1K9PA

Crystal structure of calcium free (or apo) human s100a6
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
89
structure length
89
Chain Sequence
ACPLDQAIGLLVAIFHKYSGREGDKHTLSKKELKELIQKELTIGSKLQDAEIARLMEDLDRNKDQEVNFQEYVTFLGALALIYNEALKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords S100A6
publication title Crystal structures of S100A6 in the Ca(2+)-free and Ca(2+)-bound states: the calcium sensor mechanism of S100 proteins revealed at atomic resolution.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 30
structure length 89
sequence length 89
ec nomenclature
pdb deposition date 2001-10-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1k9pA00
3JTDB 2PASA 1BODA 1F71A 3IQOA 2KFGA 1SRAA 1PRWA 3TUYB 1MXLC 1OMRA 2KHNA 2MJWB 4GNKB 5HKWA 2O60A 1AUIB 1S36A 2MLFC 5J3XA 3GK1A 2EHBA 3DVMA 1XFYO 2WOSA 3FWBA 3NSKA 1C7WA 2LUXA 4PE4A 2LMVA 1B8LA 1MUXA 1NX1A 1UUSA 1LA0A 3IF7A 3CWGA 5HKZA 3HX4A 5AEQA 3SG6A 2KOTA 2CBLA 4HREE 1J55A 4YGDB 4UPGA 5IBWA 1S6CA 3TDIA 1QX2A 1UHKA 3PN7C 4R1EA 2M1UA 2M3WA 4M2QA 2KAVA 5AXIA 3SJSA 1NUBA 2Y5IA 5JOLA 3DD4A 1A2XA 2KYCA 1S5GZ 4PCWA 5AERA 1EG4A 2KAXA 2ZN8A 4GUKA 4N5XA 1IRJA 2LCPA 1DJZA 1HT9A 4P2YB 4FTGA 1QATA 4WQ2A 4DUQA 1DJWA 1MR8A 4WRIA 2HQ8A 1NPQA 2ZKMX 2BBNA 3EVUA 4CFRA 1BR4B 1L2OC 1CMGA 1M45A 1S6JA 5HLVA 1F70A 4GPLB 2WCBA 3D10A 2M7NA 2JT3A 3LCPC 4NQGA 2OPOA 2QACA 3TDZA 3TDUA 1K94A 2ZN9A 3A8RA 4PALA 1CLLA 3HCMA 1KK7Z 4ORAB 1CFFA 1AP4A 1S1EA 3SIBA 1B47A 5I8NA 1TCFA 1XFZO 1BF5A 1NX2A 2L0PA 1E8AA 1PULA 3VGOA 1GGWA 1KFUL 2JZIA 3PALA 1WDCC 2TN4A 3OP0A 3DF0B 2FCDA 1U5IB 1FW4A 1WLZA 2O5GA 1RFJA 5DKRA 3LK1A 3VRNA 4MRXA 1C07A 1YVLA 1JFJA 2L50A 2OTGC 1R6PA 4OVNF 2MBXA 2EGDA 2JXCA 2NZ0A 3NSOA 1NCXA 2OS8B 5D69A 1TIZA 1SMGA 3LK0A 4TNCA 4I5KA 4PE0A 1CB1A 3PATA 2KGRA 1ZACA 1S6IA 2CT9A 2KI4C 1KK8B 4OV2A 4XYNA 4CLNA 3PM8A 1B4CA 3NSLA 2V53A 1CDLA 2JT8A 2OTGB 1G4YR 2PRUA 4I5LB 1M46A 1AVSA 3A4UB 5ER4X 2LMUA 3TS5B 1XFXO 2CXJA 1SNLA 3DVJA 1OE9B 5I2OA 1U5IA 2HETA 1K95A 1K9PA 1PVBA 1WLMA 2LE9B 4OCIA 2K2AA 1IJ5A 2HF5A 2E30A 2M49B 4C0LA 2I94A 3VRRA 1YURA 1J1DA 1Y0VH 3EVVA 1FI6A 2LVVA 3PLFB 3PFVA 5BPJA 1MWNA 2BCAA 3I5IB 1YRTB 1V1GA 1DJXA 2K7OA 4MN0A 2AUCA 1CM1A 1IGVA 1F8HA 5G08A 2P6BB 4A4CA 3I5GC 2LHIA 3D0YA 1BJFA 2LMTA 3BOWB 1IH0A 2H2KA 4OR9B 1F4QA 1YUUA 1SR6C 2JRFA 2M8UA 5FYXA 1BLQA 2R2IA 4BY4A 4CFQA 1S3PA 3F45A 1AK8A 1RTP1 2MA2A 2HPSA 2WORA 1FI5A 1TNXA 1W7JB 1SK6D 1GQMA 1K9UA 2I7AA 2COLB 3SG7A 1DJGA 1WRKA 3AAKA 1KCYA 1QVIY 2F33A 1DF0A 3H4SE 3MSEB 2L2EA 1RJVA 4YI9A 1UHHA 3DVKA 3OB1B 1A75B 2LLSA 4PDZA 2LVIA 4U8DA 2K7BA 4YGAA 4FQOA 2JNXA 1L7ZA 2H61A 1J7QA 3SG2A 2NXQA 3BUWB 1SCMB 1LXFC 3BOWA 3KEVA 4NDCA 2KDHA 3BQ3A 1KFUS 1K8UA 2E6WA 2BE4A 4Q04A 2LHLA 4YGCB 3RLZA 4GGFA 1DTLA 1AJ4A 1IQ5A 1A03A 1IKUA 2F3YA 1R2UA 2BECA 4C0KA 1C7VA 4AQJA 3OB2B 1NSHA 1XFVO 1SL7A 2KBIA 3WHTB 4WQ3A 1NP8A 1XK4C 1DT7B 1JWDA 5DKQA 4GGNA 1OZOA 1SPYA 2Q91A 2ISDA 1SKTA 3JVTC 1BR1B 4N1FA 1A75A 4JWQA 2BL0C 2HQWA 3PN7B 4QJ3B 3ZWHA 1XA5A 1DGVA 1B8RA 4L9MA 1NX3A 2KAYA 2GGZA 2L98A 1RROA 4YI8A 1K9KA 2I2RE 1K2HA 1M39A 4MZJA 1EXRA 1SCVA 1CTRA 2JULA 1F54A 1XO5A 3E3RA 4PHKA 4BY5A 2K0JA 5I2QA 4E68A 1F4OA 4I5JA 1L2OB 1QVIZ 2MRDA 3CGAA 1QIWA 4JQ0D 3TZ1A 4DCKA 3CS1A 2LM5A 4OKHA 1PSRA 1YX7A 4YBHB 2L4HA 3EK4A 1ZUZA 1GGZA 1LINA 1YRUB 2LLTA 1DJHA 1TTXA 1V1FA 4DRWA 4NDDA 3FWCA 1B8CA 2LP2A 4AQIA 2K61A 3AKBA 3SG4A 2JXLA 3NSIA 4PHJA 1LKJA 2KYFA 3ZNIA 4QJ4B 1QXPA 1WDCB 4HRHA 1YR5A 1UHNA 1QS7A 1SW8A 5CSNA 1CNPA 1PVAA 1Y1AA 1CFDA 1S26D 1TRFA 3BUXB 3WHUB 3AAJA 4C0JA 3I5HC 1J1EA 1YTZC 5PALA 1CFPA 2JOJA 4GAOA 1A4PA 2K7CA 1KFXL 4A4BA 3DF0A 2M29A 1ZFSA 1ZOTB 4N1GA 1X02A 3LL8B 2MHHA 3WNXB 2KI4B 1B9AA 2Y1NA 3FIAA 5KSZA 1K96A 5HKYA 3ICBA 1JF0A 2LNKA 1ZMZA 3O6BA 4MSPA 1UHJA 1CMFA 1K93D 2LVJA 1WRZA 1DGUA 1NWDA 2BCBA 1ALWA 2RGIA 1XYDA 4ZCUA 1KQMC 5AFPA 2PVBA 1QTXA 5AANA 1F55A 3CR5X 3BUMB 1MQ1A 1Y1XA 3AKAA 2L5XB 1N65A 3EK7A 1QIVA 5TNCA 2WCFA 2JTTA 2ZRTA 2Y1MA 1DJYA 1OMDA 1H8BA 4PHNA 2PMYA 1DJIA 1DVIA 2QPTA 3M0WA 3I5FC 2KSPA 1S5GY 3KPXA 4YRUA 5CSFA 1SL8A 1ALVA 2I18A 3I5GB 4CPVA 4GGFC 2L4IA 1CDMA 1IG5A 3K21A 1CDPA 1BOCA 1LA3A 1BMOA 1W7IB 1SR6B 1JSAA 1NCYA 2M0RA 2F8PA 1AHRA 5CPVA 2AMIA 4NDBA 2G2BA 1FPWA 2M9GA 2Y4QA 4CIDA 3QRXA 1CDNA 2LUCA 1GJYA 4P5OE 2F3ZA 2JTZA 1UURA 2CNPA 1B1GA 1VRKA 2ZNEA 1CFCA 4I5NB 1BG1A 1CLBA 1QX5B 4PHMA 1JC2A 1AJ5A 2M7LA 3BXKA 1SL9A 4MRYA 1N0YA 3DVEA 4M2OA 1NCZA 1JF2A 1TNQA 4MEWA 1JUOA 3BUNB 3EKHA 2FCEA 5GQQC 2ZRSA 2KFHA 3RM1A 1PK0D 1K90D 1IJ6A 1BU3A 1NX0A 2K2FA 2LANA 1TOPA 3VRPA 4HRGA 4GFTA 2EC6C 2FOTA 1OQPA 1B7TY 5CSIA 2DOQA 1J7OA 2PSRA 2WNDA 3FS7A 1UHIA 1MHOA 2KQYA 2M97A 1YX8A 4ORCB 3OX5A 3BYAA 3O78A 3CZTX 4ICBA 2KI6D 2K7DA 2K8MB 2AAOA 1JBAA 1KWOC 1OZSA 3O4YA 1QLSA 4USLA 2EC6B 1M63B 1FF1A 1KFXS 5HLOA 4PE1A 2JU0A 1IWQA 2LLUA 3GK4X 1G8IA 1N2DA 2IS9A 1XFUO 2JC2A 3JVTB 2BBMA 5F6TA 2FJUB 2BL0B 4MVFA 2GGMA 2MAZA 4GBAA 2NCPA 1MXEA 2D8NA 4MLWA 1EJ3A 4AOMA 4IL1A 5K89A 2NCOA 1KWOB 3LLEA 1KSOA 2KBMA 3NXAA 4YGEB 5DKNA 2VRGA 1SY9A 4JPZB 1TN4A 1JFKA 2KNEA 3GK2A 1J7PA 4QJ5B 1SYMA 4F0ZB 4PE7A 4DIRA 5D7FA 1CLMA 1RK9A 2LP3A 5CSJA 1EG3A 1QV0A 1M31A 1XK4A 1XFWO 3OX6A 1KSMA 1OSAA 4XJKB 2OS8C 1D1OA 3SG5A 1UP5A 1YVHA 2G9BA 2BE6A 1QX7A 1ODBA 2WC8A 1MF8B 4MZKA 1RECA 3CR4X 1TNWA 2JPTA 4YGBB 1KK8C 1QASA 4ORBB 4HSZA 3OHMB 1B7TZ 1YUSA 1H4BA 2SASA 2Q4UA 2KGBC 2B1UA 3EVRA 3TS5C 1CKKA 5ER5A 2M1KB 1WRLA 1WY9A 3EK8A 3D0YB 3I5HB 4ZCVA 5HYDA 3PSRA 3EKJA 3IQQA 1G33A 2JWWA 2WCEA 2KQ6A 2ZNDA 3VRQA 1YUTA 3SIAA 1A29A 1OMVA 1EH2A 2BKHB 2L51A 2SCPA 2BKIB 3I5IC 2BCXA 4XJKA 2JQ6A 1QV1A 1KQVA 2LVKA 2F2OA 3CR2A 2JT0A 1IQ3A 1Q80A 1EL4A 3CTNA 2LV7A 1CM4A 5KU1A 2H61C 1FBVA 1BT6A 1DMOA 3C1VA 1J7RA 1DF0B 1OOJA 1PALA 1SBJA 1TCOB 3CLNA 4ETOA 3GOFA 4D1EA 5B8IB 1KQMB 4MZLA 2CTNA 2ZFDA 5KTYA 1QLKA 3SG3A 5I2LA 2JNFA 1NYAA 2PALA 2F2PA 3KHEA 1NIWA 2KFFA 1XVJA 3JTDC 2CCMA 1TNPA 4DS7A 3KO0A 5JJGA 2LC5A 2MLEC 3BUOB 3I5FB 3WXAA 2NLNA 3TUYC 2A4JA 1LVCD 1PSBA 3KF9A 1RWYA 3O2PA 3VROA 1QJTA 1KK7Y 2LAPA 1UWOA 2KI6C 1Y1UA 1HQVA 4M2PA 4MBEA 1Y6WA 1SCMC 2GV5A
