1K9PA

Crystal structure of calcium free (or apo) human s100a6
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
89
structure length
89
Chain Sequence
ACPLDQAIGLLVAIFHKYSGREGDKHTLSKKELKELIQKELTIGSKLQDAEIARLMEDLDRNKDQEVNFQEYVTFLGALALIYNEALKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords S100A6
publication title Crystal structures of S100A6 in the Ca(2+)-free and Ca(2+)-bound states: the calcium sensor mechanism of S100 proteins revealed at atomic resolution.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 30
structure length 89
sequence length 89
ec nomenclature
pdb deposition date 2001-10-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1k9pA00
1C7VA 1IJ5A 3VRQA 2WCFA 2M1KB 1A75B 2L5XB 2BCBA 2KOTA 4BY5A 4R1EA 1UHHA 2JULA 2K7OA 5F6TA 1RECA 4OVNF 1OSAA 1L2OC 4JWQA 2BL0B 1S5GY 1BU3A 1R2UA 4YGDB 1J7PA 1XYDA 1LA0A 3AKAA 5AANA 2O5GA 3PFVA 4MZLA 1RTP1 5D69A 1S5GZ 2BE6A 1RJVA 2LM5A 1XFXO 1J1DA 1F71A 4M2OA 3NXAA 4OV2A 1DJIA 3VRPA 2Y1NA 2O60A 4AOMA 1QS7A 5HKZA 2JT3A 4XJKB 1CKKA 1TCFA 5HLVA 4C0KA 1QIVA 1XO5A 1LINA 4BY4A 3EVUA 3D0YA 1XFYO 3SG7A 4YRUA 5AEQA 1MWNA 1YX8A 1HQVA 4MSPA 1GGWA 3I5HB 3DVMA 2Y4QA 1IH0A 2LAPA 3DVKA 2KYFA 1IJ6A 3O78A 3GK4X 1S1EA 1EXRA 3LL8B 1TNPA 5DKQA 1JFJA 1UP5A 1KQMC 2ZRTA 2LLSA 1TNWA 1BR4B 5JJGA 2KI6C 3FWBA 2P6BB 4F0ZB 4QJ3B 3SG2A 3OB1B 3ZNIA 4PDZA 3NSKA 4OCIA 4WQ2A 1JBAA 1MR8A 2KAYA 3ZWHA 2PASA 2KHNA 1NP8A 1L2OB 1IRJA 2K7BA 2MLEC 1JWDA 1XFUO 3M0WA 1F8HA 1WRKA 1X02A 1DJXA 3F45A 1DTLA 1SY9A 3EVRA 3I5FC 1SR6C 1PULA 2LC5A 2JT0A 2LVJA 1OOJA 1D1OA 1M46A 1QX2A 2LLTA 1B1GA 1EH2A 4CFQA 3MSEB 1CFCA 3BXKA 1TIZA 4PHKA 1IQ5A 4DUQA 1SL9A 1A03A 1RK9A 1N0YA 1QVIY 5G08A 3C1VA 2BCAA 3DVEA 4WQ3A 1Y0VH 4D1EA 1QIWA 4YGCB 1YUTA 3NSIA 2Y1MA 3TDIA 3VROA 2QACA 5FYXA 1QVIZ 4GUKA 3SG5A 1K95A 1KFXL 2PSRA 3E3RA 1CMGA 1RFJA 1PVAA 1FPWA 4PHNA 1BJFA 2L4HA 1NYAA 2JNFA 2LNKA 2M7LA 4A4BA 2DOQA 1CLLA 1SRAA 1S6CA 1Y1AA 1DJHA 2FCDA 1DJYA 5B8IB 1NIWA 1NCXA 1ZUZA 2HQ8A 2MJWB 2LHLA 5CSJA 1KQMB 1UWOA 3KEVA 2AMIA 2ZKMX 2JZIA 1K9KA 2LUCA 3BQ3A 2E30A 2BCXA 2MHHA 1OZOA 1SKTA 2LE9B 3AAKA 2ZNDA 1CMFA 4YI8A 3I5FB 1SR6B 2KI6D 3FIAA 1PALA 3PALA 1RROA 4U8DA 2ZFDA 1PRWA 2I18A 2LVIA 1ZACA 4QJ5B 2Q4UA 1NX3A 2WCEA 3CR5X 1K8UA 1SCVA 3K21A 1CM4A 3EK7A 4C0JA 2LVKA 1DMOA 1WRLA 3NSOA 2MA2A 4GBAA 3PLFB 1YRUB 1ZMZA 1IWQA 2M8UA 1MXLC 1Y1XA 2NLNA 1NCYA 1KWOC 1E8AA 5I8NA 2CCMA 1CFPA 2B1UA 1BODA 1AJ4A 3DD4A 1S36A 4GAOA 4P5OE 1EG4A 1CLMA 1V1GA 4HREE 2H61A 1FF1A 3D0YB 3WXAA 2Q91A 1S6JA 4ETOA 1J1EA 1GGZA 2MRDA 1SCMC 3VGOA 1SMGA 2WOSA 1CB1A 1PSBA 4DIRA 2JTTA 2LLUA 3PSRA 4ORBB 3FWCA 1SNLA 2K7DA 1YR5A 1M45A 1JUOA 1DF0A 3O6BA 1B9AA 2BE4A 2KFGA 3I5GC 4A4CA 4I5LB 2PVBA 1SPYA 3O2PA 1NX2A 2KBMA 1CFFA 1MF8B 1LKJA 1K93D 4IL1A 4PE0A 2WNDA 5ER4X 4DS7A 3BUOB 1PK0D 1BF5A 2CTNA 1XK4A 3D10A 2LCPA 3RM1A 4UPGA 2BKHB 3EVVA 2M49B 1KQVA 1YUUA 1DGUA 1C07A 2SASA 2LHIA 2EC6C 4CLNA 1Y6WA 2KSPA 2JQ6A 1XFWO 4YBHB 5DKNA 1FI6A 3EK4A 1KCYA 1WLZA 1KWOB 1QLSA 1KFXS 3BUNB 1ODBA 1QX7A 1GQMA 1QV1A 1JSAA 1N2DA 2HETA 4MZJA 1XVJA 4USLA 5TNCA 3IF7A 3PM8A 1V1FA 1F54A 2ZNEA 4MEWA 5CSFA 4MRYA 1WLMA 2JRFA 4GGNA 4HRGA 5KSZA 4I5NB 1QX5B 1XFVO 1XA5A 2M0RA 4NDCA 1XFZO 1SCMB 1B8RA 2FCEA 2JU0A 2LANA 2COLB 2F3ZA 1Q80A 4DRWA 1GJYA 2PMYA 4GGFA 5D7FA 2JC2A 1HT9A 1NPQA 1K2HA 2EGDA 2CNPA 1PSRA 2H61C 3KPXA 3O4YA 2Y5IA 3BYAA 3I5GB 2F2OA 1QJTA 2G9BA 5DKRA 2L4IA 1BMOA 1UHIA 1UUSA 4M2QA 3EKHA 2HF5A 2JXLA 1DJWA 1BG1A 1J7OA 1YX7A 2M29A 4MVFA 1LVCD 3QRXA 2EHBA 1JF0A 1QLKA 1N65A 4AQJA 2EC6B 1MXEA 1YRTB 5K89A 1ALWA 2KFHA 1DVIA 2OS8C 1FBVA 2NCPA 4ZCUA 1DJGA 2TN4A 3EK8A 4CIDA 2KQYA 1F4OA 1IGVA 1BLQA 1XK4C 1YUSA 4M2PA 1KFUL 1JF2A 2IS9A 2K2FA 2KFFA 1TN4A 3PATA 4FQOA 2JOJA 1K9PA 1YVHA 3OP0A 1FI5A 2LMTA 1F70A 2KNEA 1WDCC 3VRNA 5GQQC 1OQPA 2I7AA 2AUCA 1VRKA 3KHEA 2ZN9A 1DGVA 4NDDA 3KF9A 1U5IA 2LMUA 1TRFA 3TDUA 1EG3A 4PE7A 2FOTA 2L2EA 2H2KA 3OHMB 3NSLA 2K8MB 2RGIA 2K61A 2ZN8A 3BOWA 3GOFA 1NX1A 1TTXA 2NXQA 5AXIA 3TUYC 1TCOB 3IQOA 2F2PA 2BBNA 2I94A 5KTYA 1QV0A 1UURA 1CDLA 3SG3A 2HQWA 1F4QA 1UHJA 4GGFC 5CPVA 5ER5A 4QJ4B 1DT7B 2CXJA 3BUWB 1DF0B 2I2RE 2L0PA 2F33A 2QPTA 3BUMB 3VRRA 2V53A 1CNPA 1CDNA 1M31A 1RWYA 2JNXA 2E6WA 1B8LA 3SG4A 1ZOTB 1OMVA 4PE4A 2OS8B 1KK7Y 4NDBA 3KO0A 3IQQA 1OMDA 2GGZA 1NUBA 2JXCA 1B4CA 2L98A 1A2XA 3PN7B 4ORAB 2MLFC 3CGAA 2A4JA 1BR1B 1M39A 2F8PA 5HLOA 4CPVA 1G33A 1WDCB 2BKIB 1WY9A 4GFTA 4JPZB 1QATA 1TNQA 3CR2A 3DF0B 1BOCA 1SBJA 5PALA 3HCMA 3I5IC 3OX5A 5J3XA 4AQIA 4DCKA 1KK8C 2KBIA 4CFRA 1TOPA 3TDZA 1EJ3A 1WRZA 1A29A 1ALVA 3TUYB 5I2LA 4YI9A 2M1UA 3AAJA 2M7NA 2PALA 3FS7A 2ISDA 1CFDA 4C0LA 4YGBB 1AP4A 1B47A 2GV5A 1AVSA 1A75A 4MBEA 4TNCA 1YTZC 3WNXB 2OPOA 1QXPA 4NQGA 2LP3A 1KSMA 3DF0A 5I2OA 1OMRA 2KAVA 4PHMA 3SIAA 2MAZA 2JWWA 1OZSA 2PRUA 3TZ1A 4PCWA 2CT9A 4GPLB 3CWGA 4ZCVA 1FW4A 5CSIA 3RLZA 1K94A 2WORA 2LP2A 2LVVA 2JT8A 4OR9B 4Q04A 2GGMA 2WC8A 1AJ5A 4YGAA 1K9UA 4PALA 1LXFC 1KFUS 1JC2A 1NSHA 1B7TY 3TS5C 1NWDA 5JOLA 1K96A 4XJKA 4MN0A 2WCBA 1IQ3A 1KSOA 1J55A 5I2QA 1H8BA 3A8RA 1LA3A 1F55A 5AFPA 1B7TZ 3I5IB 1PVBA 4I5KA 3WHUB 5KU1A 1IG5A 2L51A 5HKWA 3H4SE 3CTNA 1KK8B 4JQ0D 1G8IA 2HPSA 2M9GA 2M97A 4ICBA 5HYDA 1ZFSA 2KI4C 3LK0A 1SL8A 4PHJA 1QASA 1M63B 3JVTC 2LV7A 2SCPA 1U5IB 4GNKB 2MBXA 1UHKA 5CSNA 1S26D 1L7ZA 1SK6D 4YGEB 3GK1A 1QTXA 2BBMA 2FJUB 2R2IA 2ZRSA 1A4PA 1UHNA 1CTRA 3SJSA 4MRXA 2L50A 2KGBC 3BOWB 3PN7C 1J7RA 3JTDC 4HRHA 3CLNA 4I5JA 1DJZA 5AERA 1AHRA 2OTGC 4N1FA 1YURA 4HSZA 2AAOA 1CDMA 1K90D 2CBLA 2K7CA 1SW8A 3CR4X 1IKUA 4PE1A 1AK8A 3SG6A 1S3PA 2K0JA 3OB2B 2VRGA 3OX6A 3ICBA 2KQ6A 1NX0A 1SL7A 1W7IB 4MZKA 3CZTX 2KGRA 2BL0C 3TS5B 3EKJA 2JTZA 5BPJA 3SIBA 1Y1UA 3LCPC 2KYCA 5IBWA 4OKHA 1J7QA 1CM1A 1R6PA 1B8CA 1OE9B 3HX4A 2KAXA 1EL4A 2LUXA 2JPTA 2BECA 4N5XA 1TNXA 2NCOA 1CDPA 4P2YB 2KDHA 1JFKA 1MQ1A 1MUXA 3A4UB 4FTGA 2M3WA 4N1GA 3GK2A 4ORCB 4E68A 2KI4B 1H4BA 4MLWA 1AUIB 1G4YR 2G2BA 3LLEA 4WRIA 3JVTB 1MHOA 3I5HC 3CS1A 2NZ0A 1W7JB 2K2AA 1YVLA 4L9MA 1CLBA 4XYNA 3AKBA 3BUXB 1S6IA 1SYMA 1NCZA 3LK1A 1C7WA 2F3YA 1KK7Z 2D8NA 3JTDB 2LMVA 1BT6A 5HKYA 3DVJA 2OTGB 3WHTB
