2I18A

The refined structure of c-terminal domain of an ef-hand calcium binding protein from entamoeba histolytica
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
64
structure length
64
Chain Sequence
SDDKIGLKVLYKLMDVDGDGKLTKEEVTSFFKKHGIEKVAEQVMKADANGDGYITLEEFLEFSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords Calcium-binding protein
publication title Structural basis for the observed differential magnetic anisotropic tensorial values in calcium binding proteins.
pubmed doi rcsb
total genus 13
structure length 64
sequence length 64
ec nomenclature
pdb deposition date 2006-08-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2i18A00
4A4CA 2MAZA 1NX0A 1QJTA 2PMYA 2BBMA 2I18A 2LUCA 1DMOA 4NDBA 4ZCVA 1W7JB 2LLTA 2NZ0A 1OZOA 1JFKA 1ODBA 4Q04A 3D0YA 2WNDA 1AK8A 1FBVA 1J7QA 5IBWA 1GGWA 4MZJA 1CDLA 3BUMB 3D10A 3EK8A 4BY4A 3E3RA 3MSEB 2K2AA 1FW4A 3TDZA 3EKHA 1NCXA 3AAKA 2E6WA 5AEQA 3PN7B 3VRNA 1QIWA 2JZIA 1Y6WA 3NSLA 1SL7A 3PLFB 1UHNA 1AUIB 4CFQA 1K8UA 3SIAA 2L51A 2CTNA 2PASA 2KI6D 1M46A 3BXKA 3I5HB 1V1FA 4I5KA 2JRFA 2PSRA 1A75A 1SRAA 1K9KA 4MBEA 1TOPA 1BR4B 1U5IB 3SIBA 3ZNIA 3BUXB 1Y1UA 1BT6A 1SMGA 2Y1NA 1CM1A 1QIVA 3NSKA 4JPZB 3CS1A 4YRUA 3TDIA 2BCAA 2ZKMX 3KEVA 5HKWA 5J3XA 1YR5A 1F4QA 4YI9A 1UUSA 1NX3A 1KFUS 1KFXL 1S5GZ 1WRLA 1XFVO 4D1EA 4QJ5B 1OSAA 2I94A 1YVHA 2I2RE 5CSNA 1RJVA 5CSIA 1IJ5A 1CM4A 3WNXB 5HLVA 1DVIA 1EG4A 3K21A 2MRDA 2KQYA 3PFVA 4HREE 4DUQA 2ZN8A 1KFUL 1JUOA 1ALVA 2KGRA 1LA3A 4PDZA 1GQMA 2OS8B 4GGFC 1SR6B 2IS9A 1RECA 2Y4QA 2L4IA 1YTZC 4PHMA 3OP0A 1WDCB 1N2DA 1A75B 2LC5A 1CLBA 1CFFA 3O2PA 4I5LB 4F0ZB 1F71A 2JXCA 3OB2B 3TZ1A 1NCZA 1B8CA 1MHOA 2HQ8A 2M7LA 3CR5X 1DGUA 1G8IA 1J7PA 1G33A 3PATA 2F8PA 1TCFA 4L9MA 1D1OA 2BE6A 1WLMA 4MRXA 1Y0VH 1H4BA 2Q91A 4OR9B 1EH2A 3CR4X 1B4CA 3I5IB 3KPXA 2LMUA 2B1UA 4PE7A 4YBHB 1ZUZA 2LUXA 3M0WA 1LINA 2L50A 3PSRA 1XK4A 3HCMA 2QPTA 4MZLA 2KFGA 2PVBA 1S1EA 4MLWA 5CSFA 4AQJA 2M7NA 1A29A 5BPJA 4GBAA 1HT9A 2GGMA 5F6TA 1M45A 5HKYA 1LVCD 4BY5A 2LVIA 5K89A 1KSOA 2KI4B 1QX5B 2JT3A 3PM8A 2QACA 1CLMA 2FCDA 1XO5A 3I5GB 5CSJA 1IQ3A 3KHEA 2EGDA 3WHTB 2LMVA 4CLNA 1V1GA 3VRQA 3OHMB 4JQ0D 4OKHA 2G9BA 1XYDA 1OZSA 3CZTX 1YUTA 1TNWA 2PRUA 5DKNA 3TS5B 5TNCA 2CXJA 2R2IA 2LHIA 1IQ5A 4YGDB 3ICBA 1UP5A 1UURA 5JJGA 2HETA 2M0RA 3OX6A 1TCOB 2BCBA 2EC6B 1YVLA 3SG2A 3I5FC 1KCYA 1AVSA 1CMFA 2GV5A 4GGNA 1Y1AA 4YI8A 2MBXA 1B7TY 2K7OA 2OTGB 4XJKB 1C07A 3OB1B 1B1GA 5DKQA 4HRHA 4DCKA 2MLFC 1UHJA 2BL0B 1OMRA 2KHNA 2JTZA 2LVKA 2M9GA 2WCEA 1RK9A 1PVAA 3DVJA 1JBAA 1M31A 2KNEA 4MN0A 3SG3A 1KK8C 4YGEB 1SCMB 4WRIA 3VRRA 4FQOA 1DJYA 4WQ3A 1M39A 2H61C 3PN7C 5AANA 1EJ3A 4P5OE 3EKJA 1J7OA 1K2HA 2L5XB 3SJSA 1J1EA 1SBJA 2M1UA 1IH0A 2L4HA 5HYDA 3I5HC 1CFPA 3DD4A 4ORAB 3TUYB 1IJ6A 4U8DA 1MR8A 1DJWA 2G2BA 1WRZA 2FOTA 2BBNA 2HF5A 3FS7A 2KAVA 1L2OB 2GGZA 4PHJA 1WY9A 4ORCB 1PSBA 2F33A 1UHKA 3LL8B 3D0YB 3O6BA 1AHRA 3GK4X 1F70A 1J55A 1MUXA 4MEWA 5AXIA 4MSPA 1QXPA 1W7IB 3SG4A 2KYCA 3BYAA 1F4OA 1XFYO 3FWCA 1LXFC 4OCIA 1S36A 2HQWA 5JOLA 1QV1A 4DS7A 1RWYA 1OMDA 4CIDA 1M63B 2JQ6A 5KTYA 1NCYA 1B7TZ 1SK6D 1RTP1 5I2LA 4PALA 2OS8C 1SR6C 1MXLC 1DF0A 3EVRA 3KO0A 1WDCC 2KI6C 3CTNA 2NXQA 2CNPA 1AJ4A 4MRYA 1KQMB 2LM5A 1MQ1A 2M97A 1NWDA 4MZKA 1ZFSA 2F2OA 1YURA 3SG7A 1IWQA 1PALA 3BOWA 1OE9B 4NQGA 1BR1B 1B8LA 1PULA 1UHHA 4PHKA 1UHIA 1CLLA 1SKTA 2WC8A 1IRJA 1ZACA 1CTRA 1XFZO 3EVUA 2JT0A 2ISDA 1YUSA 3JVTB 2KBMA 3I5IC 1DJGA 1K94A 2ZNEA 3ZWHA 3FWBA 5I2QA 4R1EA 1BOCA 1SPYA 2M49B 2Y1MA 4GNKB 2K8MB 2JNFA 4QJ3B 4TNCA 3PALA 1SCVA 1Y1XA 1LA0A 1EXRA 2TN4A 2LLSA 1SY9A 2P6BB 5D69A 2WCBA 4IL1A 1SL8A 1ZOTB 2ZRTA 3A8RA 1NSHA 2KQ6A 1F54A 1QLSA 2LE9B 2KAXA 1N0YA 5FYXA 3HX4A 3SG6A 1JSAA 4JWQA 4M2OA 1IKUA 4ZCUA 4MVFA 3BOWB 2KDHA 2LAPA 2KI4C 2K61A 2MJWB 4M2QA 3AAJA 3IF7A 3I5GC 2BE4A 3BUNB 2K7BA 1B47A 2K2FA 3DVEA 1SYMA 1YX8A 1TNPA 3CGAA 3TUYC 1TN4A 1CFCA 2KAYA 1S26D 4ORBB 2ZN9A 2CBLA 1DT7B 1MWNA 1VRKA 1TIZA 1BODA 1XK4C 2EC6C 1IGVA 2LNKA 4C0LA 3VGOA 5I8NA 4UPGA 1YX7A 5HLOA 2RGIA 3DVKA 5G08A 1DJIA 1J1DA 2LP3A 5AERA 2LP2A 3BUWB 3WXAA 1PSRA 2NLNA 2OTGC 4M2PA 4DIRA 4YGBB 3JTDB 5ER5A 1OQPA 1SL9A 1XVJA 3LLEA 2EHBA 2M1KB 2SCPA 1H8BA 3DVMA 3SG5A 3NXAA 1KWOB 2BL0C 3O4YA 1K96A 2DOQA 1C7WA 1YUUA 1NPQA 5KSZA 1QLKA 1JC2A 1NP8A 1IG5A 2Y5IA 1YRUB 2H61A 4WQ2A 1QVIY 1UWOA 1KQVA 1KSMA 2BECA 2LHLA 2MA2A 2FJUB 2L2EA 1A2XA 1K9PA 1SCMC 3TDUA 2M8UA 1C7VA 4OVNF 1NX1A 1S3PA 2KGBC 4E68A 5ER4X 5B8IB 1X02A 2K0JA 1FI6A 1S6JA 4DRWA 1MF8B 1JF2A 2D8NA 1U5IA 4OV2A 2NCPA 1BF5A 3AKBA 1Q80A 2ZRSA 4AOMA 1BLQA 1FI5A 1ZMZA 4I5JA 2JC2A 3KF9A 2Q4UA 2OPOA 2LVVA 2V53A 1CKKA 1L2OC 4YGCB 2LLUA 2F2PA 5D7FA 1B9AA 1BJFA 1FF1A 1KK8B 3LK1A 3CR2A 1R2UA 1CDPA 4A4BA 1PK0D 2KOTA 1TRFA 3RM1A 1JWDA 1DJZA 2JULA 3VROA 2WCFA 2JNXA 3NSOA 1EG3A 2LANA 1G4YR 3O78A 2KYFA 2A4JA 1A4PA 2E30A 2JWWA 1TNQA 1S6IA 4GGFA 5CPVA 2BCXA 3IQQA 4PE4A 1XFXO 1QASA 1KFXS 1NIWA 1K90D 4GUKA 5I2OA 1R6PA 2HPSA 1MXEA 2O60A 2BKHB 4GPLB 1BU3A 3DF0A 1K9UA 1KQMC 1QX7A 3QRXA 5HKZA 1OMVA 4ICBA 4PCWA 2VRGA 1YRTB 1CFDA 1GJYA 3F45A 1DGVA 2AAOA 1QVIZ 2F3YA 4GFTA 1ALWA 1K95A 2L0PA 1DJXA 2JTTA 2AUCA 4N5XA 1SW8A 1KK7Y 1XA5A 1SNLA 2AMIA 3LCPC 1WLZA 1N65A 1CDNA 2M3WA 5AFPA 1RFJA 4FTGA 3JVTC 4HRGA 4NDDA 4USLA 1QATA 4YGAA 1JFJA 5PALA 3BUOB 3RLZA 2NCOA 1DTLA 1FPWA 2KBIA 4N1FA 3WHUB 4P2YB 3EK7A 1XFUO 1EL4A 4PE0A 3GOFA 1NX2A 2ZNDA 1DF0B 1PVBA 1TTXA 3DF0B 4CPVA 1BMOA 2BKIB 3EK4A 4QJ4B 2LVJA 2LCPA 3IQOA 1XFWO 2JXLA 1PRWA 2LV7A 3VRPA 1RROA 4CFRA 2MLEC 2O5GA 1F55A 1WRKA 2M29A 2ZFDA 1CB1A 1JF0A 1CMGA 1AP4A 1F8HA 1J7RA 1S6CA 2JOJA 2CT9A 2K7CA 3TS5C 1B8RA 4C0KA 4PE1A 3CWGA 1QV0A 2I7AA 2KFHA 2H2KA 1NYAA 1DJHA 1NUBA 2K7DA 1TNXA 2SASA 2KSPA 1AJ5A 1HQVA 3LK0A 1QX2A 4XJKA 4HSZA 2PALA 1GGZA 2F3ZA 2L98A 3NSIA 4AQIA 3BQ3A 1A03A 3GK2A 2CCMA 3JTDC 1LKJA 1E8AA 3FIAA 1KK7Z 4PHNA 3CLNA 3AKAA 4I5NB 1QTXA 3EVVA 1CDMA 1KWOC 2LMTA 4N1GA 2WOSA 1OOJA 2FCEA 1K93D 4XYNA 3OX5A 1QS7A 1L7ZA 1S5GY 1BG1A 3GK1A 2KFFA 4GAOA 2JU0A 5GQQC 2COLB 2JT8A 3H4SE 3I5FB 3C1VA 4NDCA 5KU1A 2MHHA 3A4UB 5DKRA 1CNPA 2JPTA 4ETOA 2WORA 4C0JA