chains in the Genus database with same CATH superfamily
3JTDB 2PASA 1BODA 1F71A 3CABA 3BJHA 3IQOA 2KFGA 1SRAA 1PRWA 3TUYB 1MXLC 1OMRA 2KHNA 2MJWB 4GNKB 5HKWA 2O60A 1AUIB 1S36A 1TUJA 2MLFC 3IVTA 5J3XA 3GK1A 4KYNA 2EHBA 3DVMA 1XFYO 2WOSA 3FWBA 3NSKA 1C7WA 2LUXA 4PE4A 2LMVA 3N7HA 1B8LA 1MUXA 1NX1A 1UUSA 1LA0A 3IF7A 3CWGA 5HKZA 3HX4A 5AEQA 3SG6A 1C3ZA 2KOTA 2CBLA 4HREE 1J55A 5EL2A 4YGDB 3B6XA 4UPGA 5IBWA 1S6CA 3TDIA 1QX2A 1UHKA 3PN7C 4R1EA 4IJ7A 2M1UA 2M3WA 4M2QA 2KAVA 5AXIA 3SJSA 1NUBA 2Y5IA 3NHTA 2P70A 3DD4A 5JOLA 1A2XA 2KYCA 1S5GZ 4PCWA 5AERA 1EG4A 2KAXA 2ZN8A 4GUKA 4N5XA 1IRJA 2LCPA 1DJZA 1HT9A 4P2YB 4FTGA 1QATA 4WQ2A 4DUQA 1DJWA 1MR8A 4WRIA 2HQ8A 1NPQA 2ZKMX 2BBNA 3EVUA 4CFRA 1BR4B 1L2OC 1CMGA 1M45A 1S6JA 5HLVA 1XFRA 4GPLB 2WCBA 3D10A 2M7NA 1F70A 3BFHA 2JT3A 3LCPC 4NQGA 2OPOA 2QACA 3TDZA 3TDUA 1K94A 2BNXA 2ZN9A 3A8RA 4PALA 1CLLA 3HCMA 1KK7Z 4ORAB 1TUZA 1CFFA 1AP4A 1S1EA 3SIBA 3SS3A 1B47A 5I8NA 1TCFA 1XFZO 1BF5A 1NX2A 2L0PA 1E8AA 1PULA 3VGOA 1GGWA 1KFUL 2JZIA 3B86A 3PALA 1WDCC 2TN4A 3OP0A 3DF0B 2L5YA 2FCDA 1U5IB 1FW4A 5FI7A 1WLZA 2O5GA 3UNWA 1RFJA 5DKRA 3LK1A 2QDIA 3VRNA 3R1PA 4MRXA 1C07A 1YVLA 1JFJA 3OGNA 2PQLA 2L50A 2OTGC 1R6PA 4OVNF 2MBXA 2EGDA 2JXCA 2NZ0A 3NSOA 1NCXA 2OS8B 5D69A 1TIZA 1SMGA 3LK0A 4TNCA 4I5KA 4PE0A 1CB1A 3PATA 2KGRA 1ZACA 1S6IA 3R72A 3CYZA 2CT9A 2KI4C 2L2CA 1KK8B 3L4LA 3OBVA 4OV2A 3PM8A 4XYNA 3NSLA 4CLNA 2V53A 1B4CA 1CDLA 2JT8A 2BAPA 2OTGB 1G4YR 2PRUA 4I5LB 1M46A 1GM0A 1AVSA 3A4UB 5ER4X 2LMUA 2FJYA 1XFXO 2CXJA 3SS5A 3TS5B 1SNLA 5HL1A 3DVJA 1OE9B 5I2OA 1U5IA 2HETA 1K95A 1K9PA 1OOGA 1PVBA 1WLMA 2LE9B 3CZ1A 4OCIA 2K2AA 1IJ5A 2HF5A 2E30A 2M49B 4C0LA 2I94A 3VRRA 1YURA 1J1DA 1Y0VH 3EVVA 1FI6A 2LVVA 3PLFB 3PFVA 5BPJA 1MWNA 2BCAA 4JD9A 3I5IB 1YRTB 1V1GA 1DJXA 2K7OA 4MN0A 2AUCA 1CM1A 1IGVA 1F8HA 5G08A 2P6BB 4A4CA 3I5GC 2LHIA 3D0YA 2YGUA 1BJFA 2LMTA 3BOWB 2WCKA 1IH0A 2H2KA 4OR9B 1F4QA 1YUUA 3CDNA 1SR6C 2JRFA 2M8UA 5FYXA 1BLQA 2R2IA 3PJIA 4BY4A 4CFQA 1S3PA 3F45A 1AK8A 1RTP1 2MA2A 2HPSA 2WORA 1FI5A 1TNXA 1TWOA 1W7JB 1SK6D 1GQMA 1K9UA 2I7AA 3DYEA 2COLB 3D76A 3SG7A 1DJGA 1WRKA 3AAKA 1KCYA 1QVIY 2F33A 1DF0A 3H4SE 3MSEB 2WCJA 2L2EA 4FQTA 1RJVA 4YI9A 1UHHA 5FI6A 3DVKA 3OB1B 1A75B 2LLSA 4PDZA 2LVIA 4U8DA 2K7BA 4YGAA 4FQOA 5FI2A 2JNXA 1L7ZA 2H61A 3BFAA 1J7QA 2ERBA 3SG2A 2NXQA 3BUWB 1SCMB 1LXFC 3BOWA 3KEVA 4NDCA 2KDHA 3BQ3A 1KFUS 2WCMA 1K8UA 2E6WA 2BE4A 3FE8A 4Q04A 2LHLA 4YGCB 3RLZA 4GGFA 1DTLA 1AJ4A 1IQ5A 1A03A 1IKUA 2F3YA 1R2UA 2BECA 4C0KA 1C7VA 4AQJA 3OB2B 1NSHA 1XFVO 1SL7A 2KBIA 3WHTB 4JKTA 4WQ3A 1NP8A 1XK4C 1OOIX 1DT7B 1JWDA 4INXA 5DKQA 4GGNA 1OZOA 1SPYA 3V2LA 2Q91A 2ISDA 3D77A 3RZSA 1SKTA 3JVTC 1BR1B 4N1FA 1OW4A 1A75A 4JWQA 2BL0C 2HQWA 3PN7B 4QJ3B 3SS4A 1XA5A 3ZWHA 1DGVA 1B8RA 4L9MA 1NX3A 2KAYA 1P28A 2GGZA 2L98A 1RROA 4YI8A 1K9KA 2I2RE 1K2HA 1M39A 4MZJA 1EXRA 1SCVA 1CTRA 2JULA 1F54A 1XO5A 3E3RA 3S0DA 4PHKA 4BY5A 2K0JA 5I2QA 4E68A 1F4OA 4I5JA 1L2OB 1QVIZ 2MRDA 3CGAA 1QIWA 4JQ0D 1ORGA 3TZ1A 4DCKA 3BFBA 3FE9A 3CS1A 2LM5A 4OKHA 1PSRA 2WCHA 3CZ0A 1YX7A 4YBHB 2KPHA 2L4HA 3EK4A 1ZUZA 1SSEB 1GGZA 1LINA 1YRUB 2LLTA 1DJHA 1TTXA 1V1FA 4DRWA 4NDDA 3FWCA 1B8CA 2LP2A 4AQIA 2K61A 3AKBA 3SG4A 2JXLA 3NSIA 4PHJA 1LKJA 2KYFA 3ZNIA 4QJ4B 1QXPA 1WDCB 4HRHA 1YR5A 1UHNA 3S0EA 3NHIA 1LS8A 1QS7A 1SW8A 5CSNA 1CNPA 1PVAA 1Y1AA 1CFDA 1S26D 1TRFA 1OOFA 3BUXB 3AAJA 5DICA 3WHUB 3I5HC 4C0JA 1C3YA 1J1EA 1YTZC 5PALA 1CFPA 2JOJA 4GAOA 1A4PA 2K7CA 1KFXL 3S0BA 4A4BA 3DF0A 2M29A 1ZFSA 1ZOTB 4N1GA 1X02A 1DEKA 1DQEA 3LL8B 2MHHA 3WNXB 2KI4B 1B9AA 2Y1NA 3FIAA 5KSZA 1K96A 5HKYA 3ICBA 1JF0A 2LNKA 1ZMZA 3O6BA 4MSPA 1UHJA 1CMFA 1K93D 2LVJA 2QEOA 3VB1A 1WRZA 2QEVA 1DGUA 1NWDA 2BCBA 1ALWA 2RGIA 1XYDA 4ZCUA 1KQMC 5AFPA 2PVBA 1QTXA 3R1OA 5AANA 1Z4HA 1F55A 3CR5X 3BUMB 1MQ1A 1Y1XA 3AKAA 2L5XB 2H8VA 1N65A 3EK7A 1QIVA 5TNCA 2WCFA 2JTTA 2ZRTA 2Y1MA 1DJYA 1OMDA 2PYQA 1H8BA 4PHNA 2PMYA 1DJIA 1DVIA 2JPOA 2QPTA 3M0WA 3S0GA 3I5FC 2KSPA 1S5GY 3KPXA 4YRUA 2KLDA 5CSFA 1SL8A 1ALVA 2I18A 3I5GB 4CPVA 4GGFC 2L4IA 2QEHA 1CDMA 1IG5A 3K21A 1CDPA 1BOCA 1LA3A 1BMOA 1W7IB 2WCLA 1SR6B 1JSAA 1NCYA 2M0RA 2F8PA 1AHRA 3D75A 5CPVA 2AMIA 4NDBA 2G2BA 1FPWA 3FE6A 2M9GA 2Y4QA 4CIDA 3QRXA 1CDNA 2LUCA 1GJYA 3D74A 4P5OE 2F3ZA 2JTZA 1UURA 2CNPA 1B1GA 1VRKA 2ZNEA 3DY9A 1CFCA 4I5NB 1BG1A 3O4XA 1QX5B 1CLBA 4PHMA 1JC2A 1AJ5A 2M7LA 3BXKA 3S0FA 1SL9A 4MRYA 1DELA 1N0YA 3DVEA 4M2OA 3K1EA 1NCZA 1JF2A 1TNQA 1W9ZA 4MEWA 1JUOA 3BUNB 3EKHA 2FCEA 5GQQC 2ZRSA 2KFHA 3L47A 1PK0D 3RM1A 1K90D 1IJ6A 1BU3A 1NX0A 2K2FA 2LANA 1TOPA 2WC5A 3VRPA 3DXLA 4HRGA 4GFTA 2EC6C 2FOTA 1OQPA 1B7TY 5CSIA 2DOQA 3EG5B 2PSRA 2WNDA 1J7OA 2GTEA 3FS7A 1UHIA 4PT1A 1MHOA 2KQYA 2M97A 1YX8A 4ORCB 1DC1A 3OX5A 3BYAA 3D73A 3O78A 3CZTX 4ICBA 2KI6D 2K7DA 2K8MB 2AAOA 1JBAA 1KWOC 1OZSA 3O4YA 