2LMVA

Androcam at high calcium with three explicit ca2+
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
147
structure length
147
Chain Sequence
SELTEEQIAEFKDAFVQFDKEGTGKIATRELGTLMRTLGQNPTEAELQDLIAEAENNNNGQLNFTEFCGIMAKQMRETDTEEEMREAFKIFDRDGDGFISPAELRFVMINLGEKVTDEEIDEMIREADFDGDGMINYEEFVWMISQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Calmodulin-related protein 97A
publication title Structure of androcam supports specialized interactions with myosin VI.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Metal binding protein
total genus 44
structure length 147
sequence length 147
ec nomenclature
pdb deposition date 2011-12-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2lmvA01
1S6JA 4DCKA 1BR4B 1NIWA 2B1UA 1NX1A 1B8RA 2M7NA 1A29A 1TOPA 1UHHA 1DGUA 1NCYA 3IQQA 1IG5A 3NSOA 2LC5A 2JT8A 2LLUA 1PRWA 4HREE 1K96A 1WRKA 2PMYA 3KF9A 1IH0A 1L7ZA 1BLQA 1BJFA 2MHHA 2NZ0A 5B8IB 3SG4A 5D69A 3PFVA 1UP5A 1EL4A 5HLOA 4YGCB 1K9KA 2KI4B 4ICBA 2BCBA 4HRGA 4WQ3A 1OMRA 2JT3A 1CMFA 1MHOA 2LNKA 3BYAA 2OS8C 3WNXB 1E8AA 2DOQA 3HX4A 2KQ6A 1D1OA 1J7QA 4XYNA 2D8NA 3FIAA 3CWGA 2K7DA 2L4IA 2LUCA 4USLA 4NQGA 2O60A 2BKHB 2CTNA 2LHLA 2JULA 1PK0D 1Y1AA 1XK4A 2WCFA 4GFTA 5JJGA 5KSZA 1MXLC 1YUSA 5AEQA 2M9GA 1KSMA 1LVCD 1S5GY 3KHEA 1CDMA 1N0YA 3FWBA 2M1UA 1OOJA 2CCMA 2JOJA 1LXFC 1K9UA 3FS7A 3OHMB 2Y5IA 2AAOA 4BY4A 3I5GC 1KFUL 2ISDA 4OV2A 4XJKA 1XYDA 4C0LA 1G33A 2JXLA 1KK8C 2KNEA 4I5JA 3KO0A 4M2QA 4N1GA 4ZCUA 2LCPA 2LUXA 3A8RA 1QVIZ 2G2BA 2H61C 3D0YA 3AKAA 3BUNB 1BODA 4CFRA 1YVHA 1DJGA 1CM4A 2K0JA 4JWQA 2PASA 1B8LA 4QJ3B 3DVMA 2WOSA 3SG3A 3JVTC 3EKHA 1A75A 1G4YR 1YR5A 3I5GB 4GBAA 4GGNA 3TDUA 4E68A 2LVVA 1QIWA 4CLNA 1UHIA 2JRFA 2PVBA 4BY5A 4N1FA 3BUMB 1MR8A 1SCMB 1MQ1A 4MBEA 1UUSA 2K7OA 1B7TY 1A2XA 1S3PA 5CPVA 4YGAA 3CZTX 2AMIA 2KBMA 4GUKA 1SL7A 1JSAA 2ZNEA 1KSOA 1CLMA 1V1GA 1XFVO 2F3ZA 2MA2A 1YRUB 2L4HA 2JXCA 4MRXA 3TZ1A 1J7OA 1YUUA 3M0WA 1IJ6A 1KWOB 2JPTA 1KFXL 4MN0A 2CT9A 1A4PA 1EG3A 5HKYA 1AK8A 3JTDC 3CGAA 1ZOTB 4QJ4B 1YTZC 2ZKMX 4MEWA 2WCBA 2MBXA 1R6PA 5CSJA 5FYXA 1K94A 3SG2A 1OMDA 1DF0B 3CR2A 2KFGA 5I2LA 1XO5A 3GOFA 5KTYA 1DJZA 2FJUB 3VGOA 4I5KA 1NP8A 2V53A 2ZNDA 2LE9B 1QX5B 1KQMC 1PULA 2KHNA 1SYMA 4OCIA 1JF2A 4ETOA 2LP2A 3EKJA 1PVBA 4UPGA 2OTGC 1SY9A 3OX5A 2KGBC 2E30A 3GK2A 1ODBA 5CSFA 3EK8A 1MF8B 1YURA 1TCFA 1OE9B 1SW8A 2F2PA 2L2EA 1QJTA 1L2OB 1SKTA 1NPQA 3JTDB 2BBNA 3I5FB 1KCYA 1WLZA 3TDIA 2M7LA 1RECA 4GGFC 1LA0A 3EK7A 2R2IA 1CFCA 2FCDA 2KYCA 1WY9A 1OQPA 2GGMA 3F45A 4YBHB 1CKKA 3H4SE 3OB1B 1M39A 2LVJA 3EVVA 3NSLA 5DKQA 5PALA 2L98A 2I18A 1NCXA 2JTTA 3SG5A 4YGEB 3HCMA 2GV5A 3LK0A 3TS5C 3ZWHA 4A4CA 2BKIB 2FCEA 4YGBB 1DGVA 2WNDA 1BR1B 2NCOA 1LKJA 1G8IA 1SMGA 1JC2A 2M8UA 1QV0A 1TIZA 4MZLA 1TN4A 4P2YB 1YRTB 1KK7Z 1AJ4A 1N2DA 2M0RA 2NLNA 1V1FA 1J7RA 3BUOB 3RM1A 1BOCA 1BU3A 2HPSA 2BCXA 4D1EA 4YGDB 1QASA 1R2UA 2KGRA 5ER5A 2KDHA 3TUYC 1QX2A 2H2KA 2OS8B 2KBIA 3O6BA 4I5LB 1XFYO 1AVSA 4OVNF 1K90D 4Q04A 4PE7A 1N65A 3IQOA 1AP4A 2KOTA 4DS7A 5DKNA 3OX6A 1CNPA 1J55A 3BXKA 1SR6C 3SG7A 1JWDA 1YUTA 5AERA 1CTRA 2JC2A 1FI6A 4MSPA 2O5GA 1F55A 1A03A 1QIVA 3ZNIA 3DF0B 2WC8A 4PE0A 4PDZA 1S6IA 1NWDA 1RTP1 1XVJA 4GAOA 4PHMA 1WRZA 2JNFA 3TUYB 2JNXA 2LP3A 4CPVA 1ALWA 1OMVA 1GGWA 1Y1XA 1JFKA 1IJ5A 2F3YA 1RROA 1WLMA 2E6WA 3BUWB 2A4JA 1F8HA 3WHUB 1UHNA 3VRNA 5AFPA 1XK4C 2LAPA 4DIRA 2SCPA 1FF1A 4F0ZB 2Q91A 2BE6A 2L51A 5F6TA 1WDCC 2F8PA 4DUQA 1J1DA 1TNWA 4AQIA 3VRRA 2BL0C 2JTZA 2MLFC 3VRQA 4DRWA 1KK8B 1BT6A 2F33A 2HF5A 2LHIA 2QPTA 4I5NB 2K7BA 1ZUZA 1J1EA 3KPXA 2LMVA 4CIDA 1CMGA 2BECA 3I5IC 1CFFA 1IGVA 2K8MB 3WHTB 1QATA 3BOWB 1YVLA 2K61A 1C7VA 1RFJA 3JVTB 1WDCB 2JQ6A 1Y6WA 2KAXA 2BBMA 5D7FA 1H8BA 2BL0B 1QVIY 1K8UA 2AUCA 2SASA 1UHJA 1BMOA 4MZKA 1SL9A 3EVUA 3TDZA 1GGZA 1BG1A 4M2PA 2LM5A 1CLLA 1DJHA 1HQVA 1SBJA 1PSRA 4NDDA 2COLB 3I5HC 1EJ3A 4TNCA 4GGFA 1M31A 1DT7B 2LLSA 1F4QA 3DD4A 3AAJA 1UHKA 4CFQA 1YX7A 1CM1A 1SL8A 4YI8A 4N5XA 3SIBA 4PHKA 1S26D 1Y1UA 5DKRA 1QXPA 1U5IB 1ZFSA 2CNPA 3OP0A 2KAVA 5CSNA 3NSKA 2JT0A 5IBWA 1SPYA 1ZMZA 3D0YB 3QRXA 2PSRA 4ORCB 1B8CA 2VRGA 4PHNA 5I2QA 1EXRA 1X02A 1VRKA 1CB1A 1A75B 1GQMA 2M29A 1ALVA 1UURA 3O4YA 1KQMB 1MUXA 1W7JB 2IS9A 3BUXB 1QX7A 3SG6A 4PALA 1PVAA 5JOLA 2OTGB 4GNKB 1B47A 2JU0A 5KU1A 2L0PA 1QLSA 1MWNA 3DVJA 2PALA 3K21A 3KEVA 1Y0VH 1TRFA 1TNPA 2LMTA 1BF5A 2EHBA 1NX0A 4FTGA 4HRHA 1IQ3A 1CDPA 1XFWO 4PHJA 4AOMA 3DF0A 1QLKA 1IQ5A 1S6CA 3GK1A 4NDBA 2M97A 4OR9B 3RLZA 4WRIA 1S36A 4JPZB 2FOTA 3SJSA 2CXJA 1S5GZ 1OZSA 3D10A 3PATA 4ZCVA 1AUIB 2Y1MA 1PALA 3PM8A 4MLWA 2MAZA 3EVRA 3PSRA 2ZRTA 4MRYA 1OSAA 1HT9A 1DJXA 4R1EA 1GJYA 1S1EA 2Y4QA 4HSZA 3PLFB 3LCPC 3TS5B 2OPOA 2ZN9A 5ER4X 1ZACA 2LMUA 3CR4X 3CTNA 1JF0A 1J7PA 2HETA 2KI6C 2TN4A 2H61A 1DVIA 3E3RA 4P5OE 1NYAA 1TNQA 1JFJA 4C0JA 1AHRA 1RWYA 2K7CA 2RGIA 1FPWA 2KI6D 3BOWA 1F71A 4ORAB 3AKBA 1Q80A 3EK4A 3CR5X 2L50A 3PALA 4M2OA 1CDLA 1DMOA 2I2RE 2ZFDA 1FW4A 5BPJA 2Y1NA 1K95A 1OZOA 2I94A 4MZJA 3PN7C 1XFZO 1DTLA 1KK7Y 3DVKA 5G08A 1IWQA 1DF0A 4A4BA 2M3WA 4AQJA 5HKWA 3NXAA 2KAYA 1DJIA 1QV1A 1SR6B 1B7TZ 2ZN8A 5TNCA 2NXQA 3A4UB 1AJ5A 2MJWB 1SCVA 2P6BB 3OB2B 2K2AA 3WXAA 4MVFA 2ZRSA 1CFDA 1IKUA 1U5IA 4FQOA 5CSIA 1NCZA 1SK6D 1K9PA 4L9MA 1SCMC 1CFPA 4IL1A 2F2OA 2M49B 2M1KB 2JWWA 3GK4X 3PN7B 1KFUS 1UWOA 1QTXA 5GQQC 3VROA 5K89A 1F54A 1C07A 1CDNA 4GPLB 1JBAA 3AAKA 1FI5A 2G9BA 2K2FA 1SNLA 2KFHA 1EH2A 2EC6C 4JQ0D 1KWOC 5HKZA 4PE1A 2LVKA 1FBVA 4OKHA 1B4CA 3NSIA 5I8NA 2L5XB 3DVEA 3BQ3A 1XFXO 2BE4A 3ICBA 3C1VA 1RJVA 1DJYA 2LVIA 1M46A 3LK1A 1LA3A 2CBLA 2GGZA 1TNXA 1NX2A 1NUBA 1RK9A 1TTXA 1YX8A 1W7IB 2LV7A 2MRDA 2NCPA 3I5IB 4ORBB 1F4OA 3FWCA 4XJKB 3CLNA 1F70A 1KQVA 2KQYA 1TCOB 4C0KA 3O2PA 4YI9A 2EC6B 2MLEC 4WQ2A 1EG4A 2PRUA 2WCEA 1XA5A 1H4BA 2KYFA 2BCAA 1IRJA 1K93D 1CLBA 1DJWA 4PE4A 2HQ8A 5HYDA 1L2OC 4NDCA 4PCWA 3LL8B 1PSBA 3I5FC 2I7AA 1M63B 1SRAA 1LINA 2QACA 5HLVA 3VRPA 1MXEA 1QS7A 1B1GA 1C7WA 3SIAA 4U8DA 1M45A 1WRLA 1K2HA 3I5HB 2HQWA 3O78A 1JUOA 4QJ5B 1KFXS 2Q4UA 2KSPA 4YRUA 2LLTA 5AXIA 2JZIA 2KFFA 5AANA 5J3XA 5I2OA 3MSEB 1NSHA 2KI4C 3IF7A 1XFUO 2EGDA 2LANA 1B9AA 2WORA 3LLEA 1NX3A 3CS1A