chains in the Genus database with same CATH superfamily
4A4CA 2K60A 2MAZA 2YGUA 1NX0A 1QJTA 2PMYA 2BBMA 2I18A 2LUCA 1DMOA 4NDBA 3R1VA 4ZCVA 1W7JB 2LLTA 2NZ0A 1OZOA 1JFKA 1ODBA 4Q04A 3D0YA 2WNDA 1AK8A 1FBVA 1J7QA 3VB1A 5IBWA 4MZJA 1CDLA 3BUMB 3D10A 3EK8A 4BY4A 1GGWA 3E3RA 3MSEB 2K2AA 1FW4A 2BAPA 3TDZA 3EKHA 1NCXA 3AAKA 2E6WA 5AEQA 3PN7B 3VRNA 1QIWA 2JZIA 1Y6WA 3NSLA 1SL7A 3PLFB 1UHNA 1AUIB 4CFQA 1K8UA 3SIAA 5HL1A 3SS4A 2L51A 2CTNA 2PASA 2KI6D 1M46A 3BXKA 3I5HB 1V1FA 4I5KA 2JRFA 2PSRA 1A75A 4INXA 1SRAA 1K9KA 4MBEA 1TOPA 1BR4B 1U5IB 3R72A 3SIBA 3ZNIA 3BUXB 1Y1UA 1BT6A 1SMGA 2Y1NA 1CM1A 1QIVA 3NSKA 4JPZB 3CS1A 4YRUA 3TDIA 2BCAA 2ZKMX 3SS5A 3KEVA 5HKWA 5J3XA 1YR5A 1F4QA 4YI9A 1UUSA 1NX3A 1KFUS 1KFXL 1S5GZ 1WRLA 1XFVO 4D1EA 4QJ5B 1OSAA 3UO9A 2I94A 1YVHA 1QWVA 2I2RE 1RJVA 5CSNA 5FI6A 5CSIA 1IJ5A 1CM4A 2ERBA 3WNXB 5HLVA 1DVIA 1EG4A 3K21A 2MRDA 2KQYA 3PFVA 4HREE 4DUQA 3BFHA 2ZN8A 1KFUL 1JUOA 3FE9A 1ALVA 2KGRA 1LA3A 4PDZA 1GQMA 2OS8B 2QEVA 1SR6B 2IS9A 4GGFC 1RECA 2Y4QA 1DC1A 2L4IA 1YTZC 4PHMA 3OP0A 1WDCB 1N2DA 1A75B 1OOIX 2LC5A 1CLBA 1CFFA 3O2PA 4I5LB 2KPHA 3B7AA 4F0ZB 1F71A 2JXCA 3BJHA 3OB2B 3TZ1A 1NCZA 1B8CA 1MHOA 2HQ8A 2M7LA 3CR5X 1DGUA 1G8IA 3L4LA 1G33A 1J7PA 1T14A 1DEKA 3PATA 2F8PA 1TCFA 4L9MA 1D1OA 2BE6A 1WLMA 3R1PA 1Y0VH 4MRXA 5EL2A 1GM0A 1H4BA 2Q91A 4OR9B 1EH2A 3CR4X 1B4CA 3I5IB 3KPXA 3D77A 2LMUA 3S0AA 2B1UA 4PE7A 4YBHB 1ZUZA 2LUXA 3M0WA 1LINA 3L47A 2L50A 3PSRA 1XK4A 3HCMA 2QPTA 4MZLA 2KFGA 2PVBA 2WCLA 1S1EA 4MLWA 5CSFA 4AQJA 3S0GA 2M7NA 1OOFA 2QEBA 1A29A 5BPJA 4GBAA 1HT9A 2GGMA 5F6TA 1M45A 5HKYA 1LVCD 4BY5A 2LVIA 5K89A 1KSOA 2BNXA 2KI4B 1QX5B 2JT3A 3PM8A 2QACA 1CLMA 2FCDA 1XO5A 3I5GB 5CSJA 1OOGA 1IQ3A 3KHEA 2EGDA 3WHTB 2LMVA 4CLNA 1V1GA 3VRQA 3OHMB 3D78A 4JQ0D 4OKHA 2G9BA 1XYDA 1OZSA 3CZTX 1YUTA 1TNWA 2PRUA 5DKNA 3TS5B 5TNCA 2WC5A 2CXJA 2R2IA 2LHIA 1IQ5A 4YGDB 3ICBA 1UP5A 1UURA 5JJGA 2HETA 2M0RA 3OX6A 1TCOB 2BCBA 2EC6B 1YVLA 3SG2A 2GTEA 3DY9A 3I5FC 3CABA 5DICA 2P70A 2WCJA 1AVSA 1KCYA 3PM2A 3UNWA 3QMEA 1CMFA 2JPOA 1Z4HA 2GV5A 1TUJA 1Y1AA 4GGNA 4YI8A 2MBXA 3RZSA 1B7TY 3BFAA 2K7OA 2OTGB 4XJKB 1C07A 3OB1B 1B1GA 5DKQA 4HRHA 4DCKA 2MLFC 1UHJA 2BL0B 1OMRA 2KHNA 2JTZA 2LVKA 2M9GA 2WCEA 1RK9A 1PVAA 3DVJA 1JBAA 1M31A 2KNEA 3CZ2A 4MN0A 3SG3A 1KK8C 4YGEB 1SCMB 4WRIA 3SS3A 3VRRA 4FQOA 1DJYA 4WQ3A 1M39A 2H61C 3PN7C 5AANA 1EJ3A 2P71A 4P5OE 3S0FA 3EKJA 1J7OA 1K2HA 2L5XB 3SJSA 1J1EA 1SBJA 1SSEB 2M1UA 1IH0A 2L4HA 5HYDA 3I5HC 1CFPA 1P28A 3DD4A 4ORAB 5FI7A 3TUYB 1IJ6A 4U8DA 1MR8A 1DJWA 2G2BA 1WRZA 2FOTA 2BBNA 2HF5A 3FS7A 2KAVA 1L2OB 3B86A 2GGZA 4PHJA 1WY9A 4ORCB 1PSBA 2F33A 1UHKA 3LL8B 3D0YB 3O6BA 3Q8IA 1AHRA 3GK4X 1F70A 1J55A 1MUXA 4MEWA 5AXIA 4MSPA 1QXPA 1C3YA 1W7IB 3SG4A 2KYCA 3BYAA 1F4OA 1XFYO 3FWCA 1LXFC 1OW4A 4OCIA 1S36A 2HQWA 5JOLA 1QV1A 4DS7A 1RWYA 1OMDA 2WC6A 1M63B 4CIDA 2PYQA 2JQ6A 5KTYA 1NCYA 1B7TZ 1SK6D 1RTP1 2KLDA 3DZTA 4PALA 5I2LA 3NHTA 2OS8C 1SR6C 1MXLC 1DF0A 3EVRA 3KO0A 2QDIA 3S0DA 1WDCC 2KI6C 3CTNA 2NXQA 2CNPA 1AJ4A 1DELA 4MRYA 3CYZA 1KQMB 2LM5A 4JD9A 1MQ1A 2M97A 1NWDA 4MZKA 1LS8A 1ZFSA 2F2OA 1YURA 3SG7A 1IWQA 1PALA 3BOWA 1OE9B 4NQGA 1BR1B 1B8LA 1PULA 1UHHA 4PHKA 1UHIA 1CLLA 1SKTA 1ORGA 1IRJA 2WC8A 1ZACA 3D76A 1CTRA 1XFZO 3EVUA 1TWOA 2JT0A 2ISDA 1YUSA 3JVTB 2KBMA 2WCKA 1DJGA 1C3ZA 1K94A 3I5IC 2ZNEA 3ZWHA 3FWBA 5I2QA 4R1EA 1BOCA 1SPYA 2M49B 2Y1MA 4GNKB 2K8MB 2JNFA 4QJ3B 4TNCA 3PALA 1SCVA 1Y1XA 1LA0A 1EXRA 2TN4A 2KLEA 2LLSA 1OOHA 1SY9A 2P6BB 3S0BA 5D69A 2WCBA 4IL1A 1SL8A 5FI2A 1ZOTB 2ZRTA 3A8RA 1NSHA 2KQ6A 1F54A 1QLSA 2LE9B 2KAXA 1N0YA 5FYXA 3HX4A 3SG6A 1JSAA 4JWQA 4IJ7A 4M2OA 1IKUA 3K1EA 4ZCUA 4MVFA 3BOWB 2KDHA 2LAPA 2KI4C 2K61A 2MJWB 4M2QA 3AAJA 3IF7A 3I5GC 2BE4A 3BUNB 2K7BA 1B47A 2K2FA 3DVEA 1SYMA 1YX8A 1TNPA 3CGAA 3TUYC 1TN4A 2QEHA 1CFCA 3N7HA 2KAYA 1S26D 4ORBB 2ZN9A 2CBLA 1DT7B 1MWNA 1VRKA 4OZDA 1TIZA 3FE6A 1BODA 1XK4C 3FE8A 2EC6C 1IGVA 2LNKA 4C0LA 3VGOA 5I8NA 4UPGA 1YX7A 5HLOA 2RGIA 3DVKA 5G08A 4PT1A 1DJIA 1J1DA 2LP3A 5AERA 2LP2A 3BUWB 3WXAA 1PSRA 2NLNA 2OTGC 4M2PA 4DIRA 4YGBB 3JTDB 5ER5A 1OQPA 1SL9A 1XVJA 3LLEA 2EHBA 2M1KB 2SCPA 3BFBA 1H8BA 4JKTA 3DVMA 3SG5A 3NXAA 1KWOB 2BL0C 3O4YA 1K96A 2DOQA 1C7WA 1YUUA 1NPQA 5KSZA 1QLKA 1JC2A 1NP8A 1IG5A 2Y5IA 1YRUB 2H61A 4WQ2A 1QVIY 1UWOA 1KQVA 1KSMA 2BECA 2LHLA 2MA2A 2FJUB 2L2EA 1A2XA 1K9PA 1SCMC 3TDUA 2M8UA 1C7VA 4OVNF 1NX1A 1S3PA 2KGBC 4E68A 5ER4X 5B8IB 3DXLA 1X02A 2K0JA 2QEOA 1FI6A 1S6JA 4DRWA 1MF8B 1JF2A 2D8NA 1U5IA 4KYNA 2NCPA 4OV2A 3AKBA 1BF5A 1Q80A 2ZRSA 4AOMA 1BLQA 1FI5A 1ZMZA 4I5JA 2JC2A 3KF9A 3NHIA 2Q4UA 2OPOA 2LVVA 2V53A 1CKKA 1L2OC 4YGCB 2LLUA 2F2PA 5D7FA 1B9AA 1BJFA 1FF1A 1KK8B 3LK1A 3CR2A 1R2UA 1CDPA 4A4BA 1PK0D 2KOTA 1TRFA 2WCHA 3RM1A 1JWDA 1DJZA 2JULA 3PJIA 3VROA 2WCFA 2JNXA 3NSOA 1EG3A 2LANA 1G4YR 4INWA 3O78A 3D73A 