3K21A

Crystal structure of carboxy-terminus of pfc0420w.
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
178
structure length
178
Chain Sequence
LYFQGIHVLENFKNYGLLLKFQKLAMTIIAQQSNDYDVEKLKSTFLVLDEDGKGYITKEQLKKGLEKDGLKLPYNFDLLLDQIDSDGSGKIDYTEFIAAALDRKQLSKKLIYCAFRVFDVDNDGEITTAELAHILYNGNKKGNITQRDVNRVKRMIRDVDKNNDGKIDFHEFSEMMKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Calcium-dependent protein kinase 3
publication title Structures of parasitic CDPK domains point to a common mechanism of activation.
pubmed doi rcsb
source organism Plasmodium falciparum
total genus 73
structure length 178
sequence length 178
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2009-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13405 EF-hand_6 EF-hand domain
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3k21A01
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3k21A02
2BBMA 2JQ6A 1C07A 2K7CA 2LP3A 2LVVA 3I5HC 3AKAA 2L4IA 1AK8A 2JWWA 4WRIA 1GGZA 1DJGA 2WC8A 1TN4A 4CPVA 2PRUA 5B8IB 2MHHA 2K7DA 3HX4A 3FWCA 1M45A 2BECA 4BY4A 2PVBA 1QVIZ 1S36A 4PE0A 3WNXB 4MLWA 2MLFC 5CSJA 1S6JA 1F55A 2Y5IA 3SG7A 1BLQA 1IG5A 1RWYA 3KPXA 2KI6C 1DJHA 3MSEB 1KSOA 1M46A 4MVFA 4NDDA 2LLUA 3NSIA 3EK4A 4NQGA 1QATA 2F2PA 3VRQA 3QRXA 1QX5B 1RROA 1SMGA 3GOFA 2HETA 2M8UA 3PN7B 4MZLA 2KGRA 1BF5A 4N1FA 1WLZA 2CNPA 1NP8A 1KFUL 1WRLA 2F3ZA 5DKRA 1OQPA 3E3RA 2LCPA 4XJKB 1CLBA 2CT9A 2AAOA 1UHJA 2Y1MA 1D1OA 2JPTA 3PN7C 1XFVO 2PMYA 2M7LA 1C7WA 1BMOA 4GUKA 3JTDB 4DRWA 1F8HA 3BUWB 1IQ5A 1IGVA 1DJZA 1U5IB 1N2DA 1YUTA 1MR8A 3LK0A 4MZKA 2BCXA 4HSZA 2OS8C 2LVJA 4C0LA 2JT3A 2MRDA 1Y0VH 3BOWA 3CR4X 1MXEA 3TS5B 2A4JA 5HKYA 2GGZA 2KYFA 3JTDC 1M31A 3D0YA 1XVJA 1MWNA 3M0WA 1R6PA 2DOQA 1ZMZA 1CFFA 4HREE 5I8NA 1Y1UA 3I5FB 3TS5C 3OB1B 1GQMA 2L50A 1N65A 1TNXA 4JPZB 1BJFA 1KQVA 2PALA 1QLSA 2AUCA 2L51A 1XK4C 1IH0A 1CB1A 2B1UA 4FTGA 4YI9A 1ZFSA 1L7ZA 1CDPA 1SPYA 3KEVA 4HRHA 4I5LB 4ORBB 5BPJA 3WXAA 3NXAA 2V53A 3I5FC 1XA5A 1BOCA 2JC2A 1DF0B 1A4PA 4IL1A 1TOPA 2HF5A 1OMRA 3OX5A 1F70A 1LVCD 1BR4B 1K90D 2LUXA 2HQ8A 1S6CA 1VRKA 3EK8A 2WNDA 3TUYB 1S1EA 3DF0A 4GAOA 5PALA 3A4UB 1X02A 3F45A 1EJ3A 1MF8B 1CDLA 2KHNA 4MZJA 4PE1A 2MBXA 3TDZA 1CDMA 1FI5A 1TRFA 3IQOA 2COLB 1B1GA 2KSPA 2PSRA 3DVKA 2KAXA 1WRKA 2KAYA 1S6IA 1ALWA 1QVIY 1PRWA 3NSLA 1AP4A 3TUYC 2FCDA 1CNPA 1OZSA 4GFTA 3RLZA 1YR5A 1CLMA 4N5XA 2QACA 2M49B 1TTXA 1B8LA 2L5XB 2M29A 2I7AA 2JU0A 3GK1A 1PVAA 3DVJA 1DVIA 4P2YB 1FI6A 3PSRA 2JOJA 2G9BA 1J7PA 1J55A 1XFZO 4A4CA 1BU3A 3KHEA 1KK8B 4GNKB 1EL4A 3EKJA 3PATA 2L2EA 2HPSA 3KO0A 1AUIB 4MN0A 1QLKA 2KQYA 2M1UA 4AOMA 4YGBB 4MRXA 3A8RA 3SJSA 3O78A 3GK2A 4N1GA 1IJ5A 1WRZA 2L0PA 4ICBA 1KK8C 1YX8A 3H4SE 4MBEA 1RTP1 5KSZA 4GGFA 1CLLA 1Y6WA 2SCPA 3CS1A 1IRJA 1XFYO 1SYMA 1LA3A 2F2OA 5ER4X 2LM5A 4P5OE 1KQMC 1SL9A 2ZRSA 1DJWA 3OX6A 1K9UA 1AHRA 3CR2A 1B7TZ 2KGBC 1NX0A 4C0JA 1KSMA 5KTYA 1IQ3A 2JNFA 4OCIA 3D10A 1EG4A 3CTNA 4U8DA 4Q04A 2LVIA 4PDZA 1NCZA 1QASA 2KDHA 2KFGA 4I5JA 2K2FA 1KCYA 3EVRA 3SG6A 1NYAA 2MAZA 1SL7A 2KAVA 2OS8B 1NIWA 4I5KA 3CGAA 2LMVA 1B4CA 1JF2A 4NDCA 1SRAA 1B8CA 2GGMA 3LL8B 3O4YA 1W7JB 2QPTA 4M2QA 3TDUA 5I2QA 2KBMA 1BT6A 2KOTA 1LA0A 3I5GB 2FCEA 3LCPC 1J7RA 3BOWB 1H4BA 1SKTA 1ZUZA 3BUMB 2L98A 4CLNA 3D0YB 3O2PA 4BY5A 1K9KA 2IS9A 1SL8A 3NSOA 1AVSA 2LHIA 1F4QA 1OZOA 1ZOTB 3BUOB 1NX1A 1NX3A 2CCMA 4TNCA 1NCXA 2JNXA 1V1GA 1XO5A 3EK7A 2LV7A 3I5GC 4AQIA 1K2HA 2CXJA 1A75B 2BCAA 4ZCUA 3C1VA 3OHMB 5DKNA 4R1EA 5D7FA 2KNEA 3SG4A 1L2OB 4PHJA 5CPVA 1TNPA 1YURA 2ZRTA 1IWQA 5FYXA 3WHUB 4MRYA 4ETOA 1JBAA 1G8IA 1K93D 4OVNF 2LHLA 1YX7A 1Y1XA 4YGDB 1A29A 3EVUA 1RJVA 4PCWA 1L2OC 2M97A 3DF0B 2EC6B 2Y4QA 4WQ2A 1AJ4A 1KK7Z 4FQOA 1SY9A 1YUSA 1SNLA 3PM8A 4JQ0D 3AKBA 4JWQA 3DD4A 2BKHB 1LKJA 4E68A 4XYNA 3IQQA 5HYDA 5TNCA 1YVLA 5AERA 1MUXA 1NPQA 2WORA 5I2LA 4MEWA 1E8AA 1DJXA 1LXFC 1K8UA 1ALVA 1OMDA 1QXPA 2ISDA 4A4BA 1Q80A 2EC6C 3AAKA 1A03A 1QIVA 3VGOA 2CTNA 3FWBA 2KFHA 1TNQA 3RM1A 3IF7A 1LINA 1EH2A 2L4HA 1K96A 4GPLB 2KBIA 2M1KB 2EHBA 2LAPA 2JTTA 1NCYA 1S5GZ 2RGIA 3EKHA 5KU1A 2K8MB 1DGVA 2OPOA 1CDNA 2ZN9A 3PFVA 3WHTB 1SW8A 1UHIA 1GGWA 1M39A 2BKIB 3LLEA 4PHNA 1DF0A 4YGEB 1AJ5A 1UWOA 1GJYA 1UHNA 1FPWA 2JT0A 1B7TY 3LK1A 2JXLA 2H2KA 1JUOA 1JF0A 2BCBA 2LUCA 2BE6A 1TNWA 2LE9B 2FJUB 3ZNIA 1DTLA 1PVBA 1BR1B 2LLTA 4GBAA 2ZKMX 1G33A 2VRGA 2ZNDA 3ZWHA 2NCOA 2K7BA 5AXIA 1JWDA 1JFKA 2F33A 1RECA 4PE4A 1JFJA 3HCMA 1CFPA 1KQMB 2KI6D 1DGUA 2NZ0A 3PALA 1SR6B 5G08A 2MJWB 4GGNA 1DJYA 2K2AA 4YGCB 3I5IB 4F0ZB 1K9PA 2H61A 1QS7A 4OV2A 2JT8A 1YRTB 5CSIA 5ER5A 3CZTX 5AFPA 1DT7B 4YBHB 1QJTA 5AEQA 5D69A 2I2RE 5GQQC 1WLMA 4CFQA 2WOSA 4GGFC 4ZCVA 4PHMA 4QJ3B 1SR6C 1C7VA 2K61A 1FBVA 3BYAA 2NLNA 3TDIA 2M9GA 4C0KA 3I5IC 4OR9B 4DIRA 5K89A 3VRRA 1YVHA 1UUSA 1RK9A 1B9AA 4DUQA 2Q91A 2I94A 3SG5A 4D1EA 2JZIA 2LMTA 2K0JA 4DCKA 3KF9A 1W7IB 1A2XA 5J3XA 4L9MA 2K7OA 4YGAA 1QV0A 3PLFB 2FOTA 1CMGA 1ZACA 1NUBA 2LANA 2JTZA 3OB2B 1OOJA 1UURA 5IBWA 1J7OA 1QTXA 1CM1A 4HRGA 1F54A 1F4OA 1NX2A 1QIWA 2OTGB 4M2OA 3CWGA 1SCMB 1QX2A 1KFXL 2D8NA 3CR5X 1S26D 1SCVA 1MXLC 2JULA 2CBLA 2Q4UA 1OSAA 2KYCA 3GK4X 5HKZA 3JVTB 1PULA 1NSHA 1B8RA 1KK7Y 3TZ1A 1TCOB 1DJIA 1MHOA 3VRPA 1H8BA 1F71A 1DMOA 2KI4B 1KWOB 2LMUA 2I18A 2OTGC 2LNKA 1SCMC 1J7QA 2NXQA 2LC5A 4AQJA 2O5GA 3OP0A 1UHKA 3JVTC 1FW4A 5HLOA 4XJKA 2BBNA 1UHHA 5AANA 4WQ3A 4USLA 5F6TA 2WCBA 2KI4C 1IKUA 1KWOC 1B47A 1UP5A 1YRUB 2KQ6A 2M3WA 3BUNB 1S5GY 2LLSA 2GV5A 3NSKA 2E30A 3AAJA 5CSNA 3VROA 