chains in the Genus database with same CATH superfamily
1S6JA 4DCKA 1BR4B 3L47A 1NIWA 2B1UA 1NX1A 1B8RA 2M7NA 1A29A 1TOPA 1UHHA 1DGUA 1NCYA 3IQQA 1IG5A 1TUJA 2LC5A 2JT8A 2LLUA 1LS8A 1PRWA 1K96A 1WRKA 2PMYA 2K60A 3KF9A 1F54A 1IH0A 1L7ZA 1BLQA 1BJFA 2MHHA 2NZ0A 5B8IB 3SG4A 5D69A 2WCHA 3PFVA 1UP5A 1EL4A 5HLOA 4YGCB 1K9KA 3NGVA 2KI4B 4ICBA 2BCBA 4HRGA 4WQ3A 1OMRA 2JT3A 1CMFA 1MHOA 2KLDA 2LNKA 3BYAA 2OS8C 1W9ZA 3WNXB 1E8AA 2DOQA 3HX4A 2KQ6A 1D1OA 1J7QA 4XYNA 2D8NA 3FIAA 4JD9A 3CWGA 2K7DA 2L4IA 2LUCA 4USLA 4NQGA 2O60A 1DC1A 1OOHA 2BKHB 2CTNA 2LHLA 3B87A 2JULA 1PK0D 1Y1AA 1XK4A 2WCFA 4GFTA 5JJGA 5KSZA 1MXLC 1YUSA 5AEQA 2M9GA 3RZSA 1KSMA 1LVCD 1S5GY 3KHEA 1CDMA 1N0YA 3S0FA 3FWBA 2M1UA 3FE6A 1OOJA 1IIOA 2CCMA 2JOJA 2QEHA 1LXFC 1K9UA 3FS7A 3OHMB 2Y5IA 2AAOA 1OOIX 4BY4A 3I5GC 1KFUL 2ISDA 4OV2A 4XJKA 1XYDA 4C0LA 1G33A 2JXLA 1KK8C 2KNEA 4I5JA 3KO0A 4M2QA 2KPHA 4N1GA 4ZCUA 5FI7A 2LCPA 2LUXA 1Z4HA 3A8RA 1QVIZ 2G2BA 2H61C 3D0YA 3AKAA 3BUNB 3D76A 3OGNA 3DYEA 4CFRA 1BODA 1YVHA 1DJGA 1CM4A 1T14A 2K0JA 2GTEA 4JWQA 2PASA 1B8LA 4QJ3B 3DVMA 2WOSA 3SG3A 3JVTC 3EKHA 1A75A 1G4YR 1YR5A 3I5GB 4GBAA 3R1PA 3QMEA 4GGNA 3TDUA 4E68A 2LVVA 1QIWA 4CLNA 1UHIA 3B86A 2JRFA 2PVBA 4BY5A 4N1FA 3BUMB 2QEOA 1MR8A 3EG5B 1SCMB 2QEBA 1MQ1A 4MBEA 1UUSA 2K7OA 1B7TY 3R1OA 1A2XA 1S3PA 3CYZA 5CPVA 4YGAA 3CZTX 2AMIA 2KBMA 4GUKA 1SL7A 1JSAA 2ZNEA 1KSOA 1CLMA 1V1GA 1XFVO 2F3ZA 1OOFA 1YRUB 2L4HA 2JXCA 2MA2A 4MRXA 3TZ1A 1J7OA 1YUUA 3M0WA 1IJ6A 1KWOB 2JPTA 1KFXL 4MN0A 2CT9A 1A4PA 1EG3A 4F7FA 5HKYA 1AK8A 3S0AA 1DEKA 3JTDC 3CGAA 1ZOTB 4QJ4B 1YTZC 2ZKMX 4MEWA 2WCBA 2QEVA 1R6PA 2MBXA 5CSJA 3S0BA 5FYXA 1K94A 3SG2A 1OMDA 1DF0B 3CR2A 2KFGA 5I2LA 1XO5A 3GOFA 5KTYA 1DJZA 2FJUB 3VGOA 4I5KA 1NP8A 2V53A 2ZNDA 2LE9B 1QX5B 1KQMC 1PULA 2KHNA 1SYMA 4OCIA 1JF2A 1TUZA 4ETOA 2LP2A 3EKJA 1PVBA 4UPGA 2OTGC 3L4LA 1SY9A 3OX5A 2KGBC 2E30A 3GK2A 1ODBA 5CSFA 3EK8A 2QDIA 1MF8B 1YURA 1TCFA 1OE9B 1OOGA 1SW8A 2F2PA 1TWOA 1DELA 2L2EA 1QJTA 1L2OB 1SKTA 1NPQA 3JTDB 2BBNA 3CZ0A 3I5FB 1KCYA 1WLZA 3TDIA 2M7LA 1RECA 4GGFC 1LA0A 3EK7A 2R2IA 1CFCA 3IVTA 2FCDA 2KYCA 1WY9A 1OQPA 2GGMA 3F45A 4YBHB 1CKKA 3H4SE 3OB1B 3D74A 1M39A 2LVJA 3EVVA 3NSLA 5DKQA 5FI6A 5PALA 2L98A 2I18A 1NCXA 2JTTA 3SG5A 4YGEB 3UNWA 3HCMA 2GV5A 3LK0A 4JKTA 3TS5C 3UO9A 2BKIB 2FCEA 4YGBB 1DGVA 3NSOA 3ZWHA 4A4CA 2WNDA 1BR1B 2NCOA 1LKJA 1G8IA 1SMGA 1JC2A 2M8UA 2WCJA 1QV0A 3K1EA 1TIZA 4MZLA 1TN4A 4P2YB 1YRTB 3N7HA 1KK7Z 1AJ4A 1N2DA 2M0RA 1P28A 2NLNA 1V1FA 1J7RA 1Z2CB 3BUOB 3RM1A 1BOCA 1BU3A 1XFRA 2HPSA 2BCXA 4D1EA 4YGDB 1QASA 1R2UA 5I94A 2KGRA 4HREE 5ER5A 2KDHA 4PT1A 2JPOA 3TUYC 1QX2A 2H2KA 2OS8B 2KBIA 3O6BA 4I5LB 1XFYO 1AVSA 4OVNF 1K90D 3BFAA 4Q04A 4PE7A 1N65A 5D3OA 3IQOA 3B88A 1AP4A 2KOTA 5FI2A 4DS7A 5DKNA 3OX6A 1CNPA 1J55A 3B7AA 3CZ1A 3SS4A 3BXKA 1SR6C 2BNXA 3SG7A 1JWDA 1YUTA 5AERA 1CTRA 2JC2A 1FI6A 4MSPA 2O5GA 1F55A 1A03A 1QIVA 3ZNIA 3DF0B 2WC8A 4PE0A 4PDZA 1S6IA 1NWDA 1RTP1 1XVJA 4GAOA 4PHMA 4OZDA 1WRZA 2JNFA 3TUYB 2JNXA 2LP3A 3VB1A 1ALWA 1OMVA 4IJ7A 1Y1XA 4CPVA 1GGWA 1JFKA 1IJ5A 2F3YA 1RROA 1WLMA 2E6WA 3BUWB 3PJIA 2A4JA 1F8HA 3WHUB 1UHNA 3VRNA 5AFPA 1XK4C 2LAPA 4DIRA 2SCPA 1FF1A 4F0ZB 1OW4A 2BE6A 2Q91A 2L51A 5F6TA 1WDCC 2F8PA 4DUQA 1J1DA 1TNWA 4AQIA 3VRRA 3D78A 2BL0C 2JTZA 2MLFC 3VRQA 4DRWA 1KK8B 3NHIA 1BT6A 2F33A 2HF5A 2L5YA 2LHIA 2PQLA 2QPTA 4I5NB 2K7BA 2FJYA 2YGUA 1ZUZA 1J1EA 3KPXA 2WC6A 2LMVA 3S0EA 4CIDA 1CMGA 2BECA 3I5IC 1CFFA 1IGVA 2K8MB 3WHTB 1QATA 3BOWB 1YVLA 2K61A 1C7VA 1RFJA 3JVTB 3D75A 1WDCB 2JQ6A 1Y6WA 2KAXA 2BBMA 5D7FA 1H8BA 2BL0B 1QVIY 1K8UA 2AUCA 2SASA 1UHJA 1BMOA 4MZKA 1SL9A 3EVUA 3TDZA 1GGZA 1BG1A 1QWVA 3S0DA 4M2PA 1SSEB 2LM5A 1CLLA 1DJHA 1HQVA 1SBJA 1PSRA 4NDDA 2COLB 3I5HC 1EJ3A 4TNCA 4GGFA 1M31A 1DT7B 1C3YA 2LLSA 1F4QA 3DD4A 3AAJA 1UHKA 4CFQA 1YX7A 4INXA 1CM1A 1SL8A 3B6XA 4YI8A 4N5XA 3SIBA 4PHKA 1S26D 1Y1UA 5DKRA 1QXPA 1U5IB 1ZFSA 2CNPA 3OP0A 2KAVA 5CSNA 3NSKA 2JT0A 5IBWA 1SPYA 1ZMZA 2PYQA 3D0YB 3BJHA 2PSRA 3CDNA 3QRXA 4ORCB 1B8CA 2VRGA 4PHNA 5I2QA 1EXRA 1X02A 1VRKA 1CB1A 1A75B 1GQMA 2M29A 1ALVA 1UURA 3O4YA 1KQMB 1MUXA 1W7JB 2IS9A 3BUXB 1QX7A 3SG6A 4PALA 1PVAA 5JOLA 2OTGB 4GNKB 1B47A 2JU0A 5KU1A 2L0PA 1QLSA 3D77A 3Q8IA 1MWNA 3DVJA 2PALA 3K21A 3KEVA 1Y0VH 1TRFA 1TNPA 2LMTA 1BF5A 3CABA 2EHBA 1NX0A 4FTGA 4HRHA 1IQ3A 1CDPA 1XFWO 4KYNA 4PHJA 4AOMA 1ORGA 3DF0A 1QLKA 1IQ5A 1S6CA 2L2CA 3GK1A 2M97A 4NDBA 4OR9B 3RLZA 4WRIA 1DQEA 1S36A 4JPZB 3L4AA 2FOTA 3SJSA 2CXJA 1S5GZ 3D73A 1OZSA 3D10A 3PATA 4ZCVA 1AUIB 2Y1MA 1PALA 3PM8A 4MLWA 2MAZA 3EVRA 3PSRA 2ZRTA 4MRYA 1OSAA 1HT9A 3SS5A 1DJXA 4R1EA 1GJYA 1S1EA 2ERBA 2Y4QA 4HSZA 3PLFB 3LCPC 3TS5B 2OPOA 2ZN9A 5ER4X 1ZACA 2LMUA 3CR4X 3CTNA 1JF0A 1J7PA 2HETA 2KI6C 2TN4A 5DICA 2H61A 1DVIA 3E3RA 4P5OE 2KLEA 1NYAA 1TNQA 