2KYFA 2A4JA 3O4XA 1A4PA 2E30A 2JWWA 1TNQA 1S6IA 4GGFA 5CPVA 2BCXA 3EG5B 3IQQA 4PE4A 1XFXO 1QASA 3B88A 1KFXS 1NIWA 1K90D 4GUKA 5I2OA 1R6PA 2HPSA 1MXEA 2O60A 2BKHB 4GPLB 1BU3A 2L5YA 3DF0A 1K9UA 1KQMC 1QX7A 3D75A 3QRXA 5HKZA 1OMVA 4ICBA 4PCWA 2VRGA 1YRTB 1CFDA 1GJYA 3F45A 1DGVA 2AAOA 1QVIZ 2F3YA 3CDNA 1ALWA 4GFTA 1K95A 2L0PA 3B87A 1DJXA 3B6XA 2JTTA 2AUCA 3DYEA 4N5XA 1SW8A 1KK7Y 1XA5A 1SNLA 2PQLA 2AMIA 5D3OA 3LCPC 1WLZA 1N65A 1CDNA 2M3WA 5AFPA 1RFJA 4FTGA 3JVTC 4HRGA 4NDDA 1TUZA 1QATA 3R1OA 4USLA 4YGAA 1JFJA 5PALA 3BUOB 3RLZA 2NCOA 1DTLA 1FPWA 2KBIA 4N1FA 5I94A 3WHUB 4P2YB 4F7FA 3EK7A 1XFUO 1EL4A 4PE0A 3GOFA 3V2LA 1NX2A 1Z2CB 2ZNDA 1DF0B 1PVBA 1TTXA 1W9ZA 3DF0B 4CPVA 1XFRA 3IVTA 1BMOA 2BKIB 3CZ0A 3EK4A 4QJ4B 2LVJA 2LCPA 3IQOA 1XFWO 2JXLA 1PRWA 2LV7A 3VRPA 1RROA 4CFRA 2MLEC 2O5GA 3CZ1A 1F55A 1WRKA 2M29A 2ZFDA 1CB1A 1JF0A 1CMGA 1AP4A 1F8HA 1J7RA 1S6CA 2JOJA 2CT9A 2K7CA 3L4AA 3TS5C 1B8RA 3D74A 4FQTA 4C0KA 4PE1A 3CWGA 1QV0A 2I7AA 2KFHA 2H2KA 1NYAA 1DJHA 1NUBA 2K7DA 1TNXA 2SASA 2KSPA 1AJ5A 1HQVA 3LK0A 1QX2A 2L2CA 4XJKA 3S0EA 4HSZA 2PALA 1GGZA 2F3ZA 2FJYA 2L98A 3NSIA 3OBVA 3BQ3A 3OGNA 4AQIA 1A03A 3GK2A 2CCMA 3JTDC 1LKJA 1E8AA 3FIAA 1KK7Z 4PHNA 3CLNA 3AKAA 4I5NB 1QTXA 3EVVA 1CDMA 1KWOC 2LMTA 4N1GA 2WOSA 1OOJA 2FCEA 1K93D 4XYNA 3OX5A 1DQEA 1QS7A 1L7ZA 1S5GY 1BG1A 3GK1A 2KFFA 4GAOA 2JU0A 5GQQC 2COLB 2JT8A 2WCMA 3H4SE 3I5FB 2H8VA 3C1VA 4NDCA 5KU1A 2MHHA 3A4UB 3NGVA 5DKRA 1CNPA 2JPTA 1IIOA 4ETOA 2WORA 4C0JA
chains in the Genus database with same CATH topology
4A4CA 2MAZA 1NX0A 1QJTA 2PMYA 2BBMA 2I18A 2LUCA 1DMOA 4NDBA 4ZCVA 1W7JB 2LLTA 2NZ0A 1OZOA 1JFKA 1ODBA 4Q04A 3D0YA 2WNDA 1AK8A 1FBVA 1J7QA 5IBWA 1GGWA 4MZJA 1CDLA 3BUMB 3D10A 3EK8A 4BY4A 3E3RA 3MSEB 2K2AA 1FW4A 3TDZA 3EKHA 1NCXA 3AAKA 2E6WA 5AEQA 3PN7B 3VRNA 1QIWA 2JZIA 1Y6WA 3NSLA 1SL7A 3PLFB 1UHNA 1AUIB 4CFQA 1K8UA 3SIAA 2L51A 2CTNA 2PASA 2KI6D 1M46A 3BXKA 3I5HB 1V1FA 4I5KA 2JRFA 2PSRA 1A75A 1SRAA 1K9KA 4MBEA 1TOPA 1BR4B 1U5IB 3SIBA 3ZNIA 3BUXB 1Y1UA 1BT6A 1SMGA 2Y1NA 1CM1A 1QIVA 3NSKA 4JPZB 3CS1A 4YRUA 3TDIA 2BCAA 2ZKMX 3KEVA 5HKWA 5J3XA 1YR5A 1F4QA 4YI9A 1UUSA 1NX3A 1KFUS 1KFXL 1S5GZ 1WRLA 1XFVO 4D1EA 4QJ5B 1OSAA 2I94A 1YVHA 2I2RE 5CSNA 1RJVA 5CSIA 1IJ5A 1CM4A 3WNXB 5HLVA 1DVIA 1EG4A 3K21A 2MRDA 2KQYA 3PFVA 4HREE 4DUQA 2ZN8A 1KFUL 1JUOA 1ALVA 2KGRA 1LA3A 4PDZA 1GQMA 2OS8B 4GGFC 1SR6B 2IS9A 1RECA 2Y4QA 2L4IA 1YTZC 4PHMA 3OP0A 1WDCB 1N2DA 1A75B 2LC5A 1CLBA 1CFFA 3O2PA 4I5LB 4F0ZB 1F71A 2JXCA 3OB2B 3TZ1A 1NCZA 1B8CA 1MHOA 2HQ8A 2M7LA 3CR5X 1DGUA 1G8IA 1J7PA 1G33A 3PATA 2F8PA 1TCFA 4L9MA 1D1OA 2BE6A 1WLMA 4MRXA 1Y0VH 1H4BA 2Q91A 4OR9B 1EH2A 3CR4X 1B4CA 3I5IB 3KPXA 2LMUA 2B1UA 4PE7A 4YBHB 1ZUZA 2LUXA 3M0WA 1LINA 2L50A 3PSRA 1XK4A 3HCMA 2QPTA 4MZLA 2KFGA 2PVBA 1S1EA 4MLWA 5CSFA 4AQJA 2M7NA 1A29A 5BPJA 4GBAA 1HT9A 2GGMA 5F6TA 1M45A 5HKYA 1LVCD 4BY5A 2LVIA 5K89A 1KSOA 2KI4B 1QX5B 2JT3A 3PM8A 2QACA 1CLMA 2FCDA 1XO5A 3I5GB 5CSJA 1IQ3A 3KHEA 2EGDA 3WHTB 2LMVA 4CLNA 1V1GA 3VRQA 3OHMB 4JQ0D 4OKHA 2G9BA 1XYDA 1OZSA 3CZTX 1YUTA 1TNWA 2PRUA 5DKNA 3TS5B 5TNCA 2CXJA 2R2IA 2LHIA 1IQ5A 4YGDB 3ICBA 1UP5A 1UURA 5JJGA 2HETA 2M0RA 3OX6A 1TCOB 2BCBA 2EC6B 1YVLA 3SG2A 3I5FC 1KCYA 1AVSA 1CMFA 2GV5A 4GGNA 1Y1AA 4YI8A 2MBXA 1B7TY 2K7OA 2OTGB 4XJKB 1C07A 3OB1B 1B1GA 5DKQA 4HRHA 4DCKA 2MLFC 1UHJA 2BL0B 1OMRA 2KHNA 2JTZA 2LVKA 2M9GA 2WCEA 1RK9A 1PVAA 3DVJA 1JBAA 1M31A 2KNEA 4MN0A 3SG3A 1KK8C 4YGEB 1SCMB 4WRIA 3VRRA 4FQOA 1DJYA 4WQ3A 1M39A 2H61C 3PN7C 5AANA 1EJ3A 4P5OE 3EKJA 1J7OA 1K2HA 2L5XB 3SJSA 1J1EA 1SBJA 2M1UA 1IH0A 2L4HA 5HYDA 3I5HC 1CFPA 3DD4A 4ORAB 3TUYB 1IJ6A 4U8DA 1MR8A 1DJWA 2G2BA 1WRZA 2FOTA 2BBNA 2HF5A 3FS7A 2KAVA 1L2OB 2GGZA 4PHJA 1WY9A 4ORCB 1PSBA 2F33A 1UHKA 3LL8B 3D0YB 3O6BA 1AHRA 3GK4X 1F70A 1J55A 1MUXA 4MEWA 5AXIA 4MSPA 1QXPA 1W7IB 3SG4A 2KYCA 3BYAA 1F4OA 1XFYO 3FWCA 1LXFC 4OCIA 1S36A 2HQWA 5JOLA 1QV1A 4DS7A 1RWYA 1OMDA 4CIDA 1M63B 2JQ6A 5KTYA 1NCYA 1B7TZ 1SK6D 1RTP1 5I2LA 4PALA 2OS8C 1SR6C 1MXLC 1DF0A 3EVRA 3KO0A 1WDCC 2KI6C 3CTNA 2NXQA 2CNPA 1AJ4A 4MRYA 1KQMB 2LM5A 1MQ1A 2M97A 1NWDA 4MZKA 1ZFSA 2F2OA 1YURA 3SG7A 1IWQA 1PALA 3BOWA 1OE9B 4NQGA 1BR1B 1B8LA 1PULA 1UHHA 4PHKA 1UHIA 1CLLA 1SKTA 2WC8A 1IRJA 1ZACA 1CTRA 1XFZO 3EVUA 2JT0A 2ISDA 1YUSA 3JVTB 2KBMA 3I5IC 1DJGA 1K94A 2ZNEA 3ZWHA 3FWBA 5I2QA 4R1EA 1BOCA 1SPYA 2M49B 2Y1MA 4GNKB 2K8MB 2JNFA 4QJ3B 4TNCA 3PALA 1SCVA 1Y1XA 1LA0A 1EXRA 2TN4A 2LLSA 1SY9A 2P6BB 5D69A 2WCBA 4IL1A 1SL8A 1ZOTB 2ZRTA 3A8RA 1NSHA 2KQ6A 1F54A 1QLSA 2LE9B 2KAXA 1N0YA 5FYXA 3HX4A 3SG6A 1JSAA 4JWQA 4M2OA 1IKUA 4ZCUA 4MVFA 3BOWB 2KDHA 2LAPA 2KI4C 2K61A 2MJWB 4M2QA 3AAJA 3IF7A 3I5GC 2BE4A 3BUNB 2K7BA 1B47A 2K2FA 3DVEA 1SYMA 1YX8A 1TNPA 3CGAA 3TUYC 1TN4A 1CFCA 2KAYA 1S26D 4ORBB 2ZN9A 2CBLA 1DT7B 1MWNA 1VRKA 1TIZA 1BODA 1XK4C 2EC6C 1IGVA 2LNKA 4C0LA 3VGOA 5I8NA 4UPGA 1YX7A 5HLOA 2RGIA 3DVKA 5G08A 1DJIA 1J1DA 2LP3A 5AERA 2LP2A 3BUWB 3WXAA 1PSRA 2NLNA 2OTGC 4M2PA 4DIRA 4YGBB 3JTDB 5ER5A 1OQPA 1SL9A 1XVJA 3LLEA 2EHBA 2M1KB 2SCPA 1H8BA 3DVMA 3SG5A 3NXAA 1KWOB 2BL0C 3O4YA 1K96A 2DOQA 1C7WA 1YUUA 1NPQA 5KSZA 1QLKA 1JC2A 1NP8A 1IG5A 2Y5IA 1YRUB 2H61A 4WQ2A 1QVIY 1UWOA 1KQVA 1KSMA 2BECA 2LHLA 2MA2A 2FJUB 2L2EA 1A2XA 1K9PA 1SCMC 3TDUA 2M8UA 1C7VA 4OVNF 1NX1A 1S3PA 2KGBC 4E68A 5ER4X 5B8IB 1X02A 2K0JA 1FI6A 1S6JA 4DRWA 1MF8B 1JF2A 2D8NA 1U5IA 4OV2A 2NCPA 1BF5A 3AKBA 1Q80A 2ZRSA 4AOMA 1BLQA 1FI5A 1ZMZA 4I5JA 2JC2A 3KF9A 