1QLSA 4USLA 2EC6B 1M63B 1FF1A 1KFXS 4INWA 5HLOA 4PE1A 2JU0A 1IWQA 1Z2CB 2LLUA 1G8IA 1N2DA 2IS9A 1XFUO 2JC2A 3GK4X 3JVTB 3B7AA 2BBMA 5F6TA 2FJUB 2BL0B 4MVFA 2GGMA 3QMEA 2MAZA 4GBAA 2NCPA 1T14A 1IIOA 1MXEA 2D8NA 4MLWA 3L4AA 1EJ3A 4AOMA 4IL1A 5K89A 2NCOA 1KWOB 3LLEA 1KSOA 2KBMA 3NXAA 4OZDA 4YGEB 5DKNA 2VRGA 1SY9A 4JPZB 1TN4A 1JFKA 2KNEA 3GK2A 1J7PA 4QJ5B 1SYMA 4F0ZB 3S0AA 4PE7A 3UO9A 4DIRA 5D7FA 1CLMA 1RK9A 2LP3A 5CSJA 1EG3A 1QV0A 1M31A 1XK4A 1XFWO 3OX6A 1KSMA 1OSAA 4XJKB 2OS8C 1D1OA 5D3OA 3SG5A 1UP5A 1YVHA 2G9BA 2BE6A 1QX7A 1ODBA 2WC8A 1MF8B 4MZKA 1RECA 1QWVA 3CR4X 3CZ2A 1TNWA 2JPTA 4YGBB 1KK8C 3B88A 1QASA 4ORBB 4HSZA 3OHMB 2K60A 3D78A 1B7TZ 1YUSA 1H4BA 2SASA 2Q4UA 2KGBC 2B1UA 3EVRA 3TS5C 3B87A 1CKKA 5ER5A 2M1KB 1WRLA 1WY9A 3EK8A 3D0YB 3I5HB 4ZCVA 5HYDA 3R1VA 3PSRA 3EKJA 3IQQA 1G33A 2JWWA 2WCEA 2P71A 2KQ6A 2ZNDA 3VRQA 2WC6A 1YUTA 3PM2A 3SIAA 1A29A 1OMVA 1EH2A 2BKHB 2L51A 2SCPA 2BKIB 3I5IC 3NGVA 2BCXA 4XJKA 5I94A 2JQ6A 1QV1A 1KQVA 2LVKA 2F2OA 3CR2A 2JT0A 1IQ3A 1Q80A 1EL4A 3CTNA 2LV7A 1CM4A 5KU1A 2H61C 1FBVA 2KLEA 1BT6A 1DMOA 3C1VA 1J7RA 1DF0B 1OOJA 1PALA 1SBJA 1TCOB 3CLNA 1OOHA 4ETOA 3GOFA 4D1EA 5B8IB 1KQMB 4MZLA 2CTNA 2ZFDA 3Q8IA 3DZTA 5KTYA 1QLKA 3SG3A 5I2LA 2JNFA 1NYAA 2PALA 2F2PA 4F7FA 3KHEA 1NIWA 2KFFA 1XVJA 3JTDC 2CCMA 1TNPA 4DS7A 3KO0A 5JJGA 2LC5A 2MLEC 3BUOB 3I5FB 3WXAA 2NLNA 3TUYC 2A4JA 1LVCD 1PSBA 3KF9A 1RWYA 3O2PA 3VROA 1QJTA 1KK7Y 2LAPA 1UWOA 2KI6C 2QEBA 1Y1UA 1HQVA 4M2PA 4MBEA 1Y6WA 1SCMC 2GV5A
chains in the Genus database with same CATH topology
3JTDB 2PASA 1BODA 1F71A 3IQOA 2KFGA 1SRAA 1PRWA 3TUYB 1MXLC 1OMRA 2KHNA 2MJWB 4GNKB 5HKWA 2O60A 1AUIB 1S36A 2MLFC 5J3XA 3GK1A 2EHBA 3DVMA 1XFYO 2WOSA 3FWBA 3NSKA 1C7WA 2LUXA 4PE4A 2LMVA 1B8LA 1MUXA 1NX1A 1UUSA 1LA0A 3IF7A 3CWGA 5HKZA 3HX4A 5AEQA 3SG6A 2KOTA 2CBLA 4HREE 1J55A 4YGDB 4UPGA 5IBWA 1S6CA 3TDIA 1QX2A 1UHKA 3PN7C 4R1EA 2M1UA 2M3WA 4M2QA 2KAVA 5AXIA 3SJSA 1NUBA 2Y5IA 5JOLA 3DD4A 1A2XA 2KYCA 1S5GZ 4PCWA 5AERA 1EG4A 2KAXA 2ZN8A 4GUKA 4N5XA 1IRJA 2LCPA 1DJZA 1HT9A 4P2YB 4FTGA 1QATA 4WQ2A 4DUQA 1DJWA 1MR8A 4WRIA 2HQ8A 1NPQA 2ZKMX 2BBNA 3EVUA 4CFRA 1BR4B 1L2OC 1CMGA 1M45A 1S6JA 5HLVA 1F70A 4GPLB 2WCBA 3D10A 2M7NA 2JT3A 3LCPC 4NQGA 2OPOA 2QACA 3TDZA 3TDUA 1K94A 2ZN9A 3A8RA 4PALA 1CLLA 3HCMA 1KK7Z 4ORAB 1CFFA 1AP4A 1S1EA 3SIBA 1B47A 5I8NA 1TCFA 1XFZO 1BF5A 1NX2A 2L0PA 1E8AA 1PULA 3VGOA 1GGWA 1KFUL 2JZIA 3PALA 1WDCC 2TN4A 3OP0A 3DF0B 2FCDA 1U5IB 1FW4A 1WLZA 2O5GA 1RFJA 5DKRA 3LK1A 3VRNA 4MRXA 1C07A 1YVLA 1JFJA 2L50A 2OTGC 1R6PA 4OVNF 2MBXA 2EGDA 2JXCA 2NZ0A 3NSOA 1NCXA 2OS8B 5D69A 1TIZA 1SMGA 3LK0A 4TNCA 4I5KA 4PE0A 1CB1A 3PATA 2KGRA 1ZACA 1S6IA 2CT9A 2KI4C 1KK8B 4OV2A 4XYNA 4CLNA 3PM8A 1B4CA 3NSLA 2V53A 1CDLA 2JT8A 2OTGB 1G4YR 2PRUA 4I5LB 1M46A 1AVSA 3A4UB 5ER4X 2LMUA 3TS5B 1XFXO 2CXJA 1SNLA 3DVJA 1OE9B 5I2OA 1U5IA 2HETA 1K95A 1K9PA 1PVBA 1WLMA 2LE9B 4OCIA 2K2AA 1IJ5A 2HF5A 2E30A 2M49B 4C0LA 2I94A 3VRRA 1YURA 1J1DA 1Y0VH 3EVVA 1FI6A 2LVVA 3PLFB 3PFVA 5BPJA 1MWNA 2BCAA 3I5IB 1YRTB 1V1GA 1DJXA 2K7OA 4MN0A 2AUCA 1CM1A 1IGVA 1F8HA 5G08A 2P6BB 4A4CA 3I5GC 2LHIA 3D0YA 1BJFA 2LMTA 3BOWB 1IH0A 2H2KA 4OR9B 1F4QA 1YUUA 1SR6C 2JRFA 2M8UA 5FYXA 1BLQA 2R2IA 4BY4A 4CFQA 1S3PA 3F45A 1AK8A 1RTP1 2MA2A 2HPSA 2WORA 1FI5A 1TNXA 1W7JB 1SK6D 1GQMA 1K9UA 2I7AA 2COLB 3SG7A 1DJGA 1WRKA 3AAKA 1KCYA 1QVIY 2F33A 1DF0A 3H4SE 3MSEB 2L2EA 1RJVA 4YI9A 1UHHA 3DVKA 3OB1B 1A75B 2LLSA 4PDZA 2LVIA 4U8DA 2K7BA 4YGAA 4FQOA 2JNXA 1L7ZA 2H61A 1J7QA 3SG2A 2NXQA 3BUWB 1SCMB 1LXFC 3BOWA 3KEVA 4NDCA 2KDHA 3BQ3A 1KFUS 1K8UA 2E6WA 2BE4A 4Q04A 2LHLA 4YGCB 3RLZA 4GGFA 1DTLA 1AJ4A 1IQ5A 1A03A 1IKUA 2F3YA 1R2UA 2BECA 4C0KA 1C7VA 4AQJA 3OB2B 1NSHA 1XFVO 1SL7A 2KBIA 3WHTB 4WQ3A 1NP8A 1XK4C 1DT7B 1JWDA 5DKQA 4GGNA 1OZOA 1SPYA 2Q91A 2ISDA 1SKTA 3JVTC 1BR1B 4N1FA 1A75A 4JWQA 2BL0C 2HQWA 3PN7B 4QJ3B 3ZWHA 1XA5A 1DGVA 1B8RA 4L9MA 1NX3A 2KAYA 2GGZA 2L98A 1RROA 4YI8A 1K9KA 2I2RE 1K2HA 1M39A 4MZJA 1EXRA 1SCVA 1CTRA 2JULA 1F54A 1XO5A 3E3RA 4PHKA 4BY5A 2K0JA 5I2QA 4E68A 1F4OA 4I5JA 1L2OB 1QVIZ 2MRDA 3CGAA 1QIWA 4JQ0D 3TZ1A 4DCKA 3CS1A 2LM5A 4OKHA 1PSRA 1YX7A 4YBHB 2L4HA 3EK4A 1ZUZA 1GGZA 1LINA 1YRUB 2LLTA 1DJHA 1TTXA 1V1FA 4DRWA 4NDDA 3FWCA 1B8CA 2LP2A 4AQIA 2K61A 3AKBA 3SG4A 2JXLA 3NSIA 4PHJA 1LKJA 2KYFA 3ZNIA 4QJ4B 1QXPA 1WDCB 4HRHA 1YR5A 1UHNA 1QS7A 1SW8A 5CSNA 1CNPA 1PVAA 1Y1AA 1CFDA 1S26D 1TRFA 3BUXB 3WHUB 3AAJA 4C0JA 3I5HC 1J1EA 1YTZC 5PALA 1CFPA 2JOJA 4GAOA 1A4PA 2K7CA 1KFXL 4A4BA 3DF0A 2M29A 1ZFSA 1ZOTB 4N1GA 1X02A 3LL8B 2MHHA 3WNXB 2KI4B 1B9AA 2Y1NA 3FIAA 5KSZA 1K96A 5HKYA 3ICBA 1JF0A 2LNKA 1ZMZA 3O6BA 4MSPA 1UHJA 1CMFA 1K93D 2LVJA 1WRZA 1DGUA 1NWDA 2BCBA 1ALWA 2RGIA 1XYDA 4ZCUA 1KQMC 5AFPA 2PVBA 1QTXA 5AANA 1F55A 3CR5X 3BUMB 1MQ1A 1Y1XA 3AKAA 2L5XB 1N65A 3EK7A 1QIVA 5TNCA 2WCFA 2JTTA 2ZRTA 2Y1MA 1DJYA 1OMDA 1H8BA 4PHNA 2PMYA 1DJIA 1DVIA 2QPTA 3M0WA 3I5FC 2KSPA 1S5GY 3KPXA 4YRUA 5CSFA 1SL8A 1ALVA 2I18A 3I5GB 4CPVA 4GGFC 2L4IA 1CDMA 1IG5A 3K21A 1CDPA 1BOCA 1LA3A 1BMOA 1W7IB 1SR6B 1JSAA 1NCYA 2M0RA 2F8PA 1AHRA 5CPVA 2AMIA 4NDBA 2G2BA 1FPWA 2M9GA 2Y4QA 4CIDA 3QRXA 1CDNA 2LUCA 1GJYA 4P5OE 2F3ZA 2JTZA 1UURA 2CNPA 1B1GA 1VRKA 2ZNEA 1CFCA 4I5NB 1BG1A 1CLBA 1QX5B 4PHMA 1JC2A 1AJ5A 2M7LA 3BXKA 1SL9A 4MRYA 1N0YA 3DVEA 4M2OA 1NCZA 1JF2A 1TNQA 4MEWA 1JUOA 3BUNB 3EKHA 2FCEA 5GQQC 2ZRSA 2KFHA 3RM1A 1PK0D 1K90D 1IJ6A 1BU3A 1NX0A 2K2FA 2LANA 1TOPA 3VRPA 4HRGA 4GFTA 2EC6C 2FOTA 