chains in the Genus database with same CATH superfamily
1C7VA 1IJ5A 3VRQA 2WCFA 3B6XA 2M1KB 1A75B 1ORGA 2L5XB 3PJIA 2BCBA 2KOTA 4BY5A 4R1EA 1SSEB 1UHHA 1DEKA 2JULA 1RECA 2K7OA 4OVNF 5F6TA 1OSAA 1L2OC 4JWQA 2BL0B 3PM2A 1S5GY 1BU3A 1R2UA 2QEOA 4YGDB 1J7PA 1XYDA 1LA0A 3AKAA 3BFHA 5AANA 2O5GA 3PFVA 4MZLA 1RTP1 5D69A 1S5GZ 2BE6A 1RJVA 2LM5A 3D76A 1XFXO 1J1DA 1F71A 4M2OA 5HL1A 3NXAA 4OV2A 1DJIA 3VRPA 3R1VA 2Y1NA 3N7HA 2O60A 4AOMA 1QS7A 5HKZA 2JT3A 4XJKB 1CKKA 1TCFA 5HLVA 4C0KA 1QIVA 1XO5A 1LINA 1T14A 4BY4A 3EVUA 3D0YA 1XFYO 3SG7A 4YRUA 5AEQA 1MWNA 2JPOA 1YX8A 1HQVA 2WCMA 4MSPA 1GGWA 2FJYA 3I5HB 3DVMA 2Y4QA 1IH0A 2LAPA 3DVKA 2KYFA 1IJ6A 3O78A 3GK4X 1OOHA 1S1EA 2K60A 1EXRA 3LL8B 1TNPA 5DKQA 1JFJA 1UP5A 1KQMC 2ZRTA 2LLSA 1TNWA 1BR4B 5JJGA 2KI6C 3FWBA 3B87A 2P6BB 1QWVA 4QJ3B 3SG2A 3OB1B 3L4LA 3ZNIA 4F0ZB 4PDZA 3NSKA 4OCIA 4WQ2A 1JBAA 1MR8A 2KAYA 3ZWHA 2PASA 2KHNA 1NP8A 1L2OB 1IRJA 2K7BA 2MLEC 3R1OA 1XFUO 1JWDA 3M0WA 1F8HA 1WRKA 1X02A 1DJXA 3F45A 1DTLA 1SY9A 3EVRA 3B86A 3I5FC 1SR6C 1PULA 2LC5A 2JT0A 2LVJA 1OOJA 1D1OA 1M46A 1QX2A 2LLTA 1B1GA 1EH2A 4CFQA 3MSEB 1CFCA 3BXKA 1TIZA 4PHKA 1IQ5A 4DUQA 1SL9A 1A03A 5D3OA 1RK9A 1N0YA 1QVIY 5G08A 3C1VA 2BCAA 3DVEA 4WQ3A 1Y0VH 4D1EA 1QIWA 4YGCB 1YUTA 3NSIA 2Y1MA 3TDIA 1C3YA 3VROA 2QACA 5FYXA 1QVIZ 4GUKA 3SG5A 1K95A 1KFXL 2PSRA 3E3RA 1CMGA 1RFJA 1PVAA 1FPWA 4PHNA 1BJFA 2L4HA 3D77A 1NYAA 2JNFA 2LNKA 1TUZA 2M7LA 4A4BA 2DOQA 1CLLA 1SRAA 1S6CA 1Y1AA 1GM0A 1DJHA 2FCDA 1DJYA 5B8IB 2PQLA 1NIWA 1NCXA 1ZUZA 2HQ8A 2MJWB 2P71A 2LHLA 5CSJA 1KQMB 1UWOA 3S0AA 1DQEA 5DICA 3KEVA 2KLEA 2AMIA 2ZKMX 2JZIA 1K9KA 2LUCA 4KYNA 3BQ3A 2E30A 2BCXA 2MHHA 1OZOA 1SKTA 2LE9B 3AAKA 2ZNDA 3QMEA 1CMFA 4YI8A 3I5FB 1SR6B 1P28A 2KI6D 1PALA 3FIAA 1RROA 3PALA 3D78A 5EL2A 4U8DA 2ZFDA 3L47A 1PRWA 2I18A 2LVIA 1ZACA 4QJ5B 2Q4UA 1NX3A 2WCEA 3CR5X 1K8UA 1SCVA 3K21A 1CM4A 3EK7A 4C0JA 2LVKA 1DMOA 1WRLA 3NSOA 2MA2A 4GBAA 3BFBA 3PLFB 3CZ2A 1YRUB 1ZMZA 1IWQA 2M8UA 1MXLC 1Y1XA 2QEVA 2NLNA 1NCYA 1KWOC 1W9ZA 1E8AA 5I8NA 2CCMA 1CFPA 2B1UA 1BODA 1AJ4A 3DD4A 1S36A 4GAOA 1XFRA 4P5OE 1EG4A 1CLMA 1V1GA 4HREE 2H61A 1FF1A 3D0YB 3WXAA 2Q91A 1S6JA 4ETOA 1J1EA 2WCJA 1GGZA 2MRDA 1SCMC 3DXLA 3VGOA 1SMGA 2WOSA 1CB1A 1PSBA 4INXA 2JTTA 2LLUA 4DIRA 3PSRA 4ORBB 3FWCA 3R72A 1SNLA 2K7DA 3Q8IA 1YR5A 2QDIA 1M45A 1JUOA 1DF0A 3O6BA 1C3ZA 1B9AA 2BE4A 2KFGA 3I5GC 4A4CA 4I5LB 2PVBA 1SPYA 3O2PA 1NX2A 2KBMA 1CFFA 1MF8B 1LKJA 3CZ1A 1K93D 4IL1A 4PE0A 2WNDA 5ER4X 4DS7A 3CABA 3BUOB 1PK0D 1BF5A 2CTNA 1XK4A 3D10A 2LCPA 3K1EA 3RM1A 4UPGA 2BKHB 3EVVA 2M49B 1KQVA 1YUUA 1DGUA 1C07A 2SASA 2LHIA 2EC6C 4CLNA 1Y6WA 2KSPA 2JQ6A 1XFWO 4YBHB 5DKNA 1FI6A 3EK4A 1KCYA 1WLZA 1KWOB 1QLSA 1KFXS 3BUNB 1ODBA 1QX7A 1GQMA 1QV1A 1JSAA 1N2DA 2HETA 4MZJA 1XVJA 2WCHA 4USLA 3IF7A 3PM8A 5TNCA 1V1FA 1F54A 2ZNEA 1Z4HA 2H8VA 4MEWA 3OGNA 5CSFA 4MRYA 1WLMA 2JRFA 4GGNA 4HRGA 3SS4A 5KSZA 4I5NB 1QX5B 1XFVO 1XA5A 2M0RA 4NDCA 4PT1A 1XFZO 1SCMB 1B8RA 2FCEA 2JU0A 3RZSA 3SS5A 2LANA 2COLB 2F3ZA 1Q80A 4DRWA 1GJYA 2PMYA 4GGFA 5D7FA 2JC2A 1HT9A 1NPQA 5FI6A 1K2HA 2EGDA 2CNPA 1PSRA 2H61C 3KPXA 3O4YA 2Y5IA 3BYAA 3I5GB 2F2OA 1QJTA 2G9BA 4FQTA 5DKRA 2WCKA 2L4IA 5FI2A 1BMOA 1UHIA 1UUSA 4M2QA 3EKHA 2HF5A 2JXLA 3NHIA 1DJWA 1Z2CB 2KLDA 1BG1A 1J7OA 3FE9A 1YX7A 2M29A 4MVFA 1LVCD 4INWA 3QRXA 2EHBA 1JF0A 1QLKA 1N65A 3VB1A 4AQJA 2EC6B 1MXEA 1YRTB 5K89A 1ALWA 2KFHA 1DVIA 2OS8C 5FI7A 1FBVA 2NCPA 4ZCUA 1DJGA 2BAPA 2TN4A 3EK8A 4CIDA 2KQYA 1F4OA 1IGVA 1BLQA 1XK4C 3R1PA 1YUSA 4M2PA 1KFUL 1JF2A 2IS9A 2K2FA 2KFFA 1TN4A 3PATA 4FQOA 2JOJA 1K9PA 1YVHA 4OZDA 3OP0A 1FI5A 2LMTA 1F70A 2KNEA 1WDCC 3VRNA 5GQQC 1OQPA 2I7AA 2AUCA 1VRKA 3KHEA 2ZN9A 1DGVA 4NDDA 3KF9A 1U5IA 2LMUA 1TRFA 3TDUA 1EG3A 4PE7A 2FOTA 2L2EA 2H2KA 3OHMB 3NSLA 2K8MB 2RGIA 2K61A 2ZN8A 3BOWA 3GOFA 4JD9A 1NX1A 1TTXA 2NXQA 5AXIA 3UO9A 2P70A 3TUYC 3BJHA 1TCOB 3IQOA 3CYZA 2F2PA 2BBNA 2I94A 3OBVA 5KTYA 1QV0A 1UURA 1CDLA 3SG3A 2HQWA 1F4QA 1UHJA 4GGFC 5CPVA 5ER5A 3FE8A 3D73A 2CXJA 4QJ4B 1DT7B 3BUWB 1DF0B 2I2RE 2L0PA 2F33A 2QPTA 3BUMB 3V2LA 3VRRA 2V53A 1CNPA 2QEHA 1CDNA 1M31A 1RWYA 2JNXA 2E6WA 1B8LA 3SG4A 1ZOTB 2WC5A 1OMVA 4PE4A 2OS8B 1KK7Y 3B88A 2ERBA 3KO0A 4NDBA 3IQQA 3S0DA 3L4AA 1OMDA 2GGZA 3S0FA 1NUBA 2JXCA 1B4CA 2L98A 4JKTA 1A2XA 3PN7B 4ORAB 1IIOA 2MLFC 3CGAA 2A4JA 1BR1B 3CZ0A 1M39A 2F8PA 5HLOA 4CPVA 1G33A 1WDCB 2BKIB 1WY9A 4GFTA 4JPZB 1QATA 1TNQA 3CR2A 3DF0B 1BOCA 1SBJA 3DY9A 5PALA 3HCMA 3I5IC 3OX5A 5J3XA 2YGUA 4AQIA 3UNWA 4DCKA 1KK8C 2KBIA 4CFRA 1TOPA 3TDZA 1OW4A 1OOFA 1EJ3A 1WRZA 1A29A 1ALVA 3TUYB 5I2LA 3EG5B 4YI9A 1TWOA 2M1UA 2M7NA 2PALA 3AAJA 3FS7A 2ISDA 1CFDA 3SS3A 4C0LA 4YGBB 1AP4A 1B47A 2GV5A 1AVSA 1A75A 4MBEA 4TNCA 1YTZC 3DYEA 3WNXB 2OPOA 1QXPA 4NQGA 2LP3A 1KSMA 3DF0A 5I2OA 1OMRA 3B7AA 3CDNA 2KAVA 4PHMA 3SIAA 2MAZA 2JWWA 