2Q4UA 2OPOA 2LVVA 2V53A 1CKKA 1L2OC 4YGCB 2LLUA 2F2PA 5D7FA 1B9AA 1BJFA 1FF1A 1KK8B 3LK1A 3CR2A 1R2UA 1CDPA 4A4BA 1PK0D 2KOTA 1TRFA 3RM1A 1JWDA 1DJZA 2JULA 3VROA 2WCFA 2JNXA 3NSOA 1EG3A 2LANA 1G4YR 3O78A 2KYFA 2A4JA 1A4PA 2E30A 2JWWA 1TNQA 1S6IA 4GGFA 5CPVA 2BCXA 3IQQA 4PE4A 1XFXO 1QASA 1KFXS 1NIWA 1K90D 4GUKA 5I2OA 1R6PA 2HPSA 1MXEA 2O60A 2BKHB 4GPLB 1BU3A 3DF0A 1K9UA 1KQMC 1QX7A 3QRXA 5HKZA 1OMVA 4ICBA 4PCWA 2VRGA 1YRTB 1CFDA 1GJYA 3F45A 1DGVA 2AAOA 1QVIZ 2F3YA 4GFTA 1ALWA 1K95A 2L0PA 1DJXA 2JTTA 2AUCA 4N5XA 1SW8A 1KK7Y 1XA5A 1SNLA 2AMIA 3LCPC 1WLZA 1N65A 1CDNA 2M3WA 5AFPA 1RFJA 4FTGA 3JVTC 4HRGA 4NDDA 4USLA 1QATA 4YGAA 1JFJA 5PALA 3BUOB 3RLZA 2NCOA 1DTLA 1FPWA 2KBIA 4N1FA 3WHUB 4P2YB 3EK7A 1XFUO 1EL4A 4PE0A 3GOFA 1NX2A 2ZNDA 1DF0B 1PVBA 1TTXA 3DF0B 4CPVA 1BMOA 2BKIB 3EK4A 4QJ4B 2LVJA 2LCPA 3IQOA 1XFWO 2JXLA 1PRWA 2LV7A 3VRPA 1RROA 4CFRA 2MLEC 2O5GA 1F55A 1WRKA 2M29A 2ZFDA 1CB1A 1JF0A 1CMGA 1AP4A 1F8HA 1J7RA 1S6CA 2JOJA 2CT9A 2K7CA 3TS5C 1B8RA 4C0KA 4PE1A 3CWGA 1QV0A 2I7AA 2KFHA 2H2KA 1NYAA 1DJHA 1NUBA 2K7DA 1TNXA 2SASA 2KSPA 1AJ5A 1HQVA 3LK0A 1QX2A 4XJKA 4HSZA 2PALA 1GGZA 2F3ZA 2L98A 3NSIA 4AQIA 3BQ3A 1A03A 3GK2A 2CCMA 3JTDC 1LKJA 1E8AA 3FIAA 1KK7Z 4PHNA 3CLNA 3AKAA 4I5NB 1QTXA 3EVVA 1CDMA 1KWOC 2LMTA 4N1GA 2WOSA 1OOJA 2FCEA 1K93D 4XYNA 3OX5A 1QS7A 1L7ZA 1S5GY 1BG1A 3GK1A 2KFFA 4GAOA 2JU0A 5GQQC 2COLB 2JT8A 3H4SE 3I5FB 3C1VA 4NDCA 5KU1A 2MHHA 3A4UB 5DKRA 1CNPA 2JPTA 4ETOA 2WORA 4C0JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A4C A;  2MAZ A;  1NX0 A;  1QJT A;  2PMY A;  2BBM A;  2I18 A;  2LUC A;  1DMO A;  4NDB A;  4ZCV A;  1W7J B;  2LLT A;  2NZ0 A;  1OZO A;  1JFK A;  1ODB A;  4Q04 A;  3D0Y A;  2WND A;  1AK8 A;  1FBV A;  1J7Q A;  5IBW A;  1GGW A;  4MZJ A;  1CDL A;  3BUM B;  3D10 A;  3EK8 A;  4BY4 A;  3E3R A;  3MSE B;  2K2A A;  1FW4 A;  3TDZ A;  3EKH A;  1NCX A;  3AAK A;  2E6W A;  5AEQ A;  3PN7 B;  3VRN A;  1QIW A;  2JZI A;  1Y6W A;  3NSL A;  1SL7 A;  3PLF B;  1UHN A;  1AUI B;  4CFQ A;  1K8U A;  3SIA A;  2L51 A;  2CTN A;  2PAS A;  2KI6 D;  1M46 A;  3BXK A;  3I5H B;  1V1F A;  4I5K A;  2JRF A;  2PSR A;  1A75 A;  1SRA A;  1K9K A;  4MBE A;  1TOP A;  1BR4 B;  1U5I B;  3SIB A;  3ZNI A;  3BUX B;  1Y1U A;  1BT6 A;  1SMG A;  2Y1N A;  1CM1 A;  1QIV A;  3NSK A;  4JPZ B;  3CS1 A;  4YRU A;  3TDI A;  2BCA A;  2ZKM X;  3KEV A;  5HKW A;  5J3X A;  1YR5 A;  1F4Q A;  4YI9 A;  1UUS A;  1NX3 A;  1KFU S;  1KFX L;  1S5G Z;  1WRL A;  1XFV O;  4D1E A;  4QJ5 B;  1OSA A;  2I94 A;  1YVH A;  2I2R E;  5CSN A;  1RJV A;  5CSI A;  1IJ5 A;  1CM4 A;  3WNX B;  5HLV A;  1DVI A;  1EG4 A;  3K21 A;  2MRD A;  2KQY A;  3PFV A;  4HRE E;  4DUQ A;  2ZN8 A;  1KFU L;  1JUO A;  1ALV A;  2KGR A;  1LA3 A;  4PDZ A;  1GQM A;  2OS8 B;  4GGF C;  1SR6 B;  2IS9 A;  1REC A;  2Y4Q A;  2L4I A;  1YTZ C;  4PHM A;  3OP0 A;  1WDC B;  1N2D A;  1A75 B;  2LC5 A;  1CLB A;  1CFF A;  3O2P A;  4I5L B;  4F0Z B;  1F71 A;  2JXC A;  3OB2 B;  3TZ1 A;  1NCZ A;  1B8C A;  1MHO A;  2HQ8 A;  2M7L A;  3CR5 X;  1DGU A;  1G8I A;  1J7P A;  1G33 A;  3PAT A;  2F8P A;  1TCF A;  4L9M A;  1D1O A;  2BE6 A;  1WLM A;  4MRX A;  1Y0V H;  1H4B A;  2Q91 A;  4OR9 B;  1EH2 A;  3CR4 X;  1B4C A;  3I5I B;  3KPX A;  2LMU A;  2B1U A;  4PE7 A;  4YBH B;  1ZUZ A;  2LUX A;  3M0W A;  1LIN A;  2L50 A;  3PSR A;  1XK4 A;  3HCM A;  2QPT A;  4MZL A;  2KFG A;  2PVB A;  1S1E A;  4MLW A;  5CSF A;  4AQJ A;  2M7N A;  1A29 A;  5BPJ A;  4GBA A;  1HT9 A;  2GGM A;  5F6T A;  1M45 A;  5HKY A;  1LVC D;  4BY5 A;  2LVI A;  5K89 A;  1KSO A;  2KI4 B;  1QX5 B;  2JT3 A;  3PM8 A;  2QAC A;  1CLM A;  2FCD A;  1XO5 A;  3I5G B;  5CSJ A;  1IQ3 A;  3KHE A;  2EGD A;  3WHT B;  2LMV A;  4CLN A;  1V1G A;  3VRQ A;  3OHM B;  4JQ0 D;  4OKH A;  2G9B A;  1XYD A;  1OZS A;  3CZT X;  1YUT A;  1TNW A;  2PRU A;  5DKN A;  3TS5 B;  5TNC A;  2CXJ A;  2R2I A;  2LHI A;  1IQ5 A;  4YGD B;  3ICB A;  1UP5 A;  1UUR A;  5JJG A;  2HET A;  2M0R A;  3OX6 A;  1TCO B;  2BCB A;  2EC6 B;  1YVL A;  3SG2 A;  3I5F C;  1KCY A;  1AVS A;  1CMF A;  2GV5 A;  4GGN A;  1Y1A A;  4YI8 A;  2MBX A;  1B7T Y;  2K7O A;  2OTG B;  4XJK B;  1C07 A;  3OB1 B;  1B1G A;  5DKQ A;  4HRH A;  4DCK A;  2MLF C;  1UHJ A;  2BL0 B;  1OMR A;  2KHN A;  2JTZ A;  2LVK A;  2M9G A;  2WCE A;  1RK9 A;  1PVA A;  3DVJ A;  1JBA A;  1M31 A;  2KNE A;  4MN0 A;  3SG3 A;  1KK8 C;  4YGE B;  1SCM B;  4WRI A;  3VRR A;  4FQO A;  1DJY A;  4WQ3 A;  1M39 A;  2H61 C;  3PN7 C;  5AAN A;  1EJ3 A;  4P5O E;  3EKJ A;  1J7O A;  1K2H A;  2L5X B;  3SJS A;  1J1E A;  1SBJ A;  2M1U A;  1IH0 A;  2L4H A;  5HYD A;  3I5H C;  1CFP A;  3DD4 A;  4ORA B;  3TUY B;  1IJ6 A;  4U8D A;  1MR8 A;  1DJW A;  2G2B A;  1WRZ A;  2FOT A;  2BBN A;  2HF5 A;  3FS7 A;  2KAV A;  1L2O B;  2GGZ A;  4PHJ A;  1WY9 A;  4ORC B;  1PSB A;  2F33 A;  1UHK A;  3LL8 B;  3D0Y B;  3O6B A;  1AHR A;  3GK4 X;  1F70 A;  1J55 A;  1MUX A;  4MEW A;  5AXI A;  4MSP A;  1QXP A;  1W7I B;  3SG4 A;  2KYC A;  3BYA A;  1F4O A;  1XFY O;  3FWC A;  1LXF C;  4OCI A;  1S36 A;  2HQW A;  5JOL A;  1QV1 A;  4DS7 A;  1RWY A;  1OMD A;  4CID A;  1M63 B;  2JQ6 A;  5KTY A;  1NCY A;  1B7T Z;  1SK6 D;  1RTP 1;  5I2L A;  4PAL A;  2OS8 C;  1SR6 C;  1MXL C;  1DF0 A;  3EVR A;  3KO0 A;  1WDC C;  2KI6 C;  3CTN A;  2NXQ A;  2CNP A;  1AJ4 A;  4MRY A;  1KQM B;  2LM5 A;  1MQ1 A;  2M97 A;  1NWD A;  4MZK A;  1ZFS A;  2F2O A;  1YUR A;  3SG7 A;  1IWQ A;  1PAL A;  3BOW A;  