1R6P A;  2K61 A;  3M0W A;  4YGB B;  4XJK A;  3BQ3 A;  3GK4 X;  1CFC A;  1OZO A;  1QVI Y;  1SL7 A;  1B8R A;  1XFV O;  2AUC A;  3EK7 A;  2M29 A;  2I2R E;  3KHE A;  3WHT B;  3EKJ A;  1LVC D;  1S6J A;  1OMD A;  1ALV A;  2OTG B;  1J7P A;  1CLL A;  1PSR A;  3DVJ A;  4PCW A;  1K2H A;  3KPX A;  5HKY A;  1G8I A;  1CM1 A;  2LNK A;  2HQW A;  1H4B A;  1E8A A;  3PAL A;  3PAT A;  3BOW A;  1BR4 B;  3BXK A;  4ORB B;  5ER4 X;  1AP4 A;  1TTX A;  4WQ3 A;  4N5X A;  1A75 A;  3TDZ A;  1M46 A;  1AVS A;  2WCE A;  4CFQ A;  2MJW B;  1J7O A;  2Q4U A;  4C0L A;  2KI4 B;  1B7T Z;  1TNW A;  5DKQ A;  4JPZ B;  2H2K A;  5AFP A;  1SKT A;  1AHR A;  3I5F C;  1ZAC A;  2L5X B;  4HRE E;  4AOM A;  2ZKM X;  1G4Y R;  3O6B A;  1DMO A;  4AQJ A;  1QV1 A;  1QTX A;  3BUM B;  3OX6 A;  2G2B A;  3BUO B;  1Y1X A;  1TNX A;  1Y1A A;  2JTZ A;  3KEV A;  1K94 A;  1NX1 A;  1TNP A;  3JTD C;  1DVI A;  4U8D A;  3SG5 A;  2JT3 A;  3WNX B;  1UP5 A;  1QJT A;  4WRI A;  4I5L B;  1NSH A;  2JT8 A;  1DGU A;  1DJI A;  1DJY A;  1UHJ A;  4MSP A;  1NX2 A;  2F2P A;  3OP0 A;  1MXL C;  5DKR A;  3VRN A;  3TDI A;  3WXA A;  4ZCV A;  1KFU S;  4M2Q A;  3DVK A;  5JOL A;  1NP8 A;  1JFK A;  1LXF C;  3NSO A;  1BU3 A;  2WOS A;  1SCM B;  3PM8 A;  1KSM A;  2GV5 A;  3NXA A;  1UHH A;  1ZOT B;  3EK4 A;  2HET A;  3PFV A;  1C7V A;  1S26 D;  3BUX B;  1BG1 A;  1DJW A;  1Y1U A;  2NZ0 A;  1KFX S;  2EGD A;  2JT0 A;  2KFF A;  5CSI A;  3GK2 A;  2LMT A;  3DVM A;  1NPQ A;  1ZFS A;  2LAP A;  1JBA A;  1J7R A;  1KQM C;  4E68 A;  2BE6 A;  1NX0 A;  1NCZ A;  4ORA B;  1S6C A;  1FPW A;  4Q04 A;  1MHO A;  4MRY A;  5KSZ A;  1QV0 A;  1F54 A;  1DJX A;  5AEQ A;  4F0Z B;  1CNP A;  1WLZ A;  5HLO A;  1AJ4 A;  2BKH B;  2P6B B;  1TIZ A;  5HKZ A;  3EVU A;  2Y1M A;  1QLS A;  1SW8 A;  2R2I A;  2ZFD A;  5CSJ A;  1KK7 Y;  1IWQ A;  3VRP A;  1S6I A;  5I2L A;  2L98 A;  4DS7 A;  4I5N B;  3TDU A;  4QJ4 B;  1CMF A;  2A4J A;  1TOP A;  3NSL A;  2PAS A;  3TUY B;  1SY9 A;  3MSE B;  5FYX A;  4P2Y B;  3PSR A;  2CCM A;  3SG3 A;  4R1E A;  2JU0 A;  5I2O A;  4P5O E;  2KQY A;  4AQI A;  4PHK A;  1V1G A;  2JWW A;  3IF7 A;  3LCP C;  1QS7 A;  1J55 A;  3O4Y A;  2LP3 A;  1UUR A;  1LIN A;  1J1E A;  1S1E A;  2F2O A;  1TRF A;  1YVH A;  1G33 A;  1OSA A;  1RK9 A;  1SR6 C;  2Q91 A;  1AJ5 A;  4MZL A;  5K89 A;  3AAJ A;  2MLF C;  4C0K A;  2FJU B;  1GGZ A;  3A4U B;  2M0R