1OQPA 1B7TY 5CSIA 2DOQA 1J7OA 2PSRA 2WNDA 3FS7A 1UHIA 1MHOA 2KQYA 2M97A 1YX8A 4ORCB 3OX5A 3BYAA 3O78A 3CZTX 4ICBA 2KI6D 2K7DA 2K8MB 2AAOA 1JBAA 1KWOC 1OZSA 3O4YA 1QLSA 4USLA 2EC6B 1M63B 1FF1A 1KFXS 5HLOA 4PE1A 2JU0A 1IWQA 2LLUA 3GK4X 1G8IA 1N2DA 2IS9A 1XFUO 2JC2A 3JVTB 2BBMA 5F6TA 2FJUB 2BL0B 4MVFA 2GGMA 2MAZA 4GBAA 2NCPA 1MXEA 2D8NA 4MLWA 1EJ3A 4AOMA 4IL1A 5K89A 2NCOA 1KWOB 3LLEA 1KSOA 2KBMA 3NXAA 4YGEB 5DKNA 2VRGA 1SY9A 4JPZB 1TN4A 1JFKA 2KNEA 3GK2A 1J7PA 4QJ5B 1SYMA 4F0ZB 4PE7A 4DIRA 5D7FA 1CLMA 1RK9A 2LP3A 5CSJA 1EG3A 1QV0A 1M31A 1XK4A 1XFWO 3OX6A 1KSMA 1OSAA 4XJKB 2OS8C 1D1OA 3SG5A 1UP5A 1YVHA 2G9BA 2BE6A 1QX7A 1ODBA 2WC8A 1MF8B 4MZKA 1RECA 3CR4X 1TNWA 2JPTA 4YGBB 1KK8C 1QASA 4ORBB 4HSZA 3OHMB 1B7TZ 1YUSA 1H4BA 2SASA 2Q4UA 2KGBC 2B1UA 3EVRA 3TS5C 1CKKA 5ER5A 2M1KB 1WRLA 1WY9A 3EK8A 3D0YB 3I5HB 4ZCVA 5HYDA 3PSRA 3EKJA 3IQQA 1G33A 2JWWA 2WCEA 2KQ6A 2ZNDA 3VRQA 1YUTA 3SIAA 1A29A 1OMVA 1EH2A 2BKHB 2L51A 2SCPA 2BKIB 3I5IC 2BCXA 4XJKA 2JQ6A 1QV1A 1KQVA 2LVKA 2F2OA 3CR2A 2JT0A 1IQ3A 1Q80A 1EL4A 3CTNA 2LV7A 1CM4A 5KU1A 2H61C 1FBVA 1BT6A 1DMOA 3C1VA 1J7RA 1DF0B 1OOJA 1PALA 1SBJA 1TCOB 3CLNA 4ETOA 3GOFA 4D1EA 5B8IB 1KQMB 4MZLA 2CTNA 2ZFDA 5KTYA 1QLKA 3SG3A 5I2LA 2JNFA 1NYAA 2PALA 2F2PA 3KHEA 1NIWA 2KFFA 1XVJA 3JTDC 2CCMA 1TNPA 4DS7A 3KO0A 5JJGA 2LC5A 2MLEC 3BUOB 3I5FB 3WXAA 2NLNA 3TUYC 2A4JA 1LVCD 1PSBA 3KF9A 1RWYA 3O2PA 3VROA 1QJTA 1KK7Y 2LAPA 1UWOA 2KI6C 1Y1UA 1HQVA 4M2PA 4MBEA 1Y6WA 1SCMC 2GV5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JTD B;  2PAS A;  1BOD A;  1F71 A;  3IQO A;  2KFG A;  1SRA A;  1PRW A;  3TUY B;  1MXL C;  1OMR A;  2KHN A;  2MJW B;  4GNK B;  5HKW A;  2O60 A;  1AUI B;  1S36 A;  2MLF C;  5J3X A;  3GK1 A;  2EHB A;  3DVM A;  1XFY O;  2WOS A;  3FWB A;  3NSK A;  1C7W A;  2LUX A;  4PE4 A;  2LMV A;  1B8L A;  1MUX A;  1NX1 A;  1UUS A;  1LA0 A;  3IF7 A;  3CWG A;  5HKZ A;  3HX4 A;  5AEQ A;  3SG6 A;  2KOT A;  2CBL A;  4HRE E;  1J55 A;  4YGD B;  4UPG A;  5IBW A;  1S6C A;  3TDI A;  1QX2 A;  1UHK A;  3PN7 C;  4R1E A;  2M1U A;  2M3W A;  4M2Q A;  2KAV A;  5AXI A;  3SJS A;  1NUB A;  2Y5I A;  5JOL A;  3DD4 A;  1A2X A;  2KYC A;  1S5G Z;  4PCW A;  5AER A;  1EG4 A;  2KAX A;  2ZN8 A;  4GUK A;  4N5X A;  1IRJ A;  2LCP A;  1DJZ A;  1HT9 A;  4P2Y B;  4FTG A;  1QAT A;  4WQ2 A;  4DUQ A;  1DJW A;  1MR8 A;  4WRI A;  2HQ8 A;  1NPQ A;  2ZKM X;  2BBN A;  3EVU A;  4CFR A;  1BR4 B;  1L2O C;  1CMG A;  1M45 A;  1S6J A;  5HLV A;  1F70 A;  4GPL B;  2WCB A;  3D10 A;  2M7N A;  2JT3 A;  3LCP C;  4NQG A;  2OPO A;  2QAC A;  3TDZ A;  3TDU A;  1K94 A;  2ZN9 A;  3A8R A;  4PAL A;  1CLL A;  3HCM A;  1KK7 Z;  4ORA B;  1CFF A;  1AP4 A;  1S1E A;  3SIB A;  1B47 A;  5I8N A;  1TCF A;  1XFZ O;  1BF5 A;  1NX2 A;  2L0P A;  1E8A A;  1PUL A;  3VGO A;  1GGW A;  1KFU L;  2JZI A;  3PAL A;  1WDC C;  2TN4 A;  3OP0 A;  3DF0 B;  2FCD A;  1U5I B;  1FW4 A;  1WLZ A;  2O5G A;  1RFJ A;  5DKR A;  3LK1 A;  3VRN A;  4MRX A;  1C07 A;  1YVL A;  1JFJ A;  2L50 A;  2OTG C;  1R6P A;  4OVN F;  2MBX A;  2EGD A;  2JXC A;  2NZ0 A;  3NSO A;  1NCX A;  2OS8 B;  5D69 A;  1TIZ A;  1SMG A;  3LK0 A;  4TNC A;  4I5K A;  4PE0 A;  1CB1 A;  3PAT A;  2KGR A;  1ZAC A;  1S6I A;  2CT9 A;  2KI4 C;  1KK8 B;  4OV2 A;  4XYN A;  4CLN A;  3PM8 A;  1B4C A;  3NSL A;  2V53 A;  1CDL A;  2JT8 A;  2OTG B;  1G4Y R;  2PRU A;  4I5L B;  1M46 A;  1AVS A;  3A4U B;  5ER4 X;  2LMU A;  3TS5 B;  1XFX O;  2CXJ A;  1SNL A;  3DVJ A;  1OE9 B;  5I2O A;  1U5I A;  2HET A;  1K95 A;  1K9P A;  1PVB A;  1WLM A;  2LE9 B;  4OCI A;  2K2A A;  1IJ5 A;  2HF5 A;  2E30 A;  2M49 B;  4C0L A;  2I94 A;  3VRR A;  1YUR A;  1J1D A;  1Y0V H;  3EVV A;  1FI6 A;  2LVV A;  3PLF B;  3PFV A;  5BPJ A;  1MWN A;  2BCA A;  3I5I B;  1YRT B;  1V1G A;  1DJX A;  2K7O A;  4MN0 A;  2AUC A;  1CM1 A;  1IGV A;  1F8H A;  5G08 A;  2P6B B;  4A4C A;  3I5G C;  2LHI A;  3D0Y A;  1BJF A;  2LMT A;  3BOW B;  1IH0 A;  2H2K A;  4OR9 B;  1F4Q A;  1YUU A;  1SR6 C;  2JRF A;  2M8U A;  5FYX A;  1BLQ A;  2R2I A;  4BY4 A;  4CFQ A;  1S3P A;  3F45 A;  1AK8 A;  1RTP 1;  2MA2 A;  2HPS A;  2WOR A;  1FI5 A;  1TNX A;  1W7J B;  1SK6 D;  1GQM A;  1K9U A;  2I7A A;  2COL B;  3SG7 A;  1DJG A;  1WRK A;  3AAK A;  1KCY A;  1QVI Y;  2F33 A;  1DF0 A;  3H4S E;  3MSE B;  2L2E A;  1RJV A;  4YI9 A;  1UHH A;  3DVK A;  3OB1 B;  1A75 B;  2LLS A;  4PDZ A;  2LVI A;  4U8D A;  2K7B A;  4YGA A;  4FQO A;  2JNX A;  1L7Z A;  2H61 A;  1J7Q A;  3SG2 A;  2NXQ A;  3BUW B;  1SCM B;  1LXF C;  3BOW A;  3KEV A;  4NDC A;  2KDH A;  3BQ3 A;  1KFU S;  1K8U A;  2E6W A;  2BE4 A;  4Q04 A;  2LHL A;  4YGC B;  3RLZ A;  4GGF A;  1DTL A;  1AJ4 A;  1IQ5 A;  1A03 A;  1IKU A;  2F3Y A;  1R2U A;  2BEC A;  4C0K A;  1C7V A;  4AQJ A;  3OB2 B;  1NSH A;  1XFV O;  1SL7 A;  2KBI A;  3WHT B;  4WQ3 A;  1NP8 A;  1XK4 C;  1DT7 B;  1JWD A;  5DKQ A;  4GGN A;  1OZO A;  1SPY A;  2Q91 A;  2ISD A;  1SKT A;  3JVT C;  1BR1 B;  4N1F A;  1A75 A;  4JWQ A;  2BL0 C;  2HQW A;  3PN7 B;  4QJ3 B;  3ZWH A;  1XA5 A;  1DGV A;  1B8R A;  4L9M A;  1NX3 A;  2KAY A;  2GGZ A;  2L98 A;  1RRO A;  4YI8 A;  1K9K A;  2I2R E;  1K2H A;  1M39 A;  4MZJ A;  1EXR A;  1SCV A;  1CTR A;  2JUL A;  1F54 A;  1XO5 A;  3E3R A;  4PHK A;  4BY5 A;  2K0J A;  5I2Q A;  4E68 A;  1F4O A;  4I5J A;  1L2O B;  1QVI Z;  2MRD A;  3CGA A;  1QIW A;  4JQ0 D;  3TZ1 A;  4DCK A;  3CS1 A;  2LM5 A;  4OKH A;  1PSR A;  1YX7 A;  4YBH B;  2L4H A;  3EK4 A;  