1K9PA

Crystal structure of calcium free (or apo) human s100a6
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
89
structure length
89
Chain Sequence
ACPLDQAIGLLVAIFHKYSGREGDKHTLSKKELKELIQKELTIGSKLQDAEIARLMEDLDRNKDQEVNFQEYVTFLGALALIYNEALKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords S100A6
publication title Crystal structures of S100A6 in the Ca(2+)-free and Ca(2+)-bound states: the calcium sensor mechanism of S100 proteins revealed at atomic resolution.
pubmed doi rcsb
source organism Homo sapiens
total genus 30
structure length 89
sequence length 89
ec nomenclature
pdb deposition date 2001-10-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1k9pA00
1CNPA 1YX8A 1TRFA 2M9GA 1IJ6A 3LK1A 3F45A 1LA0A 1AUIB 1B7TY 2G9BA 4YI9A 4OKHA 2OTGB 1L7ZA 2LP3A 1XFVO 4DUQA 2SASA 2KNEA 1R6PA 2L51A 4GUKA 1DJYA 4MZJA 1GJYA 2KFHA 3I5FC 3EK8A 3O78A 3LL8B 3OP0A 3CR2A 3SJSA 2LUXA 1FI6A 2KI4C 1NP8A 3AAJA 4GNKB 1M45A 1QX7A 1DJZA 1ZFSA 1YUSA 5CSNA 2PASA 3D0YB 1KQMC 1K95A 3JTDB 3NSIA 1DJGA 1MUXA 2CT9A 2GGMA 2LC5A 2LM5A 2WOSA 1LXFC 2LUCA 3PATA 1XFWO 1WY9A 1S6IA 1CDMA 1JF0A 1MXEA 1XO5A 5J3XA 4PE1A 2JC2A 1EH2A 1ZOTB 4PCWA 1KCYA 3PSRA 1X02A 3I5IC 1B1GA 1UHJA 5AXIA 1J7RA 1C7WA 1AK8A 1QX2A 5DKRA 1K2HA 1L2OC 5F6TA 1NSHA 1KFXL 3BUMB 1CDPA 1BR4B 1U5IB 2M8UA 2E30A 1DTLA 1IG5A 1MXLC 1OSAA 3A8RA 4BY5A 1A75B 2KFFA 2BE4A 1NWDA 1NX3A 2JTZA 1MR8A 1BU3A 1UHKA 1J7QA 2KBIA 2WCBA 4XYNA 4DCKA 1ZUZA 2HQWA 2KYCA 2EC6B 1NUBA 2TN4A 1NYAA 1F54A 1MWNA 2A4JA 2DOQA 2MLEC 1CMGA 1SL8A 1V1FA 3AKAA 3EKHA 1XFYO 1Y0VH 2WCFA 2OTGC 3SIBA 1CLMA 3I5GB 2PRUA 2JULA 2LANA 2GGZA 2LVJA 2BBNA 2LV7A 2L4HA 1J55A 4I5KA 5DKNA 3SG6A 1JWDA 1SY9A 1QV1A 3BOWB 1BT6A 1YTZC 2M0RA 2R2IA 2JQ6A 2CXJA 1UURA 1YRUB 1YRTB 1K9PA 2KAYA 3SIAA 1ALWA 1WLMA 3JTDC 2JZIA 1XA5A 2JTTA 5HKZA 1K94A 4QJ5B 3VRQA 1J7PA 4N1GA 2BBMA 1AHRA 4CPVA 1SCVA 5G08A 3TDUA 1KK7Z 3WXAA 1J7OA 1QV0A 1CFFA 1KSOA 2K2FA 4GGFC 2LMVA 2LMTA 4A4CA 1G8IA 1LA3A 3A4UB 1S6CA 2M3WA 4WQ3A 2JU0A 3DVMA 4GPLB 1QX5B 1U5IA 3NSOA 1PRWA 1SYMA 2KHNA 3BUOB 2LVVA 1PSRA 3VROA 1CMFA 2JXLA 2I18A 2LLUA 2NLNA 4DIRA 1UHIA 5B8IB 1QIWA 1NX1A 1G33A 4R1EA 1R2UA 3TS5B 1K96A 3CR5X 2Q4UA 2L98A 2LLSA 5AEQA 1QS7A 5CSIA 2I94A 2KDHA 3SG4A 1BMOA 4ZCVA 1RECA 2EC6C 1HQVA 1OZSA 2L5XB 1A03A 4JWQA 3NSKA 4WQ2A 1BOCA 1OE9B 1GQMA 1IWQA 1F4QA 4ICBA 4N5XA 2KAVA 4OCIA 3I5GC 1KSMA 5AANA 1RROA 1ALVA 5CPVA 2PALA 1SNLA 4MSPA 4ORAB 1H4BA 3CR4X 3HX4A 1PVAA 1TNXA 1BODA 2K7BA 2L0PA 4Q04A 4ORBB 5CSJA 1CLBA 3KPXA 1YVLA 2ZN9A 4CFRA 3ZNIA 2HPSA 2KGRA 3PM8A 5HLVA 1DMOA 2E6WA 1A4PA 3RLZA 1JF2A 1K8UA 2K61A 4YBHB 1BF5A 2F33A 3SG5A 2SCPA 3AKBA 4XJKB 2BKIB 2I2RE 1SK6D 1OMDA 2Y4QA 1SBJA 1XFZO 3LLEA 3CLNA 4OVNF 5GQQC 2QACA 4PHMA 2M29A 1DT7B 2Y1NA 4I5NB 3DF0B 1B8RA 2CCMA 4YGDB 3LCPC 5FYXA 1KK7Y 4I5JA 4UPGA 1TOPA 2NCOA 2ZFDA 3DD4A 2RGIA 1CLLA 5ER5A 1BLQA 1D1OA 1DJWA 2HQ8A 3TS5C 2KSPA 1WDCB 2WORA 2CBLA 2F3YA 3QRXA 4USLA 1K9UA 3RM1A 1ODBA 3BUXB 1SR6B 1E8AA 1Y6WA 4GGNA 4PE0A 1AJ5A 4P5OE 1JFKA 2FCDA 4CFQA 5AERA 4AQJA 4JQ0D 1CFDA 2GV5A 3BUWB 3BYAA 3KHEA 4TNCA 2WNDA 1FPWA 2AMIA 1K93D 1AJ4A 1PALA 2BCBA 1RK9A 2LP2A 2OPOA 2PMYA 2K0JA 3O6BA 4IL1A 5AFPA 2ISDA 1SMGA 1XFXO 1A29A 2MAZA 3VRPA 2WCEA 1KQVA 2OS8B 1PVBA 2MHHA 4C0JA 3BXKA 2KI6C 1KFUL 4MN0A 1IGVA 1EG4A 4PHNA 2F8PA 4JPZB 1UP5A 1S36A 2PVBA 3D0YA 1NIWA 4NQGA 1HT9A 1SPYA 4DRWA 1YUUA 1TN4A 2ZRSA 3D10A 2B1UA 1W7IB 3DF0A 1CDNA 1UHHA 3FWBA 4YRUA 2CNPA 3EVRA 1A2XA 4OR9B 5I8NA 2KQ6A 1S6JA 4GGFA 2NZ0A 2KAXA 4N1FA 1GGWA 2G2BA 1F4OA 5D69A 1NCXA 2EGDA 3BQ3A 1CM4A 1DF0B 1QLKA 2Q91A 2AAOA 1WRLA 3EK7A 4CLNA 2Y5IA 1C07A 1GGZA 4HREE 2P6BB 2LMUA 1WDCC 2L2EA 1F8HA 1PULA 1B8CA 2K2AA 1YVHA 3PN7B 2KI6D 4NDCA 1A75A 1NCYA 1SR6C 2FOTA 1F70A 4ZCUA 2HETA 1B4CA 1XK4C 2JXCA 2JT8A 1W7JB 3O4YA 5I2QA 2LNKA 1S3PA 2CTNA 4E68A 1XFUO 2K8MB 2MA2A 1V1GA 2EHBA 2FCEA 1EXRA 1N65A 4MVFA 2BL0B 1QASA 1DJXA 3TDZA 4DS7A 2F3ZA 3BOWA 2ZRTA 2OS8C 4WRIA 3KF9A 1XYDA 1SL7A 3LK0A 1AVSA 2JNFA 2LVIA 2LCPA 1QLSA 1TNQA 3EKJA 5JOLA 2F2OA 1N2DA 3VGOA 3VRNA 4D1EA 4NDDA 5JJGA 4PALA 1J1DA 1B9AA 4ORCB 1Y1AA 1FF1A 5KU1A 3MSEB 4A4BA 4MRXA 1YX7A 1WLZA 1PK0D 2MBXA 1NCZA 1DVIA 1RJVA 1S1EA 1MF8B 1RWYA 1FW4A 1JBAA 3CWGA 2M7NA 1YURA 4MRYA 4AOMA 3DVEA 1KFUS 3VRRA 3I5HB 1TNWA 4AQIA 1IH0A 2I7AA 1TTXA 2BKHB 1S5GY 4GFTA 1S26D 1MQ1A 2JNXA 1WRKA 1F55A 1K90D 1C7VA 2LLTA 2D8NA 1M39A 3PN7C 3TDIA 5HYDA 3PFVA 3OB2B 4I5LB 5PALA 2M7LA 3SG3A 1IJ5A 2JT0A 3KO0A 1AP4A 1UUSA 2LAPA 2MJWB 1QJTA 3E3RA 4HRGA 3CS1A 1ZMZA 2L50A 4MZLA 4L9MA 1DJHA 1FBVA 2HF5A 2O60A 1B47A 4MZKA 2M1KB 3CGAA 2JRFA 3OHMB 2MRDA 1KK8B 1M63B 2JWWA 2LHLA 3JVTB 1RFJA 4PDZA 2BL0C 3FWCA 5HKYA 4F0ZB 3OX6A 1YR5A 5I2LA 1IRJA 1QTXA 4BY4A 2KQYA 1Y1UA 2L4IA 3NSLA 1SCMB 1YUTA 1KWOB 4MBEA 2VRGA 4P2YB 5DKQA 1BR1B 3ZWHA 4C0LA 1G4YR 1CB1A 3K21A 4YGEB 2KFGA 1CTRA 1LKJA 1SRAA 3EVUA 1TCOB 1EG3A 3CZTX 1OOJA 1QVIY 3IQQA 1BG1A 1NPQA 1SW8A 4CIDA 3SG7A 3PALA 4XJKA 1NX2A 1Q80A 4C0KA 1SKTA 3SG2A 1DGVA 2K7DA 3I5HC 1JFJA 2BECA 3IF7A 1WRZA 3KEVA 2V53A 1IQ3A 2JOJA 1LVCD 4MLWA 2NCPA 5D7FA 2LHIA 3TZ1A 4QJ4B 1CKKA 1PSBA 2PSRA 1OMVA 1S5GZ 1K9KA 3GK1A 5TNCA 3EVVA 4FQOA 1MHOA 2KGBC 1LINA 2ZKMX 1DJIA 3DVKA 3ICBA 1B7TZ 4FTGA 5BPJA 1CFCA 4GAOA 1IKUA 1N0YA 1NX0A 1CFPA 3BUNB 5CSFA 3OX5A 2COLB 3TUYB 2BCAA 3C1VA 4PHKA 4HSZA 4GBAA 1JSAA 2NXQA 1EL4A 1Y1XA 2WC8A 2IS9A 2FJUB 4OV2A 1XK4A 1XVJA 1TIZA 1KK8C 3DVJA 2M49B 2O5GA 3JVTC 5HLOA 1UWOA 2H2KA 1OMRA 1OQPA 1M31A 3I5FB 2BE6A 3WNXB 1CDLA 3AAKA 1SCMC 3O2PA 2KI4B 1KWOC 2K7OA 2M1UA 3H4SE 1RTP1 1OZOA 1CM1A 1KQMB 2K7CA 5HKWA 3M0WA 1TNPA 4PHJA 1JC2A 2MLFC 5KTYA 4YGAA 1QVIZ 1UHNA 5IBWA 2ZNDA 3WHTB 1FI5A 4M2OA 1DGUA 2QPTA 3I5IB 2H61A 3CTNA 3GK4X 2BCXA 2LE9B 3GK2A 1H8BA 1IQ5A 4YGCB 1F71A 3IQOA 2M97A 3EK4A 4YGBB 2JPTA 4HRHA 3FIAA 2H61C 1M46A 4MEWA 4NDBA 4PE7A 5I2OA 1L2OB 1VRKA 1QXPA 2KBMA 2ZN8A 3FS7A 4ETOA 5KSZA 1EJ3A 3GOFA 1DF0A 2F2PA 1B8LA 3NXAA 1QIVA 2ZNEA 1SL9A 5K89A 1KFXS 3OB1B 5ER4X 2JT3A 4QJ3B 1JUOA 2KYFA 2LVKA 3HCMA 3TUYC 1J1EA 1ZACA 1BJFA 4PE4A 1TCFA 2Y1MA 3WHUB 2KOTA 4M2PA 4YI8A 3PLFB 2AUCA 4M2QA 1QATA 4U8DA