1OZSA 2PRUA 3TZ1A 1TUJA 3DZTA 3NHTA 4PCWA 2CT9A 2L2CA 4GPLB 3CWGA 4ZCVA 1FW4A 5CSIA 3RLZA 1K94A 2WORA 2LP2A 2LVVA 2JT8A 4OR9B 4Q04A 2GGMA 2WC8A 1AJ5A 4YGAA 1K9UA 4PALA 1LXFC 1KFUS 3S0EA 1JC2A 1NSHA 1B7TY 3TS5C 1NWDA 5JOLA 1K96A 4XJKA 4MN0A 2WCBA 1IQ3A 1KSOA 1J55A 2PYQA 5I2QA 1H8BA 3A8RA 1LA3A 1F55A 5AFPA 1B7TZ 2BNXA 3I5IB 2QEBA 1PVBA 4I5KA 3WHUB 5KU1A 1IG5A 2L51A 3S0GA 5HKWA 3H4SE 3CTNA 1KK8B 1LS8A 4F7FA 4JQ0D 1G8IA 2HPSA 2M9GA 2L5YA 2M97A 4ICBA 5HYDA 1ZFSA 1DELA 2KI4C 3LK0A 1SL8A 4PHJA 1QASA 1M63B 3JVTC 2LV7A 2SCPA 1U5IB 4GNKB 2MBXA 1UHKA 5CSNA 1S26D 1L7ZA 1SK6D 4YGEB 3GK1A 1QTXA 2BBMA 2FJUB 2R2IA 2ZRSA 1A4PA 1UHNA 1CTRA 4IJ7A 3SJSA 4MRXA 2L50A 2KGBC 3BOWB 1OOIX 3PN7C 1J7RA 3JTDC 4HRHA 3CLNA 4I5JA 1DJZA 5AERA 1AHRA 2OTGC 4N1FA 1YURA 4HSZA 2AAOA 1CDMA 1K90D 2CBLA 2K7CA 1SW8A 3CR4X 1IKUA 4PE1A 1AK8A 3SG6A 1S3PA 2K0JA 3D75A 3OB2B 2VRGA 3OX6A 3ICBA 2KQ6A 1NX0A 1SL7A 1W7IB 4MZKA 3CZTX 2KGRA 1OOGA 2BL0C 3S0BA 3TS5B 3EKJA 2JTZA 5BPJA 3SIBA 1Y1UA 3IVTA 3LCPC 2KYCA 5IBWA 4OKHA 1J7QA 1CM1A 1R6PA 1B8CA 1OE9B 3HX4A 2KAXA 3D74A 1EL4A 2LUXA 2JPTA 2BECA 3FE6A 4N5XA 1TNXA 2NCOA 1CDPA 4P2YB 2KDHA 1JFKA 1MQ1A 3BFAA 1MUXA 3A4UB 4FTGA 2M3WA 4N1GA 3GK2A 4ORCB 4E68A 2WC6A 2KI4B 1H4BA 3O4XA 4MLWA 1AUIB 1G4YR 2G2BA 3LLEA 4WRIA 3JVTB 2WCLA 2GTEA 1MHOA 3I5HC 3CS1A 2NZ0A 1W7JB 2K2AA 1YVLA 3NGVA 4L9MA 4XYNA 3AKBA 1CLBA 3BUXB 1S6IA 2KPHA 1SYMA 1DC1A 1NCZA 3LK1A 1C7WA 2F3YA 1KK7Z 2D8NA 3JTDB 2LMVA 1BT6A 5HKYA 5I94A 3DVJA 2OTGB 3WHTB
chains in the Genus database with same CATH topology
1C7VA 1IJ5A 3VRQA 2WCFA 2M1KB 1A75B 2L5XB 2BCBA 2KOTA 4BY5A 4R1EA 1UHHA 2JULA 2K7OA 5F6TA 1RECA 4OVNF 1OSAA 1L2OC 4JWQA 2BL0B 1S5GY 1BU3A 1R2UA 4YGDB 1J7PA 1XYDA 1LA0A 3AKAA 5AANA 2O5GA 3PFVA 4MZLA 1RTP1 5D69A 1S5GZ 2BE6A 1RJVA 2LM5A 1XFXO 1J1DA 1F71A 4M2OA 3NXAA 4OV2A 1DJIA 3VRPA 2Y1NA 2O60A 4AOMA 1QS7A 5HKZA 2JT3A 4XJKB 1CKKA 1TCFA 5HLVA 4C0KA 1QIVA 1XO5A 1LINA 4BY4A 3EVUA 3D0YA 1XFYO 3SG7A 4YRUA 5AEQA 1MWNA 1YX8A 1HQVA 4MSPA 1GGWA 3I5HB 3DVMA 2Y4QA 1IH0A 2LAPA 3DVKA 2KYFA 1IJ6A 3O78A 3GK4X 1S1EA 1EXRA 3LL8B 1TNPA 5DKQA 1JFJA 1UP5A 1KQMC 2ZRTA 2LLSA 1TNWA 1BR4B 5JJGA 2KI6C 3FWBA 2P6BB 4F0ZB 4QJ3B 3SG2A 3OB1B 3ZNIA 4PDZA 3NSKA 4OCIA 4WQ2A 1JBAA 1MR8A 2KAYA 3ZWHA 2PASA 2KHNA 1NP8A 1L2OB 1IRJA 2K7BA 2MLEC 1JWDA 1XFUO 3M0WA 1F8HA 1WRKA 1X02A 1DJXA 3F45A 1DTLA 1SY9A 3EVRA 3I5FC 1SR6C 1PULA 2LC5A 2JT0A 2LVJA 1OOJA 1D1OA 1M46A 1QX2A 2LLTA 1B1GA 1EH2A 4CFQA 3MSEB 1CFCA 3BXKA 1TIZA 4PHKA 1IQ5A 4DUQA 1SL9A 1A03A 1RK9A 1N0YA 1QVIY 5G08A 3C1VA 2BCAA 3DVEA 4WQ3A 1Y0VH 4D1EA 1QIWA 4YGCB 1YUTA 3NSIA 2Y1MA 3TDIA 3VROA 2QACA 5FYXA 1QVIZ 4GUKA 3SG5A 1K95A 1KFXL 2PSRA 3E3RA 1CMGA 1RFJA 1PVAA 1FPWA 4PHNA 1BJFA 2L4HA 1NYAA 2JNFA 2LNKA 2M7LA 4A4BA 2DOQA 1CLLA 1SRAA 1S6CA 1Y1AA 1DJHA 2FCDA 1DJYA 5B8IB 1NIWA 1NCXA 1ZUZA 2HQ8A 2MJWB 2LHLA 5CSJA 1KQMB 1UWOA 3KEVA 2AMIA 2ZKMX 2JZIA 1K9KA 2LUCA 3BQ3A 2E30A 2BCXA 2MHHA 1OZOA 1SKTA 2LE9B 3AAKA 2ZNDA 1CMFA 4YI8A 3I5FB 1SR6B 2KI6D 3FIAA 1PALA 3PALA 1RROA 4U8DA 2ZFDA 1PRWA 2I18A 2LVIA 1ZACA 4QJ5B 2Q4UA 1NX3A 2WCEA 3CR5X 1K8UA 1SCVA 3K21A 1CM4A 3EK7A 4C0JA 2LVKA 1DMOA 1WRLA 3NSOA 2MA2A 4GBAA 3PLFB 1YRUB 1ZMZA 1IWQA 2M8UA 1MXLC 1Y1XA 2NLNA 1NCYA 1KWOC 1E8AA 5I8NA 2CCMA 1CFPA 2B1UA 1BODA 1AJ4A 3DD4A 1S36A 4GAOA 4P5OE 1EG4A 1CLMA 1V1GA 4HREE 2H61A 1FF1A 3D0YB 3WXAA 2Q91A 1S6JA 4ETOA 1J1EA 1GGZA 2MRDA 1SCMC 3VGOA 1SMGA 2WOSA 1CB1A 1PSBA 4DIRA 2JTTA 2LLUA 3PSRA 4ORBB 3FWCA 1SNLA 2K7DA 1YR5A 1M45A 1JUOA 1DF0A 3O6BA 1B9AA 2BE4A 2KFGA 3I5GC 4A4CA 4I5LB 2PVBA 1SPYA 3O2PA 1NX2A 2KBMA 1CFFA 1MF8B 1LKJA 1K93D 4IL1A 4PE0A 2WNDA 5ER4X 4DS7A 3BUOB 1PK0D 1BF5A 2CTNA 1XK4A 3D10A 2LCPA 3RM1A 4UPGA 2BKHB 3EVVA 2M49B 1KQVA 1YUUA 1DGUA 1C07A 2SASA 2LHIA 2EC6C 4CLNA 1Y6WA 2KSPA 2JQ6A 1XFWO 4YBHB 5DKNA 1FI6A 3EK4A 1KCYA 1WLZA 1KWOB 1QLSA 1KFXS 3BUNB 1ODBA 1QX7A 1GQMA 1QV1A 1JSAA 1N2DA 2HETA 4MZJA 1XVJA 4USLA 5TNCA 3IF7A 3PM8A 1V1FA 1F54A 2ZNEA 4MEWA 5CSFA 4MRYA 1WLMA 2JRFA 4GGNA 4HRGA 5KSZA 4I5NB 1QX5B 1XFVO 1XA5A 2M0RA 4NDCA 1XFZO 1SCMB 1B8RA 2FCEA 2JU0A 2LANA 2COLB 2F3ZA 1Q80A 4DRWA 1GJYA 2PMYA 4GGFA 5D7FA 2JC2A 1HT9A 1NPQA 1K2HA 2EGDA 2CNPA 1PSRA 2H61C 3KPXA 3O4YA 2Y5IA 3BYAA 3I5GB 2F2OA 1QJTA 2G9BA 5DKRA 2L4IA 1BMOA 1UHIA 1UUSA 4M2QA 3EKHA 2HF5A 2JXLA 1DJWA 1BG1A 1J7OA 1YX7A 2M29A 4MVFA 1LVCD 3QRXA 2EHBA 1JF0A 1QLKA 1N65A 4AQJA 2EC6B 1MXEA 1YRTB 5K89A 1ALWA 2KFHA 1DVIA 2OS8C 1FBVA 2NCPA 4ZCUA 1DJGA 2TN4A 3EK8A 4CIDA 2KQYA 1F4OA 1IGVA 1BLQA 1XK4C 1YUSA 4M2PA 1KFUL 1JF2A 2IS9A 2K2FA 2KFFA 1TN4A 3PATA 4FQOA 2JOJA 1K9PA 1YVHA 3OP0A 1FI5A 2LMTA 1F70A 2KNEA 1WDCC 3VRNA 5GQQC 1OQPA 2I7AA 2AUCA 1VRKA 3KHEA 2ZN9A 1DGVA 4NDDA 3KF9A 1U5IA 2LMUA 1TRFA 3TDUA 1EG3A 4PE7A 2FOTA 2L2EA 2H2KA 3OHMB 3NSLA 2K8MB 2RGIA 2K61A 2ZN8A 3BOWA 3GOFA 1NX1A 1TTXA 2NXQA 5AXIA 3TUYC 1TCOB 3IQOA 2F2PA 2BBNA 2I94A 5KTYA 1QV0A 1UURA 1CDLA 3SG3A 2HQWA 1F4QA 1UHJA 4GGFC 5CPVA 5ER5A 4QJ4B 1DT7B 2CXJA 3BUWB 1DF0B 2I2RE 2L0PA 2F33A 2QPTA 3BUMB 3VRRA 2V53A 1CNPA 1CDNA 1M31A 1RWYA 2JNXA 2E6WA 1B8LA 3SG4A 1ZOTB 1OMVA 4PE4A 2OS8B 1KK7Y 4NDBA 3KO0A 3IQQA 1OMDA 2GGZA 1NUBA 2JXCA 1B4CA 2L98A 1A2XA 3PN7B 4ORAB 2MLFC 3CGAA 2A4JA 1BR1B 1M39A 2F8PA 5HLOA 4CPVA 1G33A 1WDCB 2BKIB 1WY9A 4GFTA 4JPZB 1QATA 1TNQA 3CR2A 3DF0B 1BOCA 1SBJA 5PALA 3HCMA 3I5IC 3OX5A 5J3XA 4AQIA 4DCKA 1KK8C 2KBIA 4CFRA 1TOPA 3TDZA 1EJ3A 1WRZA 1A29A 1ALVA 3TUYB 5I2LA 4YI9A 2M1UA 3AAJA 2M7NA 