4DS7A 1K95A 1U5IA 3K21A 1EXRA 4UPGA 5HLVA 4PHKA 1BODA 1J1EA 5HKWA 1RFJA 1PK0D 4QJ5B 2LVKA 5DKQA 1WY9A 2WCEA 1PSBA 4ORCB 1PALA 1SK6D 1XFWO 1CMFA 1XK4A 1YUUA 3O6BA 2P6BB 1A75A 2ZNEA 1Y1AA 3VRNA 2HQWA 1QV1A 1J1DA 4ORAB 3SIBA 1XFUO 2G2BA 2JXCA 2KFFA 1ODBA 3BQ3A 2ZFDA 5JOLA 1V1FA 4PALA 3FS7A 4NDBA 2BL0B 3BUXB 1R2UA 2MLEC 1CFDA 1G4YR 3EVVA 2EGDA 4MSPA 3SG2A 1K94A 2PASA 4M2PA 1SBJA 5CSFA 3BXKA 4PE7A 1M63B 1N0YA 1KFXS 2JRFA 2ZN8A 1MQ1A 4YI8A 3SIAA 2BL0C 1CFCA 1EG3A 5JJGA 2O60A 1QX7A 1S3PA 2MA2A 1XYDA 2BE4A 1CM4A 1KFUS 1JSAA 1PSRA 3DVMA 2E6WA 2WCFA 3SG3A 2AMIA 2M7NA 2LP2A 3DVEA 4QJ4B 1XFXO 2NCPA 3FIAA 3ICBA 4YRUA 1OMVA 1OE9B 1WDCB 4CFRA 1HT9A 1BG1A 4CIDA 1HQVA 3I5HB 2R2IA 2TN4A 5I2OA 2F3YA 4I5NB 2M0RA 1TIZA 4OKHA 1CTRA 1YTZC 2F8PA 3CLNA 1NWDA 1CKKA 2SASA 1TCFA 2Y1NA 1FF1A 1WDCC 1JC2A 1IJ6A 2H61C
chains in the Genus database with same CATH superfamily
2BBMA 2JQ6A 1C07A 5I94A 2K7CA 3BFHA 2LP3A 2LVVA 3I5HC 3AKAA 1XFRA 2L4IA 1AK8A 2JWWA 4WRIA 1C3YA 1GGZA 1DJGA 2WC8A 1TN4A 4CPVA 2PRUA 5B8IB 2MHHA 2K7DA 3HX4A 3FWCA 1M45A 2BECA 4BY4A 2PVBA 3DXLA 1QVIZ 1S36A 3L47A 4PE0A 1SSEB 2K60A 3WNXB 2WCKA 4MLWA 2MLFC 5CSJA 1S6JA 1F55A 4INXA 2Y5IA 3SG7A 1BLQA 1IG5A 1RWYA 3KPXA 2KI6C 1DJHA 3MSEB 1KSOA 1M46A 3CABA 4MVFA 2LLUA 4NDDA 3CZ2A 3NSIA 3EK4A 4NQGA 1QATA 2F2PA 3VRQA 3QRXA 1QX5B 1RROA 1SMGA 3D76A 3GOFA 2HETA 2M8UA 3PN7B 4MZLA 2KGRA 1BF5A 1QWVA 4N1FA 1WLZA 2CNPA 1NP8A 1KFUL 1WRLA 2F3ZA 2QDIA 5DKRA 1OQPA 2QEBA 2QEHA 3E3RA 2LCPA 4XJKB 2WC5A 2CT9A 1CLBA 2AAOA 1UHJA 2Y1MA 3OGNA 1D1OA 2JPTA 3PN7C 1XFVO 2PMYA 2M7LA 1C7WA 1BMOA 4GUKA 3JTDB 4DRWA 1GM0A 1F8HA 3BUWB 1IQ5A 1IGVA 2ERBA 1DJZA 1U5IB 1N2DA 1YUTA 1MR8A 3LK0A 4MZKA 2BCXA 4HSZA 3NGVA 2BAPA 2OS8C 2LVJA 4C0LA 2JT3A 2MRDA 1Y0VH 3BOWA 3CR4X 1MXEA 3TS5B 2A4JA 5HKYA 2GGZA 2KYFA 3JTDC 1M31A 3D0YA 1XVJA 1OOHA 1MWNA 3M0WA 1R6PA 2DOQA 1ZMZA 1CFFA 4HREE 5I8NA 1Y1UA 3I5FB 3TS5C 3OB1B 1GQMA 2L50A 1N65A 1TNXA 4JPZB 1BJFA 1KQVA 2PALA 1QLSA 2AUCA 2L51A 1XK4C 2QEOA 1IH0A 1CB1A 2B1UA 4FTGA 4YI9A 1ZFSA 3B86A 1L7ZA 1CDPA 1SPYA 3KEVA 4HRHA 4I5LB 4ORBB 5BPJA 3WXAA 3NXAA 2V53A 3I5FC 1XA5A 1TWOA 1BOCA 2JC2A 1DF0B 1A4PA 4IL1A 1TOPA 2HF5A 3SS3A 2WC6A 3BFBA 1OMRA 3OX5A 1F70A 1LVCD 3DZTA 1BR4B 1K90D 2LUXA 5FI7A 2HQ8A 3SS5A 1S6CA 1VRKA 2L2CA 3EK8A 2WNDA 5HL1A 3TUYB 1S1EA 3DF0A 4GAOA 1DELA 5PALA 3A4UB 1X02A 3F45A 1EJ3A 1MF8B 1CDLA 2KHNA 4MZJA 4PE1A 2MBXA 2GTEA 1CDMA 3TDZA 1FI5A 1Z2CB 1TRFA 3IQOA 2COLB 1B1GA 2KSPA 2PSRA 3DVKA 2KAXA 1WRKA 2KAYA 1S6IA 1ALWA 3R1PA 1QVIY 1PRWA 3NSLA 1AP4A 3TUYC 2FCDA 1CNPA 1OZSA 4GFTA 3RLZA 1YR5A 1CLMA 4N5XA 2QACA 2M49B 1TTXA 1B8LA 2L5XB 2M29A 2I7AA 3RZSA 2JU0A 3GK1A 1PVAA 3DVJA 1DVIA 4P2YB 1FI6A 3PSRA 2JOJA 2G9BA 1J7PA 1J55A 1XFZO 4A4CA 1BU3A 3R1VA 3KHEA 1KK8B 1T14A 4GNKB 1W9ZA 1TUZA 1EL4A 3EKJA 3PATA 2L2EA 2HPSA 3KO0A 1AUIB 1OOIX 4MN0A 1QLKA 2KQYA 2M1UA 4AOMA 4YGBB 4MRXA 3A8RA 3SJSA 3O78A 3GK2A 4N1GA 1IJ5A 1OOGA 1WRZA 2L0PA 3D73A 4ICBA 1KK8C 3PJIA 1YX8A 3H4SE 4MBEA 1RTP1 5KSZA 4GGFA 1CLLA 1Y6WA 2SCPA 3CS1A 1IRJA 3L4LA 4JKTA 3NHTA 1XFYO 3BJHA 1SYMA 1LA3A 2F2OA 3L4AA 5ER4X 2KPHA 2LM5A 3EG5B 3S0FA 4P5OE 1KQMC 1SL9A 2ZRSA 1DJWA 3OX6A 1K9UA 4INWA 1AHRA 3CR2A 1B7TZ 2KGBC 1NX0A 3UO9A 4C0JA 1KSMA 5KTYA 1IQ3A 2JNFA 4OCIA 1DQEA 3D10A 3OBVA 1EG4A 3CTNA 3QMEA 4U8DA 4Q04A 2LVIA 3FE9A 4PDZA 1NCZA 1QASA 2KDHA 2KFGA 4I5JA 2K2FA 1KCYA 3EVRA 3SG6A 1NYAA 2MAZA 2WCLA 1SL7A 3S0AA 2KAVA 2OS8B 1NIWA 1TUJA 3CGAA 2LMVA 4I5KA 1JF2A 1B4CA 4NDCA 1SRAA 1B8CA 2GGMA 3LL8B 3O4YA 1W7JB 2QPTA 4M2QA 3TDUA 5I2QA 2KBMA 1BT6A 2KOTA 1LA0A 3I5GB 2FCEA 3LCPC 1J7RA 3BOWB 2KLEA 1H4BA 1SKTA 1ZUZA 3BUMB 2L98A 3IVTA 4CLNA 3D0YB 3O2PA 4BY5A 1K9KA 2IS9A 1SL8A 3NSOA 1AVSA 2LHIA 1F4QA 1OZOA 2P70A 1ZOTB 3BUOB 1NX1A 1NX3A 2CCMA 4TNCA 3S0GA 4KYNA 1NCXA 2JNXA 1V1GA 1XO5A 3EK7A 2LV7A 3I5GC 4AQIA 1K2HA 2CXJA 5DICA 1A75B 2BCAA 4ZCUA 3C1VA 3OHMB 5DKNA 4R1EA 5D7FA 1Z4HA 2KNEA 3SG4A 1L2OB 4PHJA 5CPVA 3CYZA 1TNPA 1YURA 2ZRTA 3S0DA 1IWQA 5FYXA 3WHUB 3Q8IA 4MRYA 3K1EA 2WCJA 4ETOA 1JBAA 1G8IA 1K93D 4OVNF 2LHLA 1YX7A 1Y1XA 4YGDB 1A29A 3EVUA 3D75A 1RJVA 4PCWA 1L2OC 2M97A 3DF0B 2EC6B 2Y4QA 4WQ2A 1AJ4A 1KK7Z 4FQOA 1SY9A 1YUSA 1SNLA 3PM8A 4JQ0D 5FI6A 3AKBA 4JWQA 3DD4A 2BKHB 1LKJA 4E68A 4XYNA 2WCHA 3IQQA 5TNCA 1YVLA 5HYDA 5AERA 1MUXA 1NPQA 2WORA 5I2LA 1ORGA 4PT1A 4MEWA 1E8AA 1DJXA 1LXFC 1K8UA 1ALVA 1OMDA 1QXPA 2ISDA 4A4BA 1Q80A 2EC6C 3AAKA 1A03A 1QIVA 3VGOA 2CTNA 3FWBA 2KFHA 1TNQA 3R72A 3RM1A 3IF7A 1LINA 3SS4A 1EH2A 5EL2A 2L4HA 1K96A 3DY9A 4GPLB 2KBIA 2M1KB 2EHBA 2LAPA 2JTTA 1NCYA 1S5GZ 3CZ0A 2RGIA 3EKHA 5KU1A 2K8MB 1DGVA 2OPOA 1CDNA 2ZN9A 3PFVA 3WHTB 1SW8A 4IJ7A 1UHIA 1GGWA 1M39A 1OW4A 2BKIB 2WCMA 3LLEA 4PHNA 1DF0A 4YGEB 1AJ5A 1UWOA 1GJYA 1UHNA 1FPWA 2JT0A 1B7TY 3LK1A 2JXLA 2H2KA 1JUOA 1JF0A 2BCBA 2LUCA 2BE6A 3CDNA 1TNWA 2LE9B 2FJUB 3ZNIA 1DTLA 1PVBA 1BR1B 2LLTA 4GBAA 2ZKMX 1G33A 2VRGA 2ZNDA 3ZWHA 2NCOA 2K7BA 5AXIA 1DEKA 1JFKA 2PQLA 4FQTA 1JWDA 2F33A 1RECA 4PE4A 1JFJA 3HCMA 1CFPA 1KQMB 2KI6D 1DGUA 2NZ0A 3PALA 1SR6B 5G08A 2MJWB 2H8VA 4GGNA 3DYEA 1DJYA 2K2AA 4YGCB 3I5IB 4F0ZB 1K9PA 2H61A 1QS7A 4OV2A 2JT8A 1YRTB 5CSIA 5ER5A 3CZTX 5AFPA 1DT7B 3VB1A 4YBHB 1QJTA 3D78A 5AEQA 5D69A 2I2RE 5GQQC 1WLMA 4CFQA 2WOSA 4GGFC 4ZCVA 4PHMA 4QJ3B 1SR6C 1C7VA 1C3ZA 2K61A 1FBVA 3BYAA 2NLNA 3TDIA 2M9GA 4C0KA 3I5IC 4OR9B 4DIRA 5K89A 3VRRA 1YVHA 1UUSA 3D77A 1RK9A 1B9AA 4F7FA 4DUQA 2Q91A 2I94A 3SG5A 3S0BA 4D1EA 2JZIA 2LMTA 2K0JA 4DCKA 3KF9A 1FF1A 1W7IB 