1JFJA 4C0JA 1AHRA 1RWYA 2K7CA 2RGIA 1FPWA 2KI6D 3BOWA 1F71A 4ORAB 3SS3A 3AKBA 5EL2A 1Q80A 3EK4A 3CR5X 2L50A 3PALA 4M2OA 1CDLA 1DMOA 2I2RE 2ZFDA 1FW4A 5BPJA 2Y1NA 1K95A 1OZOA 2BAPA 2WCKA 2I94A 4MZJA 3PN7C 1XFZO 1DTLA 1KK7Y 3DVKA 5G08A 1IWQA 1DF0A 3OBVA 2M3WA 4A4BA 5HKWA 4AQJA 3BFBA 3NXAA 2KAYA 1DJIA 1QV1A 5HL1A 1SR6B 1B7TZ 3V2LA 2ZN8A 5TNCA 2NXQA 3A4UB 1AJ5A 2MJWB 1SCVA 2P6BB 3OB2B 3PM2A 2K2AA 3WXAA 2WC5A 4MVFA 2ZRSA 4INWA 1CFDA 1IKUA 3R1VA 3DY9A 1U5IA 4FQOA 5CSIA 4FQTA 1NCZA 1SK6D 1K9PA 4L9MA 1SCMC 1CFPA 4IL1A 2F2OA 2M49B 2M1KB 2JWWA 3GK4X 3PN7B 1KFUS 1UWOA 1QTXA 3R72A 5GQQC 3VROA 5K89A 1C07A 1CDNA 3FE9A 4GPLB 3AAKA 1JBAA 1FI5A 2G9BA 2K2FA 1SNLA 2KFHA 1EH2A 2EC6C 4JQ0D 1KWOC 3CZ2A 5HKZA 4PE1A 1C3ZA 2H8VA 1FBVA 2LVKA 2WCLA 4OKHA 1B4CA 2P70A 3NSIA 5I8NA 2L5XB 3DVEA 3BQ3A 1XFXO 2BE4A 3ICBA 3C1VA 1RJVA 1DJYA 2LVIA 1M46A 3LK1A 1LA3A 2CBLA 2GGZA 1TNXA 1NX2A 1NUBA 1RK9A 1TTXA 1YX8A 1W7IB 2LV7A 2MRDA 2NCPA 3I5IB 1GM0A 4ORBB 1F4OA 3FWCA 2WCMA 3CLNA 4XJKB 1F70A 1KQVA 2KQYA 1TCOB 4C0KA 3O2PA 4YI9A 2EC6B 2MLEC 4WQ2A 1EG4A 2PRUA 2WCEA 3S0GA 1XA5A 1H4BA 2KYFA 1IRJA 2BCAA 1K93D 1CLBA 1DJWA 4PE4A 2HQ8A 5HYDA 3DZTA 1L2OC 4NDCA 4PCWA 3LL8B 1PSBA 3I5FC 2I7AA 1M63B 1SRAA 1LINA 2QACA 3FE8A 5HLVA 3VRPA 1MXEA 1QS7A 1B1GA 1C7WA 3SIAA 4U8DA 1M45A 1WRLA 1K2HA 3I5HB 2HQWA 3O78A 1JUOA 4QJ5B 1KFXS 2Q4UA 2KSPA 4YRUA 2LLTA 5AXIA 2JZIA 2KFFA 2P71A 3DXLA 5AANA 5J3XA 5I2OA 3MSEB 1NSHA 2KI4C 3IF7A 1XFUO 2EGDA 2LANA 3BFHA 3NHTA 1B9AA 2WORA 3LLEA 1NX3A 3O4XA 3CS1A
chains in the Genus database with same CATH topology
1S6JA 4DCKA 1BR4B 1NIWA 2B1UA 1NX1A 1B8RA 2M7NA 1A29A 1TOPA 1UHHA 1DGUA 1NCYA 3IQQA 1IG5A 3NSOA 2LC5A 2JT8A 2LLUA 1PRWA 4HREE 1K96A 1WRKA 2PMYA 3KF9A 1IH0A 1L7ZA 1BLQA 1BJFA 2MHHA 2NZ0A 5B8IB 3SG4A 5D69A 3PFVA 1UP5A 1EL4A 5HLOA 4YGCB 1K9KA 2KI4B 4ICBA 2BCBA 4HRGA 4WQ3A 1OMRA 2JT3A 1CMFA 1MHOA 2LNKA 3BYAA 2OS8C 3WNXB 1E8AA 2DOQA 3HX4A 2KQ6A 1D1OA 1J7QA 4XYNA 2D8NA 3FIAA 3CWGA 2K7DA 2L4IA 2LUCA 4USLA 4NQGA 2O60A 2BKHB 2CTNA 2LHLA 2JULA 1PK0D 1Y1AA 1XK4A 2WCFA 4GFTA 5JJGA 5KSZA 1MXLC 1YUSA 5AEQA 2M9GA 1KSMA 1LVCD 1S5GY 3KHEA 1CDMA 1N0YA 3FWBA 2M1UA 1OOJA 2CCMA 2JOJA 1LXFC 1K9UA 3FS7A 3OHMB 2Y5IA 2AAOA 4BY4A 3I5GC 1KFUL 2ISDA 4OV2A 4XJKA 1XYDA 4C0LA 1G33A 2JXLA 1KK8C 2KNEA 4I5JA 3KO0A 4M2QA 4N1GA 4ZCUA 2LCPA 2LUXA 3A8RA 1QVIZ 2G2BA 2H61C 3D0YA 3AKAA 3BUNB 1BODA 4CFRA 1YVHA 1DJGA 1CM4A 2K0JA 4JWQA 2PASA 1B8LA 4QJ3B 3DVMA 2WOSA 3SG3A 3JVTC 3EKHA 1A75A 1G4YR 1YR5A 3I5GB 4GBAA 4GGNA 3TDUA 4E68A 2LVVA 1QIWA 4CLNA 1UHIA 2JRFA 2PVBA 4BY5A 4N1FA 3BUMB 1MR8A 1SCMB 1MQ1A 4MBEA 1UUSA 2K7OA 1B7TY 1A2XA 1S3PA 5CPVA 4YGAA 3CZTX 2AMIA 2KBMA 4GUKA 1SL7A 1JSAA 2ZNEA 1KSOA 1CLMA 1V1GA 1XFVO 2F3ZA 2MA2A 1YRUB 2L4HA 2JXCA 4MRXA 3TZ1A 1J7OA 1YUUA 3M0WA 1IJ6A 1KWOB 2JPTA 1KFXL 4MN0A 2CT9A 1A4PA 1EG3A 5HKYA 1AK8A 3JTDC 3CGAA 1ZOTB 4QJ4B 1YTZC 2ZKMX 4MEWA 2WCBA 2MBXA 1R6PA 5CSJA 5FYXA 1K94A 3SG2A 1OMDA 1DF0B 3CR2A 2KFGA 5I2LA 1XO5A 3GOFA 5KTYA 1DJZA 2FJUB 3VGOA 4I5KA 1NP8A 2V53A 2ZNDA 2LE9B 1QX5B 1KQMC 1PULA 2KHNA 1SYMA 4OCIA 1JF2A 4ETOA 2LP2A 3EKJA 1PVBA 4UPGA 2OTGC 1SY9A 3OX5A 2KGBC 2E30A 3GK2A 1ODBA 5CSFA 3EK8A 1MF8B 1YURA 1TCFA 1OE9B 1SW8A 2F2PA 2L2EA 1QJTA 1L2OB 1SKTA 1NPQA 3JTDB 2BBNA 3I5FB 1KCYA 1WLZA 3TDIA 2M7LA 1RECA 4GGFC 1LA0A 3EK7A 2R2IA 1CFCA 2FCDA 2KYCA 1WY9A 1OQPA 2GGMA 3F45A 4YBHB 1CKKA 3H4SE 3OB1B 1M39A 2LVJA 3EVVA 3NSLA 5DKQA 5PALA 2L98A 2I18A 1NCXA 2JTTA 3SG5A 4YGEB 3HCMA 2GV5A 3LK0A 3TS5C 3ZWHA 4A4CA 2BKIB 2FCEA 4YGBB 1DGVA 2WNDA 1BR1B 2NCOA 1LKJA 1G8IA 1SMGA 1JC2A 2M8UA 1QV0A 1TIZA 4MZLA 1TN4A 4P2YB 1YRTB 1KK7Z 1AJ4A 1N2DA 2M0RA 2NLNA 1V1FA 1J7RA 3BUOB 3RM1A 1BOCA 1BU3A 2HPSA 2BCXA 4D1EA 4YGDB 1QASA 1R2UA 2KGRA 5ER5A 2KDHA 3TUYC 1QX2A 2H2KA 2OS8B 2KBIA 3O6BA 4I5LB 1XFYO 1AVSA 4OVNF 1K90D 4Q04A 4PE7A 1N65A 3IQOA 1AP4A 2KOTA 4DS7A 5DKNA 3OX6A 1CNPA 1J55A 3BXKA 1SR6C 3SG7A 1JWDA 1YUTA 5AERA 1CTRA 2JC2A 1FI6A 4MSPA 2O5GA 1F55A 1A03A 1QIVA 3ZNIA 3DF0B 2WC8A 4PE0A 4PDZA 1S6IA 1NWDA 1RTP1 1XVJA 4GAOA 4PHMA 1WRZA 2JNFA 3TUYB 2JNXA 2LP3A 4CPVA 1ALWA 1OMVA 1GGWA 1Y1XA 1JFKA 1IJ5A 2F3YA 1RROA 1WLMA 2E6WA 3BUWB 2A4JA 1F8HA 3WHUB 1UHNA 3VRNA 5AFPA 1XK4C 2LAPA 4DIRA 2SCPA 1FF1A 4F0ZB 2Q91A 2BE6A 2L51A 5F6TA 1WDCC 2F8PA 4DUQA 1J1DA 1TNWA 4AQIA 3VRRA 2BL0C 2JTZA 2MLFC 3VRQA 4DRWA 1KK8B 1BT6A 2F33A 2HF5A 2LHIA 2QPTA 4I5NB 2K7BA 1ZUZA 1J1EA 3KPXA 2LMVA 4CIDA 1CMGA 2BECA 3I5IC 1CFFA 1IGVA 2K8MB 3WHTB 1QATA 3BOWB 1YVLA 2K61A 1C7VA 1RFJA 3JVTB 1WDCB 2JQ6A 1Y6WA 2KAXA 2BBMA 5D7FA 1H8BA 2BL0B 1QVIY 1K8UA 2AUCA 2SASA 1UHJA 1BMOA 4MZKA 1SL9A 3EVUA 3TDZA 1GGZA 1BG1A 4M2PA 2LM5A 1CLLA 1DJHA 1HQVA 1SBJA 1PSRA 4NDDA 2COLB 3I5HC 1EJ3A 4TNCA 4GGFA 1M31A 1DT7B 2LLSA 1F4QA 3DD4A 3AAJA 1UHKA 4CFQA 1YX7A 1CM1A 1SL8A 4YI8A 4N5XA 3SIBA 4PHKA 1S26D 1Y1UA 5DKRA 1QXPA 1U5IB 1ZFSA 2CNPA 3OP0A 2KAVA 5CSNA 3NSKA 2JT0A 5IBWA 1SPYA 1ZMZA 3D0YB 3QRXA 2PSRA 4ORCB 1B8CA 2VRGA 4PHNA 5I2QA 1EXRA 1X02A 1VRKA 1CB1A 1A75B 1GQMA 2M29A 1ALVA 1UURA 3O4YA 1KQMB 1MUXA 1W7JB 2IS9A 3BUXB 1QX7A 3SG6A 4PALA 1PVAA 5JOLA 2OTGB 4GNKB 1B47A 2JU0A 5KU1A 2L0PA 1QLSA 1MWNA 3DVJA 2PALA 3K21A 3KEVA 1Y0VH 1TRFA 1TNPA 2LMTA 1BF5A 2EHBA 1NX0A 4FTGA 4HRHA 1IQ3A 1CDPA 1XFWO 4PHJA 4AOMA 3DF0A 1QLKA 1IQ5A 1S6CA 3GK1A 4NDBA 2M97A 4OR9B 3RLZA 4WRIA 1S36A 4JPZB 2FOTA 3SJSA 2CXJA 1S5GZ 1OZSA 3D10A 3PATA 4ZCVA 1AUIB 2Y1MA 1PALA 3PM8A 4MLWA 2MAZA 3EVRA 3PSRA 2ZRTA 4MRYA 1OSAA 1HT9A 