2LMVA

Androcam at high calcium with three explicit ca2+
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
147
structure length
147
Chain Sequence
b'SELTEEQIAEFKDAFVQFDKEGTGKIATRELGTLMRTLGQNPTEAELQDLIAEAENNNNGQLNFTEFCGIMAKQMRETDTEEEMREAFKIFDRDGDGFISPAELRFVMINLGEKVTDEEIDEMIREADFDGDGMINYEEFVWMISQK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Calmodulin-related protein 97A
publication title Structure of androcam supports specialized interactions with myosin VI.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Metal binding protein
total genus 44
structure length 147
sequence length 147
ec nomenclature
pdb deposition date 2011-12-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2lmvA01
2FCDA 1QS7A 1MXLC 1RFJA 2Y4QA 1FW4A 1S5GY 2F8PA 3BUMB 1KSMA 1QATA 4GNKB 2B1UA 3ZNIA 1B1GA 1PK0D 4I5NB 1JFKA 1B47A 2BL0C 2LLUA 1YX8A 2BKHB 1GJYA 1S1EA 2LMUA 2PSRA 3DF0B 2MAZA 1OZOA 3OX5A 3NXAA 1CFCA 4I5LB 5AEQA 4PHMA 1C7VA 4MZKA 1YVHA 1M31A 1EJ3A 1MF8B 5KSZA 4ICBA 1KCYA 1IQ3A 1JSAA 1DJIA 4PE7A 1QXPA 1F71A 1NCXA 1C7WA 3CGAA 2JXCA 2L50A 2EC6B 2ZNEA 1M39A 3SG5A 4PDZA 3C1VA 4PE1A 5AERA 2L2EA 1KQMC 2KBMA 2M0RA 4QJ3B 1CDLA 1QJTA 1CDMA 1TOPA 2I18A 3EVVA 3OHMB 1SYMA 4WRIA 2L51A 2Q91A 1B7TY 1NX3A 2LVJA 3K21A 3OB1B 3D0YA 4U8DA 4DCKA 1C07A 1FI6A 1S6JA 1LVCD 3TS5C 2MBXA 1KFUS 1XK4C 3O2PA 3H4SE 3RM1A 2QPTA 2KSPA 4CPVA 1PALA 3BYAA 4I5JA 2OS8B 1IQ5A 1OQPA 1CLLA 2I94A 2LP2A 1TTXA 2WORA 2L4IA 3OP0A 5CSIA 1CFFA 1WY9A 2LP3A 1DJZA 1J1DA 2CTNA 1UUSA 1BOCA 3BUWB 2Q4UA 2TN4A 1F54A 1PRWA 2JPTA 4ZCVA 5PALA 3WXAA 1RROA 1TIZA 1BF5A 2G9BA 1MXEA 1WLMA 1K94A 1TRFA 1QIWA 2NCPA 1UHKA 2L5XB 4ORAB 1DT7B 1SL8A 2LVKA 1HQVA 4PE4A 5CSNA 5ER5A 5I2LA 2KGBC 2KI6D 1JBAA 1JFJA 2AMIA 4MEWA 3SG4A 2JT3A 3FIAA 1PVAA 3CS1A 5D7FA 1UP5A 1D1OA 2I7AA 4P5OE 3VROA 4CFQA 4YRUA 2E30A 3LCPC 4R1EA 1MHOA 1ALWA 1OOJA 1QV1A 2AUCA 1YUSA 1WLZA 1A29A 2M49B 1K96A 1M46A 3A8RA 1SR6B 3DF0A 3I5FB 4YGCB 1R2UA 2LNKA 3KPXA 3AAKA 5KU1A 2OTGB 3DVJA 2BE4A 3EK4A 3BXKA 1TNXA 3TDUA 3BQ3A 4HREE 4GGNA 3VRQA 1UURA 3D10A 2KDHA 1HT9A 2K7DA 1KSOA 2LHLA 3WHUB 3SG6A 4ORCB 2HETA 5FYXA 4YGBB 1XK4A 2R2IA 1KK7Z 2CBLA 4P2YB 2NZ0A 1SMGA 1XYDA 1QLKA 1Y0VH 2WNDA 3I5GB 1JF2A 1YVLA 3VGOA 3I5IC 3O6BA 4MRYA 4PHJA 3E3RA 1TNQA 3EK8A 3KF9A 5GQQC 3AAJA 3AKBA 3PALA 2OTGC 3KHEA 1Y1XA 3MSEB 1J55A 1J7RA 1R6PA 1XVJA 2KQYA 2V53A 2MA2A 1CMGA 2LMTA 3TZ1A 3DVEA 