1A2XA 5J3XA 4L9MA 2K7OA 4YGAA 1QV0A 2PYQA 2FOTA 3PLFB 1CMGA 1ZACA 2QEVA 3NHIA 1NUBA 2LANA 2JTZA 3OB2B 1OOJA 1UURA 5IBWA 1J7OA 1QTXA 1CM1A 4HRGA 1F54A 1F4OA 1NX2A 1QIWA 2OTGB 4M2OA 3CWGA 1SCMB 1QX2A 1KFXL 2D8NA 3CR5X 1S26D 1SCVA 1IIOA 1MXLC 2JULA 2CBLA 2Q4UA 1OSAA 2KYCA 3FE6A 3FE8A 3GK4X 3JVTB 5HKZA 2JPOA 1PULA 1NSHA 1B8RA 1KK7Y 3TZ1A 1TCOB 1DJIA 1MHOA 3VRPA 1H8BA 1F71A 1DMOA 2KI4B 1KWOB 2LMUA 2I18A 2OTGC 2LNKA 4JD9A 1SCMC 1J7QA 2NXQA 2LC5A 4AQJA 2O5GA 3OP0A 1UHKA 3JVTC 1FW4A 3B6XA 5HLOA 4XJKA 2BBNA 1UHHA 5AANA 3UNWA 4WQ3A 4USLA 5F6TA 2WCBA 2KI4C 1IKUA 1KWOC 1B47A 1UP5A 1YRUB 2KQ6A 2M3WA 3BUNB 1S5GY 2LLSA 2GV5A 3NSKA 2E30A 3AAJA 3B87A 3PM2A 5CSNA 3VROA 4DS7A 1K95A 1U5IA 3K21A 1EXRA 4UPGA 5FI2A 5HLVA 4PHKA 1BODA 3D74A 1P28A 1J1EA 5HKWA 1RFJA 2FJYA 1PK0D 4QJ5B 2LVKA 5DKQA 3S0EA 1WY9A 2WCEA 1PSBA 4ORCB 1PALA 1SK6D 1XFWO 1CMFA 1XK4A 1YUUA 3O6BA 2P6BB 1A75A 2ZNEA 1Y1AA 3VRNA 2HQWA 1QV1A 1J1DA 2BNXA 4ORAB 3SIBA 1DC1A 1XFUO 2G2BA 2JXCA 2KFFA 1ODBA 3BQ3A 2ZFDA 5JOLA 1V1FA 3B7AA 4PALA 3FS7A 4NDBA 2BL0B 3BUXB 1R2UA 2MLEC 1OOFA 1CFDA 1G4YR 3EVVA 2EGDA 4MSPA 3SG2A 1K94A 2PASA 1LS8A 4M2PA 1SBJA 2YGUA 3O4XA 5CSFA 2KLDA 3BXKA 4PE7A 1M63B 1N0YA 1KFXS 2JRFA 2ZN8A 1MQ1A 4YI8A 3SIAA 2BL0C 1CFCA 1EG3A 5JJGA 2O60A 3R1OA 1QX7A 1S3PA 2MA2A 1XYDA 2BE4A 1CM4A 1KFUS 1JSAA 3N7HA 1PSRA 3DVMA 2E6WA 2P71A 2WCFA 3SG3A 2AMIA 2M7NA 3V2LA 2LP2A 3DVEA 4QJ4B 1XFXO 2NCPA 3FIAA 3ICBA 4YRUA 1OMVA 1OE9B 3B88A 1WDCB 3BFAA 4OZDA 4CFRA 1HT9A 1BG1A 4CIDA 1HQVA 3I5HB 2R2IA 2TN4A 5I2OA 2F3YA 4I5NB 3CZ1A 2M0RA 1TIZA 4OKHA 1CTRA 1YTZC 2F8PA 3CLNA 1NWDA 1CKKA 2L5YA 2SASA 1TCFA 2Y1NA 5D3OA 1WDCC 1JC2A 1IJ6A 2H61C
chains in the Genus database with same CATH topology
2BBMA 2JQ6A 1C07A 2K7CA 2LP3A 2LVVA 3I5HC 3AKAA 2L4IA 1AK8A 2JWWA 4WRIA 1GGZA 1DJGA 2WC8A 1TN4A 4CPVA 2PRUA 5B8IB 2MHHA 2K7DA 3HX4A 3FWCA 1M45A 2BECA 4BY4A 2PVBA 1QVIZ 1S36A 4PE0A 3WNXB 4MLWA 2MLFC 5CSJA 1S6JA 1F55A 2Y5IA 3SG7A 1BLQA 1IG5A 1RWYA 3KPXA 2KI6C 1DJHA 3MSEB 1KSOA 1M46A 4MVFA 4NDDA 2LLUA 3NSIA 3EK4A 4NQGA 1QATA 2F2PA 3VRQA 3QRXA 1QX5B 1RROA 1SMGA 3GOFA 2HETA 2M8UA 3PN7B 4MZLA 2KGRA 1BF5A 4N1FA 1WLZA 2CNPA 1NP8A 1KFUL 1WRLA 2F3ZA 5DKRA 1OQPA 3E3RA 2LCPA 4XJKB 1CLBA 2CT9A 2AAOA 1UHJA 2Y1MA 1D1OA 2JPTA 3PN7C 1XFVO 2PMYA 2M7LA 1C7WA 1BMOA 4GUKA 3JTDB 4DRWA 1F8HA 3BUWB 1IQ5A 1IGVA 1DJZA 1U5IB 1N2DA 1YUTA 1MR8A 3LK0A 4MZKA 2BCXA 4HSZA 2OS8C 2LVJA 4C0LA 2JT3A 2MRDA 1Y0VH 3BOWA 3CR4X 1MXEA 3TS5B 2A4JA 5HKYA 2GGZA 2KYFA 3JTDC 1M31A 3D0YA 1XVJA 1MWNA 3M0WA 1R6PA 2DOQA 1ZMZA 1CFFA 4HREE 5I8NA 1Y1UA 3I5FB 3TS5C 3OB1B 1GQMA 2L50A 1N65A 1TNXA 4JPZB 1BJFA 1KQVA 2PALA 1QLSA 2AUCA 2L51A 1XK4C 1IH0A 1CB1A 2B1UA 4FTGA 4YI9A 1ZFSA 1L7ZA 1CDPA 1SPYA 3KEVA 4HRHA 4I5LB 4ORBB 5BPJA 3WXAA 3NXAA 2V53A 3I5FC 1XA5A 1BOCA 2JC2A 1DF0B 1A4PA 4IL1A 1TOPA 2HF5A 1OMRA 3OX5A 1F70A 1LVCD 1BR4B 1K90D 2LUXA 2HQ8A 1S6CA 1VRKA 3EK8A 2WNDA 3TUYB 1S1EA 3DF0A 4GAOA 5PALA 3A4UB 1X02A 3F45A 1EJ3A 1MF8B 1CDLA 2KHNA 4MZJA 4PE1A 2MBXA 3TDZA 1CDMA 1FI5A 1TRFA 3IQOA 2COLB 1B1GA 2KSPA 2PSRA 3DVKA 2KAXA 1WRKA 2KAYA 1S6IA 1ALWA 1QVIY 1PRWA 3NSLA 1AP4A 3TUYC 2FCDA 1CNPA 1OZSA 4GFTA 3RLZA 1YR5A 1CLMA 4N5XA 2QACA 2M49B 1TTXA 1B8LA 2L5XB 2M29A 2I7AA 2JU0A 3GK1A 1PVAA 3DVJA 1DVIA 4P2YB 1FI6A 3PSRA 2JOJA 2G9BA 1J7PA 1J55A 1XFZO 4A4CA 1BU3A 3KHEA 1KK8B 4GNKB 1EL4A 3EKJA 3PATA 2L2EA 2HPSA 3KO0A 1AUIB 4MN0A 1QLKA 2KQYA 2M1UA 4AOMA 4YGBB 4MRXA 3A8RA 3SJSA 3O78A 3GK2A 4N1GA 1IJ5A 1WRZA 2L0PA 4ICBA 1KK8C 1YX8A 3H4SE 4MBEA 1RTP1 5KSZA 4GGFA 1CLLA 1Y6WA 2SCPA 3CS1A 1IRJA 1XFYO 1SYMA 1LA3A 2F2OA 5ER4X 2LM5A 4P5OE 1KQMC 1SL9A 2ZRSA 1DJWA 3OX6A 1K9UA 1AHRA 3CR2A 1B7TZ 2KGBC 1NX0A 4C0JA 1KSMA 5KTYA 1IQ3A 2JNFA 4OCIA 3D10A 1EG4A 3CTNA 4U8DA 4Q04A 2LVIA 4PDZA 1NCZA 1QASA 2KDHA 2KFGA 4I5JA 2K2FA 1KCYA 3EVRA 3SG6A 1NYAA 2MAZA 1SL7A 2KAVA 2OS8B 1NIWA 4I5KA 3CGAA 2LMVA 1B4CA 1JF2A 4NDCA 1SRAA 1B8CA 2GGMA 3LL8B 3O4YA 1W7JB 2QPTA 4M2QA 3TDUA 5I2QA 2KBMA 1BT6A 2KOTA 1LA0A 3I5GB 2FCEA 3LCPC 1J7RA 3BOWB 1H4BA 1SKTA 1ZUZA 3BUMB 2L98A 4CLNA 3D0YB 3O2PA 4BY5A 1K9KA 2IS9A 1SL8A 3NSOA 1AVSA 2LHIA 1F4QA 1OZOA 1ZOTB 3BUOB 1NX1A 1NX3A 2CCMA 4TNCA 1NCXA 2JNXA 1V1GA 1XO5A 3EK7A 2LV7A 3I5GC 4AQIA 1K2HA 2CXJA 1A75B 2BCAA 4ZCUA 3C1VA 3OHMB 5DKNA 4R1EA 5D7FA 2KNEA 3SG4A 1L2OB 4PHJA 5CPVA 1TNPA 1YURA 2ZRTA 1IWQA 5FYXA 3WHUB 4MRYA 4ETOA 1JBAA 1G8IA 1K93D 4OVNF 2LHLA 1YX7A 1Y1XA 4YGDB 1A29A 3EVUA 1RJVA 4PCWA 1L2OC 2M97A 3DF0B 2EC6B 2Y4QA 4WQ2A 1AJ4A 1KK7Z 4FQOA 1SY9A 1YUSA 1SNLA 3PM8A 4JQ0D 3AKBA 4JWQA 3DD4A 2BKHB 1LKJA 4E68A 4XYNA 3IQQA 5HYDA 5TNCA 1YVLA 5AERA 1MUXA 1NPQA 2WORA 5I2LA 4MEWA 1E8AA 1DJXA 1LXFC 1K8UA 1ALVA 1OMDA 1QXPA 2ISDA 4A4BA 1Q80A 2EC6C 3AAKA 1A03A 1QIVA 3VGOA 2CTNA 3FWBA 2KFHA 1TNQA 3RM1A 3IF7A 1LINA 1EH2A 2L4HA 1K96A 4GPLB 2KBIA 2M1KB 2EHBA 2LAPA 2JTTA 1NCYA 1S5GZ 2RGIA 3EKHA 5KU1A 2K8MB 1DGVA 2OPOA 1CDNA 2ZN9A 3PFVA 3WHTB 1SW8A 1UHIA 1GGWA 1M39A 2BKIB 3LLEA 4PHNA 1DF0A 4YGEB 1AJ5A 1UWOA 1GJYA 1UHNA 1FPWA 2JT0A 1B7TY 3LK1A 2JXLA 2H2KA 1JUOA 1JF0A 2BCBA 2LUCA 2BE6A 1TNWA 2LE9B 2FJUB 3ZNIA 1DTLA 1PVBA 1BR1B 2LLTA 4GBAA 2ZKMX 1G33A 2VRGA 2ZNDA 3ZWHA 2NCOA 2K7BA 5AXIA 1JWDA 1JFKA 2F33A 1RECA 4PE4A 1JFJA 3HCMA 1CFPA 1KQMB 2KI6D 1DGUA 2NZ0A 3PALA 1SR6B 5G08A 2MJWB 4GGNA 1DJYA 2K2AA 4YGCB 3I5IB 4F0ZB 1K9PA 2H61A 1QS7A 4OV2A 2JT8A 1YRTB 5CSIA 5ER5A 3CZTX 5AFPA 1DT7B 4YBHB 1QJTA 5AEQA 5D69A 2I2RE 5GQQC 1WLMA 4CFQA 2WOSA 4GGFC 4ZCVA 4PHMA 4QJ3B 1SR6C 1C7VA 