3AKAA

Structural basis for prokaryotic calcium-mediated regulation by a streptomyces coelicolor calcium-binding protein
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
166
structure length
162
Chain Sequence
EYERRIAARFTTFDQDGNGHIDRSDFSGAAKALLAEFGVAARSDRGQALYGGAEALWQGLAGIADRDGDQRITREEFVKRLRDKPDRFAEIARPFLHAALGVADTDGDGAVTVADTARALTAFGVPEDLARQAAAALDTDGDGKVGETEIVPAFARYFTVPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords Putative calcium binding protein
publication title Structural basis for prokaryotic calciummediated regulation by a Streptomyces coelicolor calcium binding protein
pubmed doi rcsb
source organism Streptomyces coelicolor
total genus 62
structure length 162
sequence length 166
ec nomenclature
pdb deposition date 2010-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
A PF13833 EF-hand_8 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3akaA00
2F3YA 1PALA 2HPSA 4PE4A 2EHBA 4XYNA 2JQ6A 1DJGA 1QV1A 2MLFC 4MRYA 1F70A 2FOTA 3SG4A 2M7LA 3NSIA 2JTTA 2JT3A 4M2OA 1Y6WA 2G9BA 1FW4A 2JT0A 4PDZA 3EK8A 1NX1A 1TCOB 1V1GA 3AKBA 1AVSA 3IQQA 1KFXL 4YGCB 2P6BB 4YGBB 1YVHA 5IBWA 1N2DA 3DVEA 5CPVA 5K89A 1MXEA 2K2AA 1UWOA 1OZOA 1ALWA 4N1GA 1F55A 1FI6A 2KGBC 3AAJA 3EKJA 4PHJA 2B1UA 1J55A 2KHNA 1CMGA 2BL0B 3CTNA 2M7NA 1DJYA 1B8CA 2FCEA 1EL4A 2CTNA 1OSAA 1PSRA 2I18A 1L2OC 3O4YA 3CLNA 2FJUB 1YURA 1XFUO 1KK7Z 3O6BA 2K7CA 3SG2A 4U8DA 1J1DA 1NIWA 1WRZA 1K2HA 2KAVA 4PHMA 4CFRA 3JTDC 3I5GC 3ZWHA 1UP5A 2CXJA 1YUSA 1QX7A 3I5FC 4UPGA 2LUXA 1YX8A 3WHUB 2BKIB 2JNFA 1OOJA 2D8NA 2BCAA 4AOMA 1AHRA 3BOWB 1SR6B 3LL8B 3BXKA 1V1FA 2H61A 1MF8B 1A4PA 2L4HA 2LHLA 3KO0A 1M63B 2LUCA 2SASA 3TDUA 1X02A 5KU1A 1AJ4A 2ZFDA 1K96A 1NX2A 4OR9B 1MQ1A 4CLNA 2HQWA 3LCPC 1J1EA 1XA5A 1TNWA 2LAPA 2ZRSA 1A2XA 3PSRA 2M29A 3O2PA 1DTLA 1RK9A 1QLSA 3CR2A 2GV5A 1K90D 1IJ5A 2Y1MA 4YRUA 4GGFC 1B1GA 3NSKA 1DT7B 1CFPA 1NCZA 1YTZC 1B8LA 1QVIY 1EG3A 4WRIA 2V53A 5DKRA 3VRQA 1S3PA 3RLZA 1B8RA 5DKNA 3OX6A 1AP4A 3DVJA 2KQ6A 1L2OB 3GK2A 4JWQA 1KCYA 4ZCUA 3SG6A 1BT6A 1NPQA 1K9UA 2L0PA 1K94A 3DD4A 1XK4C 3BYAA 1CM4A 5KTYA 3K21A 1Q80A 5B8IB 4ORCB 1DJWA 1BODA 2BBNA 5G08A 1A03A 1KWOC 2LLUA 2KNEA 1TCFA 3JTDB 3I5GB 1B9AA 1BF5A 3EVVA 1OQPA 2JPTA 5DKQA 1UUSA 3BUXB 1BU3A 2KI4C 3I5FB 3VRPA 1KFXS 1NCYA 2NLNA 1K93D 2PMYA 2JWWA 1MWNA 4MVFA 4OVNF 3WXAA 1WY9A 3DVKA 1KQMC 3NXAA 4I5NB 1NYAA 3FS7A 1CM1A 2LP3A 3D10A 1F71A 1SYMA 1KFUL 1TN4A 4GBAA 1R6PA 2KOTA 2ZN9A 5FYXA 2M1KB 3D0YB 2NCPA 1CFCA 4FQOA 2K61A 1R2UA 1KK8C 2OTGB 2M0RA 3BOWA 2KI6C 3GK1A 1XFWO 5JJGA 3TS5C 5HKWA 1K95A 3AAKA 1PULA 4GAOA 1W7IB 1OE9B 2BE4A 2M97A 3M0WA 1RECA 1CNPA 1SK6D 1S5GY 1EXRA 4JPZB 4Q04A 1WLMA 2ZKMX 1CFDA 1WRKA 1LA0A 2L98A 3QRXA 3TDIA 4A4CA 1UHIA 1XFYO 2QACA 3VRNA 2M8UA 3OP0A 2PSRA 1OZSA 1EJ3A 1UHKA 2KAYA 3KPXA 1A29A 1NP8A 3NSOA 3ZNIA 1LVCD 1FI5A 1QXPA 2Y4QA 2AUCA 1DJIA 1U5IB 5CSIA 3TDZA 1RROA 1JSAA 2G2BA 4GNKB 1H8BA 3VROA 3IF7A 2BCXA 4CIDA 1YX7A 3PN7B 2E30A 1BOCA 3CWGA 3DF0B 2DOQA 2WOSA 4OKHA 1KSMA 1SMGA 4AQIA 1KWOB 2R2IA 4BY5A 2LE9B 1CMFA 2MAZA 2PVBA 5HKYA 1C07A 3CGAA 2HF5A 2FCDA 1UURA 2BE6A 1B7TY 2KI4B 1G4YR 3GK4X 1QS7A 2JRFA 1Y1XA 3OB2B 1SCMC 1ZMZA 5AXIA 1YVLA 3OB1B 1AJ5A 1KQMB 5I2QA 3C1VA 4ICBA 2ZN8A 1IRJA 1TTXA 5PALA 1KK8B 3OHMB 1KSOA 1CDLA 1S5GZ 1W7JB 1WRLA 1YR5A 1E8AA 4C0KA 3TS5B 1G8IA 3D0YA 2COLB 4YGEB 2JXLA 4PE1A 4MBEA 1A75B 2JT8A 1SW8A 4MEWA 1SCVA 2F2OA 3MSEB 4QJ4B 1XO5A 1TNXA 2LANA 1K8UA 2OTGC 2Q4UA 2BKHB 4YGAA 2WCEA 1ALVA 3BQ3A 1H4BA 1LA3A 2KYCA 4GGFA 1RWYA 4GGNA 5I2LA 1KFUS 2Y5IA 1TIZA 2K7BA 1FPWA 1YRUB 4AQJA 1B7TZ 5TNCA 1PK0D 2MBXA 4BY4A 2JNXA 2KDHA 1AK8A 4MZJA 2WCBA 1NCXA 1U5IA 1C7WA 1XFVO 5AANA 5AEQA 4DUQA 1FF1A 5AERA 4YI9A 1L7ZA 2L51A 1XK4A 1JFJA 2NZ0A 3PALA 4MRXA 3DF0A 2PASA 1Y1AA 2RGIA 1SCMB 2O5GA 1K9KA 3CS1A 4F0ZB 3PN7C 1XVJA 2H2KA 1CLLA 1AUIB 3OX5A 1UHJA 4GPLB 2CCMA 1WDCC 2E6WA 2LM5A 1JFKA 1NWDA 2L50A 1WLZA 3SG3A 2LLTA 4HSZA 4USLA 1OMDA 1DF0A 5I2OA 1IWQA 2KSPA 3FWBA 2WNDA 3GOFA 1CTRA 5HLVA 2KAXA 4YI8A 1NSHA 2LC5A 1MR8A 2L5XB 1RTP1 2LV7A 1C7VA 4C0LA 2KQYA 1TNPA 3I5IC 2F33A 2BCBA 1LXFC 1N0YA 1S36A 1JUOA 3TZ1A 1A75A 2ISDA 2LVVA 2LVKA 3VGOA 2ZRTA 1PRWA 2MJWB 2JC2A 1XFXO 2KYFA 2ZNEA 2LMVA 2AAOA 2QPTA 3EK4A 5JOLA 2I94A 4PALA 3KHEA 3EK7A 2Q91A 5D69A 1QX2A 1NX3A 2LLSA 1MHOA 3CR4X 5ER4X 1S6IA 1YUUA 4JQ0D 1DGVA 1IJ6A 3FIAA 1ZACA 1CLMA 1LINA 1QIWA 1BLQA 3IQOA 4QJ5B 2LVJA 2JXCA 4NDCA 1YRTB 2LNKA 2MA2A 2LHIA 1IG5A 1BG1A 2K2FA 2KFFA 4DS7A 3H4SE 1XFZO 1J7PA 4MSPA 2MHHA 3PM8A 3WHTB 2K0JA 5KSZA 1QLKA 1WDCB 3HCMA 1IQ5A 4XJKA 1SY9A 2F3ZA 2LMUA 4P2YB 4CPVA 4ETOA 4ORAB 2CBLA 2LCPA 4DCKA 3JVTB 2K7OA 5HLOA 4ZCVA 3EVRA 1SL9A 4M2QA 4MN0A 1QIVA 3F45A 1NX0A 1ZUZA 1GQMA 1TOPA 3LLEA 1DVIA 1EH2A 1S6CA 5BPJA 1DF0B 3EVUA 5CSJA 2O60A 4ORBB 3LK1A 1S1EA 1DJHA 2EC6C 1M31A 1RFJA 3I5IB 2OS8C 2CT9A 2PALA 4HRGA 4OCIA 4N5XA 1LKJA 3EKHA 1PSBA 2WORA 1JC2A 3TUYC 3I5HB 2VRGA 2WCFA 3RM1A 1HT9A 3CR5X 3PATA 3VRRA 2KGRA 1KQVA 1BR4B 2WC8A 4IL1A 1M45A 1SKTA 1VRKA 3NSLA 4CFQA 3BUWB 1CB1A 1M39A 2JZIA 2EGDA 2I2RE 2OPOA 3PFVA 2M3WA 1ZFSA 3AKAA 3A4UB 4MZKA 1SNLA 4NDDA 1SL8A 1DMOA 2LMTA 1RJVA 4P5OE 1IQ3A 4D1EA 4R1EA 1QTXA 2IS9A 5CSNA 1CLBA 1M46A 4DRWA 5HYDA 2AMIA 1UHNA 1XYDA 4PE0A 4MZLA 1BMOA 2F8PA 4L9MA 1D1OA 3E3RA 1S26D 2BBMA 3LK0A 4I5JA 2JULA 2GGZA 1YUTA 1B4CA 1J7OA 2F2PA 2JU0A 1SL7A 4PCWA 1PVAA 3BUOB 1QV0A 4HREE 2A4JA 4C0JA 2H61C 1K9PA 1NUBA 3BUMB 2MLEC 1N65A 1GGZA 2SCPA 1B47A 4PHNA 4GUKA 4XJKB 1ODBA 4MLWA 