1ZUZ A;  1GGZ A;  1LIN A;  1YRU B;  2LLT A;  1DJH A;  1TTX A;  1V1F A;  4DRW A;  4NDD A;  3FWC A;  1B8C A;  2LP2 A;  4AQI A;  2K61 A;  3AKB A;  3SG4 A;  2JXL A;  3NSI A;  4PHJ A;  1LKJ A;  2KYF A;  3ZNI A;  4QJ4 B;  1QXP A;  1WDC B;  4HRH A;  1YR5 A;  1UHN A;  1QS7 A;  1SW8 A;  5CSN A;  1CNP A;  1PVA A;  1Y1A A;  1CFD A;  1S26 D;  1TRF A;  3BUX B;  3WHU B;  3AAJ A;  4C0J A;  3I5H C;  1J1E A;  1YTZ C;  5PAL A;  1CFP A;  2JOJ A;  4GAO A;  1A4P A;  2K7C A;  1KFX L;  4A4B A;  3DF0 A;  2M29 A;  1ZFS A;  1ZOT B;  4N1G A;  1X02 A;  3LL8 B;  2MHH A;  3WNX B;  2KI4 B;  1B9A A;  2Y1N A;  3FIA A;  5KSZ A;  1K96 A;  5HKY A;  3ICB A;  1JF0 A;  2LNK A;  1ZMZ A;  3O6B A;  4MSP A;  1UHJ A;  1CMF A;  1K93 D;  2LVJ A;  1WRZ A;  1DGU A;  1NWD A;  2BCB A;  1ALW A;  2RGI A;  1XYD A;  4ZCU A;  1KQM C;  5AFP A;  2PVB A;  1QTX A;  5AAN A;  1F55 A;  3CR5 X;  3BUM B;  1MQ1 A;  1Y1X A;  3AKA A;  2L5X B;  1N65 A;  3EK7 A;  1QIV A;  5TNC A;  2WCF A;  2JTT A;  2ZRT A;  2Y1M A;  1DJY A;  1OMD A;  1H8B A;  4PHN A;  2PMY A;  1DJI A;  1DVI A;  2QPT A;  3M0W A;  3I5F C;  2KSP A;  1S5G Y;  3KPX A;  4YRU A;  5CSF A;  1SL8 A;  1ALV A;  2I18 A;  3I5G B;  4CPV A;  4GGF C;  2L4I A;  1CDM A;  1IG5 A;  3K21 A;  1CDP A;  1BOC A;  1LA3 A;  1BMO A;  1W7I B;  1SR6 B;  1JSA A;  1NCY A;  2M0R A;  2F8P A;  1AHR A;  5CPV A;  2AMI A;  4NDB A;  2G2B A;  1FPW A;  2M9G A;  2Y4Q A;  4CID A;  3QRX A;  1CDN A;  2LUC A;  1GJY A;  4P5O E;  2F3Z A;  2JTZ A;  1UUR A;  2CNP A;  1B1G A;  1VRK A;  2ZNE A;  1CFC A;  4I5N B;  1BG1 A;  1CLB A;  1QX5 B;  4PHM A;  1JC2 A;  1AJ5 A;  2M7L A;  3BXK A;  1SL9 A;  4MRY A;  1N0Y A;  3DVE A;  4M2O A;  1NCZ A;  1JF2 A;  1TNQ A;  4MEW A;  1JUO A;  3BUN B;  3EKH A;  2FCE A;  5GQQ C;  2ZRS A;  2KFH A;  3RM1 A;  1PK0 D;  1K90 D;  1IJ6 A;  1BU3 A;  1NX0 A;  2K2F A;  2LAN A;  1TOP A;  3VRP A;  4HRG A;  4GFT A;  2EC6 C;  2FOT A;  1OQP A;  1B7T Y;  5CSI A;  2DOQ A;  1J7O A;  2PSR A;  2WND A;  3FS7 A;  1UHI A;  1MHO A;  2KQY A;  2M97 A;  1YX8 A;  4ORC B;  3OX5 A;  3BYA A;  3O78 A;  3CZT X;  4ICB A;  2KI6 D;  2K7D A;  2K8M B;  2AAO A;  1JBA A;  1KWO C;  1OZS A;  3O4Y A;  1QLS A;  4USL A;  2EC6 B;  1M63 B;  1FF1 A;  1KFX S;  5HLO A;  4PE1 A;  2JU0 A;  1IWQ A;  2LLU A;  3GK4 X;  1G8I A;  1N2D A;  2IS9 A;  1XFU O;  2JC2 A;  3JVT B;  2BBM A;  5F6T A;  2FJU B;  2BL0 B;  4MVF A;  2GGM A;  2MAZ A;  4GBA A;  2NCP A;  1MXE A;  2D8N A;  4MLW A;  1EJ3 A;  4AOM A;  4IL1 A;  5K89 A;  2NCO A;  1KWO B;  3LLE A;  1KSO A;  2KBM A;  3NXA A;  4YGE B;  5DKN A;  2VRG A;  1SY9 A;  4JPZ B;  1TN4 A;  1JFK A;  2KNE A;  3GK2 A;  1J7P A;  4QJ5 B;  1SYM A;  4F0Z B;  4PE7 A;  4DIR A;  5D7F A;  1CLM A;  1RK9 A;  2LP3 A;  5CSJ A;  1EG3 A;  1QV0 A;  1M31 A;  1XK4 A;  1XFW O;  3OX6 A;  1KSM A;  1OSA A;  4XJK B;  2OS8 C;  1D1O A;  3SG5 A;  1UP5 A;  1YVH A;  2G9B A;  2BE6 A;  1QX7 A;  1ODB A;  2WC8 A;  1MF8 B;  4MZK A;  1REC A;  3CR4 X;  1TNW A;  2JPT A;  4YGB B;  1KK8 C;  1QAS A;  4ORB B;  4HSZ A;  3OHM B;  1B7T Z;  1YUS A;  1H4B A;  2SAS A;  2Q4U A;  2KGB C;  2B1U A;  3EVR A;  3TS5 C;  1CKK A;  5ER5 A;  2M1K B;  1WRL A;  1WY9 A;  3EK8 A;  3D0Y B;  3I5H B;  4ZCV A;  5HYD A;  3PSR A;  3EKJ A;  3IQQ A;  1G33 A;  2JWW A;  2WCE A;  2KQ6 A;  2ZND A;  3VRQ A;  1YUT A;  3SIA A;  1A29 A;  1OMV A;  1EH2 A;  2BKH B;  2L51 A;  2SCP A;  2BKI B;  3I5I C;  2BCX A;  4XJK A;  2JQ6 A;  1QV1 A;  1KQV A;  2LVK A;  2F2O A;  3CR2 A;  2JT0 A;  1IQ3 A;  1Q80 A;  1EL4 A;  3CTN A;  2LV7 A;  1CM4 A;  5KU1 A;  2H61 C;  1FBV A;  1BT6 A;  1DMO A;  3C1V A;  1J7R A;  1DF0 B;  1OOJ A;  1PAL A;  1SBJ A;  1TCO B;  3CLN A;  4ETO A;  3GOF A;  4D1E A;  5B8I B;  1KQM B;  4MZL A;  2CTN A;  2ZFD A;  5KTY A;  1QLK A;  3SG3 A;  5I2L A;  2JNF A;  1NYA A;  2PAL A;  2F2P A;  3KHE A;  1NIW A;  2KFF A;  1XVJ A;  3JTD C;  2CCM A;  1TNP A;  4DS7 A;  3KO0 A;  5JJG A;  2LC5 A;  2MLE C;  3BUO B;  3I5F B;  3WXA A;  2NLN A;  3TUY C;  2A4J A;  1LVC D;  1PSB A;  3KF9 A;  1RWY A;  3O2P A;  3VRO A;  1QJT A;  1KK7 Y;  2LAP A;  1UWO A;  2KI6 C;  1Y1U A;  1HQV A;  4M2P A;  4MBE A;  1Y6W A;  1SCM C;  2GV5 A; 
#chains in the Genus database with same CATH topology
 3JTD B;  2PAS A;  1BOD A;  1F71 A;  3CAB A;  3BJH A;  3IQO A;  2KFG A;  1SRA A;  1PRW A;  3TUY B;  1MXL C;  1OMR A;  2KHN A;  2MJW B;  4GNK B;  5HKW A;  2O60 A;  1AUI B;  1S36 A;  1TUJ A;  2MLF C;  3IVT A;  5J3X A;  3GK1 A;  4KYN A;  2EHB A;  3DVM A;  1XFY O;  2WOS A;  3FWB A;  3NSK A;  1C7W A;  2LUX A;  4PE4 A;  2LMV A;  3N7H A;  1B8L A;  1MUX A;  1NX1 A;  1UUS A;  1LA0 A;  3IF7 A;  3CWG A;  5HKZ A;  3HX4 A;  5AEQ A;  3SG6 A;  1C3Z A;  2KOT A;  2CBL A;  4HRE E;  1J55 A;  5EL2 A;  4YGD B;  3B6X A;  4UPG A;  5IBW A;  1S6C A;  3TDI A;  1QX2 A;  1UHK A;  3PN7 C;  4R1E A;  4IJ7 A;  2M1U A;  2M3W A;  4M2Q A;  2KAV A;  5AXI A;  3SJS A;  1NUB A;  2Y5I A;  3NHT A;  2P70 A;  3DD4 A;  5JOL A;  1A2X A;  2KYC A;  1S5G Z;  4PCW A;  5AER A;  1EG4 A;  2KAX A;  2ZN8 A;  4GUK A;  4N5X A;  1IRJ A;  2LCP A;  1DJZ A;  1HT9 A;  4P2Y B;  4FTG A;  1QAT A;  4WQ2 A;  4DUQ A;  1DJW A;  1MR8 A;  4WRI A;  2HQ8 A;  1NPQ A;  2ZKM X;  2BBN A;  3EVU A;  4CFR A;  1BR4 B;  1L2O C;  1CMG A;  1M45 A;  1S6J A;  5HLV A;  1XFR A;  4GPL B;  2WCB A;  3D10 A;  2M7N A;  1F70 A;  3BFH A;  2JT3 A;  3LCP C;  4NQG A;  2OPO A;  2QAC A;  3TDZ A;  3TDU A;  1K94 A;  2BNX A;  2ZN9 