2K61A 1FBVA 3BYAA 2NLNA 3TDIA 2M9GA 4C0KA 3I5IC 4OR9B 4DIRA 5K89A 3VRRA 1YVHA 1UUSA 1RK9A 1B9AA 4DUQA 2Q91A 2I94A 3SG5A 4D1EA 2JZIA 2LMTA 2K0JA 4DCKA 3KF9A 1W7IB 1A2XA 5J3XA 4L9MA 2K7OA 4YGAA 1QV0A 3PLFB 2FOTA 1CMGA 1ZACA 1NUBA 2LANA 2JTZA 3OB2B 1OOJA 1UURA 5IBWA 1J7OA 1QTXA 1CM1A 4HRGA 1F54A 1F4OA 1NX2A 1QIWA 2OTGB 4M2OA 3CWGA 1SCMB 1QX2A 1KFXL 2D8NA 3CR5X 1S26D 1SCVA 1MXLC 2JULA 2CBLA 2Q4UA 1OSAA 2KYCA 3GK4X 5HKZA 3JVTB 1PULA 1NSHA 1B8RA 1KK7Y 3TZ1A 1TCOB 1DJIA 1MHOA 3VRPA 1H8BA 1F71A 1DMOA 2KI4B 1KWOB 2LMUA 2I18A 2OTGC 2LNKA 1SCMC 1J7QA 2NXQA 2LC5A 4AQJA 2O5GA 3OP0A 1UHKA 3JVTC 1FW4A 5HLOA 4XJKA 2BBNA 1UHHA 5AANA 4WQ3A 4USLA 5F6TA 2WCBA 2KI4C 1IKUA 1KWOC 1B47A 1UP5A 1YRUB 2KQ6A 2M3WA 3BUNB 1S5GY 2LLSA 2GV5A 3NSKA 2E30A 3AAJA 5CSNA 3VROA 4DS7A 1K95A 1U5IA 3K21A 1EXRA 4UPGA 5HLVA 4PHKA 1BODA 1J1EA 5HKWA 1RFJA 1PK0D 4QJ5B 2LVKA 5DKQA 1WY9A 2WCEA 1PSBA 4ORCB 1PALA 1SK6D 1XFWO 1CMFA 1XK4A 1YUUA 3O6BA 2P6BB 1A75A 2ZNEA 1Y1AA 3VRNA 2HQWA 1QV1A 1J1DA 4ORAB 3SIBA 1XFUO 2G2BA 2JXCA 2KFFA 1ODBA 3BQ3A 2ZFDA 5JOLA 1V1FA 4PALA 3FS7A 4NDBA 2BL0B 3BUXB 1R2UA 2MLEC 1CFDA 1G4YR 3EVVA 2EGDA 4MSPA 3SG2A 1K94A 2PASA 4M2PA 1SBJA 5CSFA 3BXKA 4PE7A 1M63B 1N0YA 1KFXS 2JRFA 2ZN8A 1MQ1A 4YI8A 3SIAA 2BL0C 1CFCA 1EG3A 5JJGA 2O60A 1QX7A 1S3PA 2MA2A 1XYDA 2BE4A 1CM4A 1KFUS 1JSAA 1PSRA 3DVMA 2E6WA 2WCFA 3SG3A 2AMIA 2M7NA 2LP2A 3DVEA 4QJ4B 1XFXO 2NCPA 3FIAA 3ICBA 4YRUA 1OMVA 1OE9B 1WDCB 4CFRA 1HT9A 1BG1A 4CIDA 1HQVA 3I5HB 2R2IA 2TN4A 5I2OA 2F3YA 4I5NB 2M0RA 1TIZA 4OKHA 1CTRA 1YTZC 2F8PA 3CLNA 1NWDA 1CKKA 2SASA 1TCFA 2Y1NA 1FF1A 1WDCC 1JC2A 1IJ6A 2H61C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BBM A;  2JQ6 A;  1C07 A;  2K7C A;  2LP3 A;  2LVV A;  3I5H C;  3AKA A;  2L4I A;  1AK8 A;  2JWW A;  4WRI A;  1GGZ A;  1DJG A;  2WC8 A;  1TN4 A;  4CPV A;  2PRU A;  5B8I B;  2MHH A;  2K7D A;  3HX4 A;  3FWC A;  1M45 A;  2BEC A;  4BY4 A;  2PVB A;  1QVI Z;  1S36 A;  4PE0 A;  3WNX B;  4MLW A;  2MLF C;  5CSJ A;  1S6J A;  1F55 A;  2Y5I A;  3SG7 A;  1BLQ A;  1IG5 A;  1RWY A;  3KPX A;  2KI6 C;  1DJH A;  3MSE B;  1KSO A;  1M46 A;  4MVF A;  4NDD A;  2LLU A;  3NSI A;  3EK4 A;  4NQG A;  1QAT A;  2F2P A;  3VRQ A;  3QRX A;  1QX5 B;  1RRO A;  1SMG A;  3GOF A;  2HET A;  2M8U A;  3PN7 B;  4MZL A;  2KGR A;  1BF5 A;  4N1F A;  1WLZ A;  2CNP A;  1NP8 A;  1KFU L;  1WRL A;  2F3Z A;  5DKR A;  1OQP A;  3E3R A;  2LCP A;  4XJK B;  1CLB A;  2CT9 A;  2AAO A;  1UHJ A;  2Y1M A;  1D1O A;  2JPT A;  3PN7 C;  1XFV O;  2PMY A;  2M7L A;  1C7W A;  1BMO A;  4GUK A;  3JTD B;  4DRW A;  1F8H A;  3BUW B;  1IQ5 A;  1IGV A;  1DJZ A;  1U5I B;  1N2D A;  1YUT A;  1MR8 A;  3LK0 A;  4MZK A;  2BCX A;  4HSZ A;  2OS8 C;  2LVJ A;  4C0L A;  2JT3 A;  2MRD A;  1Y0V H;  3BOW A;  3CR4 X;  1MXE A;  3TS5 B;  2A4J A;  5HKY A;  2GGZ A;  2KYF A;  3JTD C;  1M31 A;  3D0Y A;  1XVJ A;  1MWN A;  3M0W A;  1R6P A;  2DOQ A;  1ZMZ A;  1CFF A;  4HRE E;  5I8N A;  1Y1U A;  3I5F B;  3TS5 C;  3OB1 B;  1GQM A;  2L50 A;  1N65 A;  1TNX A;  4JPZ B;  1BJF A;  1KQV A;  2PAL A;  1QLS A;  2AUC A;  2L51 A;  1XK4 C;  1IH0 A;  1CB1 A;  2B1U A;  4FTG A;  4YI9 A;  1ZFS A;  1L7Z A;  1CDP A;  1SPY A;  3KEV A;  4HRH A;  4I5L B;  4ORB B;  5BPJ A;  3WXA A;  3NXA A;  2V53 A;  3I5F C;  1XA5 A;  1BOC A;  2JC2 A;  1DF0 B;  1A4P A;  4IL1 A;  1TOP A;  2HF5 A;  1OMR A;  3OX5 A;  1F70 A;  1LVC D;  1BR4 B;  1K90 D;  2LUX A;  2HQ8 A;  1S6C A;  1VRK A;  3EK8 A;  2WND A;  3TUY B;  1S1E A;  3DF0 A;  4GAO A;  5PAL A;  3A4U B;  1X02 A;  3F45 A;  1EJ3 A;  1MF8 B;  1CDL A;  2KHN A;  4MZJ A;  4PE1 A;  2MBX A;  3TDZ A;  1CDM A;  1FI5 A;  1TRF A;  3IQO A;  2COL B;  1B1G A;  2KSP A;  2PSR A;  3DVK A;  2KAX A;  1WRK A;  2KAY A;  1S6I A;  1ALW A;  1QVI Y;  1PRW A;  3NSL A;  1AP4 A;  3TUY C;  2FCD A;  1CNP A;  1OZS A;  4GFT A;  3RLZ A;  1YR5 A;  1CLM A;  4N5X A;  2QAC A;  2M49 B;  1TTX A;  1B8L A;  2L5X B;  2M29 A;  2I7A A;  2JU0 A;  3GK1 A;  1PVA A;  3DVJ A;  1DVI A;  4P2Y B;  1FI6 A;  3PSR A;  2JOJ A;  2G9B A;  1J7P A;  1J55 A;  1XFZ O;  4A4C A;  1BU3 A;  3KHE A;  1KK8 B;  4GNK B;  1EL4 A;  3EKJ A;  3PAT A;  2L2E A;  2HPS A;  3KO0 A;  1AUI B;  4MN0 A;  1QLK A;  2KQY A;  2M1U A;  4AOM A;  4YGB B;  4MRX A;  3A8R A;  3SJS A;  3O78 A;  3GK2 A;  4N1G A;  1IJ5 A;  1WRZ A;  2L0P A;  4ICB A;  1KK8 C;  1YX8 A;  3H4S E;  4MBE A;  1RTP 1;  5KSZ A;  4GGF A;  1CLL A;  1Y6W A;  2SCP A;  3CS1 A;  1IRJ A;  1XFY O;  1SYM A;  1LA3 A;  2F2O A;  5ER4 X;  2LM5 A;  4P5O E;  1KQM C;  1SL9 A;  2ZRS A;  1DJW A;  3OX6 A;  1K9U A;  1AHR A;  3CR2 A;  1B7T Z;  2KGB C;  1NX0 A;  4C0J A;  1KSM A;  5KTY A;  1IQ3 A;  2JNF A;  4OCI A;  3D10 A;  1EG4 A;  3CTN A;  4U8D A;  4Q04 A;  2LVI A;  4PDZ A;  1NCZ A;  1QAS A;  2KDH A;  2KFG A;  4I5J A;  2K2F A;  1KCY A;  3EVR A;  3SG6 A;  1NYA A;  2MAZ A;  1SL7 A;  2KAV A;  2OS8 B;  1NIW A;  4I5K A;  3CGA A;  2LMV A;  1B4C A;  1JF2 A;  4NDC A;  1SRA A;  1B8C A;  2GGM A;  3LL8 B;  3O4Y A;  1W7J B;  2QPT A;  4M2Q A;  3TDU A;  5I2Q A;  2KBM A;  1BT6 A;  2KOT A;  1LA0 A;  3I5G B;  2FCE A;  3LCP C;  1J7R A;  3BOW B;  1H4B A;  1SKT A;  1ZUZ A;  3BUM B;  2L98 A;  4CLN A;  3D0Y B;  3O2P A;  4BY5 A;  1K9K A;  2IS9 A;  1SL8 A;  3NSO A;  1AVS A;  2LHI A;  1F4Q A;  1OZO A;  1ZOT B;  3BUO B;  1NX1 A;  1NX3 A;  2CCM A;  4TNC A;  1NCX A;  2JNX A;  1V1G A;  1XO5 A;  3EK7 A;  2LV7 A;  3I5G C;  4AQI A;  1K2H A;  2CXJ A;  1A75 B;  2BCA A;  4ZCU A;  