2PALA 3FS7A 2ISDA 1CFDA 4C0LA 4YGBB 1AP4A 1B47A 2GV5A 1AVSA 1A75A 4MBEA 4TNCA 1YTZC 3WNXB 2OPOA 1QXPA 4NQGA 2LP3A 1KSMA 3DF0A 5I2OA 1OMRA 2KAVA 4PHMA 3SIAA 2MAZA 2JWWA 1OZSA 2PRUA 3TZ1A 4PCWA 2CT9A 4GPLB 3CWGA 4ZCVA 1FW4A 5CSIA 3RLZA 1K94A 2WORA 2LP2A 2LVVA 2JT8A 4OR9B 4Q04A 2GGMA 2WC8A 1AJ5A 4YGAA 1K9UA 4PALA 1LXFC 1KFUS 1JC2A 1NSHA 1B7TY 3TS5C 1NWDA 5JOLA 1K96A 4XJKA 4MN0A 2WCBA 1IQ3A 1KSOA 1J55A 5I2QA 1H8BA 3A8RA 1LA3A 1F55A 5AFPA 1B7TZ 3I5IB 1PVBA 4I5KA 3WHUB 5KU1A 1IG5A 2L51A 5HKWA 3H4SE 3CTNA 1KK8B 4JQ0D 1G8IA 2HPSA 2M9GA 2M97A 4ICBA 5HYDA 1ZFSA 2KI4C 3LK0A 1SL8A 4PHJA 1QASA 1M63B 3JVTC 2LV7A 2SCPA 1U5IB 4GNKB 2MBXA 1UHKA 5CSNA 1S26D 1L7ZA 1SK6D 4YGEB 3GK1A 1QTXA 2BBMA 2FJUB 2R2IA 2ZRSA 1A4PA 1UHNA 1CTRA 3SJSA 4MRXA 2L50A 2KGBC 3BOWB 3PN7C 1J7RA 3JTDC 4HRHA 3CLNA 4I5JA 1DJZA 5AERA 1AHRA 2OTGC 4N1FA 1YURA 4HSZA 2AAOA 1CDMA 1K90D 2CBLA 2K7CA 1SW8A 3CR4X 1IKUA 4PE1A 1AK8A 3SG6A 1S3PA 2K0JA 3OB2B 2VRGA 3OX6A 3ICBA 2KQ6A 1NX0A 1SL7A 1W7IB 4MZKA 3CZTX 2KGRA 2BL0C 3TS5B 3EKJA 2JTZA 5BPJA 3SIBA 1Y1UA 3LCPC 2KYCA 5IBWA 4OKHA 1J7QA 1CM1A 1R6PA 1B8CA 1OE9B 3HX4A 2KAXA 1EL4A 2LUXA 2JPTA 2BECA 4N5XA 1TNXA 2NCOA 1CDPA 4P2YB 2KDHA 1JFKA 1MQ1A 1MUXA 3A4UB 4FTGA 2M3WA 4N1GA 3GK2A 4ORCB 4E68A 2KI4B 1H4BA 4MLWA 1AUIB 1G4YR 2G2BA 3LLEA 4WRIA 3JVTB 1MHOA 3I5HC 3CS1A 2NZ0A 1W7JB 2K2AA 1YVLA 4L9MA 1CLBA 4XYNA 3AKBA 3BUXB 1S6IA 1SYMA 1NCZA 3LK1A 1C7WA 2F3YA 1KK7Z 2D8NA 3JTDB 2LMVA 1BT6A 5HKYA 3DVJA 2OTGB 3WHTB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1C7V A;  1IJ5 A;  3VRQ A;  2WCF A;  2M1K B;  1A75 B;  2L5X B;  2BCB A;  2KOT A;  4BY5 A;  4R1E A;  1UHH A;  2JUL A;  2K7O A;  5F6T A;  1REC A;  4OVN F;  1OSA A;  1L2O C;  4JWQ A;  2BL0 B;  1S5G Y;  1BU3 A;  1R2U A;  4YGD B;  1J7P A;  1XYD A;  1LA0 A;  3AKA A;  5AAN A;  2O5G A;  3PFV A;  4MZL A;  1RTP 1;  5D69 A;  1S5G Z;  2BE6 A;  1RJV A;  2LM5 A;  1XFX O;  1J1D A;  1F71 A;  4M2O A;  3NXA A;  4OV2 A;  1DJI A;  3VRP A;  2Y1N A;  2O60 A;  4AOM A;  1QS7 A;  5HKZ A;  2JT3 A;  4XJK B;  1CKK A;  1TCF A;  5HLV A;  4C0K A;  1QIV A;  1XO5 A;  1LIN A;  4BY4 A;  3EVU A;  3D0Y A;  1XFY O;  3SG7 A;  4YRU A;  5AEQ A;  1MWN A;  1YX8 A;  1HQV A;  4MSP A;  1GGW A;  3I5H B;  3DVM A;  2Y4Q A;  1IH0 A;  2LAP A;  3DVK A;  2KYF A;  1IJ6 A;  3O78 A;  3GK4 X;  1S1E A;  1EXR A;  3LL8 B;  1TNP A;  5DKQ A;  1JFJ A;  1UP5 A;  1KQM C;  2ZRT A;  2LLS A;  1TNW A;  1BR4 B;  5JJG A;  2KI6 C;  3FWB A;  2P6B B;  4F0Z B;  4QJ3 B;  3SG2 A;  3OB1 B;  3ZNI A;  4PDZ A;  3NSK A;  4OCI A;  4WQ2 A;  1JBA A;  1MR8 A;  2KAY A;  3ZWH A;  2PAS A;  2KHN A;  1NP8 A;  1L2O B;  1IRJ A;  2K7B A;  2MLE C;  1JWD A;  1XFU O;  3M0W A;  1F8H A;  1WRK A;  1X02 A;  1DJX A;  3F45 A;  1DTL A;  1SY9 A;  3EVR A;  3I5F C;  1SR6 C;  1PUL A;  2LC5 A;  2JT0 A;  2LVJ A;  1OOJ A;  1D1O A;  1M46 A;  1QX2 A;  2LLT A;  1B1G A;  1EH2 A;  4CFQ A;  3MSE B;  1CFC A;  3BXK A;  1TIZ A;  4PHK A;  1IQ5 A;  4DUQ A;  1SL9 A;  1A03 A;  1RK9 A;  1N0Y A;  1QVI Y;  5G08 A;  3C1V A;  2BCA A;  3DVE A;  4WQ3 A;  1Y0V H;  4D1E A;  1QIW A;  4YGC B;  1YUT A;  3NSI A;  2Y1M A;  3TDI A;  3VRO A;  2QAC A;  5FYX A;  1QVI Z;  4GUK A;  3SG5 A;  1K95 A;  1KFX L;  2PSR A;  3E3R A;  1CMG A;  1RFJ A;  1PVA A;  1FPW A;  4PHN A;  1BJF A;  2L4H A;  1NYA A;  2JNF A;  2LNK A;  2M7L A;  4A4B A;  2DOQ A;  1CLL A;  1SRA A;  1S6C A;  1Y1A A;  1DJH A;  2FCD A;  1DJY A;  5B8I B;  1NIW A;  1NCX A;  1ZUZ A;  2HQ8 A;  2MJW B;  2LHL A;  5CSJ A;  1KQM B;  1UWO A;  3KEV A;  2AMI A;  2ZKM X;  2JZI A;  1K9K A;  2LUC A;  3BQ3 A;  2E30 A;  2BCX A;  2MHH A;  1OZO A;  1SKT A;  2LE9 B;  3AAK A;  2ZND A;  1CMF A;  4YI8 A;  3I5F B;  1SR6 B;  2KI6 D;  3FIA A;  1PAL A;  3PAL A;  1RRO A;  4U8D A;  2ZFD A;  1PRW A;  2I18 A;  2LVI A;  1ZAC A;  4QJ5 B;  2Q4U A;  1NX3 A;  2WCE A;  3CR5 X;  1K8U A;  1SCV A;  3K21 A;  1CM4 A;  3EK7 A;  4C0J A;  2LVK A;  1DMO A;  1WRL A;  3NSO A;  2MA2 A;  4GBA A;  3PLF B;  1YRU B;  1ZMZ A;  1IWQ A;  2M8U A;  1MXL C;  1Y1X A;  2NLN A;  1NCY A;  1KWO C;  1E8A A;  5I8N A;  2CCM A;  1CFP A;  2B1U A;  1BOD A;  1AJ4 A;  3DD4 A;  1S36 A;  4GAO A;  4P5O E;  1EG4 A;  1CLM A;  1V1G A;  4HRE E;  2H61 A;  1FF1 A;  3D0Y B;  3WXA A;  2Q91 A;  1S6J A;  4ETO A;  1J1E A;  1GGZ A;  2MRD A;  1SCM C;  3VGO A;  1SMG A;  2WOS A;  1CB1 A;  1PSB A;  4DIR A;  2JTT A;  2LLU A;  3PSR A;  4ORB B;  3FWC A;  1SNL A;  2K7D A;  1YR5 A;  1M45 A;  1JUO A;  1DF0 A;  3O6B A;  1B9A A;  2BE4 A;  2KFG A;  3I5G C;  4A4C A;  4I5L B;  2PVB A;  1SPY A;  3O2P A;  1NX2 A;  2KBM A;  1CFF A;  1MF8 B;  1LKJ A;  1K93 D;  4IL1 A;  4PE0 A;  2WND A;  5ER4 X;  4DS7 A;  3BUO B;  1PK0 D;  1BF5 A;  2CTN A;  1XK4 A;  3D10 A;  2LCP A;  3RM1 A;  4UPG A;  2BKH B;  3EVV A;  2M49 B;  1KQV A;  1YUU A;  1DGU A;  1C07 A;  2SAS A;  2LHI A;  2EC6 C;  4CLN A;  1Y6W A;  2KSP A;  2JQ6 A;  1XFW O;  4YBH B;  5DKN A;  1FI6 A;  3EK4 A;  1KCY A;  1WLZ A;  1KWO B;  1QLS A;  1KFX S;  3BUN B;  1ODB A;  1QX7 A;  1GQM A;  1QV1 A;  1JSA A;  1N2D A;  2HET A;  4MZJ A;  1XVJ A;  4USL A;  5TNC A;  3IF7 A;  3PM8 A;  1V1F A;  1F54 A;  2ZNE A;  4MEW A;  5CSF A;  4MRY A;  1WLM A;  2JRF A;  4GGN A;  4HRG A;  5KSZ A;  4I5N B;  1QX5 B;  1XFV O;  1XA5 A;  2M0R A;  4NDC A;  1XFZ O;  1SCM B;  1B8R A;  2FCE A;  2JU0 A;  2LAN A;  2COL B;  2F3Z A;  1Q80 A;  4DRW A;  1GJY A;  2PMY A;  4GGF A;  5D7F A;  2JC2 A;  1HT9 A;  