A;  2MRD A;  1CDL A;  1CFD A;  1KK8 B;  4QJ3 B;  4OKH A;  4QJ5 B;  1A2X A;  1JF2 A;  1Q80 A;  3AKB A;  1PAL A;  2FCD A;  1K9K A;  1IGV A;  4PE1 A;  3I5H B;  1HT9 A;  1W7J B;  3C1V A;  2M3W A;  2MA2 A;  1R2U A;  2F3Z A;  3D10 A;  1NCY A;  2EC6 B;  2KQ6 A;  1GGW A;  5D7F A;  1EG3 A;  2L4I A;  1DF0 B;  1CFP A;  2BCX A;  2SAS A;  1F71 A;  1AK8 A;  1DTL A;  2TN4 A;  2FOT A;  3O2P A;  1BF5 A;  2K7O A;  2ZRS A;  1ZUZ A;  1EH2 A;  1IH0 A;  1OQP A;  2M9G A;  2OS8 C;  4OVN F;  2HPS A;  2BBN A;  1WRL A;  3OB1 B;  4HSZ A;  3PN7 B;  1JC2 A;  5GQQ C;  4PHM A;  1IQ5 A;  1S5G Z;  2AMI A;  4YI9 A;  2HQ8 A;  2V53 A;  4ETO A;  3SG4 A;  4NQG A;  4MVF A;  1JFJ A;  4FTG A;  2M49 B;  4PHN A;  5B8I B;  3SIA A;  1CB1 A;  2I94 A;  1KCY A;  1ZMZ A;  2L2E A;  2NLN A;  1XFU O;  2BEC A;  1A29 A;  2ZND A;  3OB2 B;  4ORC B;  5HYD A;  4MRX A;  5CSF A;  5JJG A;  1F55 A;  4UPG A;  1YTZ C;  2CTN A;  4PAL A;  4XJK B;  5CPV A;  5J3X A;  1YX7 A;  2BE4 A;  4GUK A;  1K9U A;  4I5J A;  1NYA A;  2LVV A;  2MHH A;  2KI6 D;  3LL8 B;  2AAO A;  2NCP A;  2F3Y A;  1BLQ A;  1K95 A;  1SCV A;  3JVT C;  2ZN9 A;  4NDB A;  2JNX A;  1WRZ A;  3TZ1 A;  1ODB A;  4PE7 A;  1QX5 B;  3KF9 A;  3RLZ A;  1BOC A;  1NUB A;  1S3P A;  4N1F A;  1A75 B;  4GNK B;  4M2P A;  1A4P A;  1BR1 B;  2KAV A;  1TCF A;  2PVB A;  2BKI B;  2L0P A;  1UUS A;  1CDP A;  4HRH A;  1L2O B;  1FI6 A;  2JPT A;  5CSN A;  2E6W A;  2LLS A;  3K21 A;  1B1G A;  1SPY A;  1PVA A;  3DVE A;  1IKU A;  1YR5 A;  1U5I B;  2JOJ A;  2KYF A;  3DF0 B;  2M1U A;  1CDN A;  1BOD A;  4ICB A;  4MZK A;  2K2A A;  1QLK A;  1NWD A;  2JQ6 A;  4A4C A;  1Y0V H;  1B4C A;  4DIR A;  3CS1 A;  1OZS A;  4YGA A;  1YVL A;  1J7Q A;  2LMU A;  1MXE A;  1XVJ A;  2JTT A;  2HF5 A;  2PRU A;  3NSI A;  4MLW A;  3ICB A;  1KFU L;  2B1U A;  3FIA A;  4JQ0 D;  3PLF B;  1YUT A;  2LVK A;  4N1G A;  4GGF A;  3TS5 B;  2LM5 A;  1AUI B;  1B8L A;  1CLM A;  1H8B A;  5TNC A;  4OR9 B;  4XYN A;  3FWC A;  3BUN B;  2NCO A;  2WCF A;  1DJG A;  1UWO A;  1XFZ O;  3NSK A;  1KWO B;  1V1F A;  3SJS A;  1KFX L;  1S5G Y;  1LA0 A;  1REC A;  2CXJ A;  2H61 C;  1ALW A;  3GOF A;  1F8H A;  3BYA A;  5HLV A;  2L4H A;  4BY5 A;  1RJV A;  1WLM A;  2QPT A;  2BCA A;  2F8P A;  2GGM A;  3RM1 A;  4CID A;  4HRG A;  5IBW A;  1NIW A;  1RWY A;  1CTR A;  2LC5 A;  1DF0 A;  1FW4 A;  1BMO A;  1OOJ A;  2PAL A;  