1DJXA 4R1EA 1GJYA 1S1EA 2Y4QA 4HSZA 3PLFB 3LCPC 3TS5B 2OPOA 2ZN9A 5ER4X 1ZACA 2LMUA 3CR4X 3CTNA 1JF0A 1J7PA 2HETA 2KI6C 2TN4A 2H61A 1DVIA 3E3RA 4P5OE 1NYAA 1TNQA 1JFJA 4C0JA 1AHRA 1RWYA 2K7CA 2RGIA 1FPWA 2KI6D 3BOWA 1F71A 4ORAB 3AKBA 1Q80A 3EK4A 3CR5X 2L50A 3PALA 4M2OA 1CDLA 1DMOA 2I2RE 2ZFDA 1FW4A 5BPJA 2Y1NA 1K95A 1OZOA 2I94A 4MZJA 3PN7C 1XFZO 1DTLA 1KK7Y 3DVKA 5G08A 1IWQA 1DF0A 4A4BA 2M3WA 4AQJA 5HKWA 3NXAA 2KAYA 1DJIA 1QV1A 1SR6B 1B7TZ 2ZN8A 5TNCA 2NXQA 3A4UB 1AJ5A 2MJWB 1SCVA 2P6BB 3OB2B 2K2AA 3WXAA 4MVFA 2ZRSA 1CFDA 1IKUA 1U5IA 4FQOA 5CSIA 1NCZA 1SK6D 1K9PA 4L9MA 1SCMC 1CFPA 4IL1A 2F2OA 2M49B 2M1KB 2JWWA 3GK4X 3PN7B 1KFUS 1UWOA 1QTXA 5GQQC 3VROA 5K89A 1F54A 1C07A 1CDNA 4GPLB 1JBAA 3AAKA 1FI5A 2G9BA 2K2FA 1SNLA 2KFHA 1EH2A 2EC6C 4JQ0D 1KWOC 5HKZA 4PE1A 2LVKA 1FBVA 4OKHA 1B4CA 3NSIA 5I8NA 2L5XB 3DVEA 3BQ3A 1XFXO 2BE4A 3ICBA 3C1VA 1RJVA 1DJYA 2LVIA 1M46A 3LK1A 1LA3A 2CBLA 2GGZA 1TNXA 1NX2A 1NUBA 1RK9A 1TTXA 1YX8A 1W7IB 2LV7A 2MRDA 2NCPA 3I5IB 4ORBB 1F4OA 3FWCA 4XJKB 3CLNA 1F70A 1KQVA 2KQYA 1TCOB 4C0KA 3O2PA 4YI9A 2EC6B 2MLEC 4WQ2A 1EG4A 2PRUA 2WCEA 1XA5A 1H4BA 2KYFA 2BCAA 1IRJA 1K93D 1CLBA 1DJWA 4PE4A 2HQ8A 5HYDA 1L2OC 4NDCA 4PCWA 3LL8B 1PSBA 3I5FC 2I7AA 1M63B 1SRAA 1LINA 2QACA 5HLVA 3VRPA 1MXEA 1QS7A 1B1GA 1C7WA 3SIAA 4U8DA 1M45A 1WRLA 1K2HA 3I5HB 2HQWA 3O78A 1JUOA 4QJ5B 1KFXS 2Q4UA 2KSPA 4YRUA 2LLTA 5AXIA 2JZIA 2KFFA 5AANA 5J3XA 5I2OA 3MSEB 1NSHA 2KI4C 3IF7A 1XFUO 2EGDA 2LANA 1B9AA 2WORA 3LLEA 1NX3A 3CS1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1S6J A;  4DCK A;  1BR4 B;  1NIW A;  2B1U A;  1NX1 A;  1B8R A;  2M7N A;  1A29 A;  1TOP A;  1UHH A;  1DGU A;  1NCY A;  3IQQ A;  1IG5 A;  3NSO A;  2LC5 A;  2JT8 A;  2LLU A;  1PRW A;  4HRE E;  1K96 A;  1WRK A;  2PMY A;  3KF9 A;  1IH0 A;  1L7Z A;  1BLQ A;  1BJF A;  2MHH A;  2NZ0 A;  5B8I B;  3SG4 A;  5D69 A;  3PFV A;  1UP5 A;  1EL4 A;  5HLO A;  4YGC B;  1K9K A;  2KI4 B;  4ICB A;  2BCB A;  4HRG A;  4WQ3 A;  1OMR A;  2JT3 A;  1CMF A;  1MHO A;  2LNK A;  3BYA A;  2OS8 C;  3WNX B;  1E8A A;  2DOQ A;  3HX4 A;  2KQ6 A;  1D1O A;  1J7Q A;  4XYN A;  2D8N A;  3FIA A;  3CWG A;  2K7D A;  2L4I A;  2LUC A;  4USL A;  4NQG A;  2O60 A;  2BKH B;  2CTN A;  2LHL A;  2JUL A;  1PK0 D;  1Y1A A;  1XK4 A;  2WCF A;  4GFT A;  5JJG A;  5KSZ A;  1MXL C;  1YUS A;  5AEQ A;  2M9G A;  1KSM A;  1LVC D;  1S5G Y;  3KHE A;  1CDM A;  1N0Y A;  3FWB A;  2M1U A;  1OOJ A;  2CCM A;  2JOJ A;  1LXF C;  1K9U A;  3FS7 A;  3OHM B;  2Y5I A;  2AAO A;  4BY4 A;  3I5G C;  1KFU L;  2ISD A;  4OV2 A;  4XJK A;  1XYD A;  4C0L A;  1G33 A;  2JXL A;  1KK8 C;  2KNE A;  4I5J A;  3KO0 A;  4M2Q A;  4N1G A;  4ZCU A;  2LCP A;  2LUX A;  3A8R A;  1QVI Z;  2G2B A;  2H61 C;  3D0Y A;  3AKA A;  3BUN B;  1BOD A;  4CFR A;  1YVH A;  1DJG A;  1CM4 A;  2K0J A;  4JWQ A;  2PAS A;  1B8L A;  4QJ3 B;  3DVM A;  2WOS A;  3SG3 A;  3JVT C;  3EKH A;  1A75 A;  1G4Y R;  1YR5 A;  3I5G B;  4GBA A;  4GGN A;  3TDU A;  4E68 A;  2LVV A;  1QIW A;  4CLN A;  1UHI A;  2JRF A;  2PVB A;  4BY5 A;  4N1F A;  3BUM B;  1MR8 A;  1SCM B;  1MQ1 A;  4MBE A;  1UUS A;  2K7O A;  1B7T Y;  1A2X A;  1S3P A;  5CPV A;  4YGA A;  3CZT X;  2AMI A;  2KBM A;  4GUK A;  1SL7 A;  1JSA A;  2ZNE A;  1KSO A;  1CLM A;  1V1G A;  1XFV O;  2F3Z A;  2MA2 A;  1YRU B;  2L4H A;  2JXC A;  4MRX A;  3TZ1 A;  1J7O A;  1YUU A;  3M0W A;  1IJ6 A;  1KWO B;  2JPT A;  1KFX L;  4MN0 A;  2CT9 A;  1A4P A;  1EG3 A;  5HKY A;  1AK8 A;  3JTD C;  3CGA A;  1ZOT B;  4QJ4 B;  1YTZ C;  2ZKM X;  4MEW A;  2WCB A;  2MBX A;  1R6P A;  5CSJ A;  5FYX A;  1K94 A;  3SG2 A;  1OMD A;  1DF0 B;  3CR2 A;  2KFG A;  5I2L A;  1XO5 A;  3GOF A;  5KTY A;  1DJZ A;  2FJU B;  3VGO A;  4I5K A;  1NP8 A;  2V53 A;  2ZND A;  2LE9 B;  1QX5 B;  1KQM C;  1PUL A;  2KHN A;  1SYM A;  4OCI A;  1JF2 A;  4ETO A;  2LP2 A;  3EKJ A;  1PVB A;  4UPG A;  2OTG C;  1SY9 A;  3OX5 A;  2KGB C;  2E30 A;  3GK2 A;  1ODB A;  5CSF A;  3EK8 A;  1MF8 B;  1YUR A;  1TCF A;  1OE9 B;  1SW8 A;  2F2P A;  2L2E A;  1QJT A;  1L2O B;  1SKT A;  1NPQ A;  3JTD B;  2BBN A;  3I5F B;  1KCY A;  1WLZ A;  3TDI A;  2M7L A;  1REC A;  4GGF C;  1LA0 A;  3EK7 A;  2R2I A;  1CFC A;  2FCD A;  2KYC A;  1WY9 A;  1OQP A;  2GGM A;  3F45 A;  4YBH B;  1CKK A;  3H4S E;  3OB1 B;  1M39 A;  2LVJ A;  3EVV A;  3NSL A;  5DKQ A;  5PAL A;  2L98 A;  2I18 A;  1NCX A;  2JTT A;  3SG5 A;  4YGE B;  3HCM A;  2GV5 A;  3LK0 A;  3TS5 C;  3ZWH A;  4A4C A;  2BKI B;  2FCE A;  4YGB B;  1DGV A;  2WND A;  1BR1 B;  2NCO A;  1LKJ A;  1G8I A;  1SMG A;  1JC2 A;  2M8U A;  1QV0 A;  1TIZ A;  4MZL A;  1TN4 A;  4P2Y B;  1YRT B;  1KK7 Z;  1AJ4 A;  1N2D A;  2M0R A;  2NLN A;  1V1F A;  1J7R A;  3BUO B;  3RM1 A;  1BOC A;  1BU3 A;  2HPS A;  2BCX A;  4D1E A;  4YGD B;  1QAS A;  1R2U A;  2KGR A;  5ER5 A;  2KDH A;  3TUY C;  1QX2 A;  2H2K A;  2OS8 B;  2KBI A;  3O6B A;  4I5L B;  1XFY O;  1AVS A;  4OVN F;  1K90 D;  4Q04 A;  4PE7 A;  1N65 A;  3IQO A;  1AP4 A;  2KOT A;  4DS7 A;  5DKN A;  3OX6 A;  1CNP A;  1J55 A;  3BXK A;  1SR6 C;  3SG7 A;  1JWD A;  1YUT A;  5AER A;  1CTR A;  2JC2 A;  1FI6 A;  4MSP A;  2O5G A;  1F55 A;  1A03 A;  1QIV A;  3ZNI A;  3DF0 B;  2WC8 A;  4PE0 A;  4PDZ A;  1S6I A;  1NWD A;  1RTP 1;  1XVJ A;  4GAO A;  4PHM A;  1WRZ A;  2JNF A;  3TUY B;  2JNX A;  2LP3 A;  4CPV A;  1ALW A;  1OMV A;  1GGW A;  1Y1X A;  1JFK A;  1IJ5 A;  2F3Y A;  1RRO A;  1WLM A;  2E6W A;  3BUW B;  2A4J A;  1F8H A;  