1BR1B 3PLFB 4PE7A 1MUXA 4DIRA 1UHHA 5GQQC 5J3XA 5F6TA 1F8HA 2HQ8A 3SIAA 3BUNB 2PRUA 2EC6B 4FTGA 4YGDB 2KBIA 2OS8B 4I5LB 2M49B 3FWCA 2M1UA 4PHKA 1IH0A 2MRDA 1IKUA 4E68A 1QJTA 3KEVA 3JVTC 3SIBA 3TUYB 2ZNDA 1F4OA 2JTZA 2HETA 4GFTA 4M2PA 1GJYA 2BECA 1GGWA 4NDBA 3KF9A 2Y1NA 4A4BA 1S6JA 5ER5A 1G33A 3SG7A 5AFPA 1J7RA 3O78A 1DJXA 2JOJA 1CDMA 1SRAA 2KFGA 2NXQA 4N1FA 1CFFA 2BL0C 3I5HC 1SPYA 2L4IA 1IGVA 2LVIA 2TN4A 2I7AA 1OMVA 4QJ3B 1CDNA 1JF0A 3HX4A 1ZOTB 1HQVA 3A8RA 1CKKA 2M9GA 1F4QA 5I8NA 1QASA 2K8MB 4HRHA 1JWDA 4WQ2A 1DJZA 1PVBA 2K7DA 1BJFA 1Y0VH 2LP2A 1J7QA 1FBVA 4TNCA 3SJSA 3WNXB 1JBAA 4OV2A 1OMRA 3CZTX 4NQGA 2GGMA 1KK7Y 4YBHB 5HKZA 1JF2A 1MXLC 2NCOA 1Y1UA 1QATA 1EG4A 4I5KA 5D7FA 1F54A 1CDPA 3SG5A 1TRFA 1DGUA 3ICBA 2CNPA 1SR6C 1QX5B 2KFHA 2KBMA 1TNQA 4WQ3A 3DVMA 1QVIZ 2L2EA 5CSFA 2KI6D 1SBJA
chains in the Genus database with same CATH superfamily
2F3YA 1PALA 2JPOA 2HPSA 4PE4A 2EHBA 4XYNA 2JQ6A 1DJGA 1QV1A 2MLFC 4MRYA 1F70A 2FOTA 3SG4A 2M7LA 3NSIA 3D75A 2JTTA 2JT3A 4M2OA 1Y6WA 2G9BA 1FW4A 1OW4A 2JT0A 3BFAA 4PDZA 3EK8A 1NX1A 1TCOB 1V1GA 3AKBA 1AVSA 3OBVA 3IQQA 1KFXL 4YGCB 2P6BB 4YGBB 1YVHA 5IBWA 1N2DA 3DVEA 5CPVA 5K89A 1MXEA 2K2AA 1UWOA 1OZOA 1ALWA 4N1GA 1F55A 1FI6A 2KGBC 3AAJA 3EKJA 4PHJA 2B1UA 1J55A 2KHNA 3NHIA 2BL0B 3B88A 3CTNA 1CMGA 2M7NA 1DJYA 1B8CA 2FCEA 1EL4A 2CTNA 1OSAA 1PSRA 2I18A 2P70A 1L2OC 3O4YA 3FE6A 3CLNA 2FJUB 1YURA 1XFUO 4IJ7A 1KK7Z 3O6BA 2KPHA 2K7CA 3SG2A 3UO9A 4U8DA 1J1DA 1NIWA 1WRZA 1K2HA 2KAVA 4PHMA 4CFRA 3JTDC 3I5GC 3ZWHA 1UP5A 2CXJA 1YUSA 1QX7A 1OOHA 3I5FC 4JKTA 4UPGA 2LUXA 1YX8A 3WHUB 2BKIB 2JNFA 1OOJA 2D8NA 2BCAA 4AOMA 1AHRA 3BOWB 3DYEA 1SR6B 3LL8B 3B6XA 3BXKA 1V1FA 2H61A 2WCJA 1MF8B 1A4PA 2WCMA 2L4HA 2LHLA 3KO0A 1M63B 2LUCA 2SASA 3TDUA 1X02A 5KU1A 1AJ4A 4INXA 3CZ0A 2ZFDA 1K96A 1NX2A 1OOIX 3L47A 4OR9B 1MQ1A 4KYNA 4CLNA 2HQWA 3LCPC 1J1EA 1XA5A 1DQEA 1TNWA 2LAPA 1A2XA 1OOFA 2ZRSA 2M29A 3PSRA 3O2PA 1DTLA 1RK9A 1QLSA 3CR2A 2GV5A 1K90D 1IJ5A 2Y1MA 4YRUA 4GGFC 1B1GA 3NSKA 1DT7B 1CFPA 3RZSA 2KLEA 1NCZA 1YTZC 3SS4A 1B8LA 5I94A 1QVIY 1EG3A 4WRIA 2V53A 5DKRA 2PYQA 3VRQA 1S3PA 3RLZA 1B8RA 5DKNA 3OX6A 1AP4A 3DVJA 2KQ6A 1L2OB 3GK2A 4JWQA 1KCYA 4ZCUA 3SG6A 1BT6A 1NPQA 3R1OA 1K9UA 2L0PA 1K94A 3DD4A 1XK4C 3BYAA 1CM4A 5KTYA 3K21A 1Q80A 5B8IB 4ORCB 1DJWA 1BODA 2BBNA 5G08A 1A03A 1KWOC 2LLUA 3D74A 3DY9A 2KNEA 1TCFA 3JTDB 3I5GB 1B9AA 1BF5A 3EVVA 1OQPA 2JPTA 5DKQA 1UUSA 1TUJA 3BUXB 1BU3A 2KI4C 3I5FB 1QWVA 3VRPA 1KFXS 2QEHA 1NCYA 2NLNA 1K93D 2PMYA 2JWWA 1MWNA 4MVFA 4OVNF 3D77A 3WXAA 1WY9A 1LS8A 3DVKA 1KQMC 3NXAA 4I5NB 1NYAA 3FS7A 1CM1A 2LP3A 3D10A 1F71A 1SYMA 1KFUL 1TN4A 4GBAA 1R6PA 2KOTA 2ZN9A 5FYXA 2M1KB 3D0YB 2NCPA 3VB1A 2P71A 1CFCA 4FQOA 2K61A 1R2UA 1KK8C 2OTGB 2M0RA 3BOWA 2KI6C 3GK1A 1XFWO 5JJGA 3TS5C 5HKWA 1K95A 3AAKA 1PULA 4GAOA 1W7IB 1OE9B 2BE4A 2M97A 3M0WA 1RECA 1CNPA 1SK6D 3K1EA 2WC5A 1S5GY 2YGUA 1DC1A 1EXRA 4JPZB 4Q04A 1WLMA 2ZKMX 1CFDA 1WRKA 1C3ZA 1LA0A 5EL2A 2L98A 3QRXA 3TDIA 4A4CA 1UHIA 1XFYO 2QACA 3VRNA 2M8UA 3OP0A 2PSRA 1OZSA 1EJ3A 1UHKA 2KAYA 3KPXA 1A29A 1NP8A 3NSOA 3ZNIA 1LVCD 1FI5A 1QXPA 2Y4QA 2AUCA 1DJIA 1U5IB 5CSIA 3TDZA 1RROA 2QEOA 1JSAA 2G2BA 4GNKB 3V2LA 5HL1A 1H8BA 4JD9A 2QEVA 3VROA 3IF7A 2BCXA 4CIDA 1YX7A 3PN7B 2E30A 1BOCA 3CWGA 3DF0B 2DOQA 2WOSA 4OKHA 1KSMA 1SMGA 4AQIA 1KWOB 2R2IA 4BY5A 3N7HA 2LE9B 3CDNA 2MAZA 2PVBA 3L4LA 5HKYA 1DELA 1C07A 3CGAA 1CMFA 2HF5A 2FCDA 1UURA 2BE6A 1B7TY 2KI4B 1G4YR 3GK4X 1QS7A 2JRFA 1Y1XA 3OB2B 1SCMC 1ZMZA 5AXIA 1YVLA 3OB1B 1AJ5A 1KQMB 5I2QA 3C1VA 3BFHA 4PT1A 4ICBA 2ZN8A 1IRJA 1TTXA 5PALA 1KK8B 2WCKA 3OHMB 4INWA 1KSOA 1CDLA 1S5GZ 1W7JB 1WRLA 1YR5A 1E8AA 4C0KA 3TS5B 1G8IA 3R1PA 3D0YA 3PJIA 2COLB 4YGEB 2JXLA 4PE1A 4MBEA 1GM0A 1A75B 2JT8A 2BNXA 1SW8A 4MEWA 3S0GA 1SCVA 2F2OA 3MSEB 4QJ4B 1XO5A 1TNXA 2LANA 3D73A 1K8UA 2OTGC 2Q4UA 2BKHB 4YGAA 3B86A 2WCEA 1XFRA 1ALVA 2L5YA 3BQ3A 1H4BA 1LA3A 2KYCA 4GGFA 1RWYA 4GGNA 5I2LA 1KFUS 2Y5IA 1TIZA 2K7BA 1FPWA 1YRUB 4AQJA 1B7TZ 5TNCA 1PK0D 2MBXA 4BY4A 2JNXA 2KDHA 1AK8A 4MZJA 2WCBA 1NCXA 1U5IA 1C7WA 1XFVO 5AANA 5AEQA 4DUQA 1FF1A 3BFBA 5AERA 4YI9A 1L7ZA 3OGNA 2L51A 1XK4A 1JFJA 2NZ0A 3PALA 4MRXA 3DF0A 2PASA 1Y1AA 2RGIA 1SCMB 2O5GA 3NGVA 3UNWA 1K9KA 3CS1A 4F0ZB 5D3OA 2QDIA 3PN7C 1XVJA 2H2KA 1CLLA 1AUIB 3OX5A 1UHJA 4GPLB 5FI7A 2CCMA 1TWOA 1WDCC 2E6WA 2LM5A 1JFKA 1NWDA 2L50A 3R72A 1WLZA 2BAPA 3CZ2A 1T14A 2LLTA 4HSZA 4USLA 1OMDA 1DF0A 3SG3A 1IWQA 5I2OA 3S0AA 2KSPA 3FWBA 2WNDA 3S0DA 3D78A 3GOFA 1CTRA 5HLVA 2KAXA 4YI8A 1NSHA 2LC5A 1MR8A 2L5XB 1RTP1 2LV7A 1C7VA 4C0LA 2KQYA 1TNPA 3I5IC 2F33A 2BCBA 1LXFC 1N0YA 1C3YA 1S36A 1JUOA 3TZ1A 1A75A 2ISDA 2LVVA 1ORGA 2LVKA 3CZ1A 3SS5A 3VGOA 2ZRTA 1PRWA 2MJWB 2JC2A 1XFXO 2KYFA 2ZNEA 2LMVA 2AAOA 2QPTA 3EK4A 5JOLA 2I94A 4PALA 3KHEA 2FJYA 3EK7A 2Q91A 5D69A 1DEKA 3L4AA 1QX2A 1NX3A 2LLSA 1MHOA 3B87A 3CR4X 5ER4X 1S6IA 1YUUA 4JQ0D 4F7FA 1DGVA 1IJ6A 3FIAA 1ZACA 2WCHA 1CLMA 1LINA 1QIWA 1BLQA 3IQOA 4QJ5B 2LVJA 2JXCA 4NDCA 1YRTB 2LNKA 2MA2A 2LHIA 1IG5A 1BG1A 2K2FA 2KFFA 4DS7A 3H4SE 3CABA 1XFZO 1J7PA 4MSPA 2MHHA 2PQLA 3PM8A 3WHTB 2K0JA 5KSZA 1QLKA 1WDCB 3HCMA 1IQ5A 4XJKA 1SY9A 2F3ZA 2LMUA 4P2YB 4CPVA 4ETOA 4ORAB 2CBLA 2LCPA 4DCKA 3JVTB 2K7OA 1TUZA 5HLOA 4ZCVA 3EVRA 1SL9A 2H8VA 4M2QA 4MN0A 1QIVA 3F45A 1NX0A 1ZUZA 1GQMA 1TOPA 3LLEA 1DVIA 1Z4HA 1EH2A 1S6CA 5BPJA 1DF0B 3EVUA 3FE9A 2O60A 5CSJA 4ORBB 3LK1A 1S1EA 1DJHA 2EC6C 1M31A 1RFJA 3I5IB 2OS8C 2CT9A 2PALA 4HRGA 4OCIA 4N5XA 1LKJA 3EKHA 1PSBA 2WORA 