3C1V A;  3OHM B;  5DKN A;  4R1E A;  5D7F A;  2KNE A;  3SG4 A;  1L2O B;  4PHJ A;  5CPV A;  1TNP A;  1YUR A;  2ZRT A;  1IWQ A;  5FYX A;  3WHU B;  4MRY A;  4ETO A;  1JBA A;  1G8I A;  1K93 D;  4OVN F;  2LHL A;  1YX7 A;  1Y1X A;  4YGD B;  1A29 A;  3EVU A;  1RJV A;  4PCW A;  1L2O C;  2M97 A;  3DF0 B;  2EC6 B;  2Y4Q A;  4WQ2 A;  1AJ4 A;  1KK7 Z;  4FQO A;  1SY9 A;  1YUS A;  1SNL A;  3PM8 A;  4JQ0 D;  3AKB A;  4JWQ A;  3DD4 A;  2BKH B;  1LKJ A;  4E68 A;  4XYN A;  3IQQ A;  5HYD A;  5TNC A;  1YVL A;  5AER A;  1MUX A;  1NPQ A;  2WOR A;  5I2L A;  4MEW A;  1E8A A;  1DJX A;  1LXF C;  1K8U A;  1ALV A;  1OMD A;  1QXP A;  2ISD A;  4A4B A;  1Q80 A;  2EC6 C;  3AAK A;  1A03 A;  1QIV A;  3VGO A;  2CTN A;  3FWB A;  2KFH A;  1TNQ A;  3RM1 A;  3IF7 A;  1LIN A;  1EH2 A;  2L4H A;  1K96 A;  4GPL B;  2KBI A;  2M1K B;  2EHB A;  2LAP A;  2JTT A;  1NCY A;  1S5G Z;  2RGI A;  3EKH A;  5KU1 A;  2K8M B;  1DGV A;  2OPO A;  1CDN A;  2ZN9 A;  3PFV A;  3WHT B;  1SW8 A;  1UHI A;  1GGW A;  1M39 A;  2BKI B;  3LLE A;  4PHN A;  1DF0 A;  4YGE B;  1AJ5 A;  1UWO A;  1GJY A;  1UHN A;  1FPW A;  2JT0 A;  1B7T Y;  3LK1 A;  2JXL A;  2H2K A;  1JUO A;  1JF0 A;  2BCB A;  2LUC A;  2BE6 A;  1TNW A;  2LE9 B;  2FJU B;  3ZNI A;  1DTL A;  1PVB A;  1BR1 B;  2LLT A;  4GBA A;  2ZKM X;  1G33 A;  2VRG A;  2ZND A;  3ZWH A;  2NCO A;  2K7B A;  5AXI A;  1JWD A;  1JFK A;  2F33 A;  1REC A;  4PE4 A;  1JFJ A;  3HCM A;  1CFP A;  1KQM B;  2KI6 D;  1DGU A;  2NZ0 A;  3PAL A;  1SR6 B;  5G08 A;  2MJW B;  4GGN A;  1DJY A;  2K2A A;  4YGC B;  3I5I B;  4F0Z B;  1K9P A;  2H61 A;  1QS7 A;  4OV2 A;  2JT8 A;  1YRT B;  5CSI A;  5ER5 A;  3CZT X;  5AFP A;  1DT7 B;  4YBH B;  1QJT A;  5AEQ A;  5D69 A;  2I2R E;  5GQQ C;  1WLM A;  4CFQ A;  2WOS A;  4GGF C;  4ZCV A;  4PHM A;  4QJ3 B;  1SR6 C;  1C7V A;  2K61 A;  1FBV A;  3BYA A;  2NLN A;  3TDI A;  2M9G A;  4C0K A;  3I5I C;  4OR9 B;  4DIR A;  5K89 A;  3VRR A;  1YVH A;  1UUS A;  1RK9 A;  1B9A A;  4DUQ A;  2Q91 A;  2I94 A;  3SG5 A;  4D1E A;  2JZI A;  2LMT A;  2K0J A;  4DCK A;  3KF9 A;  1W7I B;  1A2X A;  5J3X A;  4L9M A;  2K7O A;  4YGA A;  1QV0 A;  3PLF B;  2FOT A;  1CMG A;  1ZAC A;  1NUB A;  2LAN A;  2JTZ A;  3OB2 B;  1OOJ A;  1UUR A;  5IBW A;  1J7O A;  1QTX A;  1CM1 A;  4HRG A;  1F54 A;  1F4O A;  1NX2 A;  1QIW A;  2OTG B;  4M2O A;  3CWG A;  1SCM B;  1QX2 A;  1KFX L;  2D8N A;  3CR5 X;  1S26 D;  1SCV A;  1MXL C;  2JUL A;  2CBL A;  2Q4U A;  1OSA A;  2KYC A;  3GK4 X;  5HKZ A;  3JVT B;  1PUL A;  1NSH A;  1B8R A;  1KK7 Y;  3TZ1 A;  1TCO B;  1DJI A;  1MHO A;  3VRP A;  1H8B A;  1F71 A;  1DMO A;  2KI4 B;  1KWO B;  2LMU A;  2I18 A;  2OTG C;  2LNK A;  1SCM C;  1J7Q A;  2NXQ A;  2LC5 A;  4AQJ A;  2O5G A;  3OP0 A;  1UHK A;  3JVT C;  1FW4 A;  5HLO A;  4XJK A;  2BBN A;  1UHH A;  5AAN A;  4WQ3 A;  4USL A;  5F6T A;  2WCB A;  2KI4 C;  1IKU A;  1KWO C;  1B47 A;  1UP5 A;  1YRU B;  2KQ6 A;  2M3W A;  3BUN B;  1S5G Y;  2LLS A;  2GV5 A;  3NSK A;  2E30 A;  3AAJ A;  5CSN A;  3VRO A;  4DS7 A;  1K95 A;  1U5I A;  3K21 A;  1EXR A;  4UPG A;  5HLV A;  4PHK A;  1BOD A;  1J1E A;  5HKW A;  1RFJ A;  1PK0 D;  4QJ5 B;  2LVK A;  5DKQ A;  1WY9 A;  2WCE A;  1PSB A;  4ORC B;  1PAL A;  1SK6 D;  1XFW O;  1CMF A;  1XK4 A;  1YUU A;  3O6B A;  2P6B B;  1A75 A;  2ZNE A;  1Y1A A;  3VRN A;  2HQW A;  1QV1 A;  1J1D A;  4ORA B;  3SIB A;  1XFU O;  2G2B A;  2JXC A;  2KFF A;  1ODB A;  3BQ3 A;  2ZFD A;  5JOL A;  1V1F A;  4PAL A;  3FS7 A;  4NDB A;  2BL0 B;  3BUX B;  1R2U A;  2MLE C;  1CFD A;  1G4Y R;  3EVV A;  2EGD A;  4MSP A;  3SG2 A;  1K94 A;  2PAS A;  4M2P A;  1SBJ A;  5CSF A;  3BXK A;  4PE7 A;  1M63 B;  1N0Y A;  1KFX S;  2JRF A;  2ZN8 A;  1MQ1 A;  4YI8 A;  3SIA A;  2BL0 C;  1CFC A;  1EG3 A;  5JJG A;  2O60 A;  1QX7 A;  1S3P A;  2MA2 A;  1XYD A;  2BE4 A;  1CM4 A;  1KFU S;  1JSA A;  1PSR A;  3DVM A;  2E6W A;  2WCF A;  3SG3 A;  2AMI A;  2M7N A;  2LP2 A;  3DVE A;  4QJ4 B;  1XFX O;  2NCP A;  3FIA A;  3ICB A;  4YRU A;  1OMV A;  1OE9 B;  1WDC B;  4CFR A;  1HT9 A;  1BG1 A;  4CID A;  1HQV A;  3I5H B;  2R2I A;  2TN4 A;  5I2O A;  2F3Y A;  4I5N B;  2M0R A;  1TIZ A;  4OKH A;  1CTR A;  1YTZ C;  2F8P A;  3CLN A;  1NWD A;  1CKK A;  2SAS A;  1TCF A;  2Y1N A;  1FF1 A;  1WDC C;  1JC2 A;  1IJ6 A;  2H61 C; 
#chains in the Genus database with same CATH topology
 2BBM A;  2JQ6 A;  1C07 A;  5I94 A;  2K7C A;  3BFH A;  2LP3 A;  2LVV A;  3I5H C;  3AKA A;  1XFR A;  2L4I A;  1AK8 A;  2JWW A;  4WRI A;  1C3Y A;  1GGZ A;  1DJG A;  2WC8 A;  1TN4 A;  4CPV A;  2PRU A;  5B8I B;  2MHH A;  2K7D A;  3HX4 A;  3FWC A;  1M45 A;  2BEC A;  4BY4 A;  2PVB A;  3DXL A;  1QVI Z;  1S36 A;  3L47 A;  4PE0 A;  1SSE B;  2K60 A;  3WNX B;  2WCK A;  4MLW A;  2MLF C;  5CSJ A;  1S6J A;  1F55 A;  4INX A;  2Y5I A;  3SG7 A;  1BLQ A;  1IG5 A;  1RWY A;  3KPX A;  2KI6 C;  1DJH A;  3MSE B;  1KSO A;  1M46 A;  3CAB A;  4MVF A;  2LLU A;  4NDD A;  3CZ2 A;  3NSI A;  3EK4 A;  4NQG A;  1QAT A;  2F2P A;  3VRQ A;  3QRX A;  1QX5 B;  1RRO A;  1SMG A;  3D76 A;  3GOF A;  2HET A;  2M8U A;  3PN7 B;  4MZL A;  2KGR A;  1BF5 A;  1QWV A;  4N1F A;  1WLZ A;  2CNP A;  1NP8 A;  1KFU L;  1WRL A;  2F3Z A;  2QDI A;  5DKR A;  1OQP A;  2QEB A;  2QEH A;  3E3R A;  2LCP A;  4XJK B;  2WC5 A;  2CT9 A;  1CLB A;  2AAO A;  1UHJ A;  2Y1M A;  3OGN A;  1D1O A;  2JPT A;  3PN7 C;  1XFV O;  2PMY A;  2M7L A;  1C7W A;  1BMO A;  4GUK A;  3JTD B;  4DRW A;  1GM0 A;  1F8H A;  3BUW B;  1IQ5 A;  1IGV A;  