1OE9 B;  4NQG A;  1BR1 B;  1B8L A;  1PUL A;  1UHH A;  4PHK A;  1UHI A;  1CLL A;  1SKT A;  2WC8 A;  1IRJ A;  1ZAC A;  1CTR A;  1XFZ O;  3EVU A;  2JT0 A;  2ISD A;  1YUS A;  3JVT B;  2KBM A;  3I5I C;  1DJG A;  1K94 A;  2ZNE A;  3ZWH A;  3FWB A;  5I2Q A;  4R1E A;  1BOC A;  1SPY A;  2M49 B;  2Y1M A;  4GNK B;  2K8M B;  2JNF A;  4QJ3 B;  4TNC A;  3PAL A;  1SCV A;  1Y1X A;  1LA0 A;  1EXR A;  2TN4 A;  2LLS A;  1SY9 A;  2P6B B;  5D69 A;  2WCB A;  4IL1 A;  1SL8 A;  1ZOT B;  2ZRT A;  3A8R A;  1NSH A;  2KQ6 A;  1F54 A;  1QLS A;  2LE9 B;  2KAX A;  1N0Y A;  5FYX A;  3HX4 A;  3SG6 A;  1JSA A;  4JWQ A;  4M2O A;  1IKU A;  4ZCU A;  4MVF A;  3BOW B;  2KDH A;  2LAP A;  2KI4 C;  2K61 A;  2MJW B;  4M2Q A;  3AAJ A;  3IF7 A;  3I5G C;  2BE4 A;  3BUN B;  2K7B A;  1B47 A;  2K2F A;  3DVE A;  1SYM A;  1YX8 A;  1TNP A;  3CGA A;  3TUY C;  1TN4 A;  1CFC A;  2KAY A;  1S26 D;  4ORB B;  2ZN9 A;  2CBL A;  1DT7 B;  1MWN A;  1VRK A;  1TIZ A;  1BOD A;  1XK4 C;  2EC6 C;  1IGV A;  2LNK A;  4C0L A;  3VGO A;  5I8N A;  4UPG A;  1YX7 A;  5HLO A;  2RGI A;  3DVK A;  5G08 A;  1DJI A;  1J1D A;  2LP3 A;  5AER A;  2LP2 A;  3BUW B;  3WXA A;  1PSR A;  2NLN A;  2OTG C;  4M2P A;  4DIR A;  4YGB B;  3JTD B;  5ER5 A;  1OQP A;  1SL9 A;  1XVJ A;  3LLE A;  2EHB A;  2M1K B;  2SCP A;  1H8B A;  3DVM A;  3SG5 A;  3NXA A;  1KWO B;  2BL0 C;  3O4Y A;  1K96 A;  2DOQ A;  1C7W A;  1YUU A;  1NPQ A;  5KSZ A;  1QLK A;  1JC2 A;  1NP8 A;  1IG5 A;  2Y5I A;  1YRU B;  2H61 A;  4WQ2 A;  1QVI Y;  1UWO A;  1KQV A;  1KSM A;  2BEC A;  2LHL A;  2MA2 A;  2FJU B;  2L2E A;  1A2X A;  1K9P A;  1SCM C;  3TDU A;  2M8U A;  1C7V A;  4OVN F;  1NX1 A;  1S3P A;  2KGB C;  4E68 A;  5ER4 X;  5B8I B;  1X02 A;  2K0J A;  1FI6 A;  1S6J A;  4DRW A;  1MF8 B;  1JF2 A;  2D8N A;  1U5I A;  4OV2 A;  2NCP A;  1BF5 A;  3AKB A;  1Q80 A;  2ZRS A;  4AOM A;  1BLQ A;  1FI5 A;  1ZMZ A;  4I5J A;  2JC2 A;  3KF9 A;  2Q4U A;  2OPO A;  2LVV A;  2V53 A;  1CKK A;  1L2O C;  4YGC B;  2LLU A;  2F2P A;  5D7F A;  1B9A A;  1BJF A;  1FF1 A;  1KK8 B;  3LK1 A;  3CR2 A;  1R2U A;  1CDP A;  4A4B A;  1PK0 D;  2KOT A;  1TRF A;  3RM1 A;  1JWD A;  1DJZ A;  2JUL A;  3VRO A;  2WCF A;  2JNX A;  3NSO A;  1EG3 A;  2LAN A;  1G4Y R;  3O78 A;  2KYF A;  2A4J A;  1A4P A;  2E30 A;  2JWW A;  1TNQ A;  1S6I A;  4GGF A;  5CPV A;  2BCX A;  3IQQ A;  4PE4 A;  1XFX O;  1QAS A;  1KFX S;  1NIW A;  1K90 D;  4GUK A;  5I2O A;  1R6P A;  2HPS A;  1MXE A;  2O60 A;  2BKH B;  4GPL B;  1BU3 A;  3DF0 A;  1K9U A;  1KQM C;  1QX7 A;  3QRX A;  5HKZ A;  1OMV A;  4ICB A;  4PCW A;  2VRG A;  1YRT B;  1CFD A;  1GJY A;  3F45 A;  1DGV A;  2AAO A;  1QVI Z;  2F3Y A;  4GFT A;  1ALW A;  1K95 A;  2L0P A;  1DJX A;  2JTT A;  2AUC A;  4N5X A;  1SW8 A;  1KK7 Y;  1XA5 A;  1SNL A;  2AMI A;  3LCP C;  1WLZ A;  1N65 A;  1CDN A;  2M3W A;  5AFP A;  1RFJ A;  4FTG A;  3JVT C;  4HRG A;  4NDD A;  4USL A;  1QAT A;  4YGA A;  1JFJ A;  5PAL A;  3BUO B;  3RLZ A;  2NCO A;  1DTL A;  1FPW A;  2KBI A;  4N1F A;  3WHU B;  4P2Y B;  3EK7 A;  1XFU O;  1EL4 A;  4PE0 A;  3GOF A;  1NX2 A;  2ZND A;  1DF0 B;  1PVB A;  1TTX A;  3DF0 B;  4CPV A;  1BMO A;  2BKI B;  3EK4 A;  4QJ4 B;  2LVJ A;  2LCP A;  3IQO A;  1XFW O;  2JXL A;  1PRW A;  2LV7 A;  3VRP A;  1RRO A;  4CFR A;  2MLE C;  2O5G A;  1F55 A;  1WRK A;  2M29 A;  2ZFD A;  1CB1 A;  1JF0 A;  1CMG A;  1AP4 A;  1F8H A;  1J7R A;  1S6C A;  2JOJ A;  2CT9 A;  2K7C A;  3TS5 C;  1B8R A;  4C0K A;  4PE1 A;  3CWG A;  1QV0 A;  2I7A A;  2KFH A;  2H2K A;  1NYA A;  1DJH A;  1NUB A;  2K7D A;  1TNX A;  2SAS A;  2KSP A;  1AJ5 A;  1HQV A;  3LK0 A;  1QX2 A;  4XJK A;  4HSZ A;  2PAL A;  1GGZ A;  2F3Z A;  2L98 A;  3NSI A;  4AQI A;  3BQ3 A;  1A03 A;  3GK2 A;  2CCM A;  3JTD C;  1LKJ A;  1E8A A;  3FIA A;  1KK7 Z;  4PHN A;  3CLN A;  3AKA A;  4I5N B;  1QTX A;  3EVV A;  1CDM A;  1KWO C;  2LMT A;  4N1G A;  2WOS A;  1OOJ A;  2FCE A;  1K93 D;  4XYN A;  3OX5 A;  1QS7 A;  1L7Z A;  1S5G Y;  1BG1 A;  3GK1 A;  2KFF A;  4GAO A;  2JU0 A;  5GQQ C;  2COL B;  2JT8 A;  3H4S E;  3I5F B;  3C1V A;  4NDC A;  5KU1 A;  2MHH A;  3A4U B;  5DKR A;  1CNP A;  2JPT A;  4ETO A;  2WOR A;  4C0J A; 
#chains in the Genus database with same CATH topology
 4A4C A;  2K60 A;  2MAZ A;  2YGU A;  1NX0 A;  1QJT A;  2PMY A;  2BBM A;  2I18 A;  2LUC A;  1DMO A;  4NDB A;  3R1V A;  4ZCV A;  1W7J B;  2LLT A;  2NZ0 A;  1OZO A;  1JFK A;  1ODB A;  4Q04 A;  3D0Y A;  2WND A;  1AK8 A;  1FBV A;  1J7Q A;  3VB1 A;  5IBW A;  4MZJ A;  1CDL A;  3BUM B;  3D10 A;  3EK8 A;  4BY4 A;  1GGW A;  3E3R A;  3MSE B;  2K2A A;  1FW4 A;  2BAP A;  3TDZ A;  3EKH A;  1NCX A;  3AAK A;  2E6W A;  5AEQ A;  3PN7 B;  3VRN A;  1QIW A;  2JZI A;  1Y6W A;  3NSL A;  1SL7 A;  3PLF B;  1UHN A;  1AUI B;  4CFQ A;  1K8U A;  3SIA A;  5HL1 A;  3SS4 A;  2L51 A;  2CTN A;  2PAS A;  2KI6 D;  1M46 A;  3BXK A;  3I5H B;  1V1F A;  4I5K A;  2JRF A;  2PSR A;  1A75 A;  4INX A;  1SRA A;  1K9K A;  4MBE A;  1TOP A;  1BR4 B;  1U5I B;  3R72 A;  3SIB A;  3ZNI A;  3BUX B;  1Y1U A;  1BT6 A;  1SMG A;  2Y1N A;  1CM1 A;  1QIV A;  3NSK A;  4JPZ B;  3CS1 A;  4YRU A;  3TDI A;  2BCA A;  2ZKM X;  3SS5 A;  3KEV A;  5HKW A;  5J3X A;  1YR5 A;  1F4Q A;  4YI9 A;  1UUS A;  1NX3 A;  1KFU S;  1KFX L;  1S5G Z;  1WRL A;  1XFV O;  4D1E A;  4QJ5 B;  1OSA A;  3UO9 A;  2I94 A;  1YVH A;  1QWV A;  2I2R E;  1RJV A;  5CSN A;  5FI6 A;  5CSI A;  1IJ5 A;  1CM4 A;  2ERB A;  3WNX B;  5HLV A;  1DVI