1JC2A 3TUYC 3I5HB 2VRGA 2WCFA 3RM1A 3S0EA 1HT9A 3R1VA 2WCLA 3CR5X 3PATA 2KGRA 3VRRA 1KQVA 1BR4B 2WC8A 2GTEA 1M45A 1SKTA 1VRKA 3EG5B 3NSLA 4IL1A 3BUWB 3DZTA 4CFQA 1CB1A 1M39A 2JZIA 2EGDA 2I2RE 3NHTA 2OPOA 3PFVA 5FI6A 2M3WA 1ZFSA 3AKAA 3A4UB 4MZKA 1SNLA 4NDDA 1SL8A 1DMOA 2LMTA 1RJVA 3B7AA 4P5OE 1IQ3A 4D1EA 4R1EA 1QTXA 2IS9A 5CSNA 1CLBA 1M46A 4DRWA 5HYDA 2AMIA 1UHNA 1XYDA 4PE0A 4MZLA 1BMOA 2F8PA 4L9MA 1D1OA 3E3RA 1S26D 2BBMA 3D76A 3LK0A 4I5JA 2ERBA 2GGZA 2JULA 1SSEB 1YUTA 1B4CA 1J7OA 2F2PA 5DICA 2JU0A 1SL7A 2QEBA 4PCWA 5FI2A 1PVAA 3BUOB 1QV0A 4HREE 2A4JA 4C0JA 2H61C 1K9PA 1NUBA 2K60A 3PM2A 3BUMB 2MLEC 1N65A 1GGZA 2SCPA 1B47A 4PHNA 1IIOA 4GUKA 4XJKB 1ODBA 4MLWA 1BR1B 3PLFB 4PE7A 1MUXA 4DIRA 1UHHA 3CYZA 5GQQC 5J3XA 5F6TA 1F8HA 2HQ8A 3SIAA 3BUNB 3SS3A 2PRUA 2EC6B 4FTGA 4YGDB 2KBIA 2OS8B 4I5LB 2M49B 3FWCA 2M1UA 4PHKA 1IH0A 2MRDA 1IKUA 4E68A 1QJTA 3KEVA 3JVTC 3SIBA 3TUYB 2ZNDA 1W9ZA 1F4OA 2JTZA 2HETA 2KLDA 4GFTA 4M2PA 1GJYA 2BECA 1GGWA 4NDBA 3KF9A 2Y1NA 4A4BA 1S6JA 5ER5A 1G33A 3SG7A 5AFPA 1J7RA 3O78A 3S0BA 3DXLA 3FE8A 1DJXA 2JOJA 3O4XA 1CDMA 1SRAA 2KFGA 2NXQA 4N1FA 1CFFA 2BL0C 3I5HC 1SPYA 4FQTA 1Z2CB 2L4IA 1IGVA 2LVIA 3BJHA 2TN4A 2I7AA 1OMVA 4QJ3B 1CDNA 1JF0A 3HX4A 1OOGA 1HQVA 1ZOTB 2WC6A 3A8RA 1CKKA 2M9GA 1F4QA 5I8NA 1QASA 2K8MB 4HRHA 1JWDA 2L2CA 4WQ2A 1DJZA 1PVBA 2K7DA 1BJFA 1Y0VH 2LP2A 1J7QA 1FBVA 4TNCA 3SJSA 3WNXB 1JBAA 4OV2A 1OMRA 4OZDA 3CZTX 4NQGA 2GGMA 1KK7Y 1P28A 4YBHB 5HKZA 1JF2A 1MXLC 2NCOA 1Y1UA 1QATA 1EG4A 4I5KA 5D7FA 1F54A 1CDPA 3S0FA 3SG5A 1TRFA 1DGUA 3ICBA 2CNPA 1SR6C 1QX5B 2KFHA 3QMEA 2KBMA 1TNQA 4WQ3A 3DVMA 3IVTA 3Q8IA 1QVIZ 2L2EA 5CSFA 2KI6D 1SBJA
chains in the Genus database with same CATH topology
2F3YA 1PALA 2HPSA 4PE4A 2EHBA 4XYNA 2JQ6A 1DJGA 1QV1A 2MLFC 4MRYA 1F70A 2FOTA 3SG4A 2M7LA 3NSIA 2JTTA 2JT3A 4M2OA 1Y6WA 2G9BA 1FW4A 2JT0A 4PDZA 3EK8A 1NX1A 1TCOB 1V1GA 3AKBA 1AVSA 3IQQA 1KFXL 4YGCB 2P6BB 4YGBB 1YVHA 5IBWA 1N2DA 3DVEA 5CPVA 5K89A 1MXEA 2K2AA 1UWOA 1OZOA 1ALWA 4N1GA 1F55A 1FI6A 2KGBC 3AAJA 3EKJA 4PHJA 2B1UA 1J55A 2KHNA 1CMGA 2BL0B 3CTNA 2M7NA 1DJYA 1B8CA 2FCEA 1EL4A 2CTNA 1OSAA 1PSRA 2I18A 1L2OC 3O4YA 3CLNA 2FJUB 1YURA 1XFUO 1KK7Z 3O6BA 2K7CA 3SG2A 4U8DA 1J1DA 1NIWA 1WRZA 1K2HA 2KAVA 4PHMA 4CFRA 3JTDC 3I5GC 3ZWHA 1UP5A 2CXJA 1YUSA 1QX7A 3I5FC 4UPGA 2LUXA 1YX8A 3WHUB 2BKIB 2JNFA 1OOJA 2D8NA 2BCAA 4AOMA 1AHRA 3BOWB 1SR6B 3LL8B 3BXKA 1V1FA 2H61A 1MF8B 1A4PA 2L4HA 2LHLA 3KO0A 1M63B 2LUCA 2SASA 3TDUA 1X02A 5KU1A 1AJ4A 2ZFDA 1K96A 1NX2A 4OR9B 1MQ1A 4CLNA 2HQWA 3LCPC 1J1EA 1XA5A 1TNWA 2LAPA 2ZRSA 1A2XA 3PSRA 2M29A 3O2PA 1DTLA 1RK9A 1QLSA 3CR2A 2GV5A 1K90D 1IJ5A 2Y1MA 4YRUA 4GGFC 1B1GA 3NSKA 1DT7B 1CFPA 1NCZA 1YTZC 1B8LA 1QVIY 1EG3A 4WRIA 2V53A 5DKRA 3VRQA 1S3PA 3RLZA 1B8RA 5DKNA 3OX6A 1AP4A 3DVJA 2KQ6A 1L2OB 3GK2A 4JWQA 1KCYA 4ZCUA 3SG6A 1BT6A 1NPQA 1K9UA 2L0PA 1K94A 3DD4A 1XK4C 3BYAA 1CM4A 5KTYA 3K21A 1Q80A 5B8IB 4ORCB 1DJWA 1BODA 2BBNA 5G08A 1A03A 1KWOC 2LLUA 2KNEA 1TCFA 3JTDB 3I5GB 1B9AA 1BF5A 3EVVA 1OQPA 2JPTA 5DKQA 1UUSA 3BUXB 1BU3A 2KI4C 3I5FB 3VRPA 1KFXS 1NCYA 2NLNA 1K93D 2PMYA 2JWWA 1MWNA 4MVFA 4OVNF 3WXAA 1WY9A 3DVKA 1KQMC 3NXAA 4I5NB 1NYAA 3FS7A 1CM1A 2LP3A 3D10A 1F71A 1SYMA 1KFUL 1TN4A 4GBAA 1R6PA 2KOTA 2ZN9A 5FYXA 2M1KB 3D0YB 2NCPA 1CFCA 4FQOA 2K61A 1R2UA 1KK8C 2OTGB 2M0RA 3BOWA 2KI6C 3GK1A 1XFWO 5JJGA 3TS5C 5HKWA 1K95A 3AAKA 1PULA 4GAOA 1W7IB 1OE9B 2BE4A 2M97A 3M0WA 1RECA 1CNPA 1SK6D 1S5GY 1EXRA 4JPZB 4Q04A 1WLMA 2ZKMX 1CFDA 1WRKA 1LA0A 2L98A 3QRXA 3TDIA 4A4CA 1UHIA 1XFYO 2QACA 3VRNA 2M8UA 3OP0A 2PSRA 1OZSA 1EJ3A 1UHKA 2KAYA 3KPXA 1A29A 1NP8A 3NSOA 3ZNIA 1LVCD 1FI5A 1QXPA 2Y4QA 2AUCA 1DJIA 1U5IB 5CSIA 3TDZA 1RROA 1JSAA 2G2BA 4GNKB 1H8BA 3VROA 3IF7A 2BCXA 4CIDA 1YX7A 3PN7B 2E30A 1BOCA 3CWGA 3DF0B 2DOQA 2WOSA 4OKHA 1KSMA 1SMGA 4AQIA 1KWOB 2R2IA 4BY5A 2LE9B 1CMFA 2MAZA 2PVBA 5HKYA 1C07A 3CGAA 2HF5A 2FCDA 1UURA 2BE6A 1B7TY 2KI4B 1G4YR 3GK4X 1QS7A 2JRFA 1Y1XA 3OB2B 1SCMC 1ZMZA 5AXIA 1YVLA 3OB1B 1AJ5A 1KQMB 5I2QA 3C1VA 4ICBA 2ZN8A 1IRJA 1TTXA 5PALA 1KK8B 3OHMB 1KSOA 1CDLA 1S5GZ 1W7JB 1WRLA 1YR5A 1E8AA 4C0KA 3TS5B 1G8IA 3D0YA 2COLB 4YGEB 2JXLA 4PE1A 4MBEA 1A75B 2JT8A 1SW8A 4MEWA 1SCVA 2F2OA 3MSEB 4QJ4B 1XO5A 1TNXA 2LANA 1K8UA 2OTGC 2Q4UA 2BKHB 4YGAA 2WCEA 1ALVA 3BQ3A 1H4BA 1LA3A 2KYCA 4GGFA 1RWYA 4GGNA 5I2LA 1KFUS 2Y5IA 1TIZA 2K7BA 1FPWA 1YRUB 4AQJA 1B7TZ 5TNCA 1PK0D 2MBXA 4BY4A 2JNXA 2KDHA 1AK8A 4MZJA 2WCBA 1NCXA 1U5IA 1C7WA 1XFVO 5AANA 5AEQA 4DUQA 1FF1A 5AERA 4YI9A 1L7ZA 2L51A 1XK4A 1JFJA 2NZ0A 3PALA 4MRXA 3DF0A 2PASA 1Y1AA 2RGIA 1SCMB 2O5GA 1K9KA 3CS1A 4F0ZB 3PN7C 1XVJA 2H2KA 1CLLA 1AUIB 3OX5A 1UHJA 4GPLB 2CCMA 1WDCC 2E6WA 2LM5A 1JFKA 1NWDA 2L50A 1WLZA 3SG3A 2LLTA 4HSZA 4USLA 1OMDA 1DF0A 5I2OA 1IWQA 2KSPA 3FWBA 2WNDA 3GOFA 1CTRA 5HLVA 2KAXA 4YI8A 1NSHA 2LC5A 1MR8A 2L5XB 1RTP1 2LV7A 1C7VA 4C0LA 2KQYA 1TNPA 3I5IC 2F33A 2BCBA 1LXFC 1N0YA 1S36A 1JUOA 3TZ1A 1A75A 2ISDA 2LVVA 2LVKA 3VGOA 2ZRTA 1PRWA 2MJWB 2JC2A 1XFXO 2KYFA 2ZNEA 2LMVA 2AAOA 2QPTA 3EK4A 5JOLA 2I94A 4PALA 3KHEA 3EK7A 2Q91A 5D69A 1QX2A 1NX3A 2LLSA 1MHOA 3CR4X 5ER4X 1S6IA 1YUUA 4JQ0D 1DGVA 1IJ6A 3FIAA 1ZACA 1CLMA 1LINA 1QIWA 1BLQA 3IQOA 4QJ5B 2LVJA 2JXCA 4NDCA 1YRTB 2LNKA 2MA2A 2LHIA 1IG5A 1BG1A 2K2FA 2KFFA 4DS7A 3H4SE 1XFZO 1J7PA 4MSPA 2MHHA 3PM8A 3WHTB 2K0JA 5KSZA 1QLKA 1WDCB 3HCMA 1IQ5A 4XJKA 1SY9A 2F3ZA 2LMUA 4P2YB 4CPVA 4ETOA 4ORAB 2CBLA 2LCPA 4DCKA 3JVTB 2K7OA 5HLOA 4ZCVA 3EVRA 1SL9A 4M2QA 4MN0A 1QIVA 