chains in the Genus database with same CATH superfamily
1CNPA 1YX8A 1TRFA 2M9GA 1IJ6A 3LK1A 3DXLA 1LA0A 1AUIB 1B7TY 2G9BA 3F45A 4YI9A 4OKHA 2OTGB 1L7ZA 2LP3A 1XFVO 3FE6A 2SASA 2KLDA 4DUQA 2KNEA 1R6PA 2L51A 4GUKA 1DJYA 4MZJA 3V2LA 1GJYA 1OOHA 2KFHA 3I5FC 3EK8A 3O78A 3LL8B 3OP0A 3CR2A 3SJSA 2LUXA 3D75A 1FI6A 2KI4C 1NP8A 3AAJA 4GNKB 2PQLA 1M45A 1QX7A 1DJZA 1ZFSA 1YUSA 5CSNA 2PASA 3CYZA 1KQMC 3D0YB 3NGVA 1K95A 3JTDB 3NSIA 2FJYA 5D3OA 1DJGA 1MUXA 2CT9A 2GGMA 2LC5A 2LM5A 2WOSA 1LXFC 2LUCA 3PATA 1XFWO 1WY9A 1S6IA 1CDMA 1JF0A 1MXEA 1XO5A 5J3XA 4PE1A 2JC2A 1EH2A 1ZOTB 4PCWA 1KCYA 3PSRA 1X02A 3I5IC 1B1GA 4INWA 1UHJA 5AXIA 2GTEA 1J7RA 2PYQA 1C7WA 2P71A 1AK8A 1QX2A 5DKRA 1K2HA 1L2OC 3FE9A 5F6TA 1NSHA 1KFXL 3BUMB 1CDPA 1BR4B 1U5IB 3IVTA 2JPOA 2E30A 2M8UA 1AP4A 1DTLA 1IG5A 1MXLC 1OSAA 3A8RA 4BY5A 1A75B 2KFFA 2BE4A 1NWDA 1NX3A 2JTZA 1MR8A 1BU3A 1UHKA 1J7QA 2KBIA 2WCBA 1DELA 4XYNA 4DCKA 1ZUZA 2HQWA 2KYCA 2EC6B 1NUBA 2TN4A 1NYAA 1F54A 1MWNA 3SS3A 2A4JA 2DOQA 2MLEC 1CMGA 1SL8A 1V1FA 3AKAA 3EKHA 1XFYO 1Y0VH 2WCFA 2OTGC 3NHTA 3SIBA 1CLMA 3I5GB 2PRUA 2JULA 2LANA 2GGZA 2LVJA 2BBNA 2LV7A 2L4HA 1J55A 3CABA 4I5KA 5DKNA 3SG6A 1JWDA 1SY9A 1QV1A 3BOWB 1BT6A 1YTZC 2M0RA 2R2IA 2JQ6A 2CXJA 1UURA 1YRUB 1YRTB 1K9PA 2KAYA 3SIAA 1ALWA 1WLMA 3JTDC 3OGNA 2JZIA 1XA5A 2JTTA 5HKZA 1K94A 4QJ5B 3VRQA 1J7PA 4N1GA 2BBMA 3SS5A 1AHRA 4CPVA 1SCVA 5G08A 3VB1A 3TDUA 1KK7Z 3WXAA 1J7OA 1QV0A 1CFFA 1KSOA 2K2FA 4GGFC 2LMVA 2LMTA 4A4CA 1G8IA 1LA3A 3A4UB 1S6CA 2M3WA 4WQ3A 2JU0A 3DVMA 4GPLB 1QX5B 1U5IA 3NSOA 1PRWA 1SYMA 1XFRA 2KHNA 3BUOB 2LVVA 1PSRA 3VROA 1CMFA 3BJHA 2JXLA 3N7HA 2I18A 2LLUA 2NLNA 4DIRA 3CDNA 1UHIA 5B8IB 1QIWA 3R72A 1NX1A 1G33A 4R1EA 1R2UA 3TS5B 1K96A 3CR5X 2Q4UA 2L98A 2LLSA 5AEQA 1QS7A 5CSIA 2I94A 2KDHA 3SG4A 1BMOA 3BFAA 3D73A 4ZCVA 1RECA 2EC6C 1HQVA 1OZSA 2L5XB 1A03A 4JWQA 3NSKA 4WQ2A 1BOCA 1OE9B 1GQMA 1IWQA 1F4QA 4ICBA 4N5XA 2KAVA 1DC1A 1SSEB 3I5GC 4OCIA 1KSMA 5AANA 1OOGA 1RROA 3R1VA 1ALVA 5CPVA 2PALA 1SNLA 3QMEA 4MSPA 4ORAB 1H4BA 3CR4X 4KYNA 3HX4A 1PVAA 3UNWA 1TNXA 1BODA 2K7BA 2L0PA 4Q04A 4ORBB 5CSJA 1CLBA 3KPXA 1YVLA 2ZN9A 4JKTA 4CFRA 3ZNIA 2HPSA 2KGRA 3PM8A 5HLVA 1DMOA 2E6WA 1A4PA 3OBVA 3RLZA 1JF2A 1K8UA 2K61A 3CZ0A 4YBHB 2F33A 3B7AA 3SG5A 1BF5A 2SCPA 3AKBA 4XJKB 2BKIB 2I2RE 4INXA 1SK6D 2WCKA 3O4XA 1OMDA 2Y4QA 1SBJA 1XFZO 3LLEA 3BFBA 3CLNA 4OVNF 5GQQC 2QACA 4PHMA 2M29A 2QEVA 1DT7B 2Y1NA 4I5NB 3DF0B 1B8RA 2CCMA 4YGDB 3LCPC 5FYXA 1KK7Y 4I5JA 4UPGA 1TOPA 2NCOA 2ZFDA 3DD4A 2RGIA 2YGUA 2WCMA 1CLLA 5ER5A 1BLQA 1D1OA 1DJWA 2HQ8A 3TS5C 2KSPA 3Q8IA 2QEHA 1WDCB 2WORA 2BNXA 2CBLA 1P28A 2F3YA 3QRXA 4USLA 1K9UA 3RM1A 1ODBA 2KLEA 3BUXB 1SR6B 1E8AA 1Y6WA 4GGNA 4PE0A 1AJ5A 4P5OE 1JFKA 2FCDA 4CFQA 5AERA 3R1PA 4AQJA 4JQ0D 3SS4A 3S0GA 1CFDA 2GV5A 3BUWB 3BYAA 3KHEA 4TNCA 1Z2CB 2WNDA 1FPWA 2AMIA 1K93D 1AJ4A 1PALA 2BCBA 1RK9A 2LP2A 2OPOA 2WCJA 2L5YA 1Z4HA 2PMYA 2K0JA 3O6BA 4IL1A 5AFPA 2ISDA 1SMGA 1XFXO 1A29A 2MAZA 3VRPA 2WCEA 3PM2A 1KQVA 2OS8B 1PVBA 2MHHA 4C0JA 3BXKA 2KI6C 1W9ZA 1KFUL 4MN0A 1IGVA 1EG4A 4PHNA 2F8PA 4JPZB 1UP5A 1S36A 2PVBA 3D0YA 1NIWA 4NQGA 1HT9A 1SPYA 4DRWA 1YUUA 1TN4A 2ZRSA 3D10A 2B1UA 1W7IB 1DQEA 3DF0A 1CDNA 1UHHA 3FWBA 4YRUA 2CNPA 3EVRA 1A2XA 4OR9B 5I8NA 2KQ6A 1S6JA 4GGFA 2NZ0A 4F7FA 2KAXA 4N1FA 1GGWA 2G2BA 1F4OA 5D69A 1NCXA 2EGDA 3BQ3A 1CM4A 1DF0B 1DEKA 1QLKA 2Q91A 2AAOA 1WRLA 3EK7A 4CLNA 2Y5IA 1C07A 1GGZA 3D77A 4HREE 2P6BB 2LMUA 1WDCC 2L2EA 1F8HA 1PULA 1B8CA 2K2AA 3DZTA 1YVHA 3PN7B 2KI6D 4NDCA 1A75A 1NCYA 1SR6C 2FOTA 1F70A 4ZCUA 2HETA 1B4CA 1XK4C 1TUJA 3FE8A 2JXCA 2JT8A 1W7JB 3O4YA 5I2QA 3DY9A 2KPHA 2LNKA 1S3PA 2CTNA 4OZDA 5HL1A 3S0FA 4E68A 1XFUO 3B6XA 2K8MB 2L2CA 2MA2A 1LS8A 1V1GA 2EHBA 2FCEA 1EXRA 1N65A 4MVFA 2BL0B 1QASA 1DJXA 3TDZA 4DS7A 2F3ZA 3BOWA 2ZRTA 2OS8C 4WRIA 3PLFB 3BFHA 3KF9A 1XYDA 1SL7A 3LK0A 1AVSA 2JNFA 2LVIA 5EL2A 2LCPA 1QLSA 1TNQA 3D76A 3EKJA 2F2OA 1N2DA 5JOLA 3VGOA 3VRNA 4NDDA 4D1EA 5JJGA 4PALA 1J1DA 1B9AA 4ORCB 1Y1AA 1T14A 1FF1A 5KU1A 3MSEB 4A4BA 4MRXA 1YX7A 1WLZA 1PK0D 2MBXA 1OW4A 1NCZA 1DVIA 3UO9A 1RJVA 1S1EA 1MF8B 1RWYA 1FW4A 1JBAA 3CWGA 2M7NA 1YURA 4MRYA 4AOMA 3DVEA 1KFUS 5FI2A 3VRRA 3I5HB 1TNWA 4AQIA 1IH0A 2I7AA 1TTXA 2BKHB 1S5GY 4GFTA 1S26D 1MQ1A 2JNXA 1WRKA 3CZ1A 1F55A 3B87A 4IJ7A 2QEOA 3CZ2A 1K90D 1ORGA 1C7VA 2LLTA 2D8NA 1M39A 3PN7C 3TDIA 5HYDA 3PFVA 3OB2B 1OOFA 4I5LB 1C3YA 5PALA 3K1EA 2M7LA 1IJ5A 2JT0A 3KO0A 3SG3A 1UUSA 2LAPA 2MJWB 1QJTA 3E3RA 4HRGA 1OOIX 1ZMZA 2L50A 3CS1A 5FI7A 4MZLA 1QWVA 4L9MA 1DJHA 1FBVA 2HF5A 3S0DA 2BAPA 2O60A 3S0EA 1B47A 4MZKA 2M1KB 3CGAA 2JRFA 3OHMB 2MRDA 1KK8B 1M63B 2JWWA 2LHLA 3JVTB 1RFJA 3L4AA 4PDZA 2WC6A 2BL0C 1TUZA 3FWCA 5FI6A 5HKYA 4F0ZB 3OX6A 4JD9A 1YR5A 5I2LA 1IRJA 1QTXA 4BY4A 2KQYA 1Y1UA 2L4IA 3L4LA 1SCMB 3NSLA 1YUTA 1KWOB 4MBEA 