A;  1EG4 A;  3K21 A;  2MRD A;  2KQY A;  3PFV A;  4HRE E;  4DUQ A;  3BFH A;  2ZN8 A;  1KFU L;  1JUO A;  3FE9 A;  1ALV A;  2KGR A;  1LA3 A;  4PDZ A;  1GQM A;  2OS8 B;  2QEV A;  1SR6 B;  2IS9 A;  4GGF C;  1REC A;  2Y4Q A;  1DC1 A;  2L4I A;  1YTZ C;  4PHM A;  3OP0 A;  1WDC B;  1N2D A;  1A75 B;  1OOI X;  2LC5 A;  1CLB A;  1CFF A;  3O2P A;  4I5L B;  2KPH A;  3B7A A;  4F0Z B;  1F71 A;  2JXC A;  3BJH A;  3OB2 B;  3TZ1 A;  1NCZ A;  1B8C A;  1MHO A;  2HQ8 A;  2M7L A;  3CR5 X;  1DGU A;  1G8I A;  3L4L A;  1G33 A;  1J7P A;  1T14 A;  1DEK A;  3PAT A;  2F8P A;  1TCF A;  4L9M A;  1D1O A;  2BE6 A;  1WLM A;  3R1P A;  1Y0V H;  4MRX A;  5EL2 A;  1GM0 A;  1H4B A;  2Q91 A;  4OR9 B;  1EH2 A;  3CR4 X;  1B4C A;  3I5I B;  3KPX A;  3D77 A;  2LMU A;  3S0A A;  2B1U A;  4PE7 A;  4YBH B;  1ZUZ A;  2LUX A;  3M0W A;  1LIN A;  3L47 A;  2L50 A;  3PSR A;  1XK4 A;  3HCM A;  2QPT A;  4MZL A;  2KFG A;  2PVB A;  2WCL A;  1S1E A;  4MLW A;  5CSF A;  4AQJ A;  3S0G A;  2M7N A;  1OOF A;  2QEB A;  1A29 A;  5BPJ A;  4GBA A;  1HT9 A;  2GGM A;  5F6T A;  1M45 A;  5HKY A;  1LVC D;  4BY5 A;  2LVI A;  5K89 A;  1KSO A;  2BNX A;  2KI4 B;  1QX5 B;  2JT3 A;  3PM8 A;  2QAC A;  1CLM A;  2FCD A;  1XO5 A;  3I5G B;  5CSJ A;  1OOG A;  1IQ3 A;  3KHE A;  2EGD A;  3WHT B;  2LMV A;  4CLN A;  1V1G A;  3VRQ A;  3OHM B;  3D78 A;  4JQ0 D;  4OKH A;  2G9B A;  1XYD A;  1OZS A;  3CZT X;  1YUT A;  1TNW A;  2PRU A;  5DKN A;  3TS5 B;  5TNC A;  2WC5 A;  2CXJ A;  2R2I A;  2LHI A;  1IQ5 A;  4YGD B;  3ICB A;  1UP5 A;  1UUR A;  5JJG A;  2HET A;  2M0R A;  3OX6 A;  1TCO B;  2BCB A;  2EC6 B;  1YVL A;  3SG2 A;  2GTE A;  3DY9 A;  3I5F C;  3CAB A;  5DIC A;  2P70 A;  2WCJ A;  1AVS A;  1KCY A;  3PM2 A;  3UNW A;  3QME A;  1CMF A;  2JPO A;  1Z4H A;  2GV5 A;  1TUJ A;  1Y1A A;  4GGN A;  4YI8 A;  2MBX A;  3RZS A;  1B7T Y;  3BFA A;  2K7O A;  2OTG B;  4XJK B;  1C07 A;  3OB1 B;  1B1G A;  5DKQ A;  4HRH A;  4DCK A;  2MLF C;  1UHJ A;  2BL0 B;  1OMR A;  2KHN A;  2JTZ A;  2LVK A;  2M9G A;  2WCE A;  1RK9 A;  1PVA A;  3DVJ A;  1JBA A;  1M31 A;  2KNE A;  3CZ2 A;  4MN0 A;  3SG3 A;  1KK8 C;  4YGE B;  1SCM B;  4WRI A;  3SS3 A;  3VRR A;  4FQO A;  1DJY A;  4WQ3 A;  1M39 A;  2H61 C;  3PN7 C;  5AAN A;  1EJ3 A;  2P71 A;  4P5O E;  3S0F A;  3EKJ A;  1J7O A;  1K2H A;  2L5X B;  3SJS A;  1J1E A;  1SBJ A;  1SSE B;  2M1U A;  1IH0 A;  2L4H A;  5HYD A;  3I5H C;  1CFP A;  1P28 A;  3DD4 A;  4ORA B;  5FI7 A;  3TUY B;  1IJ6 A;  4U8D A;  1MR8 A;  1DJW A;  2G2B A;  1WRZ A;  2FOT A;  2BBN A;  2HF5 A;  3FS7 A;  2KAV A;  1L2O B;  3B86 A;  2GGZ A;  4PHJ A;  1WY9 A;  4ORC B;  1PSB A;  2F33 A;  1UHK A;  3LL8 B;  3D0Y B;  3O6B A;  3Q8I A;  1AHR A;  3GK4 X;  1F70 A;  1J55 A;  1MUX A;  4MEW A;  5AXI A;  4MSP A;  1QXP A;  1C3Y A;  1W7I B;  3SG4 A;  2KYC A;  3BYA A;  1F4O A;  1XFY O;  3FWC A;  1LXF C;  1OW4 A;  4OCI A;  1S36 A;  2HQW A;  5JOL A;  1QV1 A;  4DS7 A;  1RWY A;  1OMD A;  2WC6 A;  1M63 B;  4CID A;  2PYQ A;  2JQ6 A;  5KTY A;  1NCY A;  1B7T Z;  1SK6 D;  1RTP 1;  2KLD A;  3DZT A;  4PAL A;  5I2L A;  3NHT A;  2OS8 C;  1SR6 C;  1MXL C;  1DF0 A;  3EVR A;  3KO0 A;  2QDI A;  3S0D A;  1WDC C;  2KI6 C;  3CTN A;  2NXQ A;  2CNP A;  1AJ4 A;  1DEL A;  4MRY A;  3CYZ A;  1KQM B;  2LM5 A;  4JD9 A;  1MQ1 A;  2M97 A;  1NWD A;  4MZK A;  1LS8 A;  1ZFS A;  2F2O A;  1YUR A;  3SG7 A;  1IWQ A;  1PAL A;  3BOW A;  1OE9 B;  4NQG A;  1BR1 B;  1B8L A;  1PUL A;  1UHH A;  4PHK A;  1UHI A;  1CLL A;  1SKT A;  1ORG A;  1IRJ A;  2WC8 A;  1ZAC A;  3D76 A;  1CTR A;  1XFZ O;  3EVU A;  1TWO A;  2JT0 A;  2ISD A;  1YUS A;  3JVT B;  2KBM A;  2WCK A;  1DJG A;  1C3Z A;  1K94 A;  3I5I C;  2ZNE A;  3ZWH A;  3FWB A;  5I2Q A;  4R1E A;  1BOC A;  1SPY A;  2M49 B;  2Y1M A;  4GNK B;  2K8M B;  2JNF A;  4QJ3 B;  4TNC A;  3PAL A;  1SCV A;  1Y1X A;  1LA0 A;  1EXR A;  2TN4 A;  2KLE A;  2LLS A;  1OOH A;  1SY9 A;  2P6B B;  3S0B A;  5D69 A;  2WCB A;  4IL1 A;  1SL8 A;  5FI2 A;  1ZOT B;  2ZRT A;  3A8R A;  1NSH A;  2KQ6 A;  1F54 A;  1QLS A;  2LE9 B;  2KAX A;  1N0Y A;  5FYX A;  3HX4 A;  3SG6 A;  1JSA A;  4JWQ A;  4IJ7 A;  4M2O A;  1IKU A;  3K1E A;  4ZCU A;  4MVF A;  3BOW B;  2KDH A;  2LAP A;  2KI4 C;  2K61 A;  2MJW B;  4M2Q A;  3AAJ A;  3IF7 A;  3I5G C;  2BE4 A;  3BUN B;  2K7B A;  1B47 A;  2K2F A;  3DVE A;  1SYM A;  1YX8 A;  1TNP A;  3CGA A;  3TUY C;  1TN4 A;  2QEH A;  1CFC A;  3N7H A;  2KAY A;  1S26 D;  4ORB B;  2ZN9 A;  2CBL A;  1DT7 B;  1MWN A;  1VRK A;  4OZD A;  1TIZ A;  3FE6 A;  1BOD A;  1XK4 C;  3FE8 A;  2EC6 C;  1IGV A;  2LNK A;  4C0L A;  3VGO A;  5I8N A;  4UPG A;  1YX7 A;  5HLO A;  2RGI A;  3DVK A;  5G08 A;  4PT1 A;  1DJI A;  1J1D A;  2LP3 A;  5AER A;  2LP2 A;  3BUW B;  3WXA A;  1PSR A;  2NLN A;  2OTG C;  4M2P A;  4DIR A;  4YGB B;  3JTD B;  5ER5 A;  1OQP A;  1SL9 A;  1XVJ A;  3LLE A;  2EHB A;  2M1K B;  2SCP A;  3BFB A;  1H8B A;  4JKT A;  3DVM A;  3SG5 A;  3NXA A;  1KWO B;  2BL0 C;  3O4Y A;  1K96 A;  2DOQ A;  1C7W A;  1YUU A;  1NPQ A;  5KSZ A;  1QLK A;  1JC2 A;  1NP8 A;  1IG5 A;  2Y5I A;  1YRU B;  2H61 A;  4WQ2 A;  1QVI Y;  1UWO A;  1KQV A;  1KSM A;  2BEC A;  2LHL A;  2MA2 A;  2FJU B;  2L2E A;  1A2X A;  1K9P A;  1SCM C;  3TDU A;  2M8U A;  1C7V A;  4OVN F;  1NX1 A;  1S3P A;  2KGB C;  4E68 A;  5ER4 X;  5B8I B;  3DXL A;  1X02 A;  2K0J A;  2QEO A;  1FI6 A;  1S6J A;  4DRW A;  1MF8 B;  1JF2 A;  2D8N A;  1U5I A;  4KYN A;  2NCP A;  4OV2 A;  3AKB A;  