3F45A 1NX0A 1ZUZA 1GQMA 1TOPA 3LLEA 1DVIA 1EH2A 1S6CA 5BPJA 1DF0B 3EVUA 5CSJA 2O60A 4ORBB 3LK1A 1S1EA 1DJHA 2EC6C 1M31A 1RFJA 3I5IB 2OS8C 2CT9A 2PALA 4HRGA 4OCIA 4N5XA 1LKJA 3EKHA 1PSBA 2WORA 1JC2A 3TUYC 3I5HB 2VRGA 2WCFA 3RM1A 1HT9A 3CR5X 3PATA 3VRRA 2KGRA 1KQVA 1BR4B 2WC8A 4IL1A 1M45A 1SKTA 1VRKA 3NSLA 4CFQA 3BUWB 1CB1A 1M39A 2JZIA 2EGDA 2I2RE 2OPOA 3PFVA 2M3WA 1ZFSA 3AKAA 3A4UB 4MZKA 1SNLA 4NDDA 1SL8A 1DMOA 2LMTA 1RJVA 4P5OE 1IQ3A 4D1EA 4R1EA 1QTXA 2IS9A 5CSNA 1CLBA 1M46A 4DRWA 5HYDA 2AMIA 1UHNA 1XYDA 4PE0A 4MZLA 1BMOA 2F8PA 4L9MA 1D1OA 3E3RA 1S26D 2BBMA 3LK0A 4I5JA 2JULA 2GGZA 1YUTA 1B4CA 1J7OA 2F2PA 2JU0A 1SL7A 4PCWA 1PVAA 3BUOB 1QV0A 4HREE 2A4JA 4C0JA 2H61C 1K9PA 1NUBA 3BUMB 2MLEC 1N65A 1GGZA 2SCPA 1B47A 4PHNA 4GUKA 4XJKB 1ODBA 4MLWA 1BR1B 3PLFB 4PE7A 1MUXA 4DIRA 1UHHA 5GQQC 5J3XA 5F6TA 1F8HA 2HQ8A 3SIAA 3BUNB 2PRUA 2EC6B 4FTGA 4YGDB 2KBIA 2OS8B 4I5LB 2M49B 3FWCA 2M1UA 4PHKA 1IH0A 2MRDA 1IKUA 4E68A 1QJTA 3KEVA 3JVTC 3SIBA 3TUYB 2ZNDA 1F4OA 2JTZA 2HETA 4GFTA 4M2PA 1GJYA 2BECA 1GGWA 4NDBA 3KF9A 2Y1NA 4A4BA 1S6JA 5ER5A 1G33A 3SG7A 5AFPA 1J7RA 3O78A 1DJXA 2JOJA 1CDMA 1SRAA 2KFGA 2NXQA 4N1FA 1CFFA 2BL0C 3I5HC 1SPYA 2L4IA 1IGVA 2LVIA 2TN4A 2I7AA 1OMVA 4QJ3B 1CDNA 1JF0A 3HX4A 1ZOTB 1HQVA 3A8RA 1CKKA 2M9GA 1F4QA 5I8NA 1QASA 2K8MB 4HRHA 1JWDA 4WQ2A 1DJZA 1PVBA 2K7DA 1BJFA 1Y0VH 2LP2A 1J7QA 1FBVA 4TNCA 3SJSA 3WNXB 1JBAA 4OV2A 1OMRA 3CZTX 4NQGA 2GGMA 1KK7Y 4YBHB 5HKZA 1JF2A 1MXLC 2NCOA 1Y1UA 1QATA 1EG4A 4I5KA 5D7FA 1F54A 1CDPA 3SG5A 1TRFA 1DGUA 3ICBA 2CNPA 1SR6C 1QX5B 2KFHA 2KBMA 1TNQA 4WQ3A 3DVMA 1QVIZ 2L2EA 5CSFA 2KI6D 1SBJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2F3Y A;  1PAL A;  2HPS A;  4PE4 A;  2EHB A;  4XYN A;  2JQ6 A;  1DJG A;  1QV1 A;  2MLF C;  4MRY A;  1F70 A;  2FOT A;  3SG4 A;  2M7L A;  3NSI A;  2JTT A;  2JT3 A;  4M2O A;  1Y6W A;  2G9B A;  1FW4 A;  2JT0 A;  4PDZ A;  3EK8 A;  1NX1 A;  1TCO B;  1V1G A;  3AKB A;  1AVS A;  3IQQ A;  1KFX L;  4YGC B;  2P6B B;  4YGB B;  1YVH A;  5IBW A;  1N2D A;  3DVE A;  5CPV A;  5K89 A;  1MXE A;  2K2A A;  1UWO A;  1OZO A;  1ALW A;  4N1G A;  1F55 A;  1FI6 A;  2KGB C;  3AAJ A;  3EKJ A;  4PHJ A;  2B1U A;  1J55 A;  2KHN A;  1CMG A;  2BL0 B;  3CTN A;  2M7N A;  1DJY A;  1B8C A;  2FCE A;  1EL4 A;  2CTN A;  1OSA A;  1PSR A;  2I18 A;  1L2O C;  3O4Y A;  3CLN A;  2FJU B;  1YUR A;  1XFU O;  1KK7 Z;  3O6B A;  2K7C A;  3SG2 A;  4U8D A;  1J1D A;  1NIW A;  1WRZ A;  1K2H A;  2KAV A;  4PHM A;  4CFR A;  3JTD C;  3I5G C;  3ZWH A;  1UP5 A;  2CXJ A;  1YUS A;  1QX7 A;  3I5F C;  4UPG A;  2LUX A;  1YX8 A;  3WHU B;  2BKI B;  2JNF A;  1OOJ A;  2D8N A;  2BCA A;  4AOM A;  1AHR A;  3BOW B;  1SR6 B;  3LL8 B;  3BXK A;  1V1F A;  2H61 A;  1MF8 B;  1A4P A;  2L4H A;  2LHL A;  3KO0 A;  1M63 B;  2LUC A;  2SAS A;  3TDU A;  1X02 A;  5KU1 A;  1AJ4 A;  2ZFD A;  1K96 A;  1NX2 A;  4OR9 B;  1MQ1 A;  4CLN A;  2HQW A;  3LCP C;  1J1E A;  1XA5 A;  1TNW A;  2LAP A;  2ZRS A;  1A2X A;  3PSR A;  2M29 A;  3O2P A;  1DTL A;  1RK9 A;  1QLS A;  3CR2 A;  2GV5 A;  1K90 D;  1IJ5 A;  2Y1M A;  4YRU A;  4GGF C;  1B1G A;  3NSK A;  1DT7 B;  1CFP A;  1NCZ A;  1YTZ C;  1B8L A;  1QVI Y;  1EG3 A;  4WRI A;  2V53 A;  5DKR A;  3VRQ A;  1S3P A;  3RLZ A;  1B8R A;  5DKN A;  3OX6 A;  1AP4 A;  3DVJ A;  2KQ6 A;  1L2O B;  3GK2 A;  4JWQ A;  1KCY A;  4ZCU A;  3SG6 A;  1BT6 A;  1NPQ A;  1K9U A;  2L0P A;  1K94 A;  3DD4 A;  1XK4 C;  3BYA A;  1CM4 A;  5KTY A;  3K21 A;  1Q80 A;  5B8I B;  4ORC B;  1DJW A;  1BOD A;  2BBN A;  5G08 A;  1A03 A;  1KWO C;  2LLU A;  2KNE A;  1TCF A;  3JTD B;  3I5G B;  1B9A A;  1BF5 A;  3EVV A;  1OQP A;  2JPT A;  5DKQ A;  1UUS A;  3BUX B;  1BU3 A;  2KI4 C;  3I5F B;  3VRP A;  1KFX S;  1NCY A;  2NLN A;  1K93 D;  2PMY A;  2JWW A;  1MWN A;  4MVF A;  4OVN F;  3WXA A;  1WY9 A;  3DVK A;  1KQM C;  3NXA A;  4I5N B;  1NYA A;  3FS7 A;  1CM1 A;  2LP3 A;  3D10 A;  1F71 A;  1SYM A;  1KFU L;  1TN4 A;  4GBA A;  1R6P A;  2KOT A;  2ZN9 A;  5FYX A;  2M1K B;  3D0Y B;  2NCP A;  1CFC A;  4FQO A;  2K61 A;  1R2U A;  1KK8 C;  2OTG B;  2M0R A;  3BOW A;  2KI6 C;  3GK1 A;  1XFW O;  5JJG A;  3TS5 C;  5HKW A;  1K95 A;  3AAK A;  1PUL A;  4GAO A;  1W7I B;  1OE9 B;  2BE4 A;  2M97 A;  3M0W A;  1REC A;  1CNP A;  1SK6 D;  1S5G Y;  1EXR A;  4JPZ B;  4Q04 A;  1WLM A;  2ZKM X;  1CFD A;  1WRK A;  1LA0 A;  2L98 A;  3QRX A;  3TDI A;  4A4C A;  1UHI A;  1XFY O;  2QAC A;  3VRN A;  2M8U A;  3OP0 A;  2PSR A;  1OZS A;  1EJ3 A;  1UHK A;  2KAY A;  3KPX A;  1A29 A;  1NP8 A;  3NSO A;  3ZNI A;  1LVC D;  1FI5 A;  1QXP A;  2Y4Q A;  2AUC A;  1DJI A;  1U5I B;  5CSI A;  3TDZ A;  1RRO A;  1JSA A;  2G2B A;  4GNK B;  1H8B A;  3VRO A;  3IF7 A;  2BCX A;  4CID A;  1YX7 A;  3PN7 B;  2E30 A;  1BOC A;  3CWG A;  3DF0 B;  2DOQ A;  2WOS A;  4OKH A;  1KSM A;  1SMG A;  4AQI A;  1KWO B;  2R2I A;  4BY5 A;  2LE9 B;  1CMF A;  2MAZ A;  2PVB A;  5HKY A;  1C07 A;  3CGA A;  2HF5 A;  2FCD A;  1UUR A;  2BE6 A;  1B7T Y;  2KI4 B;  1G4Y R;  3GK4 X;  1QS7 A;  2JRF A;  1Y1X A;  3OB2 B;  1SCM C;  1ZMZ A;  5AXI A;  1YVL A;  3OB1 B;  1AJ5 A;  1KQM B;  5I2Q A;  3C1V A;  4ICB A;  2ZN8 A;  1IRJ A;  1TTX A;  5PAL A;  1KK8 B;  3OHM B;  1KSO A;  1CDL A;  1S5G Z;  1W7J B;  1WRL A;  1YR5 A;  1E8A A;  4C0K A;  3TS5 B;  1G8I A;  3D0Y A;  2COL B;  4YGE B;  2JXL A;  4PE1 A;  4MBE A;  1A75 B;  2JT8 A;  1SW8 A;  4MEW A;  1SCV A;  2F2O A;  3MSE B;  4QJ4 B;  1XO5 A;  1TNX A;  2LAN A;  1K8U A;  2OTG C;  