2VRGA 4P2YB 5DKQA 1BR1B 2WCHA 3ZWHA 4C0LA 5DICA 1G4YR 1CB1A 3K21A 2P70A 2H8VA 2KFGA 4YGEB 1CTRA 1LKJA 1SRAA 3EVUA 1TCOB 1EG3A 3CZTX 1OOJA 1QVIY 3IQQA 1BG1A 1NPQA 1SW8A 4CIDA 3SG7A 3PALA 4XJKA 1NX2A 1Q80A 4C0KA 1SKTA 2K60A 2WCLA 3SG2A 1DGVA 2K7DA 3I5HC 1JFJA 2BECA 3IF7A 1WRZA 5I94A 1TWOA 3KEVA 2V53A 1IQ3A 2JOJA 1LVCD 4MLWA 2NCPA 5D7FA 2LHIA 4FQTA 3TZ1A 4QJ4B 1CKKA 1PSBA 2PSRA 1OMVA 1S5GZ 1K9KA 2ERBA 3GK1A 5TNCA 3EVVA 4FQOA 1MHOA 2KGBC 1LINA 2ZKMX 1DJIA 3DVKA 3ICBA 1B7TZ 4FTGA 5BPJA 1CFCA 4GAOA 1IKUA 1N0YA 1NX0A 1CFPA 3BUNB 5CSFA 3OX5A 2COLB 3TUYB 2BCAA 3C1VA 4PHKA 4HSZA 4GBAA 1JSAA 2NXQA 1EL4A 1Y1XA 2WC8A 2IS9A 1GM0A 2FJUB 4OV2A 1XK4A 1XVJA 2QEBA 1TIZA 1KK8C 3DVJA 2M49B 2O5GA 3JVTC 5HLOA 3S0AA 1UWOA 2H2KA 1OMRA 1OQPA 1M31A 3I5FB 2BE6A 3B88A 3WNXB 1CDLA 3AAKA 3R1OA 3RZSA 1SCMC 3O2PA 2KI4B 1KWOC 2WC5A 2K7OA 2M1UA 3H4SE 1RTP1 1OZOA 1CM1A 1KQMB 2K7CA 5HKWA 3M0WA 3D78A 1TNPA 4PHJA 1JC2A 2MLFC 2QDIA 5KTYA 4YGAA 1QVIZ 1UHNA 5IBWA 2ZNDA 3WHTB 1FI5A 4M2OA 1DGUA 2QPTA 3I5IB 2H61A 3CTNA 3GK4X 2BCXA 2LE9B 3GK2A 1H8BA 1IQ5A 4YGCB 1F71A 3IQOA 2M97A 3EK4A 4YGBB 2JPTA 3D74A 4HRHA 3FIAA 2H61C 1M46A 4MEWA 4NDBA 4PE7A 5I2OA 1L2OB 4PT1A 1VRKA 1QXPA 2KBMA 3PJIA 2ZN8A 3FS7A 4ETOA 5KSZA 1EJ3A 3GOFA 1DF0A 2F2PA 1B8LA 3DYEA 3NXAA 1QIVA 2ZNEA 1SL9A 3NHIA 5K89A 1KFXS 3OB1B 5ER4X 2JT3A 4QJ3B 1JUOA 2KYFA 2LVKA 3EG5B 3HCMA 3TUYC 1J1EA 1IIOA 3B86A 1ZACA 1BJFA 3S0BA 4PE4A 1C3ZA 1TCFA 2Y1MA 3WHUB 2KOTA 4M2PA 4YI8A 3L47A 2AUCA 4M2QA 1QATA 4U8DA
chains in the Genus database with same CATH topology
1CNPA 1YX8A 1TRFA 2M9GA 1IJ6A 3LK1A 3F45A 1LA0A 1AUIB 1B7TY 2G9BA 4YI9A 4OKHA 2OTGB 1L7ZA 2LP3A 1XFVO 4DUQA 2SASA 2KNEA 1R6PA 2L51A 4GUKA 1DJYA 4MZJA 1GJYA 2KFHA 3I5FC 3EK8A 3O78A 3LL8B 3OP0A 3CR2A 3SJSA 2LUXA 1FI6A 2KI4C 1NP8A 3AAJA 4GNKB 1M45A 1QX7A 1DJZA 1ZFSA 1YUSA 5CSNA 2PASA 3D0YB 1KQMC 1K95A 3JTDB 3NSIA 1DJGA 1MUXA 2CT9A 2GGMA 2LC5A 2LM5A 2WOSA 1LXFC 2LUCA 3PATA 1XFWO 1WY9A 1S6IA 1CDMA 1JF0A 1MXEA 1XO5A 5J3XA 4PE1A 2JC2A 1EH2A 1ZOTB 4PCWA 1KCYA 3PSRA 1X02A 3I5IC 1B1GA 1UHJA 5AXIA 1J7RA 1C7WA 1AK8A 1QX2A 5DKRA 1K2HA 1L2OC 5F6TA 1NSHA 1KFXL 3BUMB 1CDPA 1BR4B 1U5IB 2M8UA 2E30A 1DTLA 1IG5A 1MXLC 1OSAA 3A8RA 4BY5A 1A75B 2KFFA 2BE4A 1NWDA 1NX3A 2JTZA 1MR8A 1BU3A 1UHKA 1J7QA 2KBIA 2WCBA 4XYNA 4DCKA 1ZUZA 2HQWA 2KYCA 2EC6B 1NUBA 2TN4A 1NYAA 1F54A 1MWNA 2A4JA 2DOQA 2MLEC 1CMGA 1SL8A 1V1FA 3AKAA 3EKHA 1XFYO 1Y0VH 2WCFA 2OTGC 3SIBA 1CLMA 3I5GB 2PRUA 2JULA 2LANA 2GGZA 2LVJA 2BBNA 2LV7A 2L4HA 1J55A 4I5KA 5DKNA 3SG6A 1JWDA 1SY9A 1QV1A 3BOWB 1BT6A 1YTZC 2M0RA 2R2IA 2JQ6A 2CXJA 1UURA 1YRUB 1YRTB 1K9PA 2KAYA 3SIAA 1ALWA 1WLMA 3JTDC 2JZIA 1XA5A 2JTTA 5HKZA 1K94A 4QJ5B 3VRQA 1J7PA 4N1GA 2BBMA 1AHRA 4CPVA 1SCVA 5G08A 3TDUA 1KK7Z 3WXAA 1J7OA 1QV0A 1CFFA 1KSOA 2K2FA 4GGFC 2LMVA 2LMTA 4A4CA 1G8IA 1LA3A 3A4UB 1S6CA 2M3WA 4WQ3A 2JU0A 3DVMA 4GPLB 1QX5B 1U5IA 3NSOA 1PRWA 1SYMA 2KHNA 3BUOB 2LVVA 1PSRA 3VROA 1CMFA 2JXLA 2I18A 2LLUA 2NLNA 4DIRA 1UHIA 5B8IB 1QIWA 1NX1A 1G33A 4R1EA 1R2UA 3TS5B 1K96A 3CR5X 2Q4UA 2L98A 2LLSA 5AEQA 1QS7A 5CSIA 2I94A 2KDHA 3SG4A 1BMOA 4ZCVA 1RECA 2EC6C 1HQVA 1OZSA 2L5XB 1A03A 4JWQA 3NSKA 4WQ2A 1BOCA 1OE9B 1GQMA 1IWQA 1F4QA 4ICBA 4N5XA 2KAVA 4OCIA 3I5GC 1KSMA 5AANA 1RROA 1ALVA 5CPVA 2PALA 1SNLA 4MSPA 4ORAB 1H4BA 3CR4X 3HX4A 1PVAA 1TNXA 1BODA 2K7BA 2L0PA 4Q04A 4ORBB 5CSJA 1CLBA 3KPXA 1YVLA 2ZN9A 4CFRA 3ZNIA 2HPSA 2KGRA 3PM8A 5HLVA 1DMOA 2E6WA 1A4PA 3RLZA 1JF2A 1K8UA 2K61A 4YBHB 1BF5A 2F33A 3SG5A 2SCPA 3AKBA 4XJKB 2BKIB 2I2RE 1SK6D 1OMDA 2Y4QA 1SBJA 1XFZO 3LLEA 3CLNA 4OVNF 5GQQC 2QACA 4PHMA 2M29A 1DT7B 2Y1NA 4I5NB 3DF0B 1B8RA 2CCMA 4YGDB 3LCPC 5FYXA 1KK7Y 4I5JA 4UPGA 1TOPA 2NCOA 2ZFDA 3DD4A 2RGIA 1CLLA 5ER5A 1BLQA 1D1OA 1DJWA 2HQ8A 3TS5C 2KSPA 1WDCB 2WORA 2CBLA 2F3YA 3QRXA 4USLA 1K9UA 3RM1A 1ODBA 3BUXB 1SR6B 1E8AA 1Y6WA 4GGNA 4PE0A 1AJ5A 4P5OE 1JFKA 2FCDA 4CFQA 5AERA 4AQJA 4JQ0D 1CFDA 2GV5A 3BUWB 3BYAA 3KHEA 4TNCA 2WNDA 1FPWA 2AMIA 1K93D 1AJ4A 1PALA 2BCBA 1RK9A 2LP2A 2OPOA 2PMYA 2K0JA 3O6BA 4IL1A 5AFPA 2ISDA 1SMGA 1XFXO 1A29A 2MAZA 3VRPA 2WCEA 1KQVA 2OS8B 1PVBA 2MHHA 4C0JA 3BXKA 2KI6C 1KFUL 4MN0A 1IGVA 1EG4A 4PHNA 2F8PA 4JPZB 1UP5A 1S36A 2PVBA 3D0YA 1NIWA 4NQGA 1HT9A 1SPYA 4DRWA 1YUUA 1TN4A 2ZRSA 3D10A 2B1UA 1W7IB 3DF0A 1CDNA 1UHHA 3FWBA 4YRUA 2CNPA 3EVRA 1A2XA 4OR9B 5I8NA 2KQ6A 1S6JA 4GGFA 2NZ0A 2KAXA 4N1FA 1GGWA 2G2BA 1F4OA 5D69A 1NCXA 2EGDA 3BQ3A 1CM4A 1DF0B 1QLKA 2Q91A 2AAOA 1WRLA 3EK7A 4CLNA 2Y5IA 1C07A 1GGZA 4HREE 2P6BB 2LMUA 1WDCC 2L2EA 1F8HA 1PULA 1B8CA 2K2AA 1YVHA 3PN7B 2KI6D 4NDCA 1A75A 1NCYA 1SR6C 2FOTA 1F70A 4ZCUA 2HETA 1B4CA 1XK4C 2JXCA 2JT8A 1W7JB 3O4YA 5I2QA 2LNKA 1S3PA 2CTNA 4E68A 1XFUO 2K8MB 2MA2A 1V1GA 2EHBA 2FCEA 1EXRA 1N65A 4MVFA 2BL0B 1QASA 1DJXA 3TDZA 4DS7A 2F3ZA 3BOWA 2ZRTA 2OS8C 4WRIA 3KF9A 1XYDA 1SL7A 3LK0A 1AVSA 2JNFA 2LVIA 2LCPA 1QLSA 1TNQA 3EKJA 5JOLA 2F2OA 1N2DA 3VGOA 3VRNA 4D1EA 4NDDA 5JJGA 4PALA 1J1DA 1B9AA 4ORCB 1Y1AA 1FF1A 5KU1A 3MSEB 4A4BA 4MRXA 1YX7A 1WLZA 1PK0D 2MBXA 1NCZA 1DVIA 1RJVA 1S1EA 1MF8B 1RWYA 1FW4A 1JBAA 3CWGA 2M7NA 1YURA 4MRYA 4AOMA 3DVEA 1KFUS 3VRRA 3I5HB 1TNWA 4AQIA 1IH0A 2I7AA 1TTXA 2BKHB 1S5GY 4GFTA 1S26D 1MQ1A 2JNXA 1WRKA 1F55A 1K90D 1C7VA 2LLTA 2D8NA 1M39A 3PN7C 3TDIA 5HYDA 3PFVA 3OB2B 4I5LB 5PALA 2M7LA 3SG3A 1IJ5A 2JT0A 3KO0A 1AP4A 1UUSA 2LAPA 2MJWB 1QJTA 3E3RA 4HRGA 3CS1A 1ZMZA 2L50A 4MZLA 4L9MA 1DJHA 1FBVA 2HF5A 2O60A 1B47A 4MZKA 2M1KB 3CGAA 2JRFA 