1NPQ A;  1K2H A;  2EGD A;  2CNP A;  1PSR A;  2H61 C;  3KPX A;  3O4Y A;  2Y5I A;  3BYA A;  3I5G B;  2F2O A;  1QJT A;  2G9B A;  5DKR A;  2L4I A;  1BMO A;  1UHI A;  1UUS A;  4M2Q A;  3EKH A;  2HF5 A;  2JXL A;  1DJW A;  1BG1 A;  1J7O A;  1YX7 A;  2M29 A;  4MVF A;  1LVC D;  3QRX A;  2EHB A;  1JF0 A;  1QLK A;  1N65 A;  4AQJ A;  2EC6 B;  1MXE A;  1YRT B;  5K89 A;  1ALW A;  2KFH A;  1DVI A;  2OS8 C;  1FBV A;  2NCP A;  4ZCU A;  1DJG A;  2TN4 A;  3EK8 A;  4CID A;  2KQY A;  1F4O A;  1IGV A;  1BLQ A;  1XK4 C;  1YUS A;  4M2P A;  1KFU L;  1JF2 A;  2IS9 A;  2K2F A;  2KFF A;  1TN4 A;  3PAT A;  4FQO A;  2JOJ A;  1K9P A;  1YVH A;  3OP0 A;  1FI5 A;  2LMT A;  1F70 A;  2KNE A;  1WDC C;  3VRN A;  5GQQ C;  1OQP A;  2I7A A;  2AUC A;  1VRK A;  3KHE A;  2ZN9 A;  1DGV A;  4NDD A;  3KF9 A;  1U5I A;  2LMU A;  1TRF A;  3TDU A;  1EG3 A;  4PE7 A;  2FOT A;  2L2E A;  2H2K A;  3OHM B;  3NSL A;  2K8M B;  2RGI A;  2K61 A;  2ZN8 A;  3BOW A;  3GOF A;  1NX1 A;  1TTX A;  2NXQ A;  5AXI A;  3TUY C;  1TCO B;  3IQO A;  2F2P A;  2BBN A;  2I94 A;  5KTY A;  1QV0 A;  1UUR A;  1CDL A;  3SG3 A;  2HQW A;  1F4Q A;  1UHJ A;  4GGF C;  5CPV A;  5ER5 A;  4QJ4 B;  1DT7 B;  2CXJ A;  3BUW B;  1DF0 B;  2I2R E;  2L0P A;  2F33 A;  2QPT A;  3BUM B;  3VRR A;  2V53 A;  1CNP A;  1CDN A;  1M31 A;  1RWY A;  2JNX A;  2E6W A;  1B8L A;  3SG4 A;  1ZOT B;  1OMV A;  4PE4 A;  2OS8 B;  1KK7 Y;  4NDB A;  3KO0 A;  3IQQ A;  1OMD A;  2GGZ A;  1NUB A;  2JXC A;  1B4C A;  2L98 A;  1A2X A;  3PN7 B;  4ORA B;  2MLF C;  3CGA A;  2A4J A;  1BR1 B;  1M39 A;  2F8P A;  5HLO A;  4CPV A;  1G33 A;  1WDC B;  2BKI B;  1WY9 A;  4GFT A;  4JPZ B;  1QAT A;  1TNQ A;  3CR2 A;  3DF0 B;  1BOC A;  1SBJ A;  5PAL A;  3HCM A;  3I5I C;  3OX5 A;  5J3X A;  4AQI A;  4DCK A;  1KK8 C;  2KBI A;  4CFR A;  1TOP A;  3TDZ A;  1EJ3 A;  1WRZ A;  1A29 A;  1ALV A;  3TUY B;  5I2L A;  4YI9 A;  2M1U A;  3AAJ A;  2M7N A;  2PAL A;  3FS7 A;  2ISD A;  1CFD A;  4C0L A;  4YGB B;  1AP4 A;  1B47 A;  2GV5 A;  1AVS A;  1A75 A;  4MBE A;  4TNC A;  1YTZ C;  3WNX B;  2OPO A;  1QXP A;  4NQG A;  2LP3 A;  1KSM A;  3DF0 A;  5I2O A;  1OMR A;  2KAV A;  4PHM A;  3SIA A;  2MAZ A;  2JWW A;  1OZS A;  2PRU A;  3TZ1 A;  4PCW A;  2CT9 A;  4GPL B;  3CWG A;  4ZCV A;  1FW4 A;  5CSI A;  3RLZ A;  1K94 A;  2WOR A;  2LP2 A;  2LVV A;  2JT8 A;  4OR9 B;  4Q04 A;  2GGM A;  2WC8 A;  1AJ5 A;  4YGA A;  1K9U A;  4PAL A;  1LXF C;  1KFU S;  1JC2 A;  1NSH A;  1B7T Y;  3TS5 C;  1NWD A;  5JOL A;  1K96 A;  4XJK A;  4MN0 A;  2WCB A;  1IQ3 A;  1KSO A;  1J55 A;  5I2Q A;  1H8B A;  3A8R A;  1LA3 A;  1F55 A;  5AFP A;  1B7T Z;  3I5I B;  1PVB A;  4I5K A;  3WHU B;  5KU1 A;  1IG5 A;  2L51 A;  5HKW A;  3H4S E;  3CTN A;  1KK8 B;  4JQ0 D;  1G8I A;  2HPS A;  2M9G A;  2M97 A;  4ICB A;  5HYD A;  1ZFS A;  2KI4 C;  3LK0 A;  1SL8 A;  4PHJ A;  1QAS A;  1M63 B;  3JVT C;  2LV7 A;  2SCP A;  1U5I B;  4GNK B;  2MBX A;  1UHK A;  5CSN A;  1S26 D;  1L7Z A;  1SK6 D;  4YGE B;  3GK1 A;  1QTX A;  2BBM A;  2FJU B;  2R2I A;  2ZRS A;  1A4P A;  1UHN A;  1CTR A;  3SJS A;  4MRX A;  2L50 A;  2KGB C;  3BOW B;  3PN7 C;  1J7R A;  3JTD C;  4HRH A;  3CLN A;  4I5J A;  1DJZ A;  5AER A;  1AHR A;  2OTG C;  4N1F A;  1YUR A;  4HSZ A;  2AAO A;  1CDM A;  1K90 D;  2CBL A;  2K7C A;  1SW8 A;  3CR4 X;  1IKU A;  4PE1 A;  1AK8 A;  3SG6 A;  1S3P A;  2K0J A;  3OB2 B;  2VRG A;  3OX6 A;  3ICB A;  2KQ6 A;  1NX0 A;  1SL7 A;  1W7I B;  4MZK A;  3CZT X;  2KGR A;  2BL0 C;  3TS5 B;  3EKJ A;  2JTZ A;  5BPJ A;  3SIB A;  1Y1U A;  3LCP C;  2KYC A;  5IBW A;  4OKH A;  1J7Q A;  1CM1 A;  1R6P A;  1B8C A;  1OE9 B;  3HX4 A;  2KAX A;  1EL4 A;  2LUX A;  2JPT A;  2BEC A;  4N5X A;  1TNX A;  2NCO A;  1CDP A;  4P2Y B;  2KDH A;  1JFK A;  1MQ1 A;  1MUX A;  3A4U B;  4FTG A;  2M3W A;  4N1G A;  3GK2 A;  4ORC B;  4E68 A;  2KI4 B;  1H4B A;  4MLW A;  1AUI B;  1G4Y R;  2G2B A;  3LLE A;  4WRI A;  3JVT B;  1MHO A;  3I5H C;  3CS1 A;  2NZ0 A;  1W7J B;  2K2A A;  1YVL A;  4L9M A;  1CLB A;  4XYN A;  3AKB A;  3BUX B;  1S6I A;  1SYM A;  1NCZ A;  3LK1 A;  1C7W A;  2F3Y A;  1KK7 Z;  2D8N A;  3JTD B;  2LMV A;  1BT6 A;  5HKY A;  3DVJ A;  2OTG B;  3WHT B; 
#chains in the Genus database with same CATH topology
 1C7V A;  1IJ5 A;  3VRQ A;  2WCF A;  3B6X A;  2M1K B;  1A75 B;  1ORG A;  2L5X B;  3PJI A;  2BCB A;  2KOT A;  4BY5 A;  4R1E A;  1SSE B;  1UHH A;  1DEK A;  2JUL A;  1REC A;  2K7O A;  4OVN F;  5F6T A;  1OSA A;  1L2O C;  4JWQ A;  2BL0 B;  3PM2 A;  1S5G Y;  1BU3 A;  1R2U A;  2QEO A;  4YGD B;  1J7P A;  1XYD A;  1LA0 A;  3AKA A;  3BFH A;  5AAN A;  2O5G A;  3PFV A;  4MZL A;  1RTP 1;  5D69 A;  1S5G Z;  2BE6 A;  1RJV A;  2LM5 A;  3D76 A;  1XFX O;  1J1D A;  1F71 A;  4M2O A;  5HL1 A;  3NXA A;  4OV2 A;  1DJI A;  3VRP A;  3R1V A;  2Y1N A;  3N7H A;  2O60 A;  4AOM A;  1QS7 A;  5HKZ A;  2JT3 A;  4XJK B;  1CKK A;  1TCF A;  5HLV A;  4C0K A;  1QIV A;  1XO5 A;  1LIN A;  1T14 A;  4BY4 A;  3EVU A;  3D0Y A;  1XFY O;  3SG7 A;  4YRU A;  5AEQ A;  1MWN A;  2JPO A;  1YX8 A;  1HQV A;  2WCM A;  4MSP A;  1GGW A;  2FJY A;  3I5H B;  3DVM A;  2Y4Q A;  1IH0 A;  2LAP A;  3DVK A;  2KYF A;  1IJ6 A;  3O78 A;  3GK4 X;  1OOH A;  1S1E A;  2K60 A;  1EXR A;  3LL8 B;  1TNP A;  5DKQ A;  1JFJ A;  1UP5 A;  1KQM C;  2ZRT A;  2LLS A;  1TNW A;  1BR4 B;  5JJG A;  2KI6 C;  3FWB A;  3B87 A;  2P6B B;  1QWV A;  4QJ3 B;  3SG2 A;  3OB1 B;  3L4L A;  3ZNI A;  4F0Z B;  4PDZ A;  3NSK A;  4OCI A;  