2Q4U A;  2BKH B;  4YGA A;  2WCE A;  1ALV A;  3BQ3 A;  1H4B A;  1LA3 A;  2KYC A;  4GGF A;  1RWY A;  4GGN A;  5I2L A;  1KFU S;  2Y5I A;  1TIZ A;  2K7B A;  1FPW A;  1YRU B;  4AQJ A;  1B7T Z;  5TNC A;  1PK0 D;  2MBX A;  4BY4 A;  2JNX A;  2KDH A;  1AK8 A;  4MZJ A;  2WCB A;  1NCX A;  1U5I A;  1C7W A;  1XFV O;  5AAN A;  5AEQ A;  4DUQ A;  1FF1 A;  5AER A;  4YI9 A;  1L7Z A;  2L51 A;  1XK4 A;  1JFJ A;  2NZ0 A;  3PAL A;  4MRX A;  3DF0 A;  2PAS A;  1Y1A A;  2RGI A;  1SCM B;  2O5G A;  1K9K A;  3CS1 A;  4F0Z B;  3PN7 C;  1XVJ A;  2H2K A;  1CLL A;  1AUI B;  3OX5 A;  1UHJ A;  4GPL B;  2CCM A;  1WDC C;  2E6W A;  2LM5 A;  1JFK A;  1NWD A;  2L50 A;  1WLZ A;  3SG3 A;  2LLT A;  4HSZ A;  4USL A;  1OMD A;  1DF0 A;  5I2O A;  1IWQ A;  2KSP A;  3FWB A;  2WND A;  3GOF A;  1CTR A;  5HLV A;  2KAX A;  4YI8 A;  1NSH A;  2LC5 A;  1MR8 A;  2L5X B;  1RTP 1;  2LV7 A;  1C7V A;  4C0L A;  2KQY A;  1TNP A;  3I5I C;  2F33 A;  2BCB A;  1LXF C;  1N0Y A;  1S36 A;  1JUO A;  3TZ1 A;  1A75 A;  2ISD A;  2LVV A;  2LVK A;  3VGO A;  2ZRT A;  1PRW A;  2MJW B;  2JC2 A;  1XFX O;  2KYF A;  2ZNE A;  2LMV A;  2AAO A;  2QPT A;  3EK4 A;  5JOL A;  2I94 A;  4PAL A;  3KHE A;  3EK7 A;  2Q91 A;  5D69 A;  1QX2 A;  1NX3 A;  2LLS A;  1MHO A;  3CR4 X;  5ER4 X;  1S6I A;  1YUU A;  4JQ0 D;  1DGV A;  1IJ6 A;  3FIA A;  1ZAC A;  1CLM A;  1LIN A;  1QIW A;  1BLQ A;  3IQO A;  4QJ5 B;  2LVJ A;  2JXC A;  4NDC A;  1YRT B;  2LNK A;  2MA2 A;  2LHI A;  1IG5 A;  1BG1 A;  2K2F A;  2KFF A;  4DS7 A;  3H4S E;  1XFZ O;  1J7P A;  4MSP A;  2MHH A;  3PM8 A;  3WHT B;  2K0J A;  5KSZ A;  1QLK A;  1WDC B;  3HCM A;  1IQ5 A;  4XJK A;  1SY9 A;  2F3Z A;  2LMU A;  4P2Y B;  4CPV A;  4ETO A;  4ORA B;  2CBL A;  2LCP A;  4DCK A;  3JVT B;  2K7O A;  5HLO A;  4ZCV A;  3EVR A;  1SL9 A;  4M2Q A;  4MN0 A;  1QIV A;  3F45 A;  1NX0 A;  1ZUZ A;  1GQM A;  1TOP A;  3LLE A;  1DVI A;  1EH2 A;  1S6C A;  5BPJ A;  1DF0 B;  3EVU A;  5CSJ A;  2O60 A;  4ORB B;  3LK1 A;  1S1E A;  1DJH A;  2EC6 C;  1M31 A;  1RFJ A;  3I5I B;  2OS8 C;  2CT9 A;  2PAL A;  4HRG A;  4OCI A;  4N5X A;  1LKJ A;  3EKH A;  1PSB A;  2WOR A;  1JC2 A;  3TUY C;  3I5H B;  2VRG A;  2WCF A;  3RM1 A;  1HT9 A;  3CR5 X;  3PAT A;  3VRR A;  2KGR A;  1KQV A;  1BR4 B;  2WC8 A;  4IL1 A;  1M45 A;  1SKT A;  1VRK A;  3NSL A;  4CFQ A;  3BUW B;  1CB1 A;  1M39 A;  2JZI A;  2EGD A;  2I2R E;  2OPO A;  3PFV A;  2M3W A;  1ZFS A;  3AKA A;  3A4U B;  4MZK A;  1SNL A;  4NDD A;  1SL8 A;  1DMO A;  2LMT A;  1RJV A;  4P5O E;  1IQ3 A;  4D1E A;  4R1E A;  1QTX A;  2IS9 A;  5CSN A;  1CLB A;  1M46 A;  4DRW A;  5HYD A;  2AMI A;  1UHN A;  1XYD A;  4PE0 A;  4MZL A;  1BMO A;  2F8P A;  4L9M A;  1D1O A;  3E3R A;  1S26 D;  2BBM A;  3LK0 A;  4I5J A;  2JUL A;  2GGZ A;  1YUT A;  1B4C A;  1J7O A;  2F2P A;  2JU0 A;  1SL7 A;  4PCW A;  1PVA A;  3BUO B;  1QV0 A;  4HRE E;  2A4J A;  4C0J A;  2H61 C;  1K9P A;  1NUB A;  3BUM B;  2MLE C;  1N65 A;  1GGZ A;  2SCP A;  1B47 A;  4PHN A;  4GUK A;  4XJK B;  1ODB A;  4MLW A;  1BR1 B;  3PLF B;  4PE7 A;  1MUX A;  4DIR A;  1UHH A;  5GQQ C;  5J3X A;  5F6T A;  1F8H A;  2HQ8 A;  3SIA A;  3BUN B;  2PRU A;  2EC6 B;  4FTG A;  4YGD B;  2KBI A;  2OS8 B;  4I5L B;  2M49 B;  3FWC A;  2M1U A;  4PHK A;  1IH0 A;  2MRD A;  1IKU A;  4E68 A;  1QJT A;  3KEV A;  3JVT C;  3SIB A;  3TUY B;  2ZND A;  1F4O A;  2JTZ A;  2HET A;  4GFT A;  4M2P A;  1GJY A;  2BEC A;  1GGW A;  4NDB A;  3KF9 A;  2Y1N A;  4A4B A;  1S6J A;  5ER5 A;  1G33 A;  3SG7 A;  5AFP A;  1J7R A;  3O78 A;  1DJX A;  2JOJ A;  1CDM A;  1SRA A;  2KFG A;  2NXQ A;  4N1F A;  1CFF A;  2BL0 C;  3I5H C;  1SPY A;  2L4I A;  1IGV A;  2LVI A;  2TN4 A;  2I7A A;  1OMV A;  4QJ3 B;  1CDN A;  1JF0 A;  3HX4 A;  1ZOT B;  1HQV A;  3A8R A;  1CKK A;  2M9G A;  1F4Q A;  5I8N A;  1QAS A;  2K8M B;  4HRH A;  1JWD A;  4WQ2 A;  1DJZ A;  1PVB A;  2K7D A;  1BJF A;  1Y0V H;  2LP2 A;  1J7Q A;  1FBV A;  4TNC A;  3SJS A;  3WNX B;  1JBA A;  4OV2 A;  1OMR A;  3CZT X;  4NQG A;  2GGM A;  1KK7 Y;  4YBH B;  5HKZ A;  1JF2 A;  1MXL C;  2NCO A;  1Y1U A;  1QAT A;  1EG4 A;  4I5K A;  5D7F A;  1F54 A;  1CDP A;  3SG5 A;  1TRF A;  1DGU A;  3ICB A;  2CNP A;  1SR6 C;  1QX5 B;  2KFH A;  2KBM A;  1TNQ A;  4WQ3 A;  3DVM A;  1QVI Z;  2L2E A;  5CSF A;  2KI6 D;  1SBJ A; 
#chains in the Genus database with same CATH topology
 2F3Y A;  1PAL A;  2JPO A;  2HPS A;  4PE4 A;  2EHB A;  4XYN A;  2JQ6 A;  1DJG A;  1QV1 A;  2MLF C;  4MRY A;  1F70 A;  2FOT A;  3SG4 A;  2M7L A;  3NSI A;  3D75 A;  2JTT A;  2JT3 A;  4M2O A;  1Y6W A;  2G9B A;  1FW4 A;  1OW4 A;  2JT0 A;  3BFA A;  4PDZ A;  3EK8 A;  1NX1 A;  1TCO B;  1V1G A;  3AKB A;  1AVS A;  3OBV A;  3IQQ A;  1KFX L;  4YGC B;  2P6B B;  4YGB B;  1YVH A;  5IBW A;  1N2D A;  3DVE A;  5CPV A;  5K89 A;  1MXE A;  2K2A A;  1UWO A;  1OZO A;  1ALW A;  4N1G A;  1F55 A;  1FI6 A;  2KGB C;  3AAJ A;  3EKJ A;  4PHJ A;  2B1U A;  1J55 A;  2KHN A;  3NHI A;  2BL0 B;  3B88 A;  3CTN A;  1CMG A;  2M7N A;  1DJY A;  1B8C A;  2FCE A;  1EL4 A;  2CTN A;  1OSA A;  1PSR A;  2I18 A;  2P70 A;  1L2O C;  3O4Y A;  3FE6 A;  3CLN A;  2FJU B;  1YUR A;  1XFU O;  4IJ7 A;  1KK7 Z;  3O6B A;  2KPH A;  2K7C A;  3SG2 A;  3UO9 A;  4U8D A;  1J1D A;  1NIW A;  1WRZ A;  1K2H A;  2KAV A;  4PHM A;  4CFR A;  3JTD C;  3I5G C;  3ZWH A;  1UP5 A;  2CXJ A;  1YUS A;  1QX7 A;  1OOH A;  3I5F C;  4JKT A;  4UPG A;  2LUX A;  1YX8 A;  3WHU B;  2BKI B;  2JNF A;  1OOJ A;  2D8N A;  2BCA A;  4AOM A;  1AHR A;  