3OHMB 2MRDA 1KK8B 1M63B 2JWWA 2LHLA 3JVTB 1RFJA 4PDZA 2BL0C 3FWCA 5HKYA 4F0ZB 3OX6A 1YR5A 5I2LA 1IRJA 1QTXA 4BY4A 2KQYA 1Y1UA 2L4IA 3NSLA 1SCMB 1YUTA 1KWOB 4MBEA 2VRGA 4P2YB 5DKQA 1BR1B 3ZWHA 4C0LA 1G4YR 1CB1A 3K21A 4YGEB 2KFGA 1CTRA 1LKJA 1SRAA 3EVUA 1TCOB 1EG3A 3CZTX 1OOJA 1QVIY 3IQQA 1BG1A 1NPQA 1SW8A 4CIDA 3SG7A 3PALA 4XJKA 1NX2A 1Q80A 4C0KA 1SKTA 3SG2A 1DGVA 2K7DA 3I5HC 1JFJA 2BECA 3IF7A 1WRZA 3KEVA 2V53A 1IQ3A 2JOJA 1LVCD 4MLWA 2NCPA 5D7FA 2LHIA 3TZ1A 4QJ4B 1CKKA 1PSBA 2PSRA 1OMVA 1S5GZ 1K9KA 3GK1A 5TNCA 3EVVA 4FQOA 1MHOA 2KGBC 1LINA 2ZKMX 1DJIA 3DVKA 3ICBA 1B7TZ 4FTGA 5BPJA 1CFCA 4GAOA 1IKUA 1N0YA 1NX0A 1CFPA 3BUNB 5CSFA 3OX5A 2COLB 3TUYB 2BCAA 3C1VA 4PHKA 4HSZA 4GBAA 1JSAA 2NXQA 1EL4A 1Y1XA 2WC8A 2IS9A 2FJUB 4OV2A 1XK4A 1XVJA 1TIZA 1KK8C 3DVJA 2M49B 2O5GA 3JVTC 5HLOA 1UWOA 2H2KA 1OMRA 1OQPA 1M31A 3I5FB 2BE6A 3WNXB 1CDLA 3AAKA 1SCMC 3O2PA 2KI4B 1KWOC 2K7OA 2M1UA 3H4SE 1RTP1 1OZOA 1CM1A 1KQMB 2K7CA 5HKWA 3M0WA 1TNPA 4PHJA 1JC2A 2MLFC 5KTYA 4YGAA 1QVIZ 1UHNA 5IBWA 2ZNDA 3WHTB 1FI5A 4M2OA 1DGUA 2QPTA 3I5IB 2H61A 3CTNA 3GK4X 2BCXA 2LE9B 3GK2A 1H8BA 1IQ5A 4YGCB 1F71A 3IQOA 2M97A 3EK4A 4YGBB 2JPTA 4HRHA 3FIAA 2H61C 1M46A 4MEWA 4NDBA 4PE7A 5I2OA 1L2OB 1VRKA 1QXPA 2KBMA 2ZN8A 3FS7A 4ETOA 5KSZA 1EJ3A 3GOFA 1DF0A 2F2PA 1B8LA 3NXAA 1QIVA 2ZNEA 1SL9A 5K89A 1KFXS 3OB1B 5ER4X 2JT3A 4QJ3B 1JUOA 2KYFA 2LVKA 3HCMA 3TUYC 1J1EA 1ZACA 1BJFA 4PE4A 1TCFA 2Y1MA 3WHUB 2KOTA 4M2PA 4YI8A 3PLFB 2AUCA 4M2QA 1QATA 4U8DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CNP A;  1YX8 A;  1TRF A;  2M9G A;  1IJ6 A;  3LK1 A;  3F45 A;  1LA0 A;  1AUI B;  1B7T Y;  2G9B A;  4YI9 A;  4OKH A;  2OTG B;  1L7Z A;  2LP3 A;  1XFV O;  4DUQ A;  2SAS A;  2KNE A;  1R6P A;  2L51 A;  4GUK A;  1DJY A;  4MZJ A;  1GJY A;  2KFH A;  3I5F C;  3EK8 A;  3O78 A;  3LL8 B;  3OP0 A;  3CR2 A;  3SJS A;  2LUX A;  1FI6 A;  2KI4 C;  1NP8 A;  3AAJ A;  4GNK B;  1M45 A;  1QX7 A;  1DJZ A;  1ZFS A;  1YUS A;  5CSN A;  2PAS A;  3D0Y B;  1KQM C;  1K95 A;  3JTD B;  3NSI A;  1DJG A;  1MUX A;  2CT9 A;  2GGM A;  2LC5 A;  2LM5 A;  2WOS A;  1LXF C;  2LUC A;  3PAT A;  1XFW O;  1WY9 A;  1S6I A;  1CDM A;  1JF0 A;  1MXE A;  1XO5 A;  5J3X A;  4PE1 A;  2JC2 A;  1EH2 A;  1ZOT B;  4PCW A;  1KCY A;  3PSR A;  1X02 A;  3I5I C;  1B1G A;  1UHJ A;  5AXI A;  1J7R A;  1C7W A;  1AK8 A;  1QX2 A;  5DKR A;  1K2H A;  1L2O C;  5F6T A;  1NSH A;  1KFX L;  3BUM B;  1CDP A;  1BR4 B;  1U5I B;  2M8U A;  2E30 A;  1DTL A;  1IG5 A;  1MXL C;  1OSA A;  3A8R A;  4BY5 A;  1A75 B;  2KFF A;  2BE4 A;  1NWD A;  1NX3 A;  2JTZ A;  1MR8 A;  1BU3 A;  1UHK A;  1J7Q A;  2KBI A;  2WCB A;  4XYN A;  4DCK A;  1ZUZ A;  2HQW A;  2KYC A;  2EC6 B;  1NUB A;  2TN4 A;  1NYA A;  1F54 A;  1MWN A;  2A4J A;  2DOQ A;  2MLE C;  1CMG A;  1SL8 A;  1V1F A;  3AKA A;  3EKH A;  1XFY O;  1Y0V H;  2WCF A;  2OTG C;  3SIB A;  1CLM A;  3I5G B;  2PRU A;  2JUL A;  2LAN A;  2GGZ A;  2LVJ A;  2BBN A;  2LV7 A;  2L4H A;  1J55 A;  4I5K A;  5DKN A;  3SG6 A;  1JWD A;  1SY9 A;  1QV1 A;  3BOW B;  1BT6 A;  1YTZ C;  2M0R A;  2R2I A;  2JQ6 A;  2CXJ A;  1UUR A;  1YRU B;  1YRT B;  1K9P A;  2KAY A;  3SIA A;  1ALW A;  1WLM A;  3JTD C;  2JZI A;  1XA5 A;  2JTT A;  5HKZ A;  1K94 A;  4QJ5 B;  3VRQ A;  1J7P A;  4N1G A;  2BBM A;  1AHR A;  4CPV A;  1SCV A;  5G08 A;  3TDU A;  1KK7 Z;  3WXA A;  1J7O A;  1QV0 A;  1CFF A;  1KSO A;  2K2F A;  4GGF C;  2LMV A;  2LMT A;  4A4C A;  1G8I A;  1LA3 A;  3A4U B;  1S6C A;  2M3W A;  4WQ3 A;  2JU0 A;  3DVM A;  4GPL B;  1QX5 B;  1U5I A;  3NSO A;  1PRW A;  1SYM A;  2KHN A;  3BUO B;  2LVV A;  1PSR A;  3VRO A;  1CMF A;  2JXL A;  2I18 A;  2LLU A;  2NLN A;  4DIR A;  1UHI A;  5B8I B;  1QIW A;  1NX1 A;  1G33 A;  4R1E A;  1R2U A;  3TS5 B;  1K96 A;  3CR5 X;  2Q4U A;  2L98 A;  2LLS A;  5AEQ A;  1QS7 A;  5CSI A;  2I94 A;  2KDH A;  3SG4 A;  1BMO A;  4ZCV A;  1REC A;  2EC6 C;  1HQV A;  1OZS A;  2L5X B;  1A03 A;  4JWQ A;  3NSK A;  4WQ2 A;  1BOC A;  1OE9 B;  1GQM A;  1IWQ A;  1F4Q A;  4ICB A;  4N5X A;  2KAV A;  4OCI A;  3I5G C;  1KSM A;  5AAN A;  1RRO A;  1ALV A;  5CPV A;  2PAL A;  1SNL A;  4MSP A;  4ORA B;  1H4B A;  3CR4 X;  3HX4 A;  1PVA A;  1TNX A;  1BOD A;  2K7B A;  2L0P A;  4Q04 A;  4ORB B;  5CSJ A;  1CLB A;  3KPX A;  1YVL A;  2ZN9 A;  4CFR A;  3ZNI A;  2HPS A;  2KGR A;  3PM8 A;  5HLV A;  1DMO A;  2E6W A;  1A4P A;  3RLZ A;  1JF2 A;  1K8U A;  2K61 A;  4YBH B;  1BF5 A;  2F33 A;  3SG5 A;  2SCP A;  3AKB A;  4XJK B;  2BKI B;  2I2R E;  1SK6 D;  1OMD A;  2Y4Q A;  1SBJ A;  1XFZ O;  3LLE A;  3CLN A;  4OVN F;  5GQQ C;  2QAC A;  4PHM A;  2M29 A;  1DT7 B;  2Y1N A;  4I5N B;  3DF0 B;  1B8R A;  2CCM A;  4YGD B;  3LCP C;  5FYX A;  1KK7 Y;  4I5J A;  4UPG A;  1TOP A;  2NCO A;  2ZFD A;  3DD4 A;  2RGI A;  1CLL A;  5ER5 A;  1BLQ A;  1D1O A;  1DJW A;  2HQ8 A;  3TS5 C;  2KSP A;  1WDC B;  2WOR A;  2CBL A;  2F3Y A;  3QRX A;  4USL A;  1K9U A;  3RM1 A;  1ODB A;  3BUX B;  1SR6 B;  1E8A A;  1Y6W A;  4GGN A;  4PE0 A;  1AJ5 A;  4P5O E;  1JFK A;  2FCD A;  4CFQ A;  5AER A;  4AQJ A;  4JQ0 D;  1CFD A;  2GV5 A;  3BUW B;  3BYA A;  3KHE A;  4TNC A;  2WND A;  1FPW A;  2AMI A;  1K93 D;  1AJ4 A;  1PAL A;  2BCB A;  1RK9 A;  2LP2 A;  2OPO A;  2PMY A;  2K0J A;  3O6B A;  4IL1 A;  5AFP A;  2ISD A;  1SMG A;  1XFX O;  1A29 A;  2MAZ A;  3VRP A;  2WCE A;  1KQV A;  2OS8 B;  1PVB A;  2MHH A;  4C0J A;  3BXK A;  2KI6 C;  1KFU L;  4MN0 A;  1IGV A;  1EG4 A;  4PHN