4WQ2 A;  1JBA A;  1MR8 A;  2KAY A;  3ZWH A;  2PAS A;  2KHN A;  1NP8 A;  1L2O B;  1IRJ A;  2K7B A;  2MLE C;  3R1O A;  1XFU O;  1JWD A;  3M0W A;  1F8H A;  1WRK A;  1X02 A;  1DJX A;  3F45 A;  1DTL A;  1SY9 A;  3EVR A;  3B86 A;  3I5F C;  1SR6 C;  1PUL A;  2LC5 A;  2JT0 A;  2LVJ A;  1OOJ A;  1D1O A;  1M46 A;  1QX2 A;  2LLT A;  1B1G A;  1EH2 A;  4CFQ A;  3MSE B;  1CFC A;  3BXK A;  1TIZ A;  4PHK A;  1IQ5 A;  4DUQ A;  1SL9 A;  1A03 A;  5D3O A;  1RK9 A;  1N0Y A;  1QVI Y;  5G08 A;  3C1V A;  2BCA A;  3DVE A;  4WQ3 A;  1Y0V H;  4D1E A;  1QIW A;  4YGC B;  1YUT A;  3NSI A;  2Y1M A;  3TDI A;  1C3Y A;  3VRO A;  2QAC A;  5FYX A;  1QVI Z;  4GUK A;  3SG5 A;  1K95 A;  1KFX L;  2PSR A;  3E3R A;  1CMG A;  1RFJ A;  1PVA A;  1FPW A;  4PHN A;  1BJF A;  2L4H A;  3D77 A;  1NYA A;  2JNF A;  2LNK A;  1TUZ A;  2M7L A;  4A4B A;  2DOQ A;  1CLL A;  1SRA A;  1S6C A;  1Y1A A;  1GM0 A;  1DJH A;  2FCD A;  1DJY A;  5B8I B;  2PQL A;  1NIW A;  1NCX A;  1ZUZ A;  2HQ8 A;  2MJW B;  2P71 A;  2LHL A;  5CSJ A;  1KQM B;  1UWO A;  3S0A A;  1DQE A;  5DIC A;  3KEV A;  2KLE A;  2AMI A;  2ZKM X;  2JZI A;  1K9K A;  2LUC A;  4KYN A;  3BQ3 A;  2E30 A;  2BCX A;  2MHH A;  1OZO A;  1SKT A;  2LE9 B;  3AAK A;  2ZND A;  3QME A;  1CMF A;  4YI8 A;  3I5F B;  1SR6 B;  1P28 A;  2KI6 D;  1PAL A;  3FIA A;  1RRO A;  3PAL A;  3D78 A;  5EL2 A;  4U8D A;  2ZFD A;  3L47 A;  1PRW A;  2I18 A;  2LVI A;  1ZAC A;  4QJ5 B;  2Q4U A;  1NX3 A;  2WCE A;  3CR5 X;  1K8U A;  1SCV A;  3K21 A;  1CM4 A;  3EK7 A;  4C0J A;  2LVK A;  1DMO A;  1WRL A;  3NSO A;  2MA2 A;  4GBA A;  3BFB A;  3PLF B;  3CZ2 A;  1YRU B;  1ZMZ A;  1IWQ A;  2M8U A;  1MXL C;  1Y1X A;  2QEV A;  2NLN A;  1NCY A;  1KWO C;  1W9Z A;  1E8A A;  5I8N A;  2CCM A;  1CFP A;  2B1U A;  1BOD A;  1AJ4 A;  3DD4 A;  1S36 A;  4GAO A;  1XFR A;  4P5O E;  1EG4 A;  1CLM A;  1V1G A;  4HRE E;  2H61 A;  1FF1 A;  3D0Y B;  3WXA A;  2Q91 A;  1S6J A;  4ETO A;  1J1E A;  2WCJ A;  1GGZ A;  2MRD A;  1SCM C;  3DXL A;  3VGO A;  1SMG A;  2WOS A;  1CB1 A;  1PSB A;  4INX A;  2JTT A;  2LLU A;  4DIR A;  3PSR A;  4ORB B;  3FWC A;  3R72 A;  1SNL A;  2K7D A;  3Q8I A;  1YR5 A;  2QDI A;  1M45 A;  1JUO A;  1DF0 A;  3O6B A;  1C3Z A;  1B9A A;  2BE4 A;  2KFG A;  3I5G C;  4A4C A;  4I5L B;  2PVB A;  1SPY A;  3O2P A;  1NX2 A;  2KBM A;  1CFF A;  1MF8 B;  1LKJ A;  3CZ1 A;  1K93 D;  4IL1 A;  4PE0 A;  2WND A;  5ER4 X;  4DS7 A;  3CAB A;  3BUO B;  1PK0 D;  1BF5 A;  2CTN A;  1XK4 A;  3D10 A;  2LCP A;  3K1E A;  3RM1 A;  4UPG A;  2BKH B;  3EVV A;  2M49 B;  1KQV A;  1YUU A;  1DGU A;  1C07 A;  2SAS A;  2LHI A;  2EC6 C;  4CLN A;  1Y6W A;  2KSP A;  2JQ6 A;  1XFW O;  4YBH B;  5DKN A;  1FI6 A;  3EK4 A;  1KCY A;  1WLZ A;  1KWO B;  1QLS A;  1KFX S;  3BUN B;  1ODB A;  1QX7 A;  1GQM A;  1QV1 A;  1JSA A;  1N2D A;  2HET A;  4MZJ A;  1XVJ A;  2WCH A;  4USL A;  3IF7 A;  3PM8 A;  5TNC A;  1V1F A;  1F54 A;  2ZNE A;  1Z4H A;  2H8V A;  4MEW A;  3OGN A;  5CSF A;  4MRY A;  1WLM A;  2JRF A;  4GGN A;  4HRG A;  3SS4 A;  5KSZ A;  4I5N B;  1QX5 B;  1XFV O;  1XA5 A;  2M0R A;  4NDC A;  4PT1 A;  1XFZ O;  1SCM B;  1B8R A;  2FCE A;  2JU0 A;  3RZS A;  3SS5 A;  2LAN A;  2COL B;  2F3Z A;  1Q80 A;  4DRW A;  1GJY A;  2PMY A;  4GGF A;  5D7F A;  2JC2 A;  1HT9 A;  1NPQ A;  5FI6 A;  1K2H A;  2EGD A;  2CNP A;  1PSR A;  2H61 C;  3KPX A;  3O4Y A;  2Y5I A;  3BYA A;  3I5G B;  2F2O A;  1QJT A;  2G9B A;  4FQT A;  5DKR A;  2WCK A;  2L4I A;  5FI2 A;  1BMO A;  1UHI A;  1UUS A;  4M2Q A;  3EKH A;  2HF5 A;  2JXL A;  3NHI A;  1DJW A;  1Z2C B;  2KLD A;  1BG1 A;  1J7O A;  3FE9 A;  1YX7 A;  2M29 A;  4MVF A;  1LVC D;  4INW A;  3QRX A;  2EHB A;  1JF0 A;  1QLK A;  1N65 A;  3VB1 A;  4AQJ A;  2EC6 B;  1MXE A;  1YRT B;  5K89 A;  1ALW A;  2KFH A;  1DVI A;  2OS8 C;  5FI7 A;  1FBV A;  2NCP A;  4ZCU A;  1DJG A;  2BAP A;  2TN4 A;  3EK8 A;  4CID A;  2KQY A;  1F4O A;  1IGV A;  1BLQ A;  1XK4 C;  3R1P A;  1YUS A;  4M2P A;  1KFU L;  1JF2 A;  2IS9 A;  2K2F A;  2KFF A;  1TN4 A;  3PAT A;  4FQO A;  2JOJ A;  1K9P A;  1YVH A;  4OZD A;  3OP0 A;  1FI5 A;  2LMT A;  1F70 A;  2KNE A;  1WDC C;  3VRN A;  5GQQ C;  1OQP A;  2I7A A;  2AUC A;  1VRK A;  3KHE A;  2ZN9 A;  1DGV A;  4NDD A;  3KF9 A;  1U5I A;  2LMU A;  1TRF A;  3TDU A;  1EG3 A;  4PE7 A;  2FOT A;  2L2E A;  2H2K A;  3OHM B;  3NSL A;  2K8M B;  2RGI A;  2K61 A;  2ZN8 A;  3BOW A;  3GOF A;  4JD9 A;  1NX1 A;  1TTX A;  2NXQ A;  5AXI A;  3UO9 A;  2P70 A;  3TUY C;  3BJH A;  1TCO B;  3IQO A;  3CYZ A;  2F2P A;  2BBN A;  2I94 A;  3OBV A;  5KTY A;  1QV0 A;  1UUR A;  1CDL A;  3SG3 A;  2HQW A;  1F4Q A;  1UHJ A;  4GGF C;  5CPV A;  5ER5 A;  3FE8 A;  3D73 A;  2CXJ A;  4QJ4 B;  1DT7 B;  3BUW B;  1DF0 B;  2I2R E;  2L0P A;  2F33 A;  2QPT A;  3BUM B;  3V2L A;  3VRR A;  2V53 A;  1CNP A;  2QEH A;  1CDN A;  1M31 A;  1RWY A;  2JNX A;  2E6W A;  1B8L A;  3SG4 A;  1ZOT B;  2WC5 A;  1OMV A;  4PE4 A;  2OS8 B;  1KK7 Y;  3B88 A;  2ERB A;  3KO0 A;  4NDB A;  3IQQ A;  3S0D A;  3L4A A;  1OMD A;  2GGZ A;  3S0F A;  1NUB A;  2JXC A;  1B4C A;  2L98 A;  4JKT A;  1A2X A;  3PN7 B;  4ORA B;  1IIO A;  2MLF C;  3CGA A;  2A4J A;  1BR1 B;  3CZ0 A;  1M39 A;  2F8P A;  5HLO A;  4CPV A;  1G33 A;  1WDC B;  2BKI B;  1WY9 A;  4GFT A;  4JPZ B;  1QAT A;  1TNQ A;  3CR2 A;  3DF0 B;  1BOC A;  1SBJ A;  3DY9 A;  5PAL A;  3HCM A;  3I5I C;  3OX5 A;  5J3X A;  2YGU A;  4AQI A;  3UNW A;  4DCK A;  1KK8 C;  2KBI A;  4CFR A;  1TOP A;  