A;  3A8R A;  4PAL A;  1CLL A;  3HCM A;  1KK7 Z;  4ORA B;  1TUZ A;  1CFF A;  1AP4 A;  1S1E A;  3SIB A;  3SS3 A;  1B47 A;  5I8N A;  1TCF A;  1XFZ O;  1BF5 A;  1NX2 A;  2L0P A;  1E8A A;  1PUL A;  3VGO A;  1GGW A;  1KFU L;  2JZI A;  3B86 A;  3PAL A;  1WDC C;  2TN4 A;  3OP0 A;  3DF0 B;  2L5Y A;  2FCD A;  1U5I B;  1FW4 A;  5FI7 A;  1WLZ A;  2O5G A;  3UNW A;  1RFJ A;  5DKR A;  3LK1 A;  2QDI A;  3VRN A;  3R1P A;  4MRX A;  1C07 A;  1YVL A;  1JFJ A;  3OGN A;  2PQL A;  2L50 A;  2OTG C;  1R6P A;  4OVN F;  2MBX A;  2EGD A;  2JXC A;  2NZ0 A;  3NSO A;  1NCX A;  2OS8 B;  5D69 A;  1TIZ A;  1SMG A;  3LK0 A;  4TNC A;  4I5K A;  4PE0 A;  1CB1 A;  3PAT A;  2KGR A;  1ZAC A;  1S6I A;  3R72 A;  3CYZ A;  2CT9 A;  2KI4 C;  2L2C A;  1KK8 B;  3L4L A;  3OBV A;  4OV2 A;  3PM8 A;  4XYN A;  3NSL A;  4CLN A;  2V53 A;  1B4C A;  1CDL A;  2JT8 A;  2BAP A;  2OTG B;  1G4Y R;  2PRU A;  4I5L B;  1M46 A;  1GM0 A;  1AVS A;  3A4U B;  5ER4 X;  2LMU A;  2FJY A;  1XFX O;  2CXJ A;  3SS5 A;  3TS5 B;  1SNL A;  5HL1 A;  3DVJ A;  1OE9 B;  5I2O A;  1U5I A;  2HET A;  1K95 A;  1K9P A;  1OOG A;  1PVB A;  1WLM A;  2LE9 B;  3CZ1 A;  4OCI A;  2K2A A;  1IJ5 A;  2HF5 A;  2E30 A;  2M49 B;  4C0L A;  2I94 A;  3VRR A;  1YUR A;  1J1D A;  1Y0V H;  3EVV A;  1FI6 A;  2LVV A;  3PLF B;  3PFV A;  5BPJ A;  1MWN A;  2BCA A;  4JD9 A;  3I5I B;  1YRT B;  1V1G A;  1DJX A;  2K7O A;  4MN0 A;  2AUC A;  1CM1 A;  1IGV A;  1F8H A;  5G08 A;  2P6B B;  4A4C A;  3I5G C;  2LHI A;  3D0Y A;  2YGU A;  1BJF A;  2LMT A;  3BOW B;  2WCK A;  1IH0 A;  2H2K A;  4OR9 B;  1F4Q A;  1YUU A;  3CDN A;  1SR6 C;  2JRF A;  2M8U A;  5FYX A;  1BLQ A;  2R2I A;  3PJI A;  4BY4 A;  4CFQ A;  1S3P A;  3F45 A;  1AK8 A;  1RTP 1;  2MA2 A;  2HPS A;  2WOR A;  1FI5 A;  1TNX A;  1TWO A;  1W7J B;  1SK6 D;  1GQM A;  1K9U A;  2I7A A;  3DYE A;  2COL B;  3D76 A;  3SG7 A;  1DJG A;  1WRK A;  3AAK A;  1KCY A;  1QVI Y;  2F33 A;  1DF0 A;  3H4S E;  3MSE B;  2WCJ A;  2L2E A;  4FQT A;  1RJV A;  4YI9 A;  1UHH A;  5FI6 A;  3DVK A;  3OB1 B;  1A75 B;  2LLS A;  4PDZ A;  2LVI A;  4U8D A;  2K7B A;  4YGA A;  4FQO A;  5FI2 A;  2JNX A;  1L7Z A;  2H61 A;  3BFA A;  1J7Q A;  2ERB A;  3SG2 A;  2NXQ A;  3BUW B;  1SCM B;  1LXF C;  3BOW A;  3KEV A;  4NDC A;  2KDH A;  3BQ3 A;  1KFU S;  2WCM A;  1K8U A;  2E6W A;  2BE4 A;  3FE8 A;  4Q04 A;  2LHL A;  4YGC B;  3RLZ A;  4GGF A;  1DTL A;  1AJ4 A;  1IQ5 A;  1A03 A;  1IKU A;  2F3Y A;  1R2U A;  2BEC A;  4C0K A;  1C7V A;  4AQJ A;  3OB2 B;  1NSH A;  1XFV O;  1SL7 A;  2KBI A;  3WHT B;  4JKT A;  4WQ3 A;  1NP8 A;  1XK4 C;  1OOI X;  1DT7 B;  1JWD A;  4INX A;  5DKQ A;  4GGN A;  1OZO A;  1SPY A;  3V2L A;  2Q91 A;  2ISD A;  3D77 A;  3RZS A;  1SKT A;  3JVT C;  1BR1 B;  4N1F A;  1OW4 A;  1A75 A;  4JWQ A;  2BL0 C;  2HQW A;  3PN7 B;  4QJ3 B;  3SS4 A;  1XA5 A;  3ZWH A;  1DGV A;  1B8R A;  4L9M A;  1NX3 A;  2KAY A;  1P28 A;  2GGZ A;  2L98 A;  1RRO A;  4YI8 A;  1K9K A;  2I2R E;  1K2H A;  1M39 A;  4MZJ A;  1EXR A;  1SCV A;  1CTR A;  2JUL A;  1F54 A;  1XO5 A;  3E3R A;  3S0D A;  4PHK A;  4BY5 A;  2K0J A;  5I2Q A;  4E68 A;  1F4O A;  4I5J A;  1L2O B;  1QVI Z;  2MRD A;  3CGA A;  1QIW A;  4JQ0 D;  1ORG A;  3TZ1 A;  4DCK A;  3BFB A;  3FE9 A;  3CS1 A;  2LM5 A;  4OKH A;  1PSR A;  2WCH A;  3CZ0 A;  1YX7 A;  4YBH B;  2KPH A;  2L4H A;  3EK4 A;  1ZUZ A;  1SSE B;  1GGZ A;  1LIN A;  1YRU B;  2LLT A;  1DJH A;  1TTX A;  1V1F A;  4DRW A;  4NDD A;  3FWC A;  1B8C A;  2LP2 A;  4AQI A;  2K61 A;  3AKB A;  3SG4 A;  2JXL A;  3NSI A;  4PHJ A;  1LKJ A;  2KYF A;  3ZNI A;  4QJ4 B;  1QXP A;  1WDC B;  4HRH A;  1YR5 A;  1UHN A;  3S0E A;  3NHI A;  1LS8 A;  1QS7 A;  1SW8 A;  5CSN A;  1CNP A;  1PVA A;  1Y1A A;  1CFD A;  1S26 D;  1TRF A;  1OOF A;  3BUX B;  3AAJ A;  5DIC A;  3WHU B;  3I5H C;  4C0J A;  1C3Y A;  1J1E A;  1YTZ C;  5PAL A;  1CFP A;  2JOJ A;  4GAO A;  1A4P A;  2K7C A;  1KFX L;  3S0B A;  4A4B A;  3DF0 A;  2M29 A;  1ZFS A;  1ZOT B;  4N1G A;  1X02 A;  1DEK A;  1DQE A;  3LL8 B;  2MHH A;  3WNX B;  2KI4 B;  1B9A A;  2Y1N A;  3FIA A;  5KSZ A;  1K96 A;  5HKY A;  3ICB A;  1JF0 A;  2LNK A;  1ZMZ A;  3O6B A;  4MSP A;  1UHJ A;  1CMF A;  1K93 D;  2LVJ A;  2QEO A;  3VB1 A;  1WRZ A;  2QEV A;  1DGU A;  1NWD A;  2BCB A;  1ALW A;  2RGI A;  1XYD A;  4ZCU A;  1KQM C;  5AFP A;  2PVB A;  1QTX A;  3R1O A;  5AAN A;  1Z4H A;  1F55 A;  3CR5 X;  3BUM B;  1MQ1 A;  1Y1X A;  3AKA A;  2L5X B;  2H8V A;  1N65 A;  3EK7 A;  1QIV A;  5TNC A;  2WCF A;  2JTT A;  2ZRT A;  2Y1M A;  1DJY A;  1OMD A;  2PYQ A;  1H8B A;  4PHN A;  2PMY A;  1DJI A;  1DVI A;  2JPO A;  2QPT A;  3M0W A;  3S0G A;  3I5F C;  2KSP A;  1S5G Y;  3KPX A;  4YRU A;  2KLD A;  5CSF A;  1SL8 A;  1ALV A;  2I18 A;  3I5G B;  4CPV A;  4GGF C;  2L4I A;  2QEH A;  1CDM A;  1IG5 A;  3K21 A;  1CDP A;  1BOC A;  1LA3 A;  1BMO A;  1W7I B;  2WCL A;  1SR6 B;  1JSA A;  1NCY A;  2M0R A;  2F8P A;  1AHR A;  3D75 A;  5CPV A;  2AMI A;  4NDB A;  2G2B A;  1FPW A;  3FE6 A;  2M9G A;  2Y4Q A;  4CID A;  3QRX A;  1CDN A;  2LUC A;  1GJY A;  3D74 A;  4P5O E;  2F3Z A;  2JTZ A;  1UUR A;  2CNP A;  1B1G A;  1VRK A;  2ZNE A;  3DY9 A;  1CFC A;  4I5N B;  1BG1 A;  3O4X A;  1QX5 B;  1CLB A;  4PHM A;  1JC2 A;  1AJ5 A;  2M7L A;  3BXK A;  3S0F A;  1SL9 A;  4MRY A;  1DEL A;  1N0Y A;  3DVE A;  4M2O A;  3K1E A;  1NCZ A;  1JF2 A;  1TNQ A;  1W9Z A;  4MEW A;  1JUO A;  3BUN B;  3EKH A;  2FCE A;  5GQQ C;  2ZRS A;  2KFH A;  3L47 A;  1PK0 