A;  2F8P A;  4JPZ B;  1UP5 A;  1S36 A;  2PVB A;  3D0Y A;  1NIW A;  4NQG A;  1HT9 A;  1SPY A;  4DRW A;  1YUU A;  1TN4 A;  2ZRS A;  3D10 A;  2B1U A;  1W7I B;  3DF0 A;  1CDN A;  1UHH A;  3FWB A;  4YRU A;  2CNP A;  3EVR A;  1A2X A;  4OR9 B;  5I8N A;  2KQ6 A;  1S6J A;  4GGF A;  2NZ0 A;  2KAX A;  4N1F A;  1GGW A;  2G2B A;  1F4O A;  5D69 A;  1NCX A;  2EGD A;  3BQ3 A;  1CM4 A;  1DF0 B;  1QLK A;  2Q91 A;  2AAO A;  1WRL A;  3EK7 A;  4CLN A;  2Y5I A;  1C07 A;  1GGZ A;  4HRE E;  2P6B B;  2LMU A;  1WDC C;  2L2E A;  1F8H A;  1PUL A;  1B8C A;  2K2A A;  1YVH A;  3PN7 B;  2KI6 D;  4NDC A;  1A75 A;  1NCY A;  1SR6 C;  2FOT A;  1F70 A;  4ZCU A;  2HET A;  1B4C A;  1XK4 C;  2JXC A;  2JT8 A;  1W7J B;  3O4Y A;  5I2Q A;  2LNK A;  1S3P A;  2CTN A;  4E68 A;  1XFU O;  2K8M B;  2MA2 A;  1V1G A;  2EHB A;  2FCE A;  1EXR A;  1N65 A;  4MVF A;  2BL0 B;  1QAS A;  1DJX A;  3TDZ A;  4DS7 A;  2F3Z A;  3BOW A;  2ZRT A;  2OS8 C;  4WRI A;  3KF9 A;  1XYD A;  1SL7 A;  3LK0 A;  1AVS A;  2JNF A;  2LVI A;  2LCP A;  1QLS A;  1TNQ A;  3EKJ A;  5JOL A;  2F2O A;  1N2D A;  3VGO A;  3VRN A;  4D1E A;  4NDD A;  5JJG A;  4PAL A;  1J1D A;  1B9A A;  4ORC B;  1Y1A A;  1FF1 A;  5KU1 A;  3MSE B;  4A4B A;  4MRX A;  1YX7 A;  1WLZ A;  1PK0 D;  2MBX A;  1NCZ A;  1DVI A;  1RJV A;  1S1E A;  1MF8 B;  1RWY A;  1FW4 A;  1JBA A;  3CWG A;  2M7N A;  1YUR A;  4MRY A;  4AOM A;  3DVE A;  1KFU S;  3VRR A;  3I5H B;  1TNW A;  4AQI A;  1IH0 A;  2I7A A;  1TTX A;  2BKH B;  1S5G Y;  4GFT A;  1S26 D;  1MQ1 A;  2JNX A;  1WRK A;  1F55 A;  1K90 D;  1C7V A;  2LLT A;  2D8N A;  1M39 A;  3PN7 C;  3TDI A;  5HYD A;  3PFV A;  3OB2 B;  4I5L B;  5PAL A;  2M7L A;  3SG3 A;  1IJ5 A;  2JT0 A;  3KO0 A;  1AP4 A;  1UUS A;  2LAP A;  2MJW B;  1QJT A;  3E3R A;  4HRG A;  3CS1 A;  1ZMZ A;  2L50 A;  4MZL A;  4L9M A;  1DJH A;  1FBV A;  2HF5 A;  2O60 A;  1B47 A;  4MZK A;  2M1K B;  3CGA A;  2JRF A;  3OHM B;  2MRD A;  1KK8 B;  1M63 B;  2JWW A;  2LHL A;  3JVT B;  1RFJ A;  4PDZ A;  2BL0 C;  3FWC A;  5HKY A;  4F0Z B;  3OX6 A;  1YR5 A;  5I2L A;  1IRJ A;  1QTX A;  4BY4 A;  2KQY A;  1Y1U A;  2L4I A;  3NSL A;  1SCM B;  1YUT A;  1KWO B;  4MBE A;  2VRG A;  4P2Y B;  5DKQ A;  1BR1 B;  3ZWH A;  4C0L A;  1G4Y R;  1CB1 A;  3K21 A;  4YGE B;  2KFG A;  1CTR A;  1LKJ A;  1SRA A;  3EVU A;  1TCO B;  1EG3 A;  3CZT X;  1OOJ A;  1QVI Y;  3IQQ A;  1BG1 A;  1NPQ A;  1SW8 A;  4CID A;  3SG7 A;  3PAL A;  4XJK A;  1NX2 A;  1Q80 A;  4C0K A;  1SKT A;  3SG2 A;  1DGV A;  2K7D A;  3I5H C;  1JFJ A;  2BEC A;  3IF7 A;  1WRZ A;  3KEV A;  2V53 A;  1IQ3 A;  2JOJ A;  1LVC D;  4MLW A;  2NCP A;  5D7F A;  2LHI A;  3TZ1 A;  4QJ4 B;  1CKK A;  1PSB A;  2PSR A;  1OMV A;  1S5G Z;  1K9K A;  3GK1 A;  5TNC A;  3EVV A;  4FQO A;  1MHO A;  2KGB C;  1LIN A;  2ZKM X;  1DJI A;  3DVK A;  3ICB A;  1B7T Z;  4FTG A;  5BPJ A;  1CFC A;  4GAO A;  1IKU A;  1N0Y A;  1NX0 A;  1CFP A;  3BUN B;  5CSF A;  3OX5 A;  2COL B;  3TUY B;  2BCA A;  3C1V A;  4PHK A;  4HSZ A;  4GBA A;  1JSA A;  2NXQ A;  1EL4 A;  1Y1X A;  2WC8 A;  2IS9 A;  2FJU B;  4OV2 A;  1XK4 A;  1XVJ A;  1TIZ A;  1KK8 C;  3DVJ A;  2M49 B;  2O5G A;  3JVT C;  5HLO A;  1UWO A;  2H2K A;  1OMR A;  1OQP A;  1M31 A;  3I5F B;  2BE6 A;  3WNX B;  1CDL A;  3AAK A;  1SCM C;  3O2P A;  2KI4 B;  1KWO C;  2K7O A;  2M1U A;  3H4S E;  1RTP 1;  1OZO A;  1CM1 A;  1KQM B;  2K7C A;  5HKW A;  3M0W A;  1TNP A;  4PHJ A;  1JC2 A;  2MLF C;  5KTY A;  4YGA A;  1QVI Z;  1UHN A;  5IBW A;  2ZND A;  3WHT B;  1FI5 A;  4M2O A;  1DGU A;  2QPT A;  3I5I B;  2H61 A;  3CTN A;  3GK4 X;  2BCX A;  2LE9 B;  3GK2 A;  1H8B A;  1IQ5 A;  4YGC B;  1F71 A;  3IQO A;  2M97 A;  3EK4 A;  4YGB B;  2JPT A;  4HRH A;  3FIA A;  2H61 C;  1M46 A;  4MEW A;  4NDB A;  4PE7 A;  5I2O A;  1L2O B;  1VRK A;  1QXP A;  2KBM A;  2ZN8 A;  3FS7 A;  4ETO A;  5KSZ A;  1EJ3 A;  3GOF A;  1DF0 A;  2F2P A;  1B8L A;  3NXA A;  1QIV A;  2ZNE A;  1SL9 A;  5K89 A;  1KFX S;  3OB1 B;  5ER4 X;  2JT3 A;  4QJ3 B;  1JUO A;  2KYF A;  2LVK A;  3HCM A;  3TUY C;  1J1E A;  1ZAC A;  1BJF A;  4PE4 A;  1TCF A;  2Y1M A;  3WHU B;  2KOT A;  4M2P A;  4YI8 A;  3PLF B;  2AUC A;  4M2Q A;  1QAT A;  4U8D A; 
#chains in the Genus database with same CATH topology
 1CNP A;  1YX8 A;  1TRF A;  2M9G A;  1IJ6 A;  3LK1 A;  3DXL A;  1LA0 A;  1AUI B;  1B7T Y;  2G9B A;  3F45 A;  4YI9 A;  4OKH A;  2OTG B;  1L7Z A;  2LP3 A;  1XFV O;  3FE6 A;  2SAS A;  2KLD A;  4DUQ A;  2KNE A;  1R6P A;  2L51 A;  4GUK A;  1DJY A;  4MZJ A;  3V2L A;  1GJY A;  1OOH A;  2KFH A;  3I5F C;  3EK8 A;  3O78 A;  3LL8 B;  3OP0 A;  3CR2 A;  3SJS A;  2LUX A;  3D75 A;  1FI6 A;  2KI4 C;  1NP8 A;  3AAJ A;  4GNK B;  2PQL A;  1M45 A;  1QX7 A;  1DJZ A;  1ZFS A;  1YUS A;  5CSN A;  2PAS A;  3CYZ A;  1KQM C;  3D0Y B;  3NGV A;  1K95 A;  3JTD B;  3NSI A;  2FJY A;  5D3O A;  1DJG A;  1MUX A;  2CT9 A;  2GGM A;  2LC5 A;  2LM5 A;  2WOS A;  1LXF C;  2LUC A;  3PAT A;  1XFW O;  1WY9 A;  1S6I A;  1CDM A;  1JF0 A;  1MXE A;  1XO5 A;  5J3X A;  4PE1 A;  2JC2 A;  1EH2 A;  1ZOT B;  4PCW A;  1KCY A;  3PSR A;  1X02 A;  3I5I C;  1B1G A;  4INW A;  1UHJ A;  5AXI A;  2GTE A;  1J7R A;  2PYQ A;  1C7W A;  2P71 A;  1AK8 A;  1QX2 A;  5DKR A;  1K2H A;  1L2O C;  3FE9 A;  5F6T A;  1NSH A;  1KFX L;  3BUM B;  1CDP A;  1BR4 B;  1U5I B;  3IVT A;  2JPO A;  2E30 A;  2M8U A;  1AP4 A;  1DTL A;  1IG5 A;  1MXL C;  1OSA A;  3A8R A;  4BY5 A;  1A75 B;  2KFF A;  2BE4 A;  1NWD A;  1NX3 