3WHU B;  1UHN A;  3VRN A;  5AFP A;  1XK4 C;  2LAP A;  4DIR A;  2SCP A;  1FF1 A;  4F0Z B;  2Q91 A;  2BE6 A;  2L51 A;  5F6T A;  1WDC C;  2F8P A;  4DUQ A;  1J1D A;  1TNW A;  4AQI A;  3VRR A;  2BL0 C;  2JTZ A;  2MLF C;  3VRQ A;  4DRW A;  1KK8 B;  1BT6 A;  2F33 A;  2HF5 A;  2LHI A;  2QPT A;  4I5N B;  2K7B A;  1ZUZ A;  1J1E A;  3KPX A;  2LMV A;  4CID A;  1CMG A;  2BEC A;  3I5I C;  1CFF A;  1IGV A;  2K8M B;  3WHT B;  1QAT A;  3BOW B;  1YVL A;  2K61 A;  1C7V A;  1RFJ A;  3JVT B;  1WDC B;  2JQ6 A;  1Y6W A;  2KAX A;  2BBM A;  5D7F A;  1H8B A;  2BL0 B;  1QVI Y;  1K8U A;  2AUC A;  2SAS A;  1UHJ A;  1BMO A;  4MZK A;  1SL9 A;  3EVU A;  3TDZ A;  1GGZ A;  1BG1 A;  4M2P A;  2LM5 A;  1CLL A;  1DJH A;  1HQV A;  1SBJ A;  1PSR A;  4NDD A;  2COL B;  3I5H C;  1EJ3 A;  4TNC A;  4GGF A;  1M31 A;  1DT7 B;  2LLS A;  1F4Q A;  3DD4 A;  3AAJ A;  1UHK A;  4CFQ A;  1YX7 A;  1CM1 A;  1SL8 A;  4YI8 A;  4N5X A;  3SIB A;  4PHK A;  1S26 D;  1Y1U A;  5DKR A;  1QXP A;  1U5I B;  1ZFS A;  2CNP A;  3OP0 A;  2KAV A;  5CSN A;  3NSK A;  2JT0 A;  5IBW A;  1SPY A;  1ZMZ A;  3D0Y B;  3QRX A;  2PSR A;  4ORC B;  1B8C A;  2VRG A;  4PHN A;  5I2Q A;  1EXR A;  1X02 A;  1VRK A;  1CB1 A;  1A75 B;  1GQM A;  2M29 A;  1ALV A;  1UUR A;  3O4Y A;  1KQM B;  1MUX A;  1W7J B;  2IS9 A;  3BUX B;  1QX7 A;  3SG6 A;  4PAL A;  1PVA A;  5JOL A;  2OTG B;  4GNK B;  1B47 A;  2JU0 A;  5KU1 A;  2L0P A;  1QLS A;  1MWN A;  3DVJ A;  2PAL A;  3K21 A;  3KEV A;  1Y0V H;  1TRF A;  1TNP A;  2LMT A;  1BF5 A;  2EHB A;  1NX0 A;  4FTG A;  4HRH A;  1IQ3 A;  1CDP A;  1XFW O;  4PHJ A;  4AOM A;  3DF0 A;  1QLK A;  1IQ5 A;  1S6C A;  3GK1 A;  4NDB A;  2M97 A;  4OR9 B;  3RLZ A;  4WRI A;  1S36 A;  4JPZ B;  2FOT A;  3SJS A;  2CXJ A;  1S5G Z;  1OZS A;  3D10 A;  3PAT A;  4ZCV A;  1AUI B;  2Y1M A;  1PAL A;  3PM8 A;  4MLW A;  2MAZ A;  3EVR A;  3PSR A;  2ZRT A;  4MRY A;  1OSA A;  1HT9 A;  1DJX A;  4R1E A;  1GJY A;  1S1E A;  2Y4Q A;  4HSZ A;  3PLF B;  3LCP C;  3TS5 B;  2OPO A;  2ZN9 A;  5ER4 X;  1ZAC A;  2LMU A;  3CR4 X;  3CTN A;  1JF0 A;  1J7P A;  2HET A;  2KI6 C;  2TN4 A;  2H61 A;  1DVI A;  3E3R A;  4P5O E;  1NYA A;  1TNQ A;  1JFJ A;  4C0J A;  1AHR A;  1RWY A;  2K7C A;  2RGI A;  1FPW A;  2KI6 D;  3BOW A;  1F71 A;  4ORA B;  3AKB A;  1Q80 A;  3EK4 A;  3CR5 X;  2L50 A;  3PAL A;  4M2O A;  1CDL A;  1DMO A;  2I2R E;  2ZFD A;  1FW4 A;  5BPJ A;  2Y1N A;  1K95 A;  1OZO A;  2I94 A;  4MZJ A;  3PN7 C;  1XFZ O;  1DTL A;  1KK7 Y;  3DVK A;  5G08 A;  1IWQ A;  1DF0 A;  4A4B A;  2M3W A;  4AQJ A;  5HKW A;  3NXA A;  2KAY A;  1DJI A;  1QV1 A;  1SR6 B;  1B7T Z;  2ZN8 A;  5TNC A;  2NXQ A;  3A4U B;  1AJ5 A;  2MJW B;  1SCV A;  2P6B B;  3OB2 B;  2K2A A;  3WXA A;  4MVF A;  2ZRS A;  1CFD A;  1IKU A;  1U5I A;  4FQO A;  5CSI A;  1NCZ A;  1SK6 D;  1K9P A;  4L9M A;  1SCM C;  1CFP A;  4IL1 A;  2F2O A;  2M49 B;  2M1K B;  2JWW A;  3GK4 X;  3PN7 B;  1KFU S;  1UWO A;  1QTX A;  5GQQ C;  3VRO A;  5K89 A;  1F54 A;  1C07 A;  1CDN A;  4GPL B;  1JBA A;  3AAK A;  1FI5 A;  2G9B A;  2K2F A;  1SNL A;  2KFH A;  1EH2 A;  2EC6 C;  4JQ0 D;  1KWO C;  5HKZ A;  4PE1 A;  2LVK A;  1FBV A;  4OKH A;  1B4C A;  3NSI A;  5I8N A;  2L5X B;  3DVE A;  3BQ3 A;  1XFX O;  2BE4 A;  3ICB A;  3C1V A;  1RJV A;  1DJY A;  2LVI A;  1M46 A;  3LK1 A;  1LA3 A;  2CBL A;  2GGZ A;  1TNX A;  1NX2 A;  1NUB A;  1RK9 A;  1TTX A;  1YX8 A;  1W7I B;  2LV7 A;  2MRD A;  2NCP A;  3I5I B;  4ORB B;  1F4O A;  3FWC A;  4XJK B;  3CLN A;  1F70 A;  1KQV A;  2KQY A;  1TCO B;  4C0K A;  3O2P A;  4YI9 A;  2EC6 B;  2MLE C;  4WQ2 A;  1EG4 A;  2PRU A;  2WCE A;  1XA5 A;  1H4B A;  2KYF A;  2BCA A;  1IRJ A;  1K93 D;  1CLB A;  1DJW A;  4PE4 A;  2HQ8 A;  5HYD A;  1L2O C;  4NDC A;  4PCW A;  3LL8 B;  1PSB A;  3I5F C;  2I7A A;  1M63 B;  1SRA A;  1LIN A;  2QAC A;  5HLV A;  3VRP A;  1MXE A;  1QS7 A;  1B1G A;  1C7W A;  3SIA A;  4U8D A;  1M45 A;  1WRL A;  1K2H A;  3I5H B;  2HQW A;  3O78 A;  1JUO A;  4QJ5 B;  1KFX S;  2Q4U A;  2KSP A;  4YRU A;  2LLT A;  5AXI A;  2JZI A;  2KFF A;  5AAN A;  5J3X A;  5I2O A;  3MSE B;  1NSH A;  2KI4 C;  3IF7 A;  1XFU O;  2EGD A;  2LAN A;  1B9A A;  2WOR A;  3LLE A;  1NX3 A;  3CS1 A; 
#chains in the Genus database with same CATH topology
 1S6J A;  4DCK A;  1BR4 B;  3L47 A;  1NIW A;  2B1U A;  1NX1 A;  1B8R A;  2M7N A;  1A29 A;  1TOP A;  1UHH A;  1DGU A;  1NCY A;  3IQQ A;  1IG5 A;  1TUJ A;  2LC5 A;  2JT8 A;  2LLU A;  1LS8 A;  1PRW A;  1K96 A;  1WRK A;  2PMY A;  2K60 A;  3KF9 A;  1F54 A;  1IH0 A;  1L7Z A;  1BLQ A;  1BJF A;  2MHH A;  2NZ0 A;  5B8I B;  3SG4 A;  5D69 A;  2WCH A;  3PFV A;  1UP5 A;  1EL4 A;  5HLO A;  4YGC B;  1K9K A;  3NGV A;  2KI4 B;  4ICB A;  2BCB A;  4HRG A;  4WQ3 A;  1OMR A;  2JT3 A;  1CMF A;  1MHO A;  2KLD A;  2LNK A;  3BYA A;  2OS8 C;  1W9Z A;  3WNX B;  1E8A A;  2DOQ A;  3HX4 A;  2KQ6 A;  1D1O A;  1J7Q A;  4XYN A;  2D8N A;  3FIA A;  4JD9 A;  3CWG A;  2K7D A;  2L4I A;  2LUC A;  4USL A;  4NQG A;  2O60 A;  1DC1 A;  1OOH A;  2BKH B;  2CTN A;  2LHL A;  3B87 A;  2JUL A;  1PK0 D;  1Y1A A;  1XK4 A;  2WCF A;  4GFT A;  5JJG A;  5KSZ A;  1MXL C;  1YUS A;  5AEQ A;  2M9G A;  3RZS A;  1KSM A;  1LVC D;  1S5G Y;  3KHE A;  1CDM A;  1N0Y A;  3S0F A;  3FWB A;  2M1U A;  3FE6 A;  1OOJ A;  1IIO A;  2CCM A;  2JOJ A;  2QEH A;  1LXF C;  1K9U A;  3FS7 A;  3OHM B;  2Y5I A;  2AAO A;  1OOI X;  4BY4 A;  3I5G C;  1KFU L;  2ISD A;  4OV2 A;  4XJK A;  1XYD A;  4C0L A;  1G33 