D;  3RM1 A;  1K90 D;  1IJ6 A;  1BU3 A;  1NX0 A;  2K2F A;  2LAN A;  1TOP A;  2WC5 A;  3VRP A;  3DXL A;  4HRG A;  4GFT A;  2EC6 C;  2FOT A;  1OQP A;  1B7T Y;  5CSI A;  2DOQ A;  3EG5 B;  2PSR A;  2WND A;  1J7O A;  2GTE A;  3FS7 A;  1UHI A;  4PT1 A;  1MHO A;  2KQY A;  2M97 A;  1YX8 A;  4ORC B;  1DC1 A;  3OX5 A;  3BYA A;  3D73 A;  3O78 A;  3CZT X;  4ICB A;  2KI6 D;  2K7D A;  2K8M B;  2AAO A;  1JBA A;  1KWO C;  1OZS A;  3O4Y A;  1QLS A;  4USL A;  2EC6 B;  1M63 B;  1FF1 A;  1KFX S;  4INW A;  5HLO A;  4PE1 A;  2JU0 A;  1IWQ A;  1Z2C B;  2LLU A;  1G8I A;  1N2D A;  2IS9 A;  1XFU O;  2JC2 A;  3GK4 X;  3JVT B;  3B7A A;  2BBM A;  5F6T A;  2FJU B;  2BL0 B;  4MVF A;  2GGM A;  3QME A;  2MAZ A;  4GBA A;  2NCP A;  1T14 A;  1IIO A;  1MXE A;  2D8N A;  4MLW A;  3L4A A;  1EJ3 A;  4AOM A;  4IL1 A;  5K89 A;  2NCO A;  1KWO B;  3LLE A;  1KSO A;  2KBM A;  3NXA A;  4OZD A;  4YGE B;  5DKN A;  2VRG A;  1SY9 A;  4JPZ B;  1TN4 A;  1JFK A;  2KNE A;  3GK2 A;  1J7P A;  4QJ5 B;  1SYM A;  4F0Z B;  3S0A A;  4PE7 A;  3UO9 A;  4DIR A;  5D7F A;  1CLM A;  1RK9 A;  2LP3 A;  5CSJ A;  1EG3 A;  1QV0 A;  1M31 A;  1XK4 A;  1XFW O;  3OX6 A;  1KSM A;  1OSA A;  4XJK B;  2OS8 C;  1D1O A;  5D3O A;  3SG5 A;  1UP5 A;  1YVH A;  2G9B A;  2BE6 A;  1QX7 A;  1ODB A;  2WC8 A;  1MF8 B;  4MZK A;  1REC A;  1QWV A;  3CR4 X;  3CZ2 A;  1TNW A;  2JPT A;  4YGB B;  1KK8 C;  3B88 A;  1QAS A;  4ORB B;  4HSZ A;  3OHM B;  2K60 A;  3D78 A;  1B7T Z;  1YUS A;  1H4B A;  2SAS A;  2Q4U A;  2KGB C;  2B1U A;  3EVR A;  3TS5 C;  3B87 A;  1CKK A;  5ER5 A;  2M1K B;  1WRL A;  1WY9 A;  3EK8 A;  3D0Y B;  3I5H B;  4ZCV A;  5HYD A;  3R1V A;  3PSR A;  3EKJ A;  3IQQ A;  1G33 A;  2JWW A;  2WCE A;  2P71 A;  2KQ6 A;  2ZND A;  3VRQ A;  2WC6 A;  1YUT A;  3PM2 A;  3SIA A;  1A29 A;  1OMV A;  1EH2 A;  2BKH B;  2L51 A;  2SCP A;  2BKI B;  3I5I C;  3NGV A;  2BCX A;  4XJK A;  5I94 A;  2JQ6 A;  1QV1 A;  1KQV A;  2LVK A;  2F2O A;  3CR2 A;  2JT0 A;  1IQ3 A;  1Q80 A;  1EL4 A;  3CTN A;  2LV7 A;  1CM4 A;  5KU1 A;  2H61 C;  1FBV A;  2KLE A;  1BT6 A;  1DMO A;  3C1V A;  1J7R A;  1DF0 B;  1OOJ A;  1PAL A;  1SBJ A;  1TCO B;  3CLN A;  1OOH A;  4ETO A;  3GOF A;  4D1E A;  5B8I B;  1KQM B;  4MZL A;  2CTN A;  2ZFD A;  3Q8I A;  3DZT A;  5KTY A;  1QLK A;  3SG3 A;  5I2L A;  2JNF A;  1NYA A;  2PAL A;  2F2P A;  4F7F A;  3KHE A;  1NIW A;  2KFF A;  1XVJ A;  3JTD C;  2CCM A;  1TNP A;  4DS7 A;  3KO0 A;  5JJG A;  2LC5 A;  2MLE C;  3BUO B;  3I5F B;  3WXA A;  2NLN A;  3TUY C;  2A4J A;  1LVC D;  1PSB A;  3KF9 A;  1RWY A;  3O2P A;  3VRO A;  1QJT A;  1KK7 Y;  2LAP A;  1UWO A;  2KI6 C;  2QEB A;  1Y1U A;  1HQV A;  4M2P A;  4MBE A;  1Y6W A;  1SCM C;  2GV5 A; 
#chains in the Genus database with same CATH homology
 3JTD B;  2PAS A;  1BOD A;  1F71 A;  3IQO A;  2KFG A;  1SRA A;  1PRW A;  3TUY B;  1MXL C;  1OMR A;  2KHN A;  2MJW B;  4GNK B;  5HKW A;  2O60 A;  1AUI B;  1S36 A;  2MLF C;  5J3X A;  3GK1 A;  2EHB A;  3DVM A;  1XFY O;  2WOS A;  3FWB A;  3NSK A;  1C7W A;  2LUX A;  4PE4 A;  2LMV A;  1B8L A;  1MUX A;  1NX1 A;  1UUS A;  1LA0 A;  3IF7 A;  3CWG A;  5HKZ A;  3HX4 A;  5AEQ A;  3SG6 A;  2KOT A;  2CBL A;  4HRE E;  1J55 A;  4YGD B;  4UPG A;  5IBW A;  1S6C A;  3TDI A;  1QX2 A;  1UHK A;  3PN7 C;  4R1E A;  2M1U A;  2M3W A;  4M2Q A;  2KAV A;  5AXI A;  3SJS A;  1NUB A;  2Y5I A;  5JOL A;  3DD4 A;  1A2X A;  2KYC A;  1S5G Z;  4PCW A;  5AER A;  1EG4 A;  2KAX A;  2ZN8 A;  4GUK A;  4N5X A;  1IRJ A;  2LCP A;  1DJZ A;  1HT9 A;  4P2Y B;  4FTG A;  1QAT A;  4WQ2 A;  4DUQ A;  1DJW A;  1MR8 A;  4WRI A;  2HQ8 A;  1NPQ A;  2ZKM X;  2BBN A;  3EVU A;  4CFR A;  1BR4 B;  1L2O C;  1CMG A;  1M45 A;  1S6J A;  5HLV A;  1F70 A;  4GPL B;  2WCB A;  3D10 A;  2M7N A;  2JT3 A;  3LCP C;  4NQG A;  2OPO A;  2QAC A;  3TDZ A;  3TDU A;  1K94 A;  2ZN9 A;  3A8R A;  4PAL A;  1CLL A;  3HCM A;  1KK7 Z;  4ORA B;  1CFF A;  1AP4 A;  1S1E A;  3SIB A;  1B47 A;  5I8N A;  1TCF A;  1XFZ O;  1BF5 A;  1NX2 A;  2L0P A;  1E8A A;  1PUL A;  3VGO A;  1GGW A;  1KFU L;  2JZI A;  3PAL A;  1WDC C;  2TN4 A;  3OP0 A;  3DF0 B;  2FCD A;  1U5I B;  1FW4 A;  1WLZ A;  2O5G A;  1RFJ A;  5DKR A;  3LK1 A;  3VRN A;  4MRX A;  1C07 A;  1YVL A;  1JFJ A;  2L50 A;  2OTG C;  1R6P A;  4OVN F;  2MBX A;  2EGD A;  2JXC A;  2NZ0 A;  3NSO A;  1NCX A;  2OS8 B;  5D69 A;  1TIZ A;  1SMG A;  3LK0 A;  4TNC A;  4I5K A;  4PE0 A;  1CB1 A;  3PAT A;  2KGR A;  1ZAC A;  1S6I A;  2CT9 A;  2KI4 C;  1KK8 B;  4OV2 A;  4XYN A;  4CLN A;  3PM8 A;  1B4C A;  3NSL A;  2V53 A;  1CDL A;  2JT8 A;  2OTG B;  1G4Y R;  2PRU A;  4I5L B;  1M46 A;  1AVS A;  3A4U B;  5ER4 X;  2LMU A;  3TS5 B;  1XFX O;  2CXJ A;  1SNL A;  3DVJ A;  1OE9 B;  5I2O A;  1U5I A;  2HET A;  1K95 A;  1K9P A;  1PVB A;  1WLM A;  2LE9 B;  4OCI A;  2K2A A;  1IJ5 A;  2HF5 A;  2E30 A;  2M49 B;  4C0L A;  2I94 A;  3VRR A;  1YUR A;  1J1D A;  1Y0V H;  3EVV A;  1FI6 A;  2LVV A;  3PLF B;  3PFV A;  5BPJ A;  1MWN A;  2BCA A;  3I5I B;  1YRT B;  1V1G A;  1DJX A;  2K7O A;  4MN0 A;  2AUC A;  1CM1 A;  1IGV A;  1F8H A;  5G08 A;  2P6B B;  4A4C A;  3I5G C;  2LHI A;  3D0Y A;  1BJF A;  2LMT A;  3BOW B;  1IH0 A;  2H2K A;  4OR9 B;  1F4Q A;  1YUU A;  1SR6 C;  2JRF A;  2M8U A;  5FYX A;  1BLQ A;  2R2I A;  4BY4 A;  4CFQ A;  1S3P A;  3F45 A;  1AK8 A;  1RTP 1;  2MA2 A;  2HPS A;  2WOR A;  1FI5 A;  1TNX A;  1W7J B;  1SK6 D;  1GQM A;  1K9U A;  2I7A A;  2COL B;  3SG7 A;  1DJG A;  1WRK