A;  2JTZ A;  1MR8 A;  1BU3 A;  1UHK A;  1J7Q A;  2KBI A;  2WCB A;  1DEL A;  4XYN A;  4DCK A;  1ZUZ A;  2HQW A;  2KYC A;  2EC6 B;  1NUB A;  2TN4 A;  1NYA A;  1F54 A;  1MWN A;  3SS3 A;  2A4J A;  2DOQ A;  2MLE C;  1CMG A;  1SL8 A;  1V1F A;  3AKA A;  3EKH A;  1XFY O;  1Y0V H;  2WCF A;  2OTG C;  3NHT A;  3SIB A;  1CLM A;  3I5G B;  2PRU A;  2JUL A;  2LAN A;  2GGZ A;  2LVJ A;  2BBN A;  2LV7 A;  2L4H A;  1J55 A;  3CAB A;  4I5K A;  5DKN A;  3SG6 A;  1JWD A;  1SY9 A;  1QV1 A;  3BOW B;  1BT6 A;  1YTZ C;  2M0R A;  2R2I A;  2JQ6 A;  2CXJ A;  1UUR A;  1YRU B;  1YRT B;  1K9P A;  2KAY A;  3SIA A;  1ALW A;  1WLM A;  3JTD C;  3OGN A;  2JZI A;  1XA5 A;  2JTT A;  5HKZ A;  1K94 A;  4QJ5 B;  3VRQ A;  1J7P A;  4N1G A;  2BBM A;  3SS5 A;  1AHR A;  4CPV A;  1SCV A;  5G08 A;  3VB1 A;  3TDU A;  1KK7 Z;  3WXA A;  1J7O A;  1QV0 A;  1CFF A;  1KSO A;  2K2F A;  4GGF C;  2LMV A;  2LMT A;  4A4C A;  1G8I A;  1LA3 A;  3A4U B;  1S6C A;  2M3W A;  4WQ3 A;  2JU0 A;  3DVM A;  4GPL B;  1QX5 B;  1U5I A;  3NSO A;  1PRW A;  1SYM A;  1XFR A;  2KHN A;  3BUO B;  2LVV A;  1PSR A;  3VRO A;  1CMF A;  3BJH A;  2JXL A;  3N7H A;  2I18 A;  2LLU A;  2NLN A;  4DIR A;  3CDN A;  1UHI A;  5B8I B;  1QIW A;  3R72 A;  1NX1 A;  1G33 A;  4R1E A;  1R2U A;  3TS5 B;  1K96 A;  3CR5 X;  2Q4U A;  2L98 A;  2LLS A;  5AEQ A;  1QS7 A;  5CSI A;  2I94 A;  2KDH A;  3SG4 A;  1BMO A;  3BFA A;  3D73 A;  4ZCV A;  1REC A;  2EC6 C;  1HQV A;  1OZS A;  2L5X B;  1A03 A;  4JWQ A;  3NSK A;  4WQ2 A;  1BOC A;  1OE9 B;  1GQM A;  1IWQ A;  1F4Q A;  4ICB A;  4N5X A;  2KAV A;  1DC1 A;  1SSE B;  3I5G C;  4OCI A;  1KSM A;  5AAN A;  1OOG A;  1RRO A;  3R1V A;  1ALV A;  5CPV A;  2PAL A;  1SNL A;  3QME A;  4MSP A;  4ORA B;  1H4B A;  3CR4 X;  4KYN A;  3HX4 A;  1PVA A;  3UNW A;  1TNX A;  1BOD A;  2K7B A;  2L0P A;  4Q04 A;  4ORB B;  5CSJ A;  1CLB A;  3KPX A;  1YVL A;  2ZN9 A;  4JKT A;  4CFR A;  3ZNI A;  2HPS A;  2KGR A;  3PM8 A;  5HLV A;  1DMO A;  2E6W A;  1A4P A;  3OBV A;  3RLZ A;  1JF2 A;  1K8U A;  2K61 A;  3CZ0 A;  4YBH B;  2F33 A;  3B7A A;  3SG5 A;  1BF5 A;  2SCP A;  3AKB A;  4XJK B;  2BKI B;  2I2R E;  4INX A;  1SK6 D;  2WCK A;  3O4X A;  1OMD A;  2Y4Q A;  1SBJ A;  1XFZ O;  3LLE A;  3BFB A;  3CLN A;  4OVN F;  5GQQ C;  2QAC A;  4PHM A;  2M29 A;  2QEV A;  1DT7 B;  2Y1N A;  4I5N B;  3DF0 B;  1B8R A;  2CCM A;  4YGD B;  3LCP C;  5FYX A;  1KK7 Y;  4I5J A;  4UPG A;  1TOP A;  2NCO A;  2ZFD A;  3DD4 A;  2RGI A;  2YGU A;  2WCM A;  1CLL A;  5ER5 A;  1BLQ A;  1D1O A;  1DJW A;  2HQ8 A;  3TS5 C;  2KSP A;  3Q8I A;  2QEH A;  1WDC B;  2WOR A;  2BNX A;  2CBL A;  1P28 A;  2F3Y A;  3QRX A;  4USL A;  1K9U A;  3RM1 A;  1ODB A;  2KLE A;  3BUX B;  1SR6 B;  1E8A A;  1Y6W A;  4GGN A;  4PE0 A;  1AJ5 A;  4P5O E;  1JFK A;  2FCD A;  4CFQ A;  5AER A;  3R1P A;  4AQJ A;  4JQ0 D;  3SS4 A;  3S0G A;  1CFD A;  2GV5 A;  3BUW B;  3BYA A;  3KHE A;  4TNC A;  1Z2C B;  2WND A;  1FPW A;  2AMI A;  1K93 D;  1AJ4 A;  1PAL A;  2BCB A;  1RK9 A;  2LP2 A;  2OPO A;  2WCJ A;  2L5Y A;  1Z4H A;  2PMY A;  2K0J A;  3O6B A;  4IL1 A;  5AFP A;  2ISD A;  1SMG A;  1XFX O;  1A29 A;  2MAZ A;  3VRP A;  2WCE A;  3PM2 A;  1KQV A;  2OS8 B;  1PVB A;  2MHH A;  4C0J A;  3BXK A;  2KI6 C;  1W9Z A;  1KFU L;  4MN0 A;  1IGV A;  1EG4 A;  4PHN A;  2F8P A;  4JPZ B;  1UP5 A;  1S36 A;  2PVB A;  3D0Y A;  1NIW A;  4NQG A;  1HT9 A;  1SPY A;  4DRW A;  1YUU A;  1TN4 A;  2ZRS A;  3D10 A;  2B1U A;  1W7I B;  1DQE A;  3DF0 A;  1CDN A;  1UHH A;  3FWB A;  4YRU A;  2CNP A;  3EVR A;  1A2X A;  4OR9 B;  5I8N A;  2KQ6 A;  1S6J A;  4GGF A;  2NZ0 A;  4F7F A;  2KAX A;  4N1F A;  1GGW A;  2G2B A;  1F4O A;  5D69 A;  1NCX A;  2EGD A;  3BQ3 A;  1CM4 A;  1DF0 B;  1DEK A;  1QLK A;  2Q91 A;  2AAO A;  1WRL A;  3EK7 A;  4CLN A;  2Y5I A;  1C07 A;  1GGZ A;  3D77 A;  4HRE E;  2P6B B;  2LMU A;  1WDC C;  2L2E A;  1F8H A;  1PUL A;  1B8C A;  2K2A A;  3DZT A;  1YVH A;  3PN7 B;  2KI6 D;  4NDC A;  1A75 A;  1NCY A;  1SR6 C;  2FOT A;  1F70 A;  4ZCU A;  2HET A;  1B4C A;  1XK4 C;  1TUJ A;  3FE8 A;  2JXC A;  2JT8 A;  1W7J B;  3O4Y A;  5I2Q A;  3DY9 A;  2KPH A;  2LNK A;  1S3P A;  2CTN A;  4OZD A;  5HL1 A;  3S0F A;  4E68 A;  1XFU O;  3B6X A;  2K8M B;  2L2C A;  2MA2 A;  1LS8 A;  1V1G A;  2EHB A;  2FCE A;  1EXR A;  1N65 A;  4MVF A;  2BL0 B;  1QAS A;  1DJX A;  3TDZ A;  4DS7 A;  2F3Z A;  3BOW A;  2ZRT A;  2OS8 C;  4WRI A;  3PLF B;  3BFH A;  3KF9 A;  1XYD A;  1SL7 A;  3LK0 A;  1AVS A;  2JNF A;  2LVI A;  5EL2 A;  2LCP A;  1QLS A;  1TNQ A;  3D76 A;  3EKJ A;  2F2O A;  1N2D A;  5JOL A;  3VGO A;  3VRN A;  4NDD A;  4D1E A;  5JJG A;  4PAL A;  1J1D A;  1B9A A;  4ORC B;  1Y1A A;  1T14 A;  1FF1 A;  5KU1 A;  3MSE B;  4A4B A;  4MRX A;  1YX7 A;  1WLZ A;  1PK0 D;  2MBX A;  1OW4 A;  1NCZ A;  1DVI A;  3UO9 A;  1RJV A;  1S1E A;  1MF8 B;  1RWY A;  1FW4 A;  1JBA A;  3CWG A;  2M7N A;  1YUR A;  4MRY A;  4AOM A;  3DVE A;  1KFU S;  5FI2 A;  3VRR A;  3I5H B;  1TNW A;  4AQI A;  1IH0 A;  2I7A A;  1TTX A;  2BKH B;  1S5G Y;  4GFT A;  1S26 D;  1MQ1 A;  2JNX A;  1WRK A;  3CZ1 A;  1F55 A;  3B87 A;  4IJ7 A;  2QEO A;  3CZ2 A;  1K90 D;  1ORG A;  1C7V A;  2LLT A;  2D8N A;  1M39 A;  3PN7 C;  3TDI A;  5HYD A;  3PFV A;  3OB2 B;  1OOF A;  4I5L B;  1C3Y A;  5PAL A;  3K1E A;  2M7L A;  1IJ5 A;  2JT0 A;  3KO0 A;  3SG3 A;  1UUS A;  2LAP A;  2MJW B;  1QJT A;  3E3R A;  4HRG A;  1OOI X;  1ZMZ A;  2L50 A;  3CS1 A;  5FI7 A;  4MZL A;  1QWV