A;  2JXL A;  1KK8 C;  2KNE A;  4I5J A;  3KO0 A;  4M2Q A;  2KPH A;  4N1G A;  4ZCU A;  5FI7 A;  2LCP A;  2LUX A;  1Z4H A;  3A8R A;  1QVI Z;  2G2B A;  2H61 C;  3D0Y A;  3AKA A;  3BUN B;  3D76 A;  3OGN A;  3DYE A;  4CFR A;  1BOD A;  1YVH A;  1DJG A;  1CM4 A;  1T14 A;  2K0J A;  2GTE A;  4JWQ A;  2PAS A;  1B8L A;  4QJ3 B;  3DVM A;  2WOS A;  3SG3 A;  3JVT C;  3EKH A;  1A75 A;  1G4Y R;  1YR5 A;  3I5G B;  4GBA A;  3R1P A;  3QME A;  4GGN A;  3TDU A;  4E68 A;  2LVV A;  1QIW A;  4CLN A;  1UHI A;  3B86 A;  2JRF A;  2PVB A;  4BY5 A;  4N1F A;  3BUM B;  2QEO A;  1MR8 A;  3EG5 B;  1SCM B;  2QEB A;  1MQ1 A;  4MBE A;  1UUS A;  2K7O A;  1B7T Y;  3R1O A;  1A2X A;  1S3P A;  3CYZ A;  5CPV A;  4YGA A;  3CZT X;  2AMI A;  2KBM A;  4GUK A;  1SL7 A;  1JSA A;  2ZNE A;  1KSO A;  1CLM A;  1V1G A;  1XFV O;  2F3Z A;  1OOF A;  1YRU B;  2L4H A;  2JXC A;  2MA2 A;  4MRX A;  3TZ1 A;  1J7O A;  1YUU A;  3M0W A;  1IJ6 A;  1KWO B;  2JPT A;  1KFX L;  4MN0 A;  2CT9 A;  1A4P A;  1EG3 A;  4F7F A;  5HKY A;  1AK8 A;  3S0A A;  1DEK A;  3JTD C;  3CGA A;  1ZOT B;  4QJ4 B;  1YTZ C;  2ZKM X;  4MEW A;  2WCB A;  2QEV A;  1R6P A;  2MBX A;  5CSJ A;  3S0B A;  5FYX A;  1K94 A;  3SG2 A;  1OMD A;  1DF0 B;  3CR2 A;  2KFG A;  5I2L A;  1XO5 A;  3GOF A;  5KTY A;  1DJZ A;  2FJU B;  3VGO A;  4I5K A;  1NP8 A;  2V53 A;  2ZND A;  2LE9 B;  1QX5 B;  1KQM C;  1PUL A;  2KHN A;  1SYM A;  4OCI A;  1JF2 A;  1TUZ A;  4ETO A;  2LP2 A;  3EKJ A;  1PVB A;  4UPG A;  2OTG C;  3L4L A;  1SY9 A;  3OX5 A;  2KGB C;  2E30 A;  3GK2 A;  1ODB A;  5CSF A;  3EK8 A;  2QDI A;  1MF8 B;  1YUR A;  1TCF A;  1OE9 B;  1OOG A;  1SW8 A;  2F2P A;  1TWO A;  1DEL A;  2L2E A;  1QJT A;  1L2O B;  1SKT A;  1NPQ A;  3JTD B;  2BBN A;  3CZ0 A;  3I5F B;  1KCY A;  1WLZ A;  3TDI A;  2M7L A;  1REC A;  4GGF C;  1LA0 A;  3EK7 A;  2R2I A;  1CFC A;  3IVT A;  2FCD A;  2KYC A;  1WY9 A;  1OQP A;  2GGM A;  3F45 A;  4YBH B;  1CKK A;  3H4S E;  3OB1 B;  3D74 A;  1M39 A;  2LVJ A;  3EVV A;  3NSL A;  5DKQ A;  5FI6 A;  5PAL A;  2L98 A;  2I18 A;  1NCX A;  2JTT A;  3SG5 A;  4YGE B;  3UNW A;  3HCM A;  2GV5 A;  3LK0 A;  4JKT A;  3TS5 C;  3UO9 A;  2BKI B;  2FCE A;  4YGB B;  1DGV A;  3NSO A;  3ZWH A;  4A4C A;  2WND A;  1BR1 B;  2NCO A;  1LKJ A;  1G8I A;  1SMG A;  1JC2 A;  2M8U A;  2WCJ A;  1QV0 A;  3K1E A;  1TIZ A;  4MZL A;  1TN4 A;  4P2Y B;  1YRT B;  3N7H A;  1KK7 Z;  1AJ4 A;  1N2D A;  2M0R A;  1P28 A;  2NLN A;  1V1F A;  1J7R A;  1Z2C B;  3BUO B;  3RM1 A;  1BOC A;  1BU3 A;  1XFR A;  2HPS A;  2BCX A;  4D1E A;  4YGD B;  1QAS A;  1R2U A;  5I94 A;  2KGR A;  4HRE E;  5ER5 A;  2KDH A;  4PT1 A;  2JPO A;  3TUY C;  1QX2 A;  2H2K A;  2OS8 B;  2KBI A;  3O6B A;  4I5L B;  1XFY O;  1AVS A;  4OVN F;  1K90 D;  3BFA A;  4Q04 A;  4PE7 A;  1N65 A;  5D3O A;  3IQO A;  3B88 A;  1AP4 A;  2KOT A;  5FI2 A;  4DS7 A;  5DKN A;  3OX6 A;  1CNP A;  1J55 A;  3B7A A;  3CZ1 A;  3SS4 A;  3BXK A;  1SR6 C;  2BNX A;  3SG7 A;  1JWD A;  1YUT A;  5AER A;  1CTR A;  2JC2 A;  1FI6 A;  4MSP A;  2O5G A;  1F55 A;  1A03 A;  1QIV A;  3ZNI A;  3DF0 B;  2WC8 A;  4PE0 A;  4PDZ A;  1S6I A;  1NWD A;  1RTP 1;  1XVJ A;  4GAO A;  4PHM A;  4OZD A;  1WRZ A;  2JNF A;  3TUY B;  2JNX A;  2LP3 A;  3VB1 A;  1ALW A;  1OMV A;  4IJ7 A;  1Y1X A;  4CPV A;  1GGW A;  1JFK A;  1IJ5 A;  2F3Y A;  1RRO A;  1WLM A;  2E6W A;  3BUW B;  3PJI A;  2A4J A;  1F8H A;  3WHU B;  1UHN A;  3VRN A;  5AFP A;  1XK4 C;  2LAP A;  4DIR A;  2SCP A;  1FF1 A;  4F0Z B;  1OW4 A;  2BE6 A;  2Q91 A;  2L51 A;  5F6T A;  1WDC C;  2F8P A;  4DUQ A;  1J1D A;  1TNW A;  4AQI A;  3VRR A;  3D78 A;  2BL0 C;  2JTZ A;  2MLF C;  3VRQ A;  4DRW A;  1KK8 B;  3NHI A;  1BT6 A;  2F33 A;  2HF5 A;  2L5Y A;  2LHI A;  2PQL A;  2QPT A;  4I5N B;  2K7B A;  2FJY A;  2YGU A;  1ZUZ A;  1J1E A;  3KPX A;  2WC6 A;  2LMV A;  3S0E A;  4CID A;  1CMG A;  2BEC A;  3I5I C;  1CFF A;  1IGV A;  2K8M B;  3WHT B;  1QAT A;  3BOW B;  1YVL A;  2K61 A;  1C7V A;  1RFJ A;  3JVT B;  3D75 A;  1WDC B;  2JQ6 A;  1Y6W A;  2KAX A;  2BBM A;  5D7F A;  1H8B A;  2BL0 B;  1QVI Y;  1K8U A;  2AUC A;  2SAS A;  1UHJ A;  1BMO A;  4MZK A;  1SL9 A;  3EVU A;  3TDZ A;  1GGZ A;  1BG1 A;  1QWV A;  3S0D A;  4M2P A;  1SSE B;  2LM5 A;  1CLL A;  1DJH A;  1HQV A;  1SBJ A;  1PSR A;  4NDD A;  2COL B;  3I5H C;  1EJ3 A;  4TNC A;  4GGF A;  1M31 A;  1DT7 B;  1C3Y A;  2LLS A;  1F4Q A;  3DD4 A;  3AAJ A;  1UHK A;  4CFQ A;  1YX7 A;  4INX A;  1CM1 A;  1SL8 A;  3B6X A;  4YI8 A;  4N5X A;  3SIB A;  4PHK A;  1S26 D;  1Y1U A;  5DKR A;  1QXP A;  1U5I B;  1ZFS A;  2CNP A;  3OP0 A;  2KAV A;  5CSN A;  3NSK A;  2JT0 A;  5IBW A;  1SPY A;  1ZMZ A;  2PYQ A;  3D0Y B;  3BJH A;  2PSR A;  3CDN A;  3QRX A;  4ORC B;  1B8C A;  2VRG A;  4PHN A;  5I2Q A;  1EXR A;  1X02 A;  1VRK A;  1CB1 A;  1A75 B;  1GQM A;  2M29 A;  1ALV A;  1UUR A;  3O4Y A;  1KQM B;  1MUX A;  1W7J B;  2IS9 A;  3BUX B;  1QX7 A;  3SG6 A;  4PAL A;  1PVA A;  5JOL A;  2OTG B;  4GNK B;  1B47 A;  2JU0 A;  5KU1 A;  2L0P A;  1QLS A;  3D77 A;  3Q8I A;  1MWN A;  3DVJ A;  2PAL A;  3K21 A;  3KEV A;  1Y0V H;  1TRF A;  1TNP A;  2LMT A;  1BF5 A;  3CAB A;  2EHB A;  1NX0 A;  4FTG A;  4HRH A;  1IQ3 A;  1CDP A;  1XFW O;  4KYN A;  4PHJ A;  4AOM A;  1ORG A;  3DF0 A;  1QLK A;  1IQ5 A;  1S6C A;  2L2C A;  3GK1 A;  2M97 A;  4NDB A;  4OR9 B;  3RLZ A;  4WRI A;  1DQE A;  1S36 A;  4JPZ B;  3L4A A;  2FOT A;  3SJS A;  2CXJ A;  1S5G Z;  3D73 A;  1OZS A;  3D10 A;  3PAT A;  