3BOW B;  3DYE A;  1SR6 B;  3LL8 B;  3B6X A;  3BXK A;  1V1F A;  2H61 A;  2WCJ A;  1MF8 B;  1A4P A;  2WCM A;  2L4H A;  2LHL A;  3KO0 A;  1M63 B;  2LUC A;  2SAS A;  3TDU A;  1X02 A;  5KU1 A;  1AJ4 A;  4INX A;  3CZ0 A;  2ZFD A;  1K96 A;  1NX2 A;  1OOI X;  3L47 A;  4OR9 B;  1MQ1 A;  4KYN A;  4CLN A;  2HQW A;  3LCP C;  1J1E A;  1XA5 A;  1DQE A;  1TNW A;  2LAP A;  1A2X A;  1OOF A;  2ZRS A;  2M29 A;  3PSR A;  3O2P A;  1DTL A;  1RK9 A;  1QLS A;  3CR2 A;  2GV5 A;  1K90 D;  1IJ5 A;  2Y1M A;  4YRU A;  4GGF C;  1B1G A;  3NSK A;  1DT7 B;  1CFP A;  3RZS A;  2KLE A;  1NCZ A;  1YTZ C;  3SS4 A;  1B8L A;  5I94 A;  1QVI Y;  1EG3 A;  4WRI A;  2V53 A;  5DKR A;  2PYQ A;  3VRQ A;  1S3P A;  3RLZ A;  1B8R A;  5DKN A;  3OX6 A;  1AP4 A;  3DVJ A;  2KQ6 A;  1L2O B;  3GK2 A;  4JWQ A;  1KCY A;  4ZCU A;  3SG6 A;  1BT6 A;  1NPQ A;  3R1O A;  1K9U A;  2L0P A;  1K94 A;  3DD4 A;  1XK4 C;  3BYA A;  1CM4 A;  5KTY A;  3K21 A;  1Q80 A;  5B8I B;  4ORC B;  1DJW A;  1BOD A;  2BBN A;  5G08 A;  1A03 A;  1KWO C;  2LLU A;  3D74 A;  3DY9 A;  2KNE A;  1TCF A;  3JTD B;  3I5G B;  1B9A A;  1BF5 A;  3EVV A;  1OQP A;  2JPT A;  5DKQ A;  1UUS A;  1TUJ A;  3BUX B;  1BU3 A;  2KI4 C;  3I5F B;  1QWV A;  3VRP A;  1KFX S;  2QEH A;  1NCY A;  2NLN A;  1K93 D;  2PMY A;  2JWW A;  1MWN A;  4MVF A;  4OVN F;  3D77 A;  3WXA A;  1WY9 A;  1LS8 A;  3DVK A;  1KQM C;  3NXA A;  4I5N B;  1NYA A;  3FS7 A;  1CM1 A;  2LP3 A;  3D10 A;  1F71 A;  1SYM A;  1KFU L;  1TN4 A;  4GBA A;  1R6P A;  2KOT A;  2ZN9 A;  5FYX A;  2M1K B;  3D0Y B;  2NCP A;  3VB1 A;  2P71 A;  1CFC A;  4FQO A;  2K61 A;  1R2U A;  1KK8 C;  2OTG B;  2M0R A;  3BOW A;  2KI6 C;  3GK1 A;  1XFW O;  5JJG A;  3TS5 C;  5HKW A;  1K95 A;  3AAK A;  1PUL A;  4GAO A;  1W7I B;  1OE9 B;  2BE4 A;  2M97 A;  3M0W A;  1REC A;  1CNP A;  1SK6 D;  3K1E A;  2WC5 A;  1S5G Y;  2YGU A;  1DC1 A;  1EXR A;  4JPZ B;  4Q04 A;  1WLM A;  2ZKM X;  1CFD A;  1WRK A;  1C3Z A;  1LA0 A;  5EL2 A;  2L98 A;  3QRX A;  3TDI A;  4A4C A;  1UHI A;  1XFY O;  2QAC A;  3VRN A;  2M8U A;  3OP0 A;  2PSR A;  1OZS A;  1EJ3 A;  1UHK A;  2KAY A;  3KPX A;  1A29 A;  1NP8 A;  3NSO A;  3ZNI A;  1LVC D;  1FI5 A;  1QXP A;  2Y4Q A;  2AUC A;  1DJI A;  1U5I B;  5CSI A;  3TDZ A;  1RRO A;  2QEO A;  1JSA A;  2G2B A;  4GNK B;  3V2L A;  5HL1 A;  1H8B A;  4JD9 A;  2QEV A;  3VRO A;  3IF7 A;  2BCX A;  4CID A;  1YX7 A;  3PN7 B;  2E30 A;  1BOC A;  3CWG A;  3DF0 B;  2DOQ A;  2WOS A;  4OKH A;  1KSM A;  1SMG A;  4AQI A;  1KWO B;  2R2I A;  4BY5 A;  3N7H A;  2LE9 B;  3CDN A;  2MAZ A;  2PVB A;  3L4L A;  5HKY A;  1DEL A;  1C07 A;  3CGA A;  1CMF A;  2HF5 A;  2FCD A;  1UUR A;  2BE6 A;  1B7T Y;  2KI4 B;  1G4Y R;  3GK4 X;  1QS7 A;  2JRF A;  1Y1X A;  3OB2 B;  1SCM C;  1ZMZ A;  5AXI A;  1YVL A;  3OB1 B;  1AJ5 A;  1KQM B;  5I2Q A;  3C1V A;  3BFH A;  4PT1 A;  4ICB A;  2ZN8 A;  1IRJ A;  1TTX A;  5PAL A;  1KK8 B;  2WCK A;  3OHM B;  4INW A;  1KSO A;  1CDL A;  1S5G Z;  1W7J B;  1WRL A;  1YR5 A;  1E8A A;  4C0K A;  3TS5 B;  1G8I A;  3R1P A;  3D0Y A;  3PJI A;  2COL B;  4YGE B;  2JXL A;  4PE1 A;  4MBE A;  1GM0 A;  1A75 B;  2JT8 A;  2BNX A;  1SW8 A;  4MEW A;  3S0G A;  1SCV A;  2F2O A;  3MSE B;  4QJ4 B;  1XO5 A;  1TNX A;  2LAN A;  3D73 A;  1K8U A;  2OTG C;  2Q4U A;  2BKH B;  4YGA A;  3B86 A;  2WCE A;  1XFR A;  1ALV A;  2L5Y A;  3BQ3 A;  1H4B A;  1LA3 A;  2KYC A;  4GGF A;  1RWY A;  4GGN A;  5I2L A;  1KFU S;  2Y5I A;  1TIZ A;  2K7B A;  1FPW A;  1YRU B;  4AQJ A;  1B7T Z;  5TNC A;  1PK0 D;  2MBX A;  4BY4 A;  2JNX A;  2KDH A;  1AK8 A;  4MZJ A;  2WCB A;  1NCX A;  1U5I A;  1C7W A;  1XFV O;  5AAN A;  5AEQ A;  4DUQ A;  1FF1 A;  3BFB A;  5AER A;  4YI9 A;  1L7Z A;  3OGN A;  2L51 A;  1XK4 A;  1JFJ A;  2NZ0 A;  3PAL A;  4MRX A;  3DF0 A;  2PAS A;  1Y1A A;  2RGI A;  1SCM B;  2O5G A;  3NGV A;  3UNW A;  1K9K A;  3CS1 A;  4F0Z B;  5D3O A;  2QDI A;  3PN7 C;  1XVJ A;  2H2K A;  1CLL A;  1AUI B;  3OX5 A;  1UHJ A;  4GPL B;  5FI7 A;  2CCM A;  1TWO A;  1WDC C;  2E6W A;  2LM5 A;  1JFK A;  1NWD A;  2L50 A;  3R72 A;  1WLZ A;  2BAP A;  3CZ2 A;  1T14 A;  2LLT A;  4HSZ A;  4USL A;  1OMD A;  1DF0 A;  3SG3 A;  1IWQ A;  5I2O A;  3S0A A;  2KSP A;  3FWB A;  2WND A;  3S0D A;  3D78 A;  3GOF A;  1CTR A;  5HLV A;  2KAX A;  4YI8 A;  1NSH A;  2LC5 A;  1MR8 A;  2L5X B;  1RTP 1;  2LV7 A;  1C7V A;  4C0L A;  2KQY A;  1TNP A;  3I5I C;  2F33 A;  2BCB A;  1LXF C;  1N0Y A;  1C3Y A;  1S36 A;  1JUO A;  3TZ1 A;  1A75 A;  2ISD A;  2LVV A;  1ORG A;  2LVK A;  3CZ1 A;  3SS5 A;  3VGO A;  2ZRT A;  1PRW A;  2MJW B;  2JC2 A;  1XFX O;  2KYF A;  2ZNE A;  2LMV A;  2AAO A;  2QPT A;  3EK4 A;  5JOL A;  2I94 A;  4PAL A;  3KHE A;  2FJY A;  3EK7 A;  2Q91 A;  5D69 A;  1DEK A;  3L4A A;  1QX2 A;  1NX3 A;  2LLS A;  1MHO A;  3B87 A;  3CR4 X;  5ER4 X;  1S6I A;  1YUU A;  4JQ0 D;  4F7F A;  1DGV A;  1IJ6 A;  3FIA A;  1ZAC A;  2WCH A;  1CLM A;  1LIN A;  1QIW A;  1BLQ A;  3IQO A;  4QJ5 B;  2LVJ A;  2JXC A;  4NDC A;  1YRT B;  2LNK A;  2MA2 A;  2LHI A;  1IG5 A;  1BG1 A;  2K2F A;  2KFF A;  4DS7 A;  3H4S E;  3CAB A;  1XFZ O;  1J7P A;  4MSP A;  2MHH A;  2PQL A;  3PM8 A;  3WHT B;  2K0J A;  5KSZ A;  1QLK A;  1WDC B;  3HCM A;  1IQ5 A;  4XJK A;  1SY9 A;  2F3Z A;  2LMU A;  4P2Y B;  4CPV A;  4ETO A;  4ORA B;  2CBL A;  2LCP A;  4DCK A;  3JVT B;  2K7O A;  1TUZ A;  5HLO A;  4ZCV A;  3EVR A;  1SL9 A;  2H8V A;  4M2Q A;  4MN0 A;  1QIV A;  3F45 A;  1NX0 A;  1ZUZ A;  1GQM A;  1TOP A;  3LLE A;  1DVI A;  