A;  4L9M A;  1DJH A;  1FBV A;  2HF5 A;  3S0D A;  2BAP A;  2O60 A;  3S0E A;  1B47 A;  4MZK A;  2M1K B;  3CGA A;  2JRF A;  3OHM B;  2MRD A;  1KK8 B;  1M63 B;  2JWW A;  2LHL A;  3JVT B;  1RFJ A;  3L4A A;  4PDZ A;  2WC6 A;  2BL0 C;  1TUZ A;  3FWC A;  5FI6 A;  5HKY A;  4F0Z B;  3OX6 A;  4JD9 A;  1YR5 A;  5I2L A;  1IRJ A;  1QTX A;  4BY4 A;  2KQY A;  1Y1U A;  2L4I A;  3L4L A;  1SCM B;  3NSL A;  1YUT A;  1KWO B;  4MBE A;  2VRG A;  4P2Y B;  5DKQ A;  1BR1 B;  2WCH A;  3ZWH A;  4C0L A;  5DIC A;  1G4Y R;  1CB1 A;  3K21 A;  2P70 A;  2H8V A;  2KFG A;  4YGE B;  1CTR A;  1LKJ A;  1SRA A;  3EVU A;  1TCO B;  1EG3 A;  3CZT X;  1OOJ A;  1QVI Y;  3IQQ A;  1BG1 A;  1NPQ A;  1SW8 A;  4CID A;  3SG7 A;  3PAL A;  4XJK A;  1NX2 A;  1Q80 A;  4C0K A;  1SKT A;  2K60 A;  2WCL A;  3SG2 A;  1DGV A;  2K7D A;  3I5H C;  1JFJ A;  2BEC A;  3IF7 A;  1WRZ A;  5I94 A;  1TWO A;  3KEV A;  2V53 A;  1IQ3 A;  2JOJ A;  1LVC D;  4MLW A;  2NCP A;  5D7F A;  2LHI A;  4FQT A;  3TZ1 A;  4QJ4 B;  1CKK A;  1PSB A;  2PSR A;  1OMV A;  1S5G Z;  1K9K A;  2ERB A;  3GK1 A;  5TNC A;  3EVV A;  4FQO A;  1MHO A;  2KGB C;  1LIN A;  2ZKM X;  1DJI A;  3DVK A;  3ICB A;  1B7T Z;  4FTG A;  5BPJ A;  1CFC A;  4GAO A;  1IKU A;  1N0Y A;  1NX0 A;  1CFP A;  3BUN B;  5CSF A;  3OX5 A;  2COL B;  3TUY B;  2BCA A;  3C1V A;  4PHK A;  4HSZ A;  4GBA A;  1JSA A;  2NXQ A;  1EL4 A;  1Y1X A;  2WC8 A;  2IS9 A;  1GM0 A;  2FJU B;  4OV2 A;  1XK4 A;  1XVJ A;  2QEB A;  1TIZ A;  1KK8 C;  3DVJ A;  2M49 B;  2O5G A;  3JVT C;  5HLO A;  3S0A A;  1UWO A;  2H2K A;  1OMR A;  1OQP A;  1M31 A;  3I5F B;  2BE6 A;  3B88 A;  3WNX B;  1CDL A;  3AAK A;  3R1O A;  3RZS A;  1SCM C;  3O2P A;  2KI4 B;  1KWO C;  2WC5 A;  2K7O A;  2M1U A;  3H4S E;  1RTP 1;  1OZO A;  1CM1 A;  1KQM B;  2K7C A;  5HKW A;  3M0W A;  3D78 A;  1TNP A;  4PHJ A;  1JC2 A;  2MLF C;  2QDI A;  5KTY A;  4YGA A;  1QVI Z;  1UHN A;  5IBW A;  2ZND A;  3WHT B;  1FI5 A;  4M2O A;  1DGU A;  2QPT A;  3I5I B;  2H61 A;  3CTN A;  3GK4 X;  2BCX A;  2LE9 B;  3GK2 A;  1H8B A;  1IQ5 A;  4YGC B;  1F71 A;  3IQO A;  2M97 A;  3EK4 A;  4YGB B;  2JPT A;  3D74 A;  4HRH A;  3FIA A;  2H61 C;  1M46 A;  4MEW A;  4NDB A;  4PE7 A;  5I2O A;  1L2O B;  4PT1 A;  1VRK A;  1QXP A;  2KBM A;  3PJI A;  2ZN8 A;  3FS7 A;  4ETO A;  5KSZ A;  1EJ3 A;  3GOF A;  1DF0 A;  2F2P A;  1B8L A;  3DYE A;  3NXA A;  1QIV A;  2ZNE A;  1SL9 A;  3NHI A;  5K89 A;  1KFX S;  3OB1 B;  5ER4 X;  2JT3 A;  4QJ3 B;  1JUO A;  2KYF A;  2LVK A;  3EG5 B;  3HCM A;  3TUY C;  1J1E A;  1IIO A;  3B86 A;  1ZAC A;  1BJF A;  3S0B A;  4PE4 A;  1C3Z A;  1TCF A;  2Y1M A;  3WHU B;  2KOT A;  4M2P A;  4YI8 A;  3L47 A;  2AUC A;  4M2Q A;  1QAT A;  4U8D A; 
#chains in the Genus database with same CATH homology
 1CNP A;  1YX8 A;  1TRF A;  2M9G A;  1IJ6 A;  3LK1 A;  3F45 A;  1LA0 A;  1AUI B;  1B7T Y;  2G9B A;  4YI9 A;  4OKH A;  2OTG B;  1L7Z A;  2LP3 A;  1XFV O;  4DUQ A;  2SAS A;  2KNE A;  1R6P A;  2L51 A;  4GUK A;  1DJY A;  4MZJ A;  1GJY A;  2KFH A;  3I5F C;  3EK8 A;  3O78 A;  3LL8 B;  3OP0 A;  3CR2 A;  3SJS A;  2LUX A;  1FI6 A;  2KI4 C;  1NP8 A;  3AAJ A;  4GNK B;  1M45 A;  1QX7 A;  1DJZ A;  1ZFS A;  1YUS A;  5CSN A;  2PAS A;  3D0Y B;  1KQM C;  1K95 A;  3JTD B;  3NSI A;  1DJG A;  1MUX A;  2CT9 A;  2GGM A;  2LC5 A;  2LM5 A;  2WOS A;  1LXF C;  2LUC A;  3PAT A;  1XFW O;  1WY9 A;  1S6I A;  1CDM A;  1JF0 A;  1MXE A;  1XO5 A;  5J3X A;  4PE1 A;  2JC2 A;  1EH2 A;  1ZOT B;  4PCW A;  1KCY A;  3PSR A;  1X02 A;  3I5I C;  1B1G A;  1UHJ A;  5AXI A;  1J7R A;  1C7W A;  1AK8 A;  1QX2 A;  5DKR A;  1K2H A;  1L2O C;  5F6T A;  1NSH A;  1KFX L;  3BUM B;  1CDP A;  1BR4 B;  1U5I B;  2M8U A;  2E30 A;  1DTL A;  1IG5 A;  1MXL C;  1OSA A;  3A8R A;  4BY5 A;  1A75 B;  2KFF A;  2BE4 A;  1NWD A;  1NX3 A;  2JTZ A;  1MR8 A;  1BU3 A;  1UHK A;  1J7Q A;  2KBI A;  2WCB A;  4XYN A;  4DCK A;  1ZUZ A;  2HQW A;  2KYC A;  2EC6 B;  1NUB A;  2TN4 A;  1NYA A;  1F54 A;  1MWN A;  2A4J A;  2DOQ A;  2MLE C;  1CMG A;  1SL8 A;  1V1F A;  3AKA A;  3EKH A;  1XFY O;  1Y0V H;  2WCF A;  2OTG C;  3SIB A;  1CLM A;  3I5G B;  2PRU A;  2JUL A;  2LAN A;  2GGZ A;  2LVJ A;  2BBN A;  2LV7 A;  2L4H A;  1J55 A;  4I5K A;  5DKN A;  3SG6 A;  1JWD A;  1SY9 A;  1QV1 A;  3BOW B;  1BT6 A;  1YTZ C;  2M0R A;  2R2I A;  2JQ6 A;  2CXJ A;  1UUR A;  1YRU B;  1YRT B;  1K9P A;  2KAY A;  3SIA A;  1ALW A;  1WLM A;  3JTD C;  2JZI A;  1XA5 A;  2JTT A;  5HKZ A;  1K94 A;  4QJ5 B;  3VRQ A;  1J7P A;  4N1G A;  2BBM A;  1AHR A;  4CPV A;  1SCV A;  5G08 A;  3TDU A;  1KK7 Z;  3WXA A;  1J7O A;  1QV0 A;  1CFF A;  1KSO A;  2K2F A;  4GGF C;  2LMV A;  2LMT A;  4A4C A;  1G8I A;  1LA3 A;  3A4U B;  1S6C A;  2M3W A;  4WQ3 A;  2JU0 A;  3DVM A;  4GPL B;  1QX5 B;  1U5I A;  3NSO A;  1PRW A;  1SYM A;  2KHN A;  3BUO B;  2LVV A;  1PSR A;  3VRO A;  1CMF A;  2JXL A;  2I18 A;  2LLU A;  2NLN A;  4DIR A;  1UHI A;  5B8I B;  1QIW A;  1NX1 A;  1G33 A;  4R1E A;  1R2U A;  3TS5 B;  1K96 A;  3CR5 X;  2Q4U A;  2L98 A;  2LLS A;  5AEQ A;  1QS7 A;  5CSI A;  2I94 A;  2KDH A;  3SG4 A;  1BMO A;  4ZCV A;  1REC A;  2EC6 C;  1HQV A;  1OZS A;  2L5X B;  1A03 A;  4JWQ A;  3NSK A;  4WQ2 A;  1BOC A;  1OE9 B;  1GQM A;  1IWQ A;  1F4Q A;  4ICB A;  4N5X A;  2KAV A;  4OCI A;  3I5G C;  1KSM A;  5AAN A;  1RRO A;  1ALV A;  5CPV A;  2PAL A;  1SNL A;  4MSP A;  4ORA B;  1H4B A;  3CR4 X;  3HX4 A;  1PVA A;  1TNX A;  1BOD A;  2K7B A;  2L0P A;  4Q04 