1BF5 A;  1Q80 A;  2ZRS A;  4AOM A;  1BLQ A;  1FI5 A;  1ZMZ A;  4I5J A;  2JC2 A;  3KF9 A;  3NHI A;  2Q4U A;  2OPO A;  2LVV A;  2V53 A;  1CKK A;  1L2O C;  4YGC B;  2LLU A;  2F2P A;  5D7F A;  1B9A A;  1BJF A;  1FF1 A;  1KK8 B;  3LK1 A;  3CR2 A;  1R2U A;  1CDP A;  4A4B A;  1PK0 D;  2KOT A;  1TRF A;  2WCH A;  3RM1 A;  1JWD A;  1DJZ A;  2JUL A;  3PJI A;  3VRO A;  2WCF A;  2JNX A;  3NSO A;  1EG3 A;  2LAN A;  1G4Y R;  4INW A;  3O78 A;  3D73 A;  2KYF A;  2A4J A;  3O4X A;  1A4P A;  2E30 A;  2JWW A;  1TNQ A;  1S6I A;  4GGF A;  5CPV A;  2BCX A;  3EG5 B;  3IQQ A;  4PE4 A;  1XFX O;  1QAS A;  3B88 A;  1KFX S;  1NIW A;  1K90 D;  4GUK A;  5I2O A;  1R6P A;  2HPS A;  1MXE A;  2O60 A;  2BKH B;  4GPL B;  1BU3 A;  2L5Y A;  3DF0 A;  1K9U A;  1KQM C;  1QX7 A;  3D75 A;  3QRX A;  5HKZ A;  1OMV A;  4ICB A;  4PCW A;  2VRG A;  1YRT B;  1CFD A;  1GJY A;  3F45 A;  1DGV A;  2AAO A;  1QVI Z;  2F3Y A;  3CDN A;  1ALW A;  4GFT A;  1K95 A;  2L0P A;  3B87 A;  1DJX A;  3B6X A;  2JTT A;  2AUC A;  3DYE A;  4N5X A;  1SW8 A;  1KK7 Y;  1XA5 A;  1SNL A;  2PQL A;  2AMI A;  5D3O A;  3LCP C;  1WLZ A;  1N65 A;  1CDN A;  2M3W A;  5AFP A;  1RFJ A;  4FTG A;  3JVT C;  4HRG A;  4NDD A;  1TUZ A;  1QAT A;  3R1O A;  4USL A;  4YGA A;  1JFJ A;  5PAL A;  3BUO B;  3RLZ A;  2NCO A;  1DTL A;  1FPW A;  2KBI A;  4N1F A;  5I94 A;  3WHU B;  4P2Y B;  4F7F A;  3EK7 A;  1XFU O;  1EL4 A;  4PE0 A;  3GOF A;  3V2L A;  1NX2 A;  1Z2C B;  2ZND A;  1DF0 B;  1PVB A;  1TTX A;  1W9Z A;  3DF0 B;  4CPV A;  1XFR A;  3IVT A;  1BMO A;  2BKI B;  3CZ0 A;  3EK4 A;  4QJ4 B;  2LVJ A;  2LCP A;  3IQO A;  1XFW O;  2JXL A;  1PRW A;  2LV7 A;  3VRP A;  1RRO A;  4CFR A;  2MLE C;  2O5G A;  3CZ1 A;  1F55 A;  1WRK A;  2M29 A;  2ZFD A;  1CB1 A;  1JF0 A;  1CMG A;  1AP4 A;  1F8H A;  1J7R A;  1S6C A;  2JOJ A;  2CT9 A;  2K7C A;  3L4A A;  3TS5 C;  1B8R A;  3D74 A;  4FQT A;  4C0K A;  4PE1 A;  3CWG A;  1QV0 A;  2I7A A;  2KFH A;  2H2K A;  1NYA A;  1DJH A;  1NUB A;  2K7D A;  1TNX A;  2SAS A;  2KSP A;  1AJ5 A;  1HQV A;  3LK0 A;  1QX2 A;  2L2C A;  4XJK A;  3S0E A;  4HSZ A;  2PAL A;  1GGZ A;  2F3Z A;  2FJY A;  2L98 A;  3NSI A;  3OBV A;  3BQ3 A;  3OGN A;  4AQI A;  1A03 A;  3GK2 A;  2CCM A;  3JTD C;  1LKJ A;  1E8A A;  3FIA A;  1KK7 Z;  4PHN A;  3CLN A;  3AKA A;  4I5N B;  1QTX A;  3EVV A;  1CDM A;  1KWO C;  2LMT A;  4N1G A;  2WOS A;  1OOJ A;  2FCE A;  1K93 D;  4XYN A;  3OX5 A;  1DQE A;  1QS7 A;  1L7Z A;  1S5G Y;  1BG1 A;  3GK1 A;  2KFF A;  4GAO A;  2JU0 A;  5GQQ C;  2COL B;  2JT8 A;  2WCM A;  3H4S E;  3I5F B;  2H8V A;  3C1V A;  4NDC A;  5KU1 A;  2MHH A;  3A4U B;  3NGV A;  5DKR A;  1CNP A;  2JPT A;  1IIO A;  4ETO A;  2WOR A;  4C0J A; 
#chains in the Genus database with same CATH homology
 4A4C A;  2MAZ A;  1NX0 A;  1QJT A;  2PMY A;  2BBM A;  2I18 A;  2LUC A;  1DMO A;  4NDB A;  4ZCV A;  1W7J B;  2LLT A;  2NZ0 A;  1OZO A;  1JFK A;  1ODB A;  4Q04 A;  3D0Y A;  2WND A;  1AK8 A;  1FBV A;  1J7Q A;  5IBW A;  1GGW A;  4MZJ A;  1CDL A;  3BUM B;  3D10 A;  3EK8 A;  4BY4 A;  3E3R A;  3MSE B;  2K2A A;  1FW4 A;  3TDZ A;  3EKH A;  1NCX A;  3AAK A;  2E6W A;  5AEQ A;  3PN7 B;  3VRN A;  1QIW A;  2JZI A;  1Y6W A;  3NSL A;  1SL7 A;  3PLF B;  1UHN A;  1AUI B;  4CFQ A;  1K8U A;  3SIA A;  2L51 A;  2CTN A;  2PAS A;  2KI6 D;  1M46 A;  3BXK A;  3I5H B;  1V1F A;  4I5K A;  2JRF A;  2PSR A;  1A75 A;  1SRA A;  1K9K A;  4MBE A;  1TOP A;  1BR4 B;  1U5I B;  3SIB A;  3ZNI A;  3BUX B;  1Y1U A;  1BT6 A;  1SMG A;  2Y1N A;  1CM1 A;  1QIV A;  3NSK A;  4JPZ B;  3CS1 A;  4YRU A;  3TDI A;  2BCA A;  2ZKM X;  3KEV A;  5HKW A;  5J3X A;  1YR5 A;  1F4Q A;  4YI9 A;  1UUS A;  1NX3 A;  1KFU S;  1KFX L;  1S5G Z;  1WRL A;  1XFV O;  4D1E A;  4QJ5 B;  1OSA A;  2I94 A;  1YVH A;  2I2R E;  5CSN A;  1RJV A;  5CSI A;  1IJ5 A;  1CM4 A;  3WNX B;  5HLV A;  1DVI A;  1EG4 A;  3K21 A;  2MRD A;  2KQY A;  3PFV A;  4HRE E;  4DUQ A;  2ZN8 A;  1KFU L;  1JUO A;  1ALV A;  2KGR A;  1LA3 A;  4PDZ A;  1GQM A;  2OS8 B;  4GGF C;  1SR6 B;  2IS9 A;  1REC A;  2Y4Q A;  2L4I A;  1YTZ C;  4PHM A;  3OP0 A;  1WDC B;  1N2D A;  1A75 B;  2LC5 A;  1CLB A;  1CFF A;  3O2P A;  4I5L B;  4F0Z B;  1F71 A;  2JXC A;  3OB2 B;  3TZ1 A;  1NCZ A;  1B8C A;  1MHO A;  2HQ8 A;  2M7L A;  3CR5 X;  1DGU A;  1G8I A;  1J7P A;  1G33 A;  3PAT A;  2F8P A;  1TCF A;  4L9M A;  1D1O A;  2BE6 A;  1WLM A;  4MRX A;  1Y0V H;  1H4B A;  2Q91 A;  4OR9 B;  1EH2 A;  3CR4 X;  1B4C A;  3I5I B;  3KPX A;  2LMU A;  2B1U A;  4PE7 A;  4YBH B;  1ZUZ A;  2LUX A;  3M0W A;  1LIN A;  2L50 A;  3PSR A;  1XK4 A;  3HCM A;  2QPT A;  4MZL A;  2KFG A;  2PVB A;  1S1E A;  4MLW A;  5CSF A;  4AQJ A;  2M7N A;  1A29 A;  5BPJ A;  4GBA A;  1HT9 A;  2GGM A;  5F6T A;  1M45 A;  5HKY A;  1LVC D;  4BY5 A;  2LVI A;  5K89 A;  1KSO A;  2KI4 B;  1QX5 B;  2JT3 A;  3PM8 A;  2QAC A;  1CLM A;  2FCD A;  1XO5 A;  3I5G B;  5CSJ A;  1IQ3 A;  3KHE A;  2EGD A;  3WHT B;  2LMV A;  4CLN A;  1V1G A;  3VRQ A;  3OHM B;  4JQ0 D;  4OKH A;  2G9B A;  1XYD A;  1OZS A;  3CZT X;  1YUT A;  1TNW A;  2PRU A;  5DKN A;  3TS5 B;  5TNC A;  2CXJ A;  2R2I A;  2LHI A;  1IQ5 A;  4YGD B;  3ICB A;  1UP5 A;  1UUR A;  5JJG A;  2HET A;  2M0R A;  3OX6 A;  1TCO B;  2BCB A;  2EC6 B;  1YVL A;  3SG2 A;  3I5F C;  1KCY A;  1AVS A;  1CMF A;  2GV5 A;  4GGN A;  1Y1A A;  4YI8 A;  2MBX A;  1B7T Y;  2K7O A;  2OTG B;  4XJK B;  1C07 A;  3OB1 B;  1B1G A;  5DKQ A;  4HRH A;  4DCK A;  2MLF C;  