4ZCV A;  1AUI B;  2Y1M A;  1PAL A;  3PM8 A;  4MLW A;  2MAZ A;  3EVR A;  3PSR A;  2ZRT A;  4MRY A;  1OSA A;  1HT9 A;  3SS5 A;  1DJX A;  4R1E A;  1GJY A;  1S1E A;  2ERB A;  2Y4Q A;  4HSZ A;  3PLF B;  3LCP C;  3TS5 B;  2OPO A;  2ZN9 A;  5ER4 X;  1ZAC A;  2LMU A;  3CR4 X;  3CTN A;  1JF0 A;  1J7P A;  2HET A;  2KI6 C;  2TN4 A;  5DIC A;  2H61 A;  1DVI A;  3E3R A;  4P5O E;  2KLE A;  1NYA A;  1TNQ A;  1JFJ A;  4C0J A;  1AHR A;  1RWY A;  2K7C A;  2RGI A;  1FPW A;  2KI6 D;  3BOW A;  1F71 A;  4ORA B;  3SS3 A;  3AKB A;  5EL2 A;  1Q80 A;  3EK4 A;  3CR5 X;  2L50 A;  3PAL A;  4M2O A;  1CDL A;  1DMO A;  2I2R E;  2ZFD A;  1FW4 A;  5BPJ A;  2Y1N A;  1K95 A;  1OZO A;  2BAP A;  2WCK A;  2I94 A;  4MZJ A;  3PN7 C;  1XFZ O;  1DTL A;  1KK7 Y;  3DVK A;  5G08 A;  1IWQ A;  1DF0 A;  3OBV A;  2M3W A;  4A4B A;  5HKW A;  4AQJ A;  3BFB A;  3NXA A;  2KAY A;  1DJI A;  1QV1 A;  5HL1 A;  1SR6 B;  1B7T Z;  3V2L A;  2ZN8 A;  5TNC A;  2NXQ A;  3A4U B;  1AJ5 A;  2MJW B;  1SCV A;  2P6B B;  3OB2 B;  3PM2 A;  2K2A A;  3WXA A;  2WC5 A;  4MVF A;  2ZRS A;  4INW A;  1CFD A;  1IKU A;  3R1V A;  3DY9 A;  1U5I A;  4FQO A;  5CSI A;  4FQT A;  1NCZ A;  1SK6 D;  1K9P A;  4L9M A;  1SCM C;  1CFP A;  4IL1 A;  2F2O A;  2M49 B;  2M1K B;  2JWW A;  3GK4 X;  3PN7 B;  1KFU S;  1UWO A;  1QTX A;  3R72 A;  5GQQ C;  3VRO A;  5K89 A;  1C07 A;  1CDN A;  3FE9 A;  4GPL B;  3AAK A;  1JBA A;  1FI5 A;  2G9B A;  2K2F A;  1SNL A;  2KFH A;  1EH2 A;  2EC6 C;  4JQ0 D;  1KWO C;  3CZ2 A;  5HKZ A;  4PE1 A;  1C3Z A;  2H8V A;  1FBV A;  2LVK A;  2WCL A;  4OKH A;  1B4C A;  2P70 A;  3NSI A;  5I8N A;  2L5X B;  3DVE A;  3BQ3 A;  1XFX O;  2BE4 A;  3ICB A;  3C1V A;  1RJV A;  1DJY A;  2LVI A;  1M46 A;  3LK1 A;  1LA3 A;  2CBL A;  2GGZ A;  1TNX A;  1NX2 A;  1NUB A;  1RK9 A;  1TTX A;  1YX8 A;  1W7I B;  2LV7 A;  2MRD A;  2NCP A;  3I5I B;  1GM0 A;  4ORB B;  1F4O A;  3FWC A;  2WCM A;  3CLN A;  4XJK B;  1F70 A;  1KQV A;  2KQY A;  1TCO B;  4C0K A;  3O2P A;  4YI9 A;  2EC6 B;  2MLE C;  4WQ2 A;  1EG4 A;  2PRU A;  2WCE A;  3S0G A;  1XA5 A;  1H4B A;  2KYF A;  1IRJ A;  2BCA A;  1K93 D;  1CLB A;  1DJW A;  4PE4 A;  2HQ8 A;  5HYD A;  3DZT A;  1L2O C;  4NDC A;  4PCW A;  3LL8 B;  1PSB A;  3I5F C;  2I7A A;  1M63 B;  1SRA A;  1LIN A;  2QAC A;  3FE8 A;  5HLV A;  3VRP A;  1MXE A;  1QS7 A;  1B1G A;  1C7W A;  3SIA A;  4U8D A;  1M45 A;  1WRL A;  1K2H A;  3I5H B;  2HQW A;  3O78 A;  1JUO A;  4QJ5 B;  1KFX S;  2Q4U A;  2KSP A;  4YRU A;  2LLT A;  5AXI A;  2JZI A;  2KFF A;  2P71 A;  3DXL A;  5AAN A;  5J3X A;  5I2O A;  3MSE B;  1NSH A;  2KI4 C;  3IF7 A;  1XFU O;  2EGD A;  2LAN A;  3BFH A;  3NHT A;  1B9A A;  2WOR A;  3LLE A;  1NX3 A;  3O4X A;  3CS1 A; 
#chains in the Genus database with same CATH homology
 1S6J A;  4DCK A;  1BR4 B;  1NIW A;  2B1U A;  1NX1 A;  1B8R A;  2M7N A;  1A29 A;  1TOP A;  1UHH A;  1DGU A;  1NCY A;  3IQQ A;  1IG5 A;  3NSO A;  2LC5 A;  2JT8 A;  2LLU A;  1PRW A;  4HRE E;  1K96 A;  1WRK A;  2PMY A;  3KF9 A;  1IH0 A;  1L7Z A;  1BLQ A;  1BJF A;  2MHH A;  2NZ0 A;  5B8I B;  3SG4 A;  5D69 A;  3PFV A;  1UP5 A;  1EL4 A;  5HLO A;  4YGC B;  1K9K A;  2KI4 B;  4ICB A;  2BCB A;  4HRG A;  4WQ3 A;  1OMR A;  2JT3 A;  1CMF A;  1MHO A;  2LNK A;  3BYA A;  2OS8 C;  3WNX B;  1E8A A;  2DOQ A;  3HX4 A;  2KQ6 A;  1D1O A;  1J7Q A;  4XYN A;  2D8N A;  3FIA A;  3CWG A;  2K7D A;  2L4I A;  2LUC A;  4USL A;  4NQG A;  2O60 A;  2BKH B;  2CTN A;  2LHL A;  2JUL A;  1PK0 D;  1Y1A A;  1XK4 A;  2WCF A;  4GFT A;  5JJG A;  5KSZ A;  1MXL C;  1YUS A;  5AEQ A;  2M9G A;  1KSM A;  1LVC D;  1S5G Y;  3KHE A;  1CDM A;  1N0Y A;  3FWB A;  2M1U A;  1OOJ A;  2CCM A;  2JOJ A;  1LXF C;  1K9U A;  3FS7 A;  3OHM B;  2Y5I A;  2AAO A;  4BY4 A;  3I5G C;  1KFU L;  2ISD A;  4OV2 A;  4XJK A;  1XYD A;  4C0L A;  1G33 A;  2JXL A;  1KK8 C;  2KNE A;  4I5J A;  3KO0 A;  4M2Q A;  4N1G A;  4ZCU A;  2LCP A;  2LUX A;  3A8R A;  1QVI Z;  2G2B A;  2H61 C;  3D0Y A;  3AKA A;  3BUN B;  1BOD A;  4CFR A;  1YVH A;  1DJG A;  1CM4 A;  2K0J A;  4JWQ A;  2PAS A;  1B8L A;  4QJ3 B;  3DVM A;  2WOS A;  3SG3 A;  3JVT C;  3EKH A;  1A75 A;  1G4Y R;  1YR5 A;  3I5G B;  4GBA A;  4GGN A;  3TDU A;  4E68 A;  2LVV A;  1QIW A;  4CLN A;  1UHI A;  2JRF A;  2PVB A;  4BY5 A;  4N1F A;  3BUM B;  1MR8 A;  1SCM B;  1MQ1 A;  4MBE A;  1UUS A;  2K7O A;  1B7T Y;  1A2X A;  1S3P A;  5CPV A;  4YGA A;  3CZT X;  2AMI A;  2KBM A;  4GUK A;  1SL7 A;  1JSA A;  2ZNE A;  1KSO A;  1CLM A;  1V1G A;  1XFV O;  2F3Z A;  2MA2 A;  1YRU B;  2L4H A;  2JXC A;  4MRX A;  3TZ1 A;  1J7O A;  1YUU A;  3M0W A;  1IJ6 A;  1KWO B;  2JPT A;  1KFX L;  4MN0 A;  2CT9 A;  1A4P A;  1EG3 A;  5HKY A;  1AK8 A;  3JTD C;  3CGA A;  1ZOT B;  4QJ4 B;  1YTZ C;  2ZKM X;  4MEW A;  2WCB A;  2MBX A;  1R6P A;  5CSJ A;  5FYX A;  1K94 A;  3SG2 A;  1OMD A;  1DF0 B;  3CR2 A;  2KFG A;  5I2L A;  1XO5 A;  3GOF A;  5KTY A;  1DJZ A;  2FJU B;  3VGO A;  4I5K A;  1NP8 A;  2V53 A;  2ZND A;  2LE9 B;  1QX5 B;  1KQM C;  1PUL A;  2KHN A;  1SYM A;  4OCI A;  1JF2 A;  4ETO A;  2LP2 A;  3EKJ A;  1PVB A;  4UPG A;  2OTG C;  1SY9 A;  3OX5 A;  2KGB C;  2E30 A;  3GK2 A;  1ODB A;  5CSF A;  3EK8 A;  1MF8 B;  1YUR A;  1TCF A;  1OE9 B;  1SW8 A;  2F2P A;  2L2E A;  1QJT A;  1L2O B;  1SKT A;  1NPQ A;  3JTD B;  2BBN A;  3I5F B;  1KCY A;  1WLZ A;  3TDI A;  2M7L A;  1REC A;  4GGF C;  1LA0 A;  3EK7 A;  2R2I A;  1CFC A;  2FCD A;  2KYC A;  1WY9 A;  1OQP A;  2GGM A;  