1Z4H A;  1EH2 A;  1S6C A;  5BPJ A;  1DF0 B;  3EVU A;  3FE9 A;  2O60 A;  5CSJ A;  4ORB B;  3LK1 A;  1S1E A;  1DJH A;  2EC6 C;  1M31 A;  1RFJ A;  3I5I B;  2OS8 C;  2CT9 A;  2PAL A;  4HRG A;  4OCI A;  4N5X A;  1LKJ A;  3EKH A;  1PSB A;  2WOR A;  1JC2 A;  3TUY C;  3I5H B;  2VRG A;  2WCF A;  3RM1 A;  3S0E A;  1HT9 A;  3R1V A;  2WCL A;  3CR5 X;  3PAT A;  2KGR A;  3VRR A;  1KQV A;  1BR4 B;  2WC8 A;  2GTE A;  1M45 A;  1SKT A;  1VRK A;  3EG5 B;  3NSL A;  4IL1 A;  3BUW B;  3DZT A;  4CFQ A;  1CB1 A;  1M39 A;  2JZI A;  2EGD A;  2I2R E;  3NHT A;  2OPO A;  3PFV A;  5FI6 A;  2M3W A;  1ZFS A;  3AKA A;  3A4U B;  4MZK A;  1SNL A;  4NDD A;  1SL8 A;  1DMO A;  2LMT A;  1RJV A;  3B7A A;  4P5O E;  1IQ3 A;  4D1E A;  4R1E A;  1QTX A;  2IS9 A;  5CSN A;  1CLB A;  1M46 A;  4DRW A;  5HYD A;  2AMI A;  1UHN A;  1XYD A;  4PE0 A;  4MZL A;  1BMO A;  2F8P A;  4L9M A;  1D1O A;  3E3R A;  1S26 D;  2BBM A;  3D76 A;  3LK0 A;  4I5J A;  2ERB A;  2GGZ A;  2JUL A;  1SSE B;  1YUT A;  1B4C A;  1J7O A;  2F2P A;  5DIC A;  2JU0 A;  1SL7 A;  2QEB A;  4PCW A;  5FI2 A;  1PVA A;  3BUO B;  1QV0 A;  4HRE E;  2A4J A;  4C0J A;  2H61 C;  1K9P A;  1NUB A;  2K60 A;  3PM2 A;  3BUM B;  2MLE C;  1N65 A;  1GGZ A;  2SCP A;  1B47 A;  4PHN A;  1IIO A;  4GUK A;  4XJK B;  1ODB A;  4MLW A;  1BR1 B;  3PLF B;  4PE7 A;  1MUX A;  4DIR A;  1UHH A;  3CYZ A;  5GQQ C;  5J3X A;  5F6T A;  1F8H A;  2HQ8 A;  3SIA A;  3BUN B;  3SS3 A;  2PRU A;  2EC6 B;  4FTG A;  4YGD B;  2KBI A;  2OS8 B;  4I5L B;  2M49 B;  3FWC A;  2M1U A;  4PHK A;  1IH0 A;  2MRD A;  1IKU A;  4E68 A;  1QJT A;  3KEV A;  3JVT C;  3SIB A;  3TUY B;  2ZND A;  1W9Z A;  1F4O A;  2JTZ A;  2HET A;  2KLD A;  4GFT A;  4M2P A;  1GJY A;  2BEC A;  1GGW A;  4NDB A;  3KF9 A;  2Y1N A;  4A4B A;  1S6J A;  5ER5 A;  1G33 A;  3SG7 A;  5AFP A;  1J7R A;  3O78 A;  3S0B A;  3DXL A;  3FE8 A;  1DJX A;  2JOJ A;  3O4X A;  1CDM A;  1SRA A;  2KFG A;  2NXQ A;  4N1F A;  1CFF A;  2BL0 C;  3I5H C;  1SPY A;  4FQT A;  1Z2C B;  2L4I A;  1IGV A;  2LVI A;  3BJH A;  2TN4 A;  2I7A A;  1OMV A;  4QJ3 B;  1CDN A;  1JF0 A;  3HX4 A;  1OOG A;  1HQV A;  1ZOT B;  2WC6 A;  3A8R A;  1CKK A;  2M9G A;  1F4Q A;  5I8N A;  1QAS A;  2K8M B;  4HRH A;  1JWD A;  2L2C A;  4WQ2 A;  1DJZ A;  1PVB A;  2K7D A;  1BJF A;  1Y0V H;  2LP2 A;  1J7Q A;  1FBV A;  4TNC A;  3SJS A;  3WNX B;  1JBA A;  4OV2 A;  1OMR A;  4OZD A;  3CZT X;  4NQG A;  2GGM A;  1KK7 Y;  1P28 A;  4YBH B;  5HKZ A;  1JF2 A;  1MXL C;  2NCO A;  1Y1U A;  1QAT A;  1EG4 A;  4I5K A;  5D7F A;  1F54 A;  1CDP A;  3S0F A;  3SG5 A;  1TRF A;  1DGU A;  3ICB A;  2CNP A;  1SR6 C;  1QX5 B;  2KFH A;  3QME A;  2KBM A;  1TNQ A;  4WQ3 A;  3DVM A;  3IVT A;  3Q8I A;  1QVI Z;  2L2E A;  5CSF A;  2KI6 D;  1SBJ A; 
#chains in the Genus database with same CATH homology
 2F3Y A;  1PAL A;  2HPS A;  4PE4 A;  2EHB A;  4XYN A;  2JQ6 A;  1DJG A;  1QV1 A;  2MLF C;  4MRY A;  1F70 A;  2FOT A;  3SG4 A;  2M7L A;  3NSI A;  2JTT A;  2JT3 A;  4M2O A;  1Y6W A;  2G9B A;  1FW4 A;  2JT0 A;  4PDZ A;  3EK8 A;  1NX1 A;  1TCO B;  1V1G A;  3AKB A;  1AVS A;  3IQQ A;  1KFX L;  4YGC B;  2P6B B;  4YGB B;  1YVH A;  5IBW A;  1N2D A;  3DVE A;  5CPV A;  5K89 A;  1MXE A;  2K2A A;  1UWO A;  1OZO A;  1ALW A;  4N1G A;  1F55 A;  1FI6 A;  2KGB C;  3AAJ A;  3EKJ A;  4PHJ A;  2B1U A;  1J55 A;  2KHN A;  1CMG A;  2BL0 B;  3CTN A;  2M7N A;  1DJY A;  1B8C A;  2FCE A;  1EL4 A;  2CTN A;  1OSA A;  1PSR A;  2I18 A;  1L2O C;  3O4Y A;  3CLN A;  2FJU B;  1YUR A;  1XFU O;  1KK7 Z;  3O6B A;  2K7C A;  3SG2 A;  4U8D A;  1J1D A;  1NIW A;  1WRZ A;  1K2H A;  2KAV A;  4PHM A;  4CFR A;  3JTD C;  3I5G C;  3ZWH A;  1UP5 A;  2CXJ A;  1YUS A;  1QX7 A;  3I5F C;  4UPG A;  2LUX A;  1YX8 A;  3WHU B;  2BKI B;  2JNF A;  1OOJ A;  2D8N A;  2BCA A;  4AOM A;  1AHR A;  3BOW B;  1SR6 B;  3LL8 B;  3BXK A;  1V1F A;  2H61 A;  1MF8 B;  1A4P A;  2L4H A;  2LHL A;  3KO0 A;  1M63 B;  2LUC A;  2SAS A;  3TDU A;  1X02 A;  5KU1 A;  1AJ4 A;  2ZFD A;  1K96 A;  1NX2 A;  4OR9 B;  1MQ1 A;  4CLN A;  2HQW A;  3LCP C;  1J1E A;  1XA5 A;  1TNW A;  2LAP A;  2ZRS A;  1A2X A;  3PSR A;  2M29 A;  3O2P A;  1DTL A;  1RK9 A;  1QLS A;  3CR2 A;  2GV5 A;  1K90 D;  1IJ5 A;  2Y1M A;  4YRU A;  4GGF C;  1B1G A;  3NSK A;  1DT7 B;  1CFP A;  1NCZ A;  1YTZ C;  1B8L A;  1QVI Y;  1EG3 A;  4WRI A;  2V53 A;  5DKR A;  3VRQ A;  1S3P A;  3RLZ A;  1B8R A;  5DKN A;  3OX6 A;  1AP4 A;  3DVJ A;  2KQ6 A;  1L2O B;  3GK2 A;  4JWQ A;  1KCY A;  4ZCU A;  3SG6 A;  1BT6 A;  1NPQ A;  1K9U A;  2L0P A;  1K94 A;  3DD4 A;  1XK4 C;  3BYA A;  1CM4 A;  5KTY A;  3K21 A;  1Q80 A;  5B8I B;  4ORC B;  1DJW A;  1BOD A;  2BBN A;  5G08 A;  1A03 A;  1KWO C;  2LLU A;  2KNE A;  1TCF A;  3JTD B;  3I5G B;  1B9A A;  1BF5 A;  3EVV A;  1OQP A;  2JPT A;  5DKQ A;  1UUS A;  3BUX B;  1BU3 A;  2KI4 C;  3I5F B;  3VRP A;  1KFX S;  1NCY A;  2NLN A;  1K93 D;  2PMY A;  2JWW A;  1MWN A;  4MVF A;  4OVN F;  3WXA A;  1WY9 A;  3DVK A;  1KQM C;  3NXA A;  4I5N B;  1NYA A;  3FS7 A;  1CM1 A;  2LP3 A;  3D10 A;  1F71 A;  1SYM A;  1KFU L;  1TN4 A;  4GBA A;  1R6P A;  2KOT A;  2ZN9 A;  5FYX A;  2M1K B;  3D0Y B;  2NCP A;  1CFC A;  4FQO A;  2K61 A;  1R2U A;  1KK8 C;  2OTG B;  2M0R A;  3BOW A;  2KI6 C;  3GK1 A;  1XFW O;  5JJG A;  3TS5 C;  5HKW A;  1K95 A;  3AAK A;  1PUL A;  4GAO A;  1W7I B;  1OE9 B;  2BE4 A;  2M97 A;  3M0W A;  1REC A;  1CNP A;  1SK6 D;  1S5G Y;  1EXR A;  4JPZ B;  4Q04 A;  1WLM A;  2ZKM X;  1CFD