A;  4ORB B;  5CSJ A;  1CLB A;  3KPX A;  1YVL A;  2ZN9 A;  4CFR A;  3ZNI A;  2HPS A;  2KGR A;  3PM8 A;  5HLV A;  1DMO A;  2E6W A;  1A4P A;  3RLZ A;  1JF2 A;  1K8U A;  2K61 A;  4YBH B;  1BF5 A;  2F33 A;  3SG5 A;  2SCP A;  3AKB A;  4XJK B;  2BKI B;  2I2R E;  1SK6 D;  1OMD A;  2Y4Q A;  1SBJ A;  1XFZ O;  3LLE A;  3CLN A;  4OVN F;  5GQQ C;  2QAC A;  4PHM A;  2M29 A;  1DT7 B;  2Y1N A;  4I5N B;  3DF0 B;  1B8R A;  2CCM A;  4YGD B;  3LCP C;  5FYX A;  1KK7 Y;  4I5J A;  4UPG A;  1TOP A;  2NCO A;  2ZFD A;  3DD4 A;  2RGI A;  1CLL A;  5ER5 A;  1BLQ A;  1D1O A;  1DJW A;  2HQ8 A;  3TS5 C;  2KSP A;  1WDC B;  2WOR A;  2CBL A;  2F3Y A;  3QRX A;  4USL A;  1K9U A;  3RM1 A;  1ODB A;  3BUX B;  1SR6 B;  1E8A A;  1Y6W A;  4GGN A;  4PE0 A;  1AJ5 A;  4P5O E;  1JFK A;  2FCD A;  4CFQ A;  5AER A;  4AQJ A;  4JQ0 D;  1CFD A;  2GV5 A;  3BUW B;  3BYA A;  3KHE A;  4TNC A;  2WND A;  1FPW A;  2AMI A;  1K93 D;  1AJ4 A;  1PAL A;  2BCB A;  1RK9 A;  2LP2 A;  2OPO A;  2PMY A;  2K0J A;  3O6B A;  4IL1 A;  5AFP A;  2ISD A;  1SMG A;  1XFX O;  1A29 A;  2MAZ A;  3VRP A;  2WCE A;  1KQV A;  2OS8 B;  1PVB A;  2MHH A;  4C0J A;  3BXK A;  2KI6 C;  1KFU L;  4MN0 A;  1IGV A;  1EG4 A;  4PHN A;  2F8P A;  4JPZ B;  1UP5 A;  1S36 A;  2PVB A;  3D0Y A;  1NIW A;  4NQG A;  1HT9 A;  1SPY A;  4DRW A;  1YUU A;  1TN4 A;  2ZRS A;  3D10 A;  2B1U A;  1W7I B;  3DF0 A;  1CDN A;  1UHH A;  3FWB A;  4YRU A;  2CNP A;  3EVR A;  1A2X A;  4OR9 B;  5I8N A;  2KQ6 A;  1S6J A;  4GGF A;  2NZ0 A;  2KAX A;  4N1F A;  1GGW A;  2G2B A;  1F4O A;  5D69 A;  1NCX A;  2EGD A;  3BQ3 A;  1CM4 A;  1DF0 B;  1QLK A;  2Q91 A;  2AAO A;  1WRL A;  3EK7 A;  4CLN A;  2Y5I A;  1C07 A;  1GGZ A;  4HRE E;  2P6B B;  2LMU A;  1WDC C;  2L2E A;  1F8H A;  1PUL A;  1B8C A;  2K2A A;  1YVH A;  3PN7 B;  2KI6 D;  4NDC A;  1A75 A;  1NCY A;  1SR6 C;  2FOT A;  1F70 A;  4ZCU A;  2HET A;  1B4C A;  1XK4 C;  2JXC A;  2JT8 A;  1W7J B;  3O4Y A;  5I2Q A;  2LNK A;  1S3P A;  2CTN A;  4E68 A;  1XFU O;  2K8M B;  2MA2 A;  1V1G A;  2EHB A;  2FCE A;  1EXR A;  1N65 A;  4MVF A;  2BL0 B;  1QAS A;  1DJX A;  3TDZ A;  4DS7 A;  2F3Z A;  3BOW A;  2ZRT A;  2OS8 C;  4WRI A;  3KF9 A;  1XYD A;  1SL7 A;  3LK0 A;  1AVS A;  2JNF A;  2LVI A;  2LCP A;  1QLS A;  1TNQ A;  3EKJ A;  5JOL A;  2F2O A;  1N2D A;  3VGO A;  3VRN A;  4D1E A;  4NDD A;  5JJG A;  4PAL A;  1J1D A;  1B9A A;  4ORC B;  1Y1A A;  1FF1 A;  5KU1 A;  3MSE B;  4A4B A;  4MRX A;  1YX7 A;  1WLZ A;  1PK0 D;  2MBX A;  1NCZ A;  1DVI A;  1RJV A;  1S1E A;  1MF8 B;  1RWY A;  1FW4 A;  1JBA A;  3CWG A;  2M7N A;  1YUR A;  4MRY A;  4AOM A;  3DVE A;  1KFU S;  3VRR A;  3I5H B;  1TNW A;  4AQI A;  1IH0 A;  2I7A A;  1TTX A;  2BKH B;  1S5G Y;  4GFT A;  1S26 D;  1MQ1 A;  2JNX A;  1WRK A;  1F55 A;  1K90 D;  1C7V A;  2LLT A;  2D8N A;  1M39 A;  3PN7 C;  3TDI A;  5HYD A;  3PFV A;  3OB2 B;  4I5L B;  5PAL A;  2M7L A;  3SG3 A;  1IJ5 A;  2JT0 A;  3KO0 A;  1AP4 A;  1UUS A;  2LAP A;  2MJW B;  1QJT A;  3E3R A;  4HRG A;  3CS1 A;  1ZMZ A;  2L50 A;  4MZL A;  4L9M A;  1DJH A;  1FBV A;  2HF5 A;  2O60 A;  1B47 A;  4MZK A;  2M1K B;  3CGA A;  2JRF A;  3OHM B;  2MRD A;  1KK8 B;  1M63 B;  2JWW A;  2LHL A;  3JVT B;  1RFJ A;  4PDZ A;  2BL0 C;  3FWC A;  5HKY A;  4F0Z B;  3OX6 A;  1YR5 A;  5I2L A;  1IRJ A;  1QTX A;  4BY4 A;  2KQY A;  1Y1U A;  2L4I A;  3NSL A;  1SCM B;  1YUT A;  1KWO B;  4MBE A;  2VRG A;  4P2Y B;  5DKQ A;  1BR1 B;  3ZWH A;  4C0L A;  1G4Y R;  1CB1 A;  3K21 A;  4YGE B;  2KFG A;  1CTR A;  1LKJ A;  1SRA A;  3EVU A;  1TCO B;  1EG3 A;  3CZT X;  1OOJ A;  1QVI Y;  3IQQ A;  1BG1 A;  1NPQ A;  1SW8 A;  4CID A;  3SG7 A;  3PAL A;  4XJK A;  1NX2 A;  1Q80 A;  4C0K A;  1SKT A;  3SG2 A;  1DGV A;  2K7D A;  3I5H C;  1JFJ A;  2BEC A;  3IF7 A;  1WRZ A;  3KEV A;  2V53 A;  1IQ3 A;  2JOJ A;  1LVC D;  4MLW A;  2NCP A;  5D7F A;  2LHI A;  3TZ1 A;  4QJ4 B;  1CKK A;  1PSB A;  2PSR A;  1OMV A;  1S5G Z;  1K9K A;  3GK1 A;  5TNC A;  3EVV A;  4FQO A;  1MHO A;  2KGB C;  1LIN A;  2ZKM X;  1DJI A;  3DVK A;  3ICB A;  1B7T Z;  4FTG A;  5BPJ A;  1CFC A;  4GAO A;  1IKU A;  1N0Y A;  1NX0 A;  1CFP A;  3BUN B;  5CSF A;  3OX5 A;  2COL B;  3TUY B;  2BCA A;  3C1V A;  4PHK A;  4HSZ A;  4GBA A;  1JSA A;  2NXQ A;  1EL4 A;  1Y1X A;  2WC8 A;  2IS9 A;  2FJU B;  4OV2 A;  1XK4 A;  1XVJ A;  1TIZ A;  1KK8 C;  3DVJ A;  2M49 B;  2O5G A;  3JVT C;  5HLO A;  1UWO A;  2H2K A;  1OMR A;  1OQP A;  1M31 A;  3I5F B;  2BE6 A;  3WNX B;  1CDL A;  3AAK A;  1SCM C;  3O2P A;  2KI4 B;  1KWO C;  2K7O A;  2M1U A;  3H4S E;  1RTP 1;  1OZO A;  1CM1 A;  1KQM B;  2K7C A;  5HKW A;  3M0W A;  1TNP A;  4PHJ A;  1JC2 A;  2MLF C;  5KTY A;  4YGA A;  1QVI Z;  1UHN A;  5IBW A;  2ZND A;  3WHT B;  1FI5 A;  4M2O A;  1DGU A;  2QPT A;  3I5I B;  2H61 A;  3CTN A;  3GK4 X;  2BCX A;  2LE9 B;  3GK2 A;  1H8B A;  1IQ5 A;  4YGC B;  1F71 A;  3IQO A;  2M97 A;  3EK4 A;  4YGB B;  2JPT A;  4HRH A;  3FIA A;  2H61 C;  1M46 A;  4MEW A;  4NDB A;  4PE7 A;  5I2O A;  1L2O B;  1VRK A;  1QXP A;  2KBM A;  2ZN8 A;  3FS7 A;  4ETO A;  5KSZ A;  1EJ3 A;  3GOF A;  1DF0 A;  2F2P A;  1B8L A;  3NXA A;  1QIV A;  2ZNE A;  1SL9 A;  5K89 A;  1KFX S;  3OB1 B;  5ER4 X;  2JT3 A;  4QJ3 B;  1JUO A;  2KYF A;  2LVK A;  3HCM A;  3TUY C;  1J1E A;  1ZAC A;  1BJF A;  4PE4 A;  1TCF A;  2Y1M A;  3WHU B;  2KOT A;  4M2P A;  4YI8 A;  3PLF B;  2AUC A;  4M2Q A;  1QAT A;  4U8D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...