3F45 A;  4YBH B;  1CKK A;  3H4S E;  3OB1 B;  1M39 A;  2LVJ A;  3EVV A;  3NSL A;  5DKQ A;  5PAL A;  2L98 A;  2I18 A;  1NCX A;  2JTT A;  3SG5 A;  4YGE B;  3HCM A;  2GV5 A;  3LK0 A;  3TS5 C;  3ZWH A;  4A4C A;  2BKI B;  2FCE A;  4YGB B;  1DGV A;  2WND A;  1BR1 B;  2NCO A;  1LKJ A;  1G8I A;  1SMG A;  1JC2 A;  2M8U A;  1QV0 A;  1TIZ A;  4MZL A;  1TN4 A;  4P2Y B;  1YRT B;  1KK7 Z;  1AJ4 A;  1N2D A;  2M0R A;  2NLN A;  1V1F A;  1J7R A;  3BUO B;  3RM1 A;  1BOC A;  1BU3 A;  2HPS A;  2BCX A;  4D1E A;  4YGD B;  1QAS A;  1R2U A;  2KGR A;  5ER5 A;  2KDH A;  3TUY C;  1QX2 A;  2H2K A;  2OS8 B;  2KBI A;  3O6B A;  4I5L B;  1XFY O;  1AVS A;  4OVN F;  1K90 D;  4Q04 A;  4PE7 A;  1N65 A;  3IQO A;  1AP4 A;  2KOT A;  4DS7 A;  5DKN A;  3OX6 A;  1CNP A;  1J55 A;  3BXK A;  1SR6 C;  3SG7 A;  1JWD A;  1YUT A;  5AER A;  1CTR A;  2JC2 A;  1FI6 A;  4MSP A;  2O5G A;  1F55 A;  1A03 A;  1QIV A;  3ZNI A;  3DF0 B;  2WC8 A;  4PE0 A;  4PDZ A;  1S6I A;  1NWD A;  1RTP 1;  1XVJ A;  4GAO A;  4PHM A;  1WRZ A;  2JNF A;  3TUY B;  2JNX A;  2LP3 A;  4CPV A;  1ALW A;  1OMV A;  1GGW A;  1Y1X A;  1JFK A;  1IJ5 A;  2F3Y A;  1RRO A;  1WLM A;  2E6W A;  3BUW B;  2A4J A;  1F8H A;  3WHU B;  1UHN A;  3VRN A;  5AFP A;  1XK4 C;  2LAP A;  4DIR A;  2SCP A;  1FF1 A;  4F0Z B;  2Q91 A;  2BE6 A;  2L51 A;  5F6T A;  1WDC C;  2F8P A;  4DUQ A;  1J1D A;  1TNW A;  4AQI A;  3VRR A;  2BL0 C;  2JTZ A;  2MLF C;  3VRQ A;  4DRW A;  1KK8 B;  1BT6 A;  2F33 A;  2HF5 A;  2LHI A;  2QPT A;  4I5N B;  2K7B A;  1ZUZ A;  1J1E A;  3KPX A;  2LMV A;  4CID A;  1CMG A;  2BEC A;  3I5I C;  1CFF A;  1IGV A;  2K8M B;  3WHT B;  1QAT A;  3BOW B;  1YVL A;  2K61 A;  1C7V A;  1RFJ A;  3JVT B;  1WDC B;  2JQ6 A;  1Y6W A;  2KAX A;  2BBM A;  5D7F A;  1H8B A;  2BL0 B;  1QVI Y;  1K8U A;  2AUC A;  2SAS A;  1UHJ A;  1BMO A;  4MZK A;  1SL9 A;  3EVU A;  3TDZ A;  1GGZ A;  1BG1 A;  4M2P A;  2LM5 A;  1CLL A;  1DJH A;  1HQV A;  1SBJ A;  1PSR A;  4NDD A;  2COL B;  3I5H C;  1EJ3 A;  4TNC A;  4GGF A;  1M31 A;  1DT7 B;  2LLS A;  1F4Q A;  3DD4 A;  3AAJ A;  1UHK A;  4CFQ A;  1YX7 A;  1CM1 A;  1SL8 A;  4YI8 A;  4N5X A;  3SIB A;  4PHK A;  1S26 D;  1Y1U A;  5DKR A;  1QXP A;  1U5I B;  1ZFS A;  2CNP A;  3OP0 A;  2KAV A;  5CSN A;  3NSK A;  2JT0 A;  5IBW A;  1SPY A;  1ZMZ A;  3D0Y B;  3QRX A;  2PSR A;  4ORC B;  1B8C A;  2VRG A;  4PHN A;  5I2Q A;  1EXR A;  1X02 A;  1VRK A;  1CB1 A;  1A75 B;  1GQM A;  2M29 A;  1ALV A;  1UUR A;  3O4Y A;  1KQM B;  1MUX A;  1W7J B;  2IS9 A;  3BUX B;  1QX7 A;  3SG6 A;  4PAL A;  1PVA A;  5JOL A;  2OTG B;  4GNK B;  1B47 A;  2JU0 A;  5KU1 A;  2L0P A;  1QLS A;  1MWN A;  3DVJ A;  2PAL A;  3K21 A;  3KEV A;  1Y0V H;  1TRF A;  1TNP A;  2LMT A;  1BF5 A;  2EHB A;  1NX0 A;  4FTG A;  4HRH A;  1IQ3 A;  1CDP A;  1XFW O;  4PHJ A;  4AOM A;  3DF0 A;  1QLK A;  1IQ5 A;  1S6C A;  3GK1 A;  4NDB A;  2M97 A;  4OR9 B;  3RLZ A;  4WRI A;  1S36 A;  4JPZ B;  2FOT A;  3SJS A;  2CXJ A;  1S5G Z;  1OZS A;  3D10 A;  3PAT A;  4ZCV A;  1AUI B;  2Y1M A;  1PAL A;  3PM8 A;  4MLW A;  2MAZ A;  3EVR A;  3PSR A;  2ZRT A;  4MRY A;  1OSA A;  1HT9 A;  1DJX A;  4R1E A;  1GJY A;  1S1E A;  2Y4Q A;  4HSZ A;  3PLF B;  3LCP C;  3TS5 B;  2OPO A;  2ZN9 A;  5ER4 X;  1ZAC A;  2LMU A;  3CR4 X;  3CTN A;  1JF0 A;  1J7P A;  2HET A;  2KI6 C;  2TN4 A;  2H61 A;  1DVI A;  3E3R A;  4P5O E;  1NYA A;  1TNQ A;  1JFJ A;  4C0J A;  1AHR A;  1RWY A;  2K7C A;  2RGI A;  1FPW A;  2KI6 D;  3BOW A;  1F71 A;  4ORA B;  3AKB A;  1Q80 A;  3EK4 A;  3CR5 X;  2L50 A;  3PAL A;  4M2O A;  1CDL A;  1DMO A;  2I2R E;  2ZFD A;  1FW4 A;  5BPJ A;  2Y1N A;  1K95 A;  1OZO A;  2I94 A;  4MZJ A;  3PN7 C;  1XFZ O;  1DTL A;  1KK7 Y;  3DVK A;  5G08 A;  1IWQ A;  1DF0 A;  4A4B A;  2M3W A;  4AQJ A;  5HKW A;  3NXA A;  2KAY A;  1DJI A;  1QV1 A;  1SR6 B;  1B7T Z;  2ZN8 A;  5TNC A;  2NXQ A;  3A4U B;  1AJ5 A;  2MJW B;  1SCV A;  2P6B B;  3OB2 B;  2K2A A;  3WXA A;  4MVF A;  2ZRS A;  1CFD A;  1IKU A;  1U5I A;  4FQO A;  5CSI A;  1NCZ A;  1SK6 D;  1K9P A;  4L9M A;  1SCM C;  1CFP A;  4IL1 A;  2F2O A;  2M49 B;  2M1K B;  2JWW A;  3GK4 X;  3PN7 B;  1KFU S;  1UWO A;  1QTX A;  5GQQ C;  3VRO A;  5K89 A;  1F54 A;  1C07 A;  1CDN A;  4GPL B;  1JBA A;  3AAK A;  1FI5 A;  2G9B A;  2K2F A;  1SNL A;  2KFH A;  1EH2 A;  2EC6 C;  4JQ0 D;  1KWO C;  5HKZ A;  4PE1 A;  2LVK A;  1FBV A;  4OKH A;  1B4C A;  3NSI A;  5I8N A;  2L5X B;  3DVE A;  3BQ3 A;  1XFX O;  2BE4 A;  3ICB A;  3C1V A;  1RJV A;  1DJY A;  2LVI A;  1M46 A;  3LK1 A;  1LA3 A;  2CBL A;  2GGZ A;  1TNX A;  1NX2 A;  1NUB A;  1RK9 A;  1TTX A;  1YX8 A;  1W7I B;  2LV7 A;  2MRD A;  2NCP A;  3I5I B;  4ORB B;  1F4O A;  3FWC A;  4XJK B;  3CLN A;  1F70 A;  1KQV A;  2KQY A;  1TCO B;  4C0K A;  3O2P A;  4YI9 A;  2EC6 B;  2MLE C;  4WQ2 A;  1EG4 A;  2PRU A;  2WCE A;  1XA5 A;  1H4B A;  2KYF A;  2BCA A;  1IRJ A;  1K93 D;  1CLB A;  1DJW A;  4PE4 A;  2HQ8 A;  5HYD A;  1L2O C;  4NDC A;  4PCW A;  3LL8 B;  1PSB A;  3I5F C;  2I7A A;  1M63 B;  1SRA A;  1LIN A;  2QAC A;  5HLV A;  3VRP A;  1MXE A;  1QS7 A;  1B1G A;  1C7W A;  3SIA A;  4U8D A;  1M45 A;  1WRL A;  1K2H A;  3I5H B;  2HQW A;  3O78 A;  1JUO A;  4QJ5 B;  1KFX S;  2Q4U A;  2KSP A;  4YRU A;  2LLT A;  5AXI A;  2JZI A;  2KFF A;  5AAN A;  5J3X A;  5I2O A;  3MSE B;  1NSH A;  2KI4 C;  3IF7 A;  1XFU O;  2EGD A;  2LAN A;  1B9A A;  2WOR A;  3LLE A;  1NX3 A;  3CS1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...