A;  1WRK A;  1LA0 A;  2L98 A;  3QRX A;  3TDI A;  4A4C A;  1UHI A;  1XFY O;  2QAC A;  3VRN A;  2M8U A;  3OP0 A;  2PSR A;  1OZS A;  1EJ3 A;  1UHK A;  2KAY A;  3KPX A;  1A29 A;  1NP8 A;  3NSO A;  3ZNI A;  1LVC D;  1FI5 A;  1QXP A;  2Y4Q A;  2AUC A;  1DJI A;  1U5I B;  5CSI A;  3TDZ A;  1RRO A;  1JSA A;  2G2B A;  4GNK B;  1H8B A;  3VRO A;  3IF7 A;  2BCX A;  4CID A;  1YX7 A;  3PN7 B;  2E30 A;  1BOC A;  3CWG A;  3DF0 B;  2DOQ A;  2WOS A;  4OKH A;  1KSM A;  1SMG A;  4AQI A;  1KWO B;  2R2I A;  4BY5 A;  2LE9 B;  1CMF A;  2MAZ A;  2PVB A;  5HKY A;  1C07 A;  3CGA A;  2HF5 A;  2FCD A;  1UUR A;  2BE6 A;  1B7T Y;  2KI4 B;  1G4Y R;  3GK4 X;  1QS7 A;  2JRF A;  1Y1X A;  3OB2 B;  1SCM C;  1ZMZ A;  5AXI A;  1YVL A;  3OB1 B;  1AJ5 A;  1KQM B;  5I2Q A;  3C1V A;  4ICB A;  2ZN8 A;  1IRJ A;  1TTX A;  5PAL A;  1KK8 B;  3OHM B;  1KSO A;  1CDL A;  1S5G Z;  1W7J B;  1WRL A;  1YR5 A;  1E8A A;  4C0K A;  3TS5 B;  1G8I A;  3D0Y A;  2COL B;  4YGE B;  2JXL A;  4PE1 A;  4MBE A;  1A75 B;  2JT8 A;  1SW8 A;  4MEW A;  1SCV A;  2F2O A;  3MSE B;  4QJ4 B;  1XO5 A;  1TNX A;  2LAN A;  1K8U A;  2OTG C;  2Q4U A;  2BKH B;  4YGA A;  2WCE A;  1ALV A;  3BQ3 A;  1H4B A;  1LA3 A;  2KYC A;  4GGF A;  1RWY A;  4GGN A;  5I2L A;  1KFU S;  2Y5I A;  1TIZ A;  2K7B A;  1FPW A;  1YRU B;  4AQJ A;  1B7T Z;  5TNC A;  1PK0 D;  2MBX A;  4BY4 A;  2JNX A;  2KDH A;  1AK8 A;  4MZJ A;  2WCB A;  1NCX A;  1U5I A;  1C7W A;  1XFV O;  5AAN A;  5AEQ A;  4DUQ A;  1FF1 A;  5AER A;  4YI9 A;  1L7Z A;  2L51 A;  1XK4 A;  1JFJ A;  2NZ0 A;  3PAL A;  4MRX A;  3DF0 A;  2PAS A;  1Y1A A;  2RGI A;  1SCM B;  2O5G A;  1K9K A;  3CS1 A;  4F0Z B;  3PN7 C;  1XVJ A;  2H2K A;  1CLL A;  1AUI B;  3OX5 A;  1UHJ A;  4GPL B;  2CCM A;  1WDC C;  2E6W A;  2LM5 A;  1JFK A;  1NWD A;  2L50 A;  1WLZ A;  3SG3 A;  2LLT A;  4HSZ A;  4USL A;  1OMD A;  1DF0 A;  5I2O A;  1IWQ A;  2KSP A;  3FWB A;  2WND A;  3GOF A;  1CTR A;  5HLV A;  2KAX A;  4YI8 A;  1NSH A;  2LC5 A;  1MR8 A;  2L5X B;  1RTP 1;  2LV7 A;  1C7V A;  4C0L A;  2KQY A;  1TNP A;  3I5I C;  2F33 A;  2BCB A;  1LXF C;  1N0Y A;  1S36 A;  1JUO A;  3TZ1 A;  1A75 A;  2ISD A;  2LVV A;  2LVK A;  3VGO A;  2ZRT A;  1PRW A;  2MJW B;  2JC2 A;  1XFX O;  2KYF A;  2ZNE A;  2LMV A;  2AAO A;  2QPT A;  3EK4 A;  5JOL A;  2I94 A;  4PAL A;  3KHE A;  3EK7 A;  2Q91 A;  5D69 A;  1QX2 A;  1NX3 A;  2LLS A;  1MHO A;  3CR4 X;  5ER4 X;  1S6I A;  1YUU A;  4JQ0 D;  1DGV A;  1IJ6 A;  3FIA A;  1ZAC A;  1CLM A;  1LIN A;  1QIW A;  1BLQ A;  3IQO A;  4QJ5 B;  2LVJ A;  2JXC A;  4NDC A;  1YRT B;  2LNK A;  2MA2 A;  2LHI A;  1IG5 A;  1BG1 A;  2K2F A;  2KFF A;  4DS7 A;  3H4S E;  1XFZ O;  1J7P A;  4MSP A;  2MHH A;  3PM8 A;  3WHT B;  2K0J A;  5KSZ A;  1QLK A;  1WDC B;  3HCM A;  1IQ5 A;  4XJK A;  1SY9 A;  2F3Z A;  2LMU A;  4P2Y B;  4CPV A;  4ETO A;  4ORA B;  2CBL A;  2LCP A;  4DCK A;  3JVT B;  2K7O A;  5HLO A;  4ZCV A;  3EVR A;  1SL9 A;  4M2Q A;  4MN0 A;  1QIV A;  3F45 A;  1NX0 A;  1ZUZ A;  1GQM A;  1TOP A;  3LLE A;  1DVI A;  1EH2 A;  1S6C A;  5BPJ A;  1DF0 B;  3EVU A;  5CSJ A;  2O60 A;  4ORB B;  3LK1 A;  1S1E A;  1DJH A;  2EC6 C;  1M31 A;  1RFJ A;  3I5I B;  2OS8 C;  2CT9 A;  2PAL A;  4HRG A;  4OCI A;  4N5X A;  1LKJ A;  3EKH A;  1PSB A;  2WOR A;  1JC2 A;  3TUY C;  3I5H B;  2VRG A;  2WCF A;  3RM1 A;  1HT9 A;  3CR5 X;  3PAT A;  3VRR A;  2KGR A;  1KQV A;  1BR4 B;  2WC8 A;  4IL1 A;  1M45 A;  1SKT A;  1VRK A;  3NSL A;  4CFQ A;  3BUW B;  1CB1 A;  1M39 A;  2JZI A;  2EGD A;  2I2R E;  2OPO A;  3PFV A;  2M3W A;  1ZFS A;  3AKA A;  3A4U B;  4MZK A;  1SNL A;  4NDD A;  1SL8 A;  1DMO A;  2LMT A;  1RJV A;  4P5O E;  1IQ3 A;  4D1E A;  4R1E A;  1QTX A;  2IS9 A;  5CSN A;  1CLB A;  1M46 A;  4DRW A;  5HYD A;  2AMI A;  1UHN A;  1XYD A;  4PE0 A;  4MZL A;  1BMO A;  2F8P A;  4L9M A;  1D1O A;  3E3R A;  1S26 D;  2BBM A;  3LK0 A;  4I5J A;  2JUL A;  2GGZ A;  1YUT A;  1B4C A;  1J7O A;  2F2P A;  2JU0 A;  1SL7 A;  4PCW A;  1PVA A;  3BUO B;  1QV0 A;  4HRE E;  2A4J A;  4C0J A;  2H61 C;  1K9P A;  1NUB A;  3BUM B;  2MLE C;  1N65 A;  1GGZ A;  2SCP A;  1B47 A;  4PHN A;  4GUK A;  4XJK B;  1ODB A;  4MLW A;  1BR1 B;  3PLF B;  4PE7 A;  1MUX A;  4DIR A;  1UHH A;  5GQQ C;  5J3X A;  5F6T A;  1F8H A;  2HQ8 A;  3SIA A;  3BUN B;  2PRU A;  2EC6 B;  4FTG A;  4YGD B;  2KBI A;  2OS8 B;  4I5L B;  2M49 B;  3FWC A;  2M1U A;  4PHK A;  1IH0 A;  2MRD A;  1IKU A;  4E68 A;  1QJT A;  3KEV A;  3JVT C;  3SIB A;  3TUY B;  2ZND A;  1F4O A;  2JTZ A;  2HET A;  4GFT A;  4M2P A;  1GJY A;  2BEC A;  1GGW A;  4NDB A;  3KF9 A;  2Y1N A;  4A4B A;  1S6J A;  5ER5 A;  1G33 A;  3SG7 A;  5AFP A;  1J7R A;  3O78 A;  1DJX A;  2JOJ A;  1CDM A;  1SRA A;  2KFG A;  2NXQ A;  4N1F A;  1CFF A;  2BL0 C;  3I5H C;  1SPY A;  2L4I A;  1IGV A;  2LVI A;  2TN4 A;  2I7A A;  1OMV A;  4QJ3 B;  1CDN A;  1JF0 A;  3HX4 A;  1ZOT B;  1HQV A;  3A8R A;  1CKK A;  2M9G A;  1F4Q A;  5I8N A;  1QAS A;  2K8M B;  4HRH A;  1JWD A;  4WQ2 A;  1DJZ A;  1PVB A;  2K7D A;  1BJF A;  1Y0V H;  2LP2 A;  1J7Q A;  1FBV A;  4TNC A;  3SJS A;  3WNX B;  1JBA A;  4OV2 A;  1OMR A;  3CZT X;  4NQG A;  2GGM A;  1KK7 Y;  4YBH B;  5HKZ A;  1JF2 A;  1MXL C;  2NCO A;  1Y1U A;  1QAT A;  1EG4 A;  4I5K A;  5D7F A;  1F54 A;  1CDP A;  3SG5 A;  1TRF A;  1DGU A;  3ICB A;  2CNP A;  1SR6 C;  1QX5 B;  2KFH A;  2KBM A;  1TNQ A;  4WQ3 A;  3DVM A;  1QVI Z;  2L2E A;  5CSF A;  2KI6 D;  1SBJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...