2ERB A;  1DJZ A;  1U5I B;  1N2D A;  1YUT A;  1MR8 A;  3LK0 A;  4MZK A;  2BCX A;  4HSZ A;  3NGV A;  2BAP A;  2OS8 C;  2LVJ A;  4C0L A;  2JT3 A;  2MRD A;  1Y0V H;  3BOW A;  3CR4 X;  1MXE A;  3TS5 B;  2A4J A;  5HKY A;  2GGZ A;  2KYF A;  3JTD C;  1M31 A;  3D0Y A;  1XVJ A;  1OOH A;  1MWN A;  3M0W A;  1R6P A;  2DOQ A;  1ZMZ A;  1CFF A;  4HRE E;  5I8N A;  1Y1U A;  3I5F B;  3TS5 C;  3OB1 B;  1GQM A;  2L50 A;  1N65 A;  1TNX A;  4JPZ B;  1BJF A;  1KQV A;  2PAL A;  1QLS A;  2AUC A;  2L51 A;  1XK4 C;  2QEO A;  1IH0 A;  1CB1 A;  2B1U A;  4FTG A;  4YI9 A;  1ZFS A;  3B86 A;  1L7Z A;  1CDP A;  1SPY A;  3KEV A;  4HRH A;  4I5L B;  4ORB B;  5BPJ A;  3WXA A;  3NXA A;  2V53 A;  3I5F C;  1XA5 A;  1TWO A;  1BOC A;  2JC2 A;  1DF0 B;  1A4P A;  4IL1 A;  1TOP A;  2HF5 A;  3SS3 A;  2WC6 A;  3BFB A;  1OMR A;  3OX5 A;  1F70 A;  1LVC D;  3DZT A;  1BR4 B;  1K90 D;  2LUX A;  5FI7 A;  2HQ8 A;  3SS5 A;  1S6C A;  1VRK A;  2L2C A;  3EK8 A;  2WND A;  5HL1 A;  3TUY B;  1S1E A;  3DF0 A;  4GAO A;  1DEL A;  5PAL A;  3A4U B;  1X02 A;  3F45 A;  1EJ3 A;  1MF8 B;  1CDL A;  2KHN A;  4MZJ A;  4PE1 A;  2MBX A;  2GTE A;  1CDM A;  3TDZ A;  1FI5 A;  1Z2C B;  1TRF A;  3IQO A;  2COL B;  1B1G A;  2KSP A;  2PSR A;  3DVK A;  2KAX A;  1WRK A;  2KAY A;  1S6I A;  1ALW A;  3R1P A;  1QVI Y;  1PRW A;  3NSL A;  1AP4 A;  3TUY C;  2FCD A;  1CNP A;  1OZS A;  4GFT A;  3RLZ A;  1YR5 A;  1CLM A;  4N5X A;  2QAC A;  2M49 B;  1TTX A;  1B8L A;  2L5X B;  2M29 A;  2I7A A;  3RZS A;  2JU0 A;  3GK1 A;  1PVA A;  3DVJ A;  1DVI A;  4P2Y B;  1FI6 A;  3PSR A;  2JOJ A;  2G9B A;  1J7P A;  1J55 A;  1XFZ O;  4A4C A;  1BU3 A;  3R1V A;  3KHE A;  1KK8 B;  1T14 A;  4GNK B;  1W9Z A;  1TUZ A;  1EL4 A;  3EKJ A;  3PAT A;  2L2E A;  2HPS A;  3KO0 A;  1AUI B;  1OOI X;  4MN0 A;  1QLK A;  2KQY A;  2M1U A;  4AOM A;  4YGB B;  4MRX A;  3A8R A;  3SJS A;  3O78 A;  3GK2 A;  4N1G A;  1IJ5 A;  1OOG A;  1WRZ A;  2L0P A;  3D73 A;  4ICB A;  1KK8 C;  3PJI A;  1YX8 A;  3H4S E;  4MBE A;  1RTP 1;  5KSZ A;  4GGF A;  1CLL A;  1Y6W A;  2SCP A;  3CS1 A;  1IRJ A;  3L4L A;  4JKT A;  3NHT A;  1XFY O;  3BJH A;  1SYM A;  1LA3 A;  2F2O A;  3L4A A;  5ER4 X;  2KPH A;  2LM5 A;  3EG5 B;  3S0F A;  4P5O E;  1KQM C;  1SL9 A;  2ZRS A;  1DJW A;  3OX6 A;  1K9U A;  4INW A;  1AHR A;  3CR2 A;  1B7T Z;  2KGB C;  1NX0 A;  3UO9 A;  4C0J A;  1KSM A;  5KTY A;  1IQ3 A;  2JNF A;  4OCI A;  1DQE A;  3D10 A;  3OBV A;  1EG4 A;  3CTN A;  3QME A;  4U8D A;  4Q04 A;  2LVI A;  3FE9 A;  4PDZ A;  1NCZ A;  1QAS A;  2KDH A;  2KFG A;  4I5J A;  2K2F A;  1KCY A;  3EVR A;  3SG6 A;  1NYA A;  2MAZ A;  2WCL A;  1SL7 A;  3S0A A;  2KAV A;  2OS8 B;  1NIW A;  1TUJ A;  3CGA A;  2LMV A;  4I5K A;  1JF2 A;  1B4C A;  4NDC A;  1SRA A;  1B8C A;  2GGM A;  3LL8 B;  3O4Y A;  1W7J B;  2QPT A;  4M2Q A;  3TDU A;  5I2Q A;  2KBM A;  1BT6 A;  2KOT A;  1LA0 A;  3I5G B;  2FCE A;  3LCP C;  1J7R A;  3BOW B;  2KLE A;  1H4B A;  1SKT A;  1ZUZ A;  3BUM B;  2L98 A;  3IVT A;  4CLN A;  3D0Y B;  3O2P A;  4BY5 A;  1K9K A;  2IS9 A;  1SL8 A;  3NSO A;  1AVS A;  2LHI A;  1F4Q A;  1OZO A;  2P70 A;  1ZOT B;  3BUO B;  1NX1 A;  1NX3 A;  2CCM A;  4TNC A;  3S0G A;  4KYN A;  1NCX A;  2JNX A;  1V1G A;  1XO5 A;  3EK7 A;  2LV7 A;  3I5G C;  4AQI A;  1K2H A;  2CXJ A;  5DIC A;  1A75 B;  2BCA A;  4ZCU A;  3C1V A;  3OHM B;  5DKN A;  4R1E A;  5D7F A;  1Z4H A;  2KNE A;  3SG4 A;  1L2O B;  4PHJ A;  5CPV A;  3CYZ A;  1TNP A;  1YUR A;  2ZRT A;  3S0D A;  1IWQ A;  5FYX A;  3WHU B;  3Q8I A;  4MRY A;  3K1E A;  2WCJ A;  4ETO A;  1JBA A;  1G8I A;  1K93 D;  4OVN F;  2LHL A;  1YX7 A;  1Y1X A;  4YGD B;  1A29 A;  3EVU A;  3D75 A;  1RJV A;  4PCW A;  1L2O C;  2M97 A;  3DF0 B;  2EC6 B;  2Y4Q A;  4WQ2 A;  1AJ4 A;  1KK7 Z;  4FQO A;  1SY9 A;  1YUS A;  1SNL A;  3PM8 A;  4JQ0 D;  5FI6 A;  3AKB A;  4JWQ A;  3DD4 A;  2BKH B;  1LKJ A;  4E68 A;  4XYN A;  2WCH A;  3IQQ A;  5TNC A;  1YVL A;  5HYD A;  5AER A;  1MUX A;  1NPQ A;  2WOR A;  5I2L A;  1ORG A;  4PT1 A;  4MEW A;  1E8A A;  1DJX A;  1LXF C;  1K8U A;  1ALV A;  1OMD A;  1QXP A;  2ISD A;  4A4B A;  1Q80 A;  2EC6 C;  3AAK A;  1A03 A;  1QIV A;  3VGO A;  2CTN A;  3FWB A;  2KFH A;  1TNQ A;  3R72 A;  3RM1 A;  3IF7 A;  1LIN A;  3SS4 A;  1EH2 A;  5EL2 A;  2L4H A;  1K96 A;  3DY9 A;  4GPL B;  2KBI A;  2M1K B;  2EHB A;  2LAP A;  2JTT A;  1NCY A;  1S5G Z;  3CZ0 A;  2RGI A;  3EKH A;  5KU1 A;  2K8M B;  1DGV A;  2OPO A;  1CDN A;  2ZN9 A;  3PFV A;  3WHT B;  1SW8 A;  4IJ7 A;  1UHI A;  1GGW A;  1M39 A;  1OW4 A;  2BKI B;  2WCM A;  3LLE A;  4PHN A;  1DF0 A;  4YGE B;  1AJ5 A;  1UWO A;  1GJY A;  1UHN A;  1FPW A;  2JT0 A;  1B7T Y;  3LK1 A;  2JXL A;  2H2K A;  1JUO A;  1JF0 A;  2BCB A;  2LUC A;  2BE6 A;  3CDN A;  1TNW A;  2LE9 B;  2FJU B;  3ZNI A;  1DTL A;  1PVB A;  1BR1 B;  2LLT A;  4GBA A;  2ZKM X;  1G33 A;  2VRG A;  2ZND A;  3ZWH A;  2NCO A;  2K7B A;  5AXI A;  1DEK A;  1JFK A;  2PQL A;  4FQT A;  1JWD A;  2F33 A;  1REC A;  4PE4 A;  1JFJ A;  3HCM A;  1CFP A;  1KQM B;  2KI6 D;  1DGU A;  2NZ0 A;  3PAL A;  1SR6 B;  5G08 A;  2MJW B;  2H8V A;  4GGN A;  3DYE A;  1DJY A;  2K2A A;  4YGC B;  3I5I B;  4F0Z B;  1K9P A;  2H61 A;  1QS7 A;  4OV2 A;  2JT8 A;  1YRT B;  5CSI A;  5ER5 A;  3CZT X;  5AFP A;  1DT7 B;  3VB1 A;  4YBH B;  1QJT A;  3D78 A;  5AEQ A;  5D69 A;  2I2R E;  5GQQ C;  1WLM A;  4CFQ A;  2WOS A;  4GGF C;  4ZCV A;  4PHM A;  4QJ3 B;  1SR6 C;  1C7V A;  1C3Z A;  2K61 A;  1FBV A;  3BYA A;  2NLN A;  3TDI A;  