3TDZ A;  1OW4 A;  1OOF A;  1EJ3 A;  1WRZ A;  1A29 A;  1ALV A;  3TUY B;  5I2L A;  3EG5 B;  4YI9 A;  1TWO A;  2M1U A;  2M7N A;  2PAL A;  3AAJ A;  3FS7 A;  2ISD A;  1CFD A;  3SS3 A;  4C0L A;  4YGB B;  1AP4 A;  1B47 A;  2GV5 A;  1AVS A;  1A75 A;  4MBE A;  4TNC A;  1YTZ C;  3DYE A;  3WNX B;  2OPO A;  1QXP A;  4NQG A;  2LP3 A;  1KSM A;  3DF0 A;  5I2O A;  1OMR A;  3B7A A;  3CDN A;  2KAV A;  4PHM A;  3SIA A;  2MAZ A;  2JWW A;  1OZS A;  2PRU A;  3TZ1 A;  1TUJ A;  3DZT A;  3NHT A;  4PCW A;  2CT9 A;  2L2C A;  4GPL B;  3CWG A;  4ZCV A;  1FW4 A;  5CSI A;  3RLZ A;  1K94 A;  2WOR A;  2LP2 A;  2LVV A;  2JT8 A;  4OR9 B;  4Q04 A;  2GGM A;  2WC8 A;  1AJ5 A;  4YGA A;  1K9U A;  4PAL A;  1LXF C;  1KFU S;  3S0E A;  1JC2 A;  1NSH A;  1B7T Y;  3TS5 C;  1NWD A;  5JOL A;  1K96 A;  4XJK A;  4MN0 A;  2WCB A;  1IQ3 A;  1KSO A;  1J55 A;  2PYQ A;  5I2Q A;  1H8B A;  3A8R A;  1LA3 A;  1F55 A;  5AFP A;  1B7T Z;  2BNX A;  3I5I B;  2QEB A;  1PVB A;  4I5K A;  3WHU B;  5KU1 A;  1IG5 A;  2L51 A;  3S0G A;  5HKW A;  3H4S E;  3CTN A;  1KK8 B;  1LS8 A;  4F7F A;  4JQ0 D;  1G8I A;  2HPS A;  2M9G A;  2L5Y A;  2M97 A;  4ICB A;  5HYD A;  1ZFS A;  1DEL A;  2KI4 C;  3LK0 A;  1SL8 A;  4PHJ A;  1QAS A;  1M63 B;  3JVT C;  2LV7 A;  2SCP A;  1U5I B;  4GNK B;  2MBX A;  1UHK A;  5CSN A;  1S26 D;  1L7Z A;  1SK6 D;  4YGE B;  3GK1 A;  1QTX A;  2BBM A;  2FJU B;  2R2I A;  2ZRS A;  1A4P A;  1UHN A;  1CTR A;  4IJ7 A;  3SJS A;  4MRX A;  2L50 A;  2KGB C;  3BOW B;  1OOI X;  3PN7 C;  1J7R A;  3JTD C;  4HRH A;  3CLN A;  4I5J A;  1DJZ A;  5AER A;  1AHR A;  2OTG C;  4N1F A;  1YUR A;  4HSZ A;  2AAO A;  1CDM A;  1K90 D;  2CBL A;  2K7C A;  1SW8 A;  3CR4 X;  1IKU A;  4PE1 A;  1AK8 A;  3SG6 A;  1S3P A;  2K0J A;  3D75 A;  3OB2 B;  2VRG A;  3OX6 A;  3ICB A;  2KQ6 A;  1NX0 A;  1SL7 A;  1W7I B;  4MZK A;  3CZT X;  2KGR A;  1OOG A;  2BL0 C;  3S0B A;  3TS5 B;  3EKJ A;  2JTZ A;  5BPJ A;  3SIB A;  1Y1U A;  3IVT A;  3LCP C;  2KYC A;  5IBW A;  4OKH A;  1J7Q A;  1CM1 A;  1R6P A;  1B8C A;  1OE9 B;  3HX4 A;  2KAX A;  3D74 A;  1EL4 A;  2LUX A;  2JPT A;  2BEC A;  3FE6 A;  4N5X A;  1TNX A;  2NCO A;  1CDP A;  4P2Y B;  2KDH A;  1JFK A;  1MQ1 A;  3BFA A;  1MUX A;  3A4U B;  4FTG A;  2M3W A;  4N1G A;  3GK2 A;  4ORC B;  4E68 A;  2WC6 A;  2KI4 B;  1H4B A;  3O4X A;  4MLW A;  1AUI B;  1G4Y R;  2G2B A;  3LLE A;  4WRI A;  3JVT B;  2WCL A;  2GTE A;  1MHO A;  3I5H C;  3CS1 A;  2NZ0 A;  1W7J B;  2K2A A;  1YVL A;  3NGV A;  4L9M A;  4XYN A;  3AKB A;  1CLB A;  3BUX B;  1S6I A;  2KPH A;  1SYM A;  1DC1 A;  1NCZ A;  3LK1 A;  1C7W A;  2F3Y A;  1KK7 Z;  2D8N A;  3JTD B;  2LMV A;  1BT6 A;  5HKY A;  5I94 A;  3DVJ A;  2OTG B;  3WHT B; 
#chains in the Genus database with same CATH homology
 1C7V A;  1IJ5 A;  3VRQ A;  2WCF A;  2M1K B;  1A75 B;  2L5X B;  2BCB A;  2KOT A;  4BY5 A;  4R1E A;  1UHH A;  2JUL A;  2K7O A;  5F6T A;  1REC A;  4OVN F;  1OSA A;  1L2O C;  4JWQ A;  2BL0 B;  1S5G Y;  1BU3 A;  1R2U A;  4YGD B;  1J7P A;  1XYD A;  1LA0 A;  3AKA A;  5AAN A;  2O5G A;  3PFV A;  4MZL A;  1RTP 1;  5D69 A;  1S5G Z;  2BE6 A;  1RJV A;  2LM5 A;  1XFX O;  1J1D A;  1F71 A;  4M2O A;  3NXA A;  4OV2 A;  1DJI A;  3VRP A;  2Y1N A;  2O60 A;  4AOM A;  1QS7 A;  5HKZ A;  2JT3 A;  4XJK B;  1CKK A;  1TCF A;  5HLV A;  4C0K A;  1QIV A;  1XO5 A;  1LIN A;  4BY4 A;  3EVU A;  3D0Y A;  1XFY O;  3SG7 A;  4YRU A;  5AEQ A;  1MWN A;  1YX8 A;  1HQV A;  4MSP A;  1GGW A;  3I5H B;  3DVM A;  2Y4Q A;  1IH0 A;  2LAP A;  3DVK A;  2KYF A;  1IJ6 A;  3O78 A;  3GK4 X;  1S1E A;  1EXR A;  3LL8 B;  1TNP A;  5DKQ A;  1JFJ A;  1UP5 A;  1KQM C;  2ZRT A;  2LLS A;  1TNW A;  1BR4 B;  5JJG A;  2KI6 C;  3FWB A;  2P6B B;  4F0Z B;  4QJ3 B;  3SG2 A;  3OB1 B;  3ZNI A;  4PDZ A;  3NSK A;  4OCI A;  4WQ2 A;  1JBA A;  1MR8 A;  2KAY A;  3ZWH A;  2PAS A;  2KHN A;  1NP8 A;  1L2O B;  1IRJ A;  2K7B A;  2MLE C;  1JWD A;  1XFU O;  3M0W A;  1F8H A;  1WRK A;  1X02 A;  1DJX A;  3F45 A;  1DTL A;  1SY9 A;  3EVR A;  3I5F C;  1SR6 C;  1PUL A;  2LC5 A;  2JT0 A;  2LVJ A;  1OOJ A;  1D1O A;  1M46 A;  1QX2 A;  2LLT A;  1B1G A;  1EH2 A;  4CFQ A;  3MSE B;  1CFC A;  3BXK A;  1TIZ A;  4PHK A;  1IQ5 A;  4DUQ A;  1SL9 A;  1A03 A;  1RK9 A;  1N0Y A;  1QVI Y;  5G08 A;  3C1V A;  2BCA A;  3DVE A;  4WQ3 A;  1Y0V H;  4D1E A;  1QIW A;  4YGC B;  1YUT A;  3NSI A;  2Y1M A;  3TDI A;  3VRO A;  2QAC A;  5FYX A;  1QVI Z;  4GUK A;  3SG5 A;  1K95 A;  1KFX L;  2PSR A;  3E3R A;  1CMG A;  1RFJ A;  1PVA A;  1FPW A;  4PHN A;  1BJF A;  2L4H A;  1NYA A;  2JNF A;  2LNK A;  2M7L A;  4A4B A;  2DOQ A;  1CLL A;  1SRA A;  1S6C A;  1Y1A A;  1DJH A;  2FCD A;  1DJY A;  5B8I B;  1NIW A;  1NCX A;  1ZUZ A;  2HQ8 A;  2MJW B;  2LHL A;  5CSJ A;  1KQM B;  1UWO A;  3KEV A;  2AMI A;  2ZKM X;  2JZI A;  1K9K A;  2LUC A;  3BQ3 A;  2E30 A;  2BCX A;  2MHH A;  1OZO A;  1SKT A;  2LE9 B;  3AAK A;  2ZND A;  1CMF A;  4YI8 A;  3I5F B;  1SR6 B;  2KI6 D;  3FIA A;  1PAL A;  3PAL A;  1RRO A;  4U8D A;  2ZFD A;  1PRW A;  2I18 A;  2LVI A;  1ZAC A;  4QJ5 B;  2Q4U A;  1NX3 A;  2WCE A;  3CR5 X;  1K8U A;  1SCV A;  3K21 A;  1CM4 A;  3EK7 A;  4C0J A;  2LVK A;  1DMO A;  1WRL A;  3NSO A;  2MA2 A;  4GBA A;  3PLF B;  1YRU B;  1ZMZ A;  1IWQ A;  2M8U A;  1MXL C;  1Y1X A;  2NLN A;  1NCY A;  1KWO C;  1E8A A;  5I8N A;  2CCM A;  1CFP A;  2B1U A;  1BOD A;  1AJ4 A;  3DD4 A;  1S36 A;  4GAO A;  4P5O E;  1EG4 A;  1CLM A;  1V1G A;  4HRE E;  2H61 A;  