A;  3AAK A;  1KCY A;  1QVI Y;  2F33 A;  1DF0 A;  3H4S E;  3MSE B;  2L2E A;  1RJV A;  4YI9 A;  1UHH A;  3DVK A;  3OB1 B;  1A75 B;  2LLS A;  4PDZ A;  2LVI A;  4U8D A;  2K7B A;  4YGA A;  4FQO A;  2JNX A;  1L7Z A;  2H61 A;  1J7Q A;  3SG2 A;  2NXQ A;  3BUW B;  1SCM B;  1LXF C;  3BOW A;  3KEV A;  4NDC A;  2KDH A;  3BQ3 A;  1KFU S;  1K8U A;  2E6W A;  2BE4 A;  4Q04 A;  2LHL A;  4YGC B;  3RLZ A;  4GGF A;  1DTL A;  1AJ4 A;  1IQ5 A;  1A03 A;  1IKU A;  2F3Y A;  1R2U A;  2BEC A;  4C0K A;  1C7V A;  4AQJ A;  3OB2 B;  1NSH A;  1XFV O;  1SL7 A;  2KBI A;  3WHT B;  4WQ3 A;  1NP8 A;  1XK4 C;  1DT7 B;  1JWD A;  5DKQ A;  4GGN A;  1OZO A;  1SPY A;  2Q91 A;  2ISD A;  1SKT A;  3JVT C;  1BR1 B;  4N1F A;  1A75 A;  4JWQ A;  2BL0 C;  2HQW A;  3PN7 B;  4QJ3 B;  3ZWH A;  1XA5 A;  1DGV A;  1B8R A;  4L9M A;  1NX3 A;  2KAY A;  2GGZ A;  2L98 A;  1RRO A;  4YI8 A;  1K9K A;  2I2R E;  1K2H A;  1M39 A;  4MZJ A;  1EXR A;  1SCV A;  1CTR A;  2JUL A;  1F54 A;  1XO5 A;  3E3R A;  4PHK A;  4BY5 A;  2K0J A;  5I2Q A;  4E68 A;  1F4O A;  4I5J A;  1L2O B;  1QVI Z;  2MRD A;  3CGA A;  1QIW A;  4JQ0 D;  3TZ1 A;  4DCK A;  3CS1 A;  2LM5 A;  4OKH A;  1PSR A;  1YX7 A;  4YBH B;  2L4H A;  3EK4 A;  1ZUZ A;  1GGZ A;  1LIN A;  1YRU B;  2LLT A;  1DJH A;  1TTX A;  1V1F A;  4DRW A;  4NDD A;  3FWC A;  1B8C A;  2LP2 A;  4AQI A;  2K61 A;  3AKB A;  3SG4 A;  2JXL A;  3NSI A;  4PHJ A;  1LKJ A;  2KYF A;  3ZNI A;  4QJ4 B;  1QXP A;  1WDC B;  4HRH A;  1YR5 A;  1UHN A;  1QS7 A;  1SW8 A;  5CSN A;  1CNP A;  1PVA A;  1Y1A A;  1CFD A;  1S26 D;  1TRF A;  3BUX B;  3WHU B;  3AAJ A;  4C0J A;  3I5H C;  1J1E A;  1YTZ C;  5PAL A;  1CFP A;  2JOJ A;  4GAO A;  1A4P A;  2K7C A;  1KFX L;  4A4B A;  3DF0 A;  2M29 A;  1ZFS A;  1ZOT B;  4N1G A;  1X02 A;  3LL8 B;  2MHH A;  3WNX B;  2KI4 B;  1B9A A;  2Y1N A;  3FIA A;  5KSZ A;  1K96 A;  5HKY A;  3ICB A;  1JF0 A;  2LNK A;  1ZMZ A;  3O6B A;  4MSP A;  1UHJ A;  1CMF A;  1K93 D;  2LVJ A;  1WRZ A;  1DGU A;  1NWD A;  2BCB A;  1ALW A;  2RGI A;  1XYD A;  4ZCU A;  1KQM C;  5AFP A;  2PVB A;  1QTX A;  5AAN A;  1F55 A;  3CR5 X;  3BUM B;  1MQ1 A;  1Y1X A;  3AKA A;  2L5X B;  1N65 A;  3EK7 A;  1QIV A;  5TNC A;  2WCF A;  2JTT A;  2ZRT A;  2Y1M A;  1DJY A;  1OMD A;  1H8B A;  4PHN A;  2PMY A;  1DJI A;  1DVI A;  2QPT A;  3M0W A;  3I5F C;  2KSP A;  1S5G Y;  3KPX A;  4YRU A;  5CSF A;  1SL8 A;  1ALV A;  2I18 A;  3I5G B;  4CPV A;  4GGF C;  2L4I A;  1CDM A;  1IG5 A;  3K21 A;  1CDP A;  1BOC A;  1LA3 A;  1BMO A;  1W7I B;  1SR6 B;  1JSA A;  1NCY A;  2M0R A;  2F8P A;  1AHR A;  5CPV A;  2AMI A;  4NDB A;  2G2B A;  1FPW A;  2M9G A;  2Y4Q A;  4CID A;  3QRX A;  1CDN A;  2LUC A;  1GJY A;  4P5O E;  2F3Z A;  2JTZ A;  1UUR A;  2CNP A;  1B1G A;  1VRK A;  2ZNE A;  1CFC A;  4I5N B;  1BG1 A;  1CLB A;  1QX5 B;  4PHM A;  1JC2 A;  1AJ5 A;  2M7L A;  3BXK A;  1SL9 A;  4MRY A;  1N0Y A;  3DVE A;  4M2O A;  1NCZ A;  1JF2 A;  1TNQ A;  4MEW A;  1JUO A;  3BUN B;  3EKH A;  2FCE A;  5GQQ C;  2ZRS A;  2KFH A;  3RM1 A;  1PK0 D;  1K90 D;  1IJ6 A;  1BU3 A;  1NX0 A;  2K2F A;  2LAN A;  1TOP A;  3VRP A;  4HRG A;  4GFT A;  2EC6 C;  2FOT A;  1OQP A;  1B7T Y;  5CSI A;  2DOQ A;  1J7O A;  2PSR A;  2WND A;  3FS7 A;  1UHI A;  1MHO A;  2KQY A;  2M97 A;  1YX8 A;  4ORC B;  3OX5 A;  3BYA A;  3O78 A;  3CZT X;  4ICB A;  2KI6 D;  2K7D A;  2K8M B;  2AAO A;  1JBA A;  1KWO C;  1OZS A;  3O4Y A;  1QLS A;  4USL A;  2EC6 B;  1M63 B;  1FF1 A;  1KFX S;  5HLO A;  4PE1 A;  2JU0 A;  1IWQ A;  2LLU A;  3GK4 X;  1G8I A;  1N2D A;  2IS9 A;  1XFU O;  2JC2 A;  3JVT B;  2BBM A;  5F6T A;  2FJU B;  2BL0 B;  4MVF A;  2GGM A;  2MAZ A;  4GBA A;  2NCP A;  1MXE A;  2D8N A;  4MLW A;  1EJ3 A;  4AOM A;  4IL1 A;  5K89 A;  2NCO A;  1KWO B;  3LLE A;  1KSO A;  2KBM A;  3NXA A;  4YGE B;  5DKN A;  2VRG A;  1SY9 A;  4JPZ B;  1TN4 A;  1JFK A;  2KNE A;  3GK2 A;  1J7P A;  4QJ5 B;  1SYM A;  4F0Z B;  4PE7 A;  4DIR A;  5D7F A;  1CLM A;  1RK9 A;  2LP3 A;  5CSJ A;  1EG3 A;  1QV0 A;  1M31 A;  1XK4 A;  1XFW O;  3OX6 A;  1KSM A;  1OSA A;  4XJK B;  2OS8 C;  1D1O A;  3SG5 A;  1UP5 A;  1YVH A;  2G9B A;  2BE6 A;  1QX7 A;  1ODB A;  2WC8 A;  1MF8 B;  4MZK A;  1REC A;  3CR4 X;  1TNW A;  2JPT A;  4YGB B;  1KK8 C;  1QAS A;  4ORB B;  4HSZ A;  3OHM B;  1B7T Z;  1YUS A;  1H4B A;  2SAS A;  2Q4U A;  2KGB C;  2B1U A;  3EVR A;  3TS5 C;  1CKK A;  5ER5 A;  2M1K B;  1WRL A;  1WY9 A;  3EK8 A;  3D0Y B;  3I5H B;  4ZCV A;  5HYD A;  3PSR A;  3EKJ A;  3IQQ A;  1G33 A;  2JWW A;  2WCE A;  2KQ6 A;  2ZND A;  3VRQ A;  1YUT A;  3SIA A;  1A29 A;  1OMV A;  1EH2 A;  2BKH B;  2L51 A;  2SCP A;  2BKI B;  3I5I C;  2BCX A;  4XJK A;  2JQ6 A;  1QV1 A;  1KQV A;  2LVK A;  2F2O A;  3CR2 A;  2JT0 A;  1IQ3 A;  1Q80 A;  1EL4 A;  3CTN A;  2LV7 A;  1CM4 A;  5KU1 A;  2H61 C;  1FBV A;  1BT6 A;  1DMO A;  3C1V A;  1J7R A;  1DF0 B;  1OOJ A;  1PAL A;  1SBJ A;  1TCO B;  3CLN A;  4ETO A;  3GOF A;  4D1E A;  5B8I B;  1KQM B;  4MZL A;  2CTN A;  2ZFD A;  5KTY A;  1QLK A;  3SG3 A;  5I2L A;  2JNF A;  1NYA A;  2PAL A;  2F2P A;  3KHE A;  1NIW A;  2KFF A;  1XVJ A;  3JTD C;  2CCM A;  1TNP A;  4DS7 A;  3KO0 A;  5JJG A;  2LC5 A;  2MLE C;  3BUO B;  3I5F B;  3WXA A;  2NLN A;  3TUY C;  2A4J A;  1LVC D;  1PSB A;  3KF9 A;  1RWY A;  3O2P A;  3VRO A;  1QJT A;  1KK7 Y;  2LAP A;  1UWO A;  2KI6 C;  1Y1U A;  1HQV A;  4M2P A;  4MBE A;  1Y6W A;  1SCM C;  2GV5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...