1UHJ A;  2BL0 B;  1OMR A;  2KHN A;  2JTZ A;  2LVK A;  2M9G A;  2WCE A;  1RK9 A;  1PVA A;  3DVJ A;  1JBA A;  1M31 A;  2KNE A;  4MN0 A;  3SG3 A;  1KK8 C;  4YGE B;  1SCM B;  4WRI A;  3VRR A;  4FQO A;  1DJY A;  4WQ3 A;  1M39 A;  2H61 C;  3PN7 C;  5AAN A;  1EJ3 A;  4P5O E;  3EKJ A;  1J7O A;  1K2H A;  2L5X B;  3SJS A;  1J1E A;  1SBJ A;  2M1U A;  1IH0 A;  2L4H A;  5HYD A;  3I5H C;  1CFP A;  3DD4 A;  4ORA B;  3TUY B;  1IJ6 A;  4U8D A;  1MR8 A;  1DJW A;  2G2B A;  1WRZ A;  2FOT A;  2BBN A;  2HF5 A;  3FS7 A;  2KAV A;  1L2O B;  2GGZ A;  4PHJ A;  1WY9 A;  4ORC B;  1PSB A;  2F33 A;  1UHK A;  3LL8 B;  3D0Y B;  3O6B A;  1AHR A;  3GK4 X;  1F70 A;  1J55 A;  1MUX A;  4MEW A;  5AXI A;  4MSP A;  1QXP A;  1W7I B;  3SG4 A;  2KYC A;  3BYA A;  1F4O A;  1XFY O;  3FWC A;  1LXF C;  4OCI A;  1S36 A;  2HQW A;  5JOL A;  1QV1 A;  4DS7 A;  1RWY A;  1OMD A;  4CID A;  1M63 B;  2JQ6 A;  5KTY A;  1NCY A;  1B7T Z;  1SK6 D;  1RTP 1;  5I2L A;  4PAL A;  2OS8 C;  1SR6 C;  1MXL C;  1DF0 A;  3EVR A;  3KO0 A;  1WDC C;  2KI6 C;  3CTN A;  2NXQ A;  2CNP A;  1AJ4 A;  4MRY A;  1KQM B;  2LM5 A;  1MQ1 A;  2M97 A;  1NWD A;  4MZK A;  1ZFS A;  2F2O A;  1YUR A;  3SG7 A;  1IWQ A;  1PAL A;  3BOW A;  1OE9 B;  4NQG A;  1BR1 B;  1B8L A;  1PUL A;  1UHH A;  4PHK A;  1UHI A;  1CLL A;  1SKT A;  2WC8 A;  1IRJ A;  1ZAC A;  1CTR A;  1XFZ O;  3EVU A;  2JT0 A;  2ISD A;  1YUS A;  3JVT B;  2KBM A;  3I5I C;  1DJG A;  1K94 A;  2ZNE A;  3ZWH A;  3FWB A;  5I2Q A;  4R1E A;  1BOC A;  1SPY A;  2M49 B;  2Y1M A;  4GNK B;  2K8M B;  2JNF A;  4QJ3 B;  4TNC A;  3PAL A;  1SCV A;  1Y1X A;  1LA0 A;  1EXR A;  2TN4 A;  2LLS A;  1SY9 A;  2P6B B;  5D69 A;  2WCB A;  4IL1 A;  1SL8 A;  1ZOT B;  2ZRT A;  3A8R A;  1NSH A;  2KQ6 A;  1F54 A;  1QLS A;  2LE9 B;  2KAX A;  1N0Y A;  5FYX A;  3HX4 A;  3SG6 A;  1JSA A;  4JWQ A;  4M2O A;  1IKU A;  4ZCU A;  4MVF A;  3BOW B;  2KDH A;  2LAP A;  2KI4 C;  2K61 A;  2MJW B;  4M2Q A;  3AAJ A;  3IF7 A;  3I5G C;  2BE4 A;  3BUN B;  2K7B A;  1B47 A;  2K2F A;  3DVE A;  1SYM A;  1YX8 A;  1TNP A;  3CGA A;  3TUY C;  1TN4 A;  1CFC A;  2KAY A;  1S26 D;  4ORB B;  2ZN9 A;  2CBL A;  1DT7 B;  1MWN A;  1VRK A;  1TIZ A;  1BOD A;  1XK4 C;  2EC6 C;  1IGV A;  2LNK A;  4C0L A;  3VGO A;  5I8N A;  4UPG A;  1YX7 A;  5HLO A;  2RGI A;  3DVK A;  5G08 A;  1DJI A;  1J1D A;  2LP3 A;  5AER A;  2LP2 A;  3BUW B;  3WXA A;  1PSR A;  2NLN A;  2OTG C;  4M2P A;  4DIR A;  4YGB B;  3JTD B;  5ER5 A;  1OQP A;  1SL9 A;  1XVJ A;  3LLE A;  2EHB A;  2M1K B;  2SCP A;  1H8B A;  3DVM A;  3SG5 A;  3NXA A;  1KWO B;  2BL0 C;  3O4Y A;  1K96 A;  2DOQ A;  1C7W A;  1YUU A;  1NPQ A;  5KSZ A;  1QLK A;  1JC2 A;  1NP8 A;  1IG5 A;  2Y5I A;  1YRU B;  2H61 A;  4WQ2 A;  1QVI Y;  1UWO A;  1KQV A;  1KSM A;  2BEC A;  2LHL A;  2MA2 A;  2FJU B;  2L2E A;  1A2X A;  1K9P A;  1SCM C;  3TDU A;  2M8U A;  1C7V A;  4OVN F;  1NX1 A;  1S3P A;  2KGB C;  4E68 A;  5ER4 X;  5B8I B;  1X02 A;  2K0J A;  1FI6 A;  1S6J A;  4DRW A;  1MF8 B;  1JF2 A;  2D8N A;  1U5I A;  4OV2 A;  2NCP A;  1BF5 A;  3AKB A;  1Q80 A;  2ZRS A;  4AOM A;  1BLQ A;  1FI5 A;  1ZMZ A;  4I5J A;  2JC2 A;  3KF9 A;  2Q4U A;  2OPO A;  2LVV A;  2V53 A;  1CKK A;  1L2O C;  4YGC B;  2LLU A;  2F2P A;  5D7F A;  1B9A A;  1BJF A;  1FF1 A;  1KK8 B;  3LK1 A;  3CR2 A;  1R2U A;  1CDP A;  4A4B A;  1PK0 D;  2KOT A;  1TRF A;  3RM1 A;  1JWD A;  1DJZ A;  2JUL A;  3VRO A;  2WCF A;  2JNX A;  3NSO A;  1EG3 A;  2LAN A;  1G4Y R;  3O78 A;  2KYF A;  2A4J A;  1A4P A;  2E30 A;  2JWW A;  1TNQ A;  1S6I A;  4GGF A;  5CPV A;  2BCX A;  3IQQ A;  4PE4 A;  1XFX O;  1QAS A;  1KFX S;  1NIW A;  1K90 D;  4GUK A;  5I2O A;  1R6P A;  2HPS A;  1MXE A;  2O60 A;  2BKH B;  4GPL B;  1BU3 A;  3DF0 A;  1K9U A;  1KQM C;  1QX7 A;  3QRX A;  5HKZ A;  1OMV A;  4ICB A;  4PCW A;  2VRG A;  1YRT B;  1CFD A;  1GJY A;  3F45 A;  1DGV A;  2AAO A;  1QVI Z;  2F3Y A;  4GFT A;  1ALW A;  1K95 A;  2L0P A;  1DJX A;  2JTT A;  2AUC A;  4N5X A;  1SW8 A;  1KK7 Y;  1XA5 A;  1SNL A;  2AMI A;  3LCP C;  1WLZ A;  1N65 A;  1CDN A;  2M3W A;  5AFP A;  1RFJ A;  4FTG A;  3JVT C;  4HRG A;  4NDD A;  4USL A;  1QAT A;  4YGA A;  1JFJ A;  5PAL A;  3BUO B;  3RLZ A;  2NCO A;  1DTL A;  1FPW A;  2KBI A;  4N1F A;  3WHU B;  4P2Y B;  3EK7 A;  1XFU O;  1EL4 A;  4PE0 A;  3GOF A;  1NX2 A;  2ZND A;  1DF0 B;  1PVB A;  1TTX A;  3DF0 B;  4CPV A;  1BMO A;  2BKI B;  3EK4 A;  4QJ4 B;  2LVJ A;  2LCP A;  3IQO A;  1XFW O;  2JXL A;  1PRW A;  2LV7 A;  3VRP A;  1RRO A;  4CFR A;  2MLE C;  2O5G A;  1F55 A;  1WRK A;  2M29 A;  2ZFD A;  1CB1 A;  1JF0 A;  1CMG A;  1AP4 A;  1F8H A;  1J7R A;  1S6C A;  2JOJ A;  2CT9 A;  2K7C A;  3TS5 C;  1B8R A;  4C0K A;  4PE1 A;  3CWG A;  1QV0 A;  2I7A A;  2KFH A;  2H2K A;  1NYA A;  1DJH A;  1NUB A;  2K7D A;  1TNX A;  2SAS A;  2KSP A;  1AJ5 A;  1HQV A;  3LK0 A;  1QX2 A;  4XJK A;  4HSZ A;  2PAL A;  1GGZ A;  2F3Z A;  2L98 A;  3NSI A;  4AQI A;  3BQ3 A;  1A03 A;  3GK2 A;  2CCM A;  3JTD C;  1LKJ A;  1E8A A;  3FIA A;  1KK7 Z;  4PHN A;  3CLN A;  3AKA A;  4I5N B;  1QTX A;  3EVV A;  1CDM A;  1KWO C;  2LMT A;  4N1G A;  2WOS A;  1OOJ A;  2FCE A;  1K93 D;  4XYN A;  3OX5 A;  1QS7 A;  1L7Z A;  1S5G Y;  1BG1 A;  3GK1 A;  2KFF A;  4GAO A;  2JU0 A;  5GQQ C;  2COL B;  2JT8 A;  3H4S E;  3I5F B;  3C1V A;  4NDC A;  5KU1 A;  2MHH A;  3A4U B;  5DKR A;  1CNP A;  2JPT A;  4ETO A;  2WOR A;  4C0J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...