2M9G A;  4C0K A;  3I5I C;  4OR9 B;  4DIR A;  5K89 A;  3VRR A;  1YVH A;  1UUS A;  3D77 A;  1RK9 A;  1B9A A;  4F7F A;  4DUQ A;  2Q91 A;  2I94 A;  3SG5 A;  3S0B A;  4D1E A;  2JZI A;  2LMT A;  2K0J A;  4DCK A;  3KF9 A;  1FF1 A;  1W7I B;  1A2X A;  5J3X A;  4L9M A;  2K7O A;  4YGA A;  1QV0 A;  2PYQ A;  2FOT A;  3PLF B;  1CMG A;  1ZAC A;  2QEV A;  3NHI A;  1NUB A;  2LAN A;  2JTZ A;  3OB2 B;  1OOJ A;  1UUR A;  5IBW A;  1J7O A;  1QTX A;  1CM1 A;  4HRG A;  1F54 A;  1F4O A;  1NX2 A;  1QIW A;  2OTG B;  4M2O A;  3CWG A;  1SCM B;  1QX2 A;  1KFX L;  2D8N A;  3CR5 X;  1S26 D;  1SCV A;  1IIO A;  1MXL C;  2JUL A;  2CBL A;  2Q4U A;  1OSA A;  2KYC A;  3FE6 A;  3FE8 A;  3GK4 X;  3JVT B;  5HKZ A;  2JPO A;  1PUL A;  1NSH A;  1B8R A;  1KK7 Y;  3TZ1 A;  1TCO B;  1DJI A;  1MHO A;  3VRP A;  1H8B A;  1F71 A;  1DMO A;  2KI4 B;  1KWO B;  2LMU A;  2I18 A;  2OTG C;  2LNK A;  4JD9 A;  1SCM C;  1J7Q A;  2NXQ A;  2LC5 A;  4AQJ A;  2O5G A;  3OP0 A;  1UHK A;  3JVT C;  1FW4 A;  3B6X A;  5HLO A;  4XJK A;  2BBN A;  1UHH A;  5AAN A;  3UNW A;  4WQ3 A;  4USL A;  5F6T A;  2WCB A;  2KI4 C;  1IKU A;  1KWO C;  1B47 A;  1UP5 A;  1YRU B;  2KQ6 A;  2M3W A;  3BUN B;  1S5G Y;  2LLS A;  2GV5 A;  3NSK A;  2E30 A;  3AAJ A;  3B87 A;  3PM2 A;  5CSN A;  3VRO A;  4DS7 A;  1K95 A;  1U5I A;  3K21 A;  1EXR A;  4UPG A;  5FI2 A;  5HLV A;  4PHK A;  1BOD A;  3D74 A;  1P28 A;  1J1E A;  5HKW A;  1RFJ A;  2FJY A;  1PK0 D;  4QJ5 B;  2LVK A;  5DKQ A;  3S0E A;  1WY9 A;  2WCE A;  1PSB A;  4ORC B;  1PAL A;  1SK6 D;  1XFW O;  1CMF A;  1XK4 A;  1YUU A;  3O6B A;  2P6B B;  1A75 A;  2ZNE A;  1Y1A A;  3VRN A;  2HQW A;  1QV1 A;  1J1D A;  2BNX A;  4ORA B;  3SIB A;  1DC1 A;  1XFU O;  2G2B A;  2JXC A;  2KFF A;  1ODB A;  3BQ3 A;  2ZFD A;  5JOL A;  1V1F A;  3B7A A;  4PAL A;  3FS7 A;  4NDB A;  2BL0 B;  3BUX B;  1R2U A;  2MLE C;  1OOF A;  1CFD A;  1G4Y R;  3EVV A;  2EGD A;  4MSP A;  3SG2 A;  1K94 A;  2PAS A;  1LS8 A;  4M2P A;  1SBJ A;  2YGU A;  3O4X A;  5CSF A;  2KLD A;  3BXK A;  4PE7 A;  1M63 B;  1N0Y A;  1KFX S;  2JRF A;  2ZN8 A;  1MQ1 A;  4YI8 A;  3SIA A;  2BL0 C;  1CFC A;  1EG3 A;  5JJG A;  2O60 A;  3R1O A;  1QX7 A;  1S3P A;  2MA2 A;  1XYD A;  2BE4 A;  1CM4 A;  1KFU S;  1JSA A;  3N7H A;  1PSR A;  3DVM A;  2E6W A;  2P71 A;  2WCF A;  3SG3 A;  2AMI A;  2M7N A;  3V2L A;  2LP2 A;  3DVE A;  4QJ4 B;  1XFX O;  2NCP A;  3FIA A;  3ICB A;  4YRU A;  1OMV A;  1OE9 B;  3B88 A;  1WDC B;  3BFA A;  4OZD A;  4CFR A;  1HT9 A;  1BG1 A;  4CID A;  1HQV A;  3I5H B;  2R2I A;  2TN4 A;  5I2O A;  2F3Y A;  4I5N B;  3CZ1 A;  2M0R A;  1TIZ A;  4OKH A;  1CTR A;  1YTZ C;  2F8P A;  3CLN A;  1NWD A;  1CKK A;  2L5Y A;  2SAS A;  1TCF A;  2Y1N A;  5D3O A;  1WDC C;  1JC2 A;  1IJ6 A;  2H61 C; 
#chains in the Genus database with same CATH homology
 2BBM A;  2JQ6 A;  1C07 A;  2K7C A;  2LP3 A;  2LVV A;  3I5H C;  3AKA A;  2L4I A;  1AK8 A;  2JWW A;  4WRI A;  1GGZ A;  1DJG A;  2WC8 A;  1TN4 A;  4CPV A;  2PRU A;  5B8I B;  2MHH A;  2K7D A;  3HX4 A;  3FWC A;  1M45 A;  2BEC A;  4BY4 A;  2PVB A;  1QVI Z;  1S36 A;  4PE0 A;  3WNX B;  4MLW A;  2MLF C;  5CSJ A;  1S6J A;  1F55 A;  2Y5I A;  3SG7 A;  1BLQ A;  1IG5 A;  1RWY A;  3KPX A;  2KI6 C;  1DJH A;  3MSE B;  1KSO A;  1M46 A;  4MVF A;  4NDD A;  2LLU A;  3NSI A;  3EK4 A;  4NQG A;  1QAT A;  2F2P A;  3VRQ A;  3QRX A;  1QX5 B;  1RRO A;  1SMG A;  3GOF A;  2HET A;  2M8U A;  3PN7 B;  4MZL A;  2KGR A;  1BF5 A;  4N1F A;  1WLZ A;  2CNP A;  1NP8 A;  1KFU L;  1WRL A;  2F3Z A;  5DKR A;  1OQP A;  3E3R A;  2LCP A;  4XJK B;  1CLB A;  2CT9 A;  2AAO A;  1UHJ A;  2Y1M A;  1D1O A;  2JPT A;  3PN7 C;  1XFV O;  2PMY A;  2M7L A;  1C7W A;  1BMO A;  4GUK A;  3JTD B;  4DRW A;  1F8H A;  3BUW B;  1IQ5 A;  1IGV A;  1DJZ A;  1U5I B;  1N2D A;  1YUT A;  1MR8 A;  3LK0 A;  4MZK A;  2BCX A;  4HSZ A;  2OS8 C;  2LVJ A;  4C0L A;  2JT3 A;  2MRD A;  1Y0V H;  3BOW A;  3CR4 X;  1MXE A;  3TS5 B;  2A4J A;  5HKY A;  2GGZ A;  2KYF A;  3JTD C;  1M31 A;  3D0Y A;  1XVJ A;  1MWN A;  3M0W A;  1R6P A;  2DOQ A;  1ZMZ A;  1CFF A;  4HRE E;  5I8N A;  1Y1U A;  3I5F B;  3TS5 C;  3OB1 B;  1GQM A;  2L50 A;  1N65 A;  1TNX A;  4JPZ B;  1BJF A;  1KQV A;  2PAL A;  1QLS A;  2AUC A;  2L51 A;  1XK4 C;  1IH0 A;  1CB1 A;  2B1U A;  4FTG A;  4YI9 A;  1ZFS A;  1L7Z A;  1CDP A;  1SPY A;  3KEV A;  4HRH A;  4I5L B;  4ORB B;  5BPJ A;  3WXA A;  3NXA A;  2V53 A;  3I5F C;  1XA5 A;  1BOC A;  2JC2 A;  1DF0 B;  1A4P A;  4IL1 A;  1TOP A;  2HF5 A;  1OMR A;  3OX5 A;  1F70 A;  1LVC D;  1BR4 B;  1K90 D;  2LUX A;  2HQ8 A;  1S6C A;  1VRK A;  3EK8 A;  2WND A;  3TUY B;  1S1E A;  3DF0 A;  4GAO A;  5PAL A;  3A4U B;  1X02 A;  3F45 A;  1EJ3 A;  1MF8 B;  1CDL A;  2KHN A;  4MZJ A;  4PE1 A;  2MBX A;  3TDZ A;  1CDM A;  1FI5 A;  1TRF A;  3IQO A;  2COL B;  1B1G A;  2KSP A;  2PSR A;  3DVK A;  2KAX A;  1WRK A;  2KAY A;  1S6I A;  1ALW A;  1QVI Y;  1PRW A;  3NSL A;  1AP4 A;  3TUY C;  2FCD A;  1CNP A;  1OZS A;  4GFT A;  3RLZ A;  1YR5 A;  1CLM A;  4N5X A;  2QAC A;  2M49 B;  1TTX A;  1B8L A;  2L5X B;  2M29 A;  2I7A A;  2JU0 A;  3GK1 A;  1PVA A;  3DVJ A;  1DVI A;  4P2Y B;  1FI6 A;  3PSR A;  2JOJ A;  2G9B A;  1J7P A;  1J55 A;  1XFZ O;  4A4C A;  1BU3 A;  3KHE A;  1KK8 B;  4GNK B;  1EL4 A;  3EKJ A;  3PAT A;  2L2E A;  2HPS A;  3KO0 A;  1AUI B;  4MN0 A;  1QLK A;  2KQY A;  2M1U A;  4AOM A;  4YGB B;  4MRX A;  3A8R A;  3SJS A;  3O78 A;  3GK2 A;  4N1G A;  1IJ5 A;  1WRZ A;  2L0P A;  4ICB A;  