2LHI A;  1FF1 A;  4A4B A;  2BBM A;  1LKJ A;  4CLN A;  1XK4 A;  1K96 A;  2O60 A;  4YGD B;  1F70 A;  3H4S E;  2KSP A;  3D0Y A;  1SL9 A;  3EVR A;  2I18 A;  3CR5 X;  1SL8 A;  3VGO A;  2KAY A;  1HQV A;  3CTN A;  4NDD A;  4USL A;  5G08 A;  2QAC A;  2GGZ A;  3LLE A;  4OCI A;  1GJY A;  2LV7 A;  3VRR A;  1SK6 D;  1IQ3 A;  2VRG A;  3ZNI A;  1EJ3 A;  2LHL A;  1CKK A;  1C07 A;  2I7A A;  1PK0 D;  1X02 A;  1K93 D;  2EHB A;  1F4Q A;  2JZI A;  3VRQ A;  2LP2 A;  1WRK A;  4JWQ A;  2LLU A;  1IJ6 A;  3AAK A;  3I5G C;  2LUC A;  1QVI Z;  2KFG A;  1A03 A;  1CFF A;  1CDM A;  2LUX A;  1FI5 A;  3I5H C;  1B47 A;  1XO5 A;  2K7B A;  1D1O A;  2M97 A;  3O78 A;  2KAX A;  2MAZ A;  2KBI A;  2Y4Q A;  2LAN A;  2NXQ A;  1QAS A;  5KU1 A;  1QIW A;  1SRA A;  1IRJ A;  2WCB A;  4YBH B;  3I5G B;  1WY9 A;  2L50 A;  2KHN A;  2E30 A;  3WHU B;  1M31 A;  1U5I A;  4C0J A;  4CFR A;  1Y6W A;  3SIB A;  3I5I B;  2L51 A;  1WDC C;  5AER A;  2Y1N A;  2OS8 B;  4GGN A;  1QX7 A;  1DT7 B;  1B7T Y;  1MR8 A;  1OMV A;  2CT9 A;  1XA5 A;  4PDZ A;  1C7W A;  2JC2 A;  3I5I C;  3GK1 A;  1YUU A;  2CNP A;  4GPL B;  3E3R A;  4BY4 A;  4MN0 A;  1WDC B;  2ISD A;  2M7N A;  1M39 A;  2EC6 C;  4GGF C;  5I2Q A;  3HX4 A;  3I5F B;  2MLE C;  1UHI A;  1JSA A;  4PHJ A;  3EKH A;  1TN4 A;  4OV2 A;  1YRU B;  2KNE A;  3JTD B;  2KOT A;  2JUL A;  3F45 A;  5HKW A;  1JUO A;  1DJZ A;  1F4O A;  3CLN A;  1OE9 B;  3D0Y B;  3CWG A;  2LLT A;  2BL0 C;  2JXC A;  2BCB A;  1KQM B;  1RTP 1;  5KTY A;  1JWD A;  3DF0 A;  3FS7 A;  1QIV A;  2M8U A;  1KQV A;  3FWB A;  3LK1 A;  4PE4 A;  1N65 A;  2KI4 C;  1LA3 A;  2KBM A;  5F6T A;  4CPV A;  1IJ5 A;  1S36 A;  3OX5 A;  3TS5 C;  3CR2 A;  5DKN A;  2JRF A;  2CBL A;  2KGB C;  1MUX A;  3CZT X;  2COL B;  1CLB A;  4I5K A;  1L2O C;  2FCE A;  1PSB A;  1UHK A;  3SG6 A;  1SCM C;  3BUW B;  1UHN A;  2O5G A;  1YUR A;  1XFY O;  3OHM B;  2KGR A;  2PMY A;  1CMG A;  1NCX A;  4IL1 A;  4WQ2 A;  1FBV A;  1VRK A;  2K0J A;  1M63 B;  3SG2 A;  1TCO B;  4GBA A;  3KO0 A;  4GAO A;  4YGE B;  1TNQ A;  2KYC A;  4DRW A;  1W7I B;  1QX2 A;  1MQ1 A;  1PUL A;  1XFX O;  3DD4 A;  1XFW O;  2WND A;  3JVT B;  1EG4 A;  4YGC B;  2M7L A;  5I8N A;  1RFJ A;  3CR4 X;  2IS9 A;  1JF0 A;  1XYD A;  3A8R A;  4NDC A;  4DUQ A;  5PAL A;  4YI8 A;  2PSR A;  5D69 A;  1OMR A;  2RGI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...