1FF1 A;  3D0Y B;  3WXA A;  2Q91 A;  1S6J A;  4ETO A;  1J1E A;  1GGZ A;  2MRD A;  1SCM C;  3VGO A;  1SMG A;  2WOS A;  1CB1 A;  1PSB A;  4DIR A;  2JTT A;  2LLU A;  3PSR A;  4ORB B;  3FWC A;  1SNL A;  2K7D A;  1YR5 A;  1M45 A;  1JUO A;  1DF0 A;  3O6B A;  1B9A A;  2BE4 A;  2KFG A;  3I5G C;  4A4C A;  4I5L B;  2PVB A;  1SPY A;  3O2P A;  1NX2 A;  2KBM A;  1CFF A;  1MF8 B;  1LKJ A;  1K93 D;  4IL1 A;  4PE0 A;  2WND A;  5ER4 X;  4DS7 A;  3BUO B;  1PK0 D;  1BF5 A;  2CTN A;  1XK4 A;  3D10 A;  2LCP A;  3RM1 A;  4UPG A;  2BKH B;  3EVV A;  2M49 B;  1KQV A;  1YUU A;  1DGU A;  1C07 A;  2SAS A;  2LHI A;  2EC6 C;  4CLN A;  1Y6W A;  2KSP A;  2JQ6 A;  1XFW O;  4YBH B;  5DKN A;  1FI6 A;  3EK4 A;  1KCY A;  1WLZ A;  1KWO B;  1QLS A;  1KFX S;  3BUN B;  1ODB A;  1QX7 A;  1GQM A;  1QV1 A;  1JSA A;  1N2D A;  2HET A;  4MZJ A;  1XVJ A;  4USL A;  5TNC A;  3IF7 A;  3PM8 A;  1V1F A;  1F54 A;  2ZNE A;  4MEW A;  5CSF A;  4MRY A;  1WLM A;  2JRF A;  4GGN A;  4HRG A;  5KSZ A;  4I5N B;  1QX5 B;  1XFV O;  1XA5 A;  2M0R A;  4NDC A;  1XFZ O;  1SCM B;  1B8R A;  2FCE A;  2JU0 A;  2LAN A;  2COL B;  2F3Z A;  1Q80 A;  4DRW A;  1GJY A;  2PMY A;  4GGF A;  5D7F A;  2JC2 A;  1HT9 A;  1NPQ A;  1K2H A;  2EGD A;  2CNP A;  1PSR A;  2H61 C;  3KPX A;  3O4Y A;  2Y5I A;  3BYA A;  3I5G B;  2F2O A;  1QJT A;  2G9B A;  5DKR A;  2L4I A;  1BMO A;  1UHI A;  1UUS A;  4M2Q A;  3EKH A;  2HF5 A;  2JXL A;  1DJW A;  1BG1 A;  1J7O A;  1YX7 A;  2M29 A;  4MVF A;  1LVC D;  3QRX A;  2EHB A;  1JF0 A;  1QLK A;  1N65 A;  4AQJ A;  2EC6 B;  1MXE A;  1YRT B;  5K89 A;  1ALW A;  2KFH A;  1DVI A;  2OS8 C;  1FBV A;  2NCP A;  4ZCU A;  1DJG A;  2TN4 A;  3EK8 A;  4CID A;  2KQY A;  1F4O A;  1IGV A;  1BLQ A;  1XK4 C;  1YUS A;  4M2P A;  1KFU L;  1JF2 A;  2IS9 A;  2K2F A;  2KFF A;  1TN4 A;  3PAT A;  4FQO A;  2JOJ A;  1K9P A;  1YVH A;  3OP0 A;  1FI5 A;  2LMT A;  1F70 A;  2KNE A;  1WDC C;  3VRN A;  5GQQ C;  1OQP A;  2I7A A;  2AUC A;  1VRK A;  3KHE A;  2ZN9 A;  1DGV A;  4NDD A;  3KF9 A;  1U5I A;  2LMU A;  1TRF A;  3TDU A;  1EG3 A;  4PE7 A;  2FOT A;  2L2E A;  2H2K A;  3OHM B;  3NSL A;  2K8M B;  2RGI A;  2K61 A;  2ZN8 A;  3BOW A;  3GOF A;  1NX1 A;  1TTX A;  2NXQ A;  5AXI A;  3TUY C;  1TCO B;  3IQO A;  2F2P A;  2BBN A;  2I94 A;  5KTY A;  1QV0 A;  1UUR A;  1CDL A;  3SG3 A;  2HQW A;  1F4Q A;  1UHJ A;  4GGF C;  5CPV A;  5ER5 A;  4QJ4 B;  1DT7 B;  2CXJ A;  3BUW B;  1DF0 B;  2I2R E;  2L0P A;  2F33 A;  2QPT A;  3BUM B;  3VRR A;  2V53 A;  1CNP A;  1CDN A;  1M31 A;  1RWY A;  2JNX A;  2E6W A;  1B8L A;  3SG4 A;  1ZOT B;  1OMV A;  4PE4 A;  2OS8 B;  1KK7 Y;  4NDB A;  3KO0 A;  3IQQ A;  1OMD A;  2GGZ A;  1NUB A;  2JXC A;  1B4C A;  2L98 A;  1A2X A;  3PN7 B;  4ORA B;  2MLF C;  3CGA A;  2A4J A;  1BR1 B;  1M39 A;  2F8P A;  5HLO A;  4CPV A;  1G33 A;  1WDC B;  2BKI B;  1WY9 A;  4GFT A;  4JPZ B;  1QAT A;  1TNQ A;  3CR2 A;  3DF0 B;  1BOC A;  1SBJ A;  5PAL A;  3HCM A;  3I5I C;  3OX5 A;  5J3X A;  4AQI A;  4DCK A;  1KK8 C;  2KBI A;  4CFR A;  1TOP A;  3TDZ A;  1EJ3 A;  1WRZ A;  1A29 A;  1ALV A;  3TUY B;  5I2L A;  4YI9 A;  2M1U A;  3AAJ A;  2M7N A;  2PAL A;  3FS7 A;  2ISD A;  1CFD A;  4C0L A;  4YGB B;  1AP4 A;  1B47 A;  2GV5 A;  1AVS A;  1A75 A;  4MBE A;  4TNC A;  1YTZ C;  3WNX B;  2OPO A;  1QXP A;  4NQG A;  2LP3 A;  1KSM A;  3DF0 A;  5I2O A;  1OMR A;  2KAV A;  4PHM A;  3SIA A;  2MAZ A;  2JWW A;  1OZS A;  2PRU A;  3TZ1 A;  4PCW A;  2CT9 A;  4GPL B;  3CWG A;  4ZCV A;  1FW4 A;  5CSI A;  3RLZ A;  1K94 A;  2WOR A;  2LP2 A;  2LVV A;  2JT8 A;  4OR9 B;  4Q04 A;  2GGM A;  2WC8 A;  1AJ5 A;  4YGA A;  1K9U A;  4PAL A;  1LXF C;  1KFU S;  1JC2 A;  1NSH A;  1B7T Y;  3TS5 C;  1NWD A;  5JOL A;  1K96 A;  4XJK A;  4MN0 A;  2WCB A;  1IQ3 A;  1KSO A;  1J55 A;  5I2Q A;  1H8B A;  3A8R A;  1LA3 A;  1F55 A;  5AFP A;  1B7T Z;  3I5I B;  1PVB A;  4I5K A;  3WHU B;  5KU1 A;  1IG5 A;  2L51 A;  5HKW A;  3H4S E;  3CTN A;  1KK8 B;  4JQ0 D;  1G8I A;  2HPS A;  2M9G A;  2M97 A;  4ICB A;  5HYD A;  1ZFS A;  2KI4 C;  3LK0 A;  1SL8 A;  4PHJ A;  1QAS A;  1M63 B;  3JVT C;  2LV7 A;  2SCP A;  1U5I B;  4GNK B;  2MBX A;  1UHK A;  5CSN A;  1S26 D;  1L7Z A;  1SK6 D;  4YGE B;  3GK1 A;  1QTX A;  2BBM A;  2FJU B;  2R2I A;  2ZRS A;  1A4P A;  1UHN A;  1CTR A;  3SJS A;  4MRX A;  2L50 A;  2KGB C;  3BOW B;  3PN7 C;  1J7R A;  3JTD C;  4HRH A;  3CLN A;  4I5J A;  1DJZ A;  5AER A;  1AHR A;  2OTG C;  4N1F A;  1YUR A;  4HSZ A;  2AAO A;  1CDM A;  1K90 D;  2CBL A;  2K7C A;  1SW8 A;  3CR4 X;  1IKU A;  4PE1 A;  1AK8 A;  3SG6 A;  1S3P A;  2K0J A;  3OB2 B;  2VRG A;  3OX6 A;  3ICB A;  2KQ6 A;  1NX0 A;  1SL7 A;  1W7I B;  4MZK A;  3CZT X;  2KGR A;  2BL0 C;  3TS5 B;  3EKJ A;  2JTZ A;  5BPJ A;  3SIB A;  1Y1U A;  3LCP C;  2KYC A;  5IBW A;  4OKH A;  1J7Q A;  1CM1 A;  1R6P A;  1B8C A;  1OE9 B;  3HX4 A;  2KAX A;  1EL4 A;  2LUX A;  2JPT A;  2BEC A;  4N5X A;  1TNX A;  2NCO A;  1CDP A;  4P2Y B;  2KDH A;  1JFK A;  1MQ1 A;  1MUX A;  3A4U B;  4FTG A;  2M3W A;  4N1G A;  3GK2 A;  4ORC B;  4E68 A;  2KI4 B;  1H4B A;  4MLW A;  1AUI B;  1G4Y R;  2G2B A;  3LLE A;  4WRI A;  3JVT B;  1MHO A;  3I5H C;  3CS1 A;  2NZ0 A;  1W7J B;  2K2A A;  1YVL A;  4L9M A;  1CLB A;  4XYN A;  3AKB A;  3BUX B;  1S6I A;  1SYM A;  1NCZ A;  3LK1 A;  1C7W A;  2F3Y A;  1KK7 Z;  2D8N A;  3JTD B;  2LMV A;  1BT6 A;  5HKY A;  3DVJ A;  2OTG B;  3WHT B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...