1KK8 C;  1YX8 A;  3H4S E;  4MBE A;  1RTP 1;  5KSZ A;  4GGF A;  1CLL A;  1Y6W A;  2SCP A;  3CS1 A;  1IRJ A;  1XFY O;  1SYM A;  1LA3 A;  2F2O A;  5ER4 X;  2LM5 A;  4P5O E;  1KQM C;  1SL9 A;  2ZRS A;  1DJW A;  3OX6 A;  1K9U A;  1AHR A;  3CR2 A;  1B7T Z;  2KGB C;  1NX0 A;  4C0J A;  1KSM A;  5KTY A;  1IQ3 A;  2JNF A;  4OCI A;  3D10 A;  1EG4 A;  3CTN A;  4U8D A;  4Q04 A;  2LVI A;  4PDZ A;  1NCZ A;  1QAS A;  2KDH A;  2KFG A;  4I5J A;  2K2F A;  1KCY A;  3EVR A;  3SG6 A;  1NYA A;  2MAZ A;  1SL7 A;  2KAV A;  2OS8 B;  1NIW A;  4I5K A;  3CGA A;  2LMV A;  1B4C A;  1JF2 A;  4NDC A;  1SRA A;  1B8C A;  2GGM A;  3LL8 B;  3O4Y A;  1W7J B;  2QPT A;  4M2Q A;  3TDU A;  5I2Q A;  2KBM A;  1BT6 A;  2KOT A;  1LA0 A;  3I5G B;  2FCE A;  3LCP C;  1J7R A;  3BOW B;  1H4B A;  1SKT A;  1ZUZ A;  3BUM B;  2L98 A;  4CLN A;  3D0Y B;  3O2P A;  4BY5 A;  1K9K A;  2IS9 A;  1SL8 A;  3NSO A;  1AVS A;  2LHI A;  1F4Q A;  1OZO A;  1ZOT B;  3BUO B;  1NX1 A;  1NX3 A;  2CCM A;  4TNC A;  1NCX A;  2JNX A;  1V1G A;  1XO5 A;  3EK7 A;  2LV7 A;  3I5G C;  4AQI A;  1K2H A;  2CXJ A;  1A75 B;  2BCA A;  4ZCU A;  3C1V A;  3OHM B;  5DKN A;  4R1E A;  5D7F A;  2KNE A;  3SG4 A;  1L2O B;  4PHJ A;  5CPV A;  1TNP A;  1YUR A;  2ZRT A;  1IWQ A;  5FYX A;  3WHU B;  4MRY A;  4ETO A;  1JBA A;  1G8I A;  1K93 D;  4OVN F;  2LHL A;  1YX7 A;  1Y1X A;  4YGD B;  1A29 A;  3EVU A;  1RJV A;  4PCW A;  1L2O C;  2M97 A;  3DF0 B;  2EC6 B;  2Y4Q A;  4WQ2 A;  1AJ4 A;  1KK7 Z;  4FQO A;  1SY9 A;  1YUS A;  1SNL A;  3PM8 A;  4JQ0 D;  3AKB A;  4JWQ A;  3DD4 A;  2BKH B;  1LKJ A;  4E68 A;  4XYN A;  3IQQ A;  5HYD A;  5TNC A;  1YVL A;  5AER A;  1MUX A;  1NPQ A;  2WOR A;  5I2L A;  4MEW A;  1E8A A;  1DJX A;  1LXF C;  1K8U A;  1ALV A;  1OMD A;  1QXP A;  2ISD A;  4A4B A;  1Q80 A;  2EC6 C;  3AAK A;  1A03 A;  1QIV A;  3VGO A;  2CTN A;  3FWB A;  2KFH A;  1TNQ A;  3RM1 A;  3IF7 A;  1LIN A;  1EH2 A;  2L4H A;  1K96 A;  4GPL B;  2KBI A;  2M1K B;  2EHB A;  2LAP A;  2JTT A;  1NCY A;  1S5G Z;  2RGI A;  3EKH A;  5KU1 A;  2K8M B;  1DGV A;  2OPO A;  1CDN A;  2ZN9 A;  3PFV A;  3WHT B;  1SW8 A;  1UHI A;  1GGW A;  1M39 A;  2BKI B;  3LLE A;  4PHN A;  1DF0 A;  4YGE B;  1AJ5 A;  1UWO A;  1GJY A;  1UHN A;  1FPW A;  2JT0 A;  1B7T Y;  3LK1 A;  2JXL A;  2H2K A;  1JUO A;  1JF0 A;  2BCB A;  2LUC A;  2BE6 A;  1TNW A;  2LE9 B;  2FJU B;  3ZNI A;  1DTL A;  1PVB A;  1BR1 B;  2LLT A;  4GBA A;  2ZKM X;  1G33 A;  2VRG A;  2ZND A;  3ZWH A;  2NCO A;  2K7B A;  5AXI A;  1JWD A;  1JFK A;  2F33 A;  1REC A;  4PE4 A;  1JFJ A;  3HCM A;  1CFP A;  1KQM B;  2KI6 D;  1DGU A;  2NZ0 A;  3PAL A;  1SR6 B;  5G08 A;  2MJW B;  4GGN A;  1DJY A;  2K2A A;  4YGC B;  3I5I B;  4F0Z B;  1K9P A;  2H61 A;  1QS7 A;  4OV2 A;  2JT8 A;  1YRT B;  5CSI A;  5ER5 A;  3CZT X;  5AFP A;  1DT7 B;  4YBH B;  1QJT A;  5AEQ A;  5D69 A;  2I2R E;  5GQQ C;  1WLM A;  4CFQ A;  2WOS A;  4GGF C;  4ZCV A;  4PHM A;  4QJ3 B;  1SR6 C;  1C7V A;  2K61 A;  1FBV A;  3BYA A;  2NLN A;  3TDI A;  2M9G A;  4C0K A;  3I5I C;  4OR9 B;  4DIR A;  5K89 A;  3VRR A;  1YVH A;  1UUS A;  1RK9 A;  1B9A A;  4DUQ A;  2Q91 A;  2I94 A;  3SG5 A;  4D1E A;  2JZI A;  2LMT A;  2K0J A;  4DCK A;  3KF9 A;  1W7I B;  1A2X A;  5J3X A;  4L9M A;  2K7O A;  4YGA A;  1QV0 A;  3PLF B;  2FOT A;  1CMG A;  1ZAC A;  1NUB A;  2LAN A;  2JTZ A;  3OB2 B;  1OOJ A;  1UUR A;  5IBW A;  1J7O A;  1QTX A;  1CM1 A;  4HRG A;  1F54 A;  1F4O A;  1NX2 A;  1QIW A;  2OTG B;  4M2O A;  3CWG A;  1SCM B;  1QX2 A;  1KFX L;  2D8N A;  3CR5 X;  1S26 D;  1SCV A;  1MXL C;  2JUL A;  2CBL A;  2Q4U A;  1OSA A;  2KYC A;  3GK4 X;  5HKZ A;  3JVT B;  1PUL A;  1NSH A;  1B8R A;  1KK7 Y;  3TZ1 A;  1TCO B;  1DJI A;  1MHO A;  3VRP A;  1H8B A;  1F71 A;  1DMO A;  2KI4 B;  1KWO B;  2LMU A;  2I18 A;  2OTG C;  2LNK A;  1SCM C;  1J7Q A;  2NXQ A;  2LC5 A;  4AQJ A;  2O5G A;  3OP0 A;  1UHK A;  3JVT C;  1FW4 A;  5HLO A;  4XJK A;  2BBN A;  1UHH A;  5AAN A;  4WQ3 A;  4USL A;  5F6T A;  2WCB A;  2KI4 C;  1IKU A;  1KWO C;  1B47 A;  1UP5 A;  1YRU B;  2KQ6 A;  2M3W A;  3BUN B;  1S5G Y;  2LLS A;  2GV5 A;  3NSK A;  2E30 A;  3AAJ A;  5CSN A;  3VRO A;  4DS7 A;  1K95 A;  1U5I A;  3K21 A;  1EXR A;  4UPG A;  5HLV A;  4PHK A;  1BOD A;  1J1E A;  5HKW A;  1RFJ A;  1PK0 D;  4QJ5 B;  2LVK A;  5DKQ A;  1WY9 A;  2WCE A;  1PSB A;  4ORC B;  1PAL A;  1SK6 D;  1XFW O;  1CMF A;  1XK4 A;  1YUU A;  3O6B A;  2P6B B;  1A75 A;  2ZNE A;  1Y1A A;  3VRN A;  2HQW A;  1QV1 A;  1J1D A;  4ORA B;  3SIB A;  1XFU O;  2G2B A;  2JXC A;  2KFF A;  1ODB A;  3BQ3 A;  2ZFD A;  5JOL A;  1V1F A;  4PAL A;  3FS7 A;  4NDB A;  2BL0 B;  3BUX B;  1R2U A;  2MLE C;  1CFD A;  1G4Y R;  3EVV A;  2EGD A;  4MSP A;  3SG2 A;  1K94 A;  2PAS A;  4M2P A;  1SBJ A;  5CSF A;  3BXK A;  4PE7 A;  1M63 B;  1N0Y A;  1KFX S;  2JRF A;  2ZN8 A;  1MQ1 A;  4YI8 A;  3SIA A;  2BL0 C;  1CFC A;  1EG3 A;  5JJG A;  2O60 A;  1QX7 A;  1S3P A;  2MA2 A;  1XYD A;  2BE4 A;  1CM4 A;  1KFU S;  1JSA A;  1PSR A;  3DVM A;  2E6W A;  2WCF A;  3SG3 A;  2AMI A;  2M7N A;  2LP2 A;  3DVE A;  4QJ4 B;  1XFX O;  2NCP A;  3FIA A;  3ICB A;  4YRU A;  1OMV A;  1OE9 B;  1WDC B;  4CFR A;  1HT9 A;  1BG1 A;  4CID A;  1HQV A;  3I5H B;  2R2I A;  2TN4 A;  5I2O A;  2F3Y A;  4I5N B;  2M0R A;  1TIZ A;  4OKH A;  1CTR A;  1YTZ C;  2F8P A;  3CLN A;  1NWD A;  1CKK A;  2SAS A;  1TCF A;  2Y1N A;  1FF1 A;  1WDC C;  1JC2 A;  1IJ6 A;  2H61 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...