1J7PA 1Y1UA 2K0JA 2PRUA 3DVMA 1AJ4A 2O5GA 4DUQA 4MZLA 3SIBA 4JPZB 4CIDA 5J3XA 1DJXA 1UWOA 2K2AA 3CTNA 4QJ4B 2F3YA 3BOWB 1AK8A 1LKJA 1PSBA 4A4CA 2JQ6A 1BG1A 5I2QA 1KWOB 4NQGA 5ER4X 1NWDA 2JOJA 3CR2A 2CNPA 3KEVA 1F4QA 1DJWA 1MUXA 2LUCA 1B8RA 1DJHA 2JC2A 2H61C 5AANA 1NX2A 2JNFA 4N1FA 5I2OA 4DS7A 1J1EA 1DF0B 2NCOA 1WRZA 2LMVA 1X02A 3VRPA 2M29A 1QX2A 3JTDB 1V1GA 1F55A 4PALA 5JJGA 1SBJA 1CMFA 2PMYA 1L2OB 1VRKA 2ZRTA 3TDZA 1RTP1 5AFPA 2WC8A 1UHJA 4GBAA 3SIAA 4C0KA 1QVIZ 1JC2A 3DD4A 3O4YA 3SG7A 5HLVA 1TCOB 1FBVA 2M9GA 3JVTB 1GGWA 2AAOA 1KK8B 1YUUA 2WCFA 1CLMA 2LANA 4FTGA 2M7LA 5K89A 3TUYB 1ODBA 1PVBA 1G4YR 2LM5A 2LVIA 4N1GA 3RLZA 2PASA 3PLFB 1KK7Y 2Y5IA 1M45A 1K93D 2BCXA 1CB1A 1JF0A 1LA0A 1XFXO 1MWNA 4IL1A 2KGRA 1NCYA 1QV0A 2BKIB 1SRAA 4PE0A 2M8UA 1QASA 3WHTB 2RGIA 2EC6C 1IG5A 2BE6A 4DRWA 1BLQA 1DMOA 2CCMA 2IS9A 3CR4X 4A4BA 2BBMA 2E6WA 2NXQA 1A03A 1UHHA 2ZFDA 1KFXL 4HSZA 2ZRSA 1KFXS 1IWQA 3GK2A 2L98A 2KOTA 1IRJA 5HKWA 1NYAA 2JNXA 1AUIB 3KO0A 1Y1AA 1TN4A 4NDCA 1TNWA 2H61A 3CZTX 1XFZO 2LHIA 5DKRA 1CNPA 4MBEA 1RWYA 1AJ5A 1G33A 2SASA 1DJYA 2L4HA 2F3ZA 1CTRA 1K9KA 2OS8C 2KYFA 1BU3A 2KI6C 3F45A 1BMOA 1IGVA 1NUBA 2KQ6A 2Y1NA 3BOWA 1SCVA 3GK4X 1SL9A 1XFVO 1QVIY 2M97A 3O78A 4BY5A 4YBHB 2JWWA 4XJKB 4Q04A 1ALVA 1UHIA 4DIRA 1B8CA 1IKUA 4ZCUA 1AHRA 1DF0A 1XO5A 1SL7A 4QJ5B 2PALA 2KNEA 2VRGA 1OSAA 1NSHA 2ZKMX 4GUKA 3QRXA 2JXLA 1CKKA 1DGVA 5JOLA 5HLOA 2OPOA 4YI8A 5CSFA 2JT8A 1AP4A 4ORBB 4E68A 3I5HB 1Q80A 1EL4A 1S26D 4M2QA 4USLA 4WQ2A 2F2PA 1ZACA 3EVUA 2KAYA 5HKZA 1SCMB 4N5XA 1FPWA 1IH0A 1GGZA 2FJUB 4MSPA 2MLFC 1IJ5A 5B8IB 1SR6C 1SY9A 2O60A 3I5FC 2K7BA 1N0YA 1WDCB 1FF1A 2HPSA 1NIWA 2FOTA 2MJWB 2HF5A 4AOMA 5DKQA 4YGAA 2KFFA 1A4PA 1XFWO 1M63B 3PATA 4GGFA 1YTZC 2KYCA 4MVFA 4CLNA 2ZNDA 1ZFSA 1PULA 1EH2A 1YR5A 4YI9A 4M2OA 1BR1B 1OMVA 1A2XA 2DOQA 2KI4B 3BUOB 1WRLA 1S3PA 3OB2B 1IJ6A 1K9UA 3I5GC 2GGMA 1BT6A 3SG2A 3NSLA 2JZIA 3BUNB 2BL0B 5IBWA 1WRKA 5BPJA 1GQMA 1CDPA 3CLNA 4ETOA 1SPYA 4OVNF 3SJSA 2K2FA 2KAXA 4L9MA 1CM1A 1CFDA 2COLB 2JULA 3OX6A 3PSRA 5AXIA 1YRTB 1NPQA 3LLEA 4MLWA 2ZN8A 2EHBA 4JQ0D 1MQ1A 1SKTA 1QIVA 1EXRA 2F33A 3EKHA 2LV7A 1A75B 1QX7A 1BR4B 1S6IA 2LUXA 4GPLB 1KWOC 2Y1MA 3IF7A 3PM8A 3FWBA 1CLBA 2WCBA 2LCPA 1KQMB 1UHNA 2K8MB 2CXJA 2MLEC 2JU0A 4PHNA 4MZJA 4XJKA 1CFPA 1N65A 4GFTA 3JTDC 1LXFC 1LINA 3VRRA 3BUXB 3NSOA 2HQWA 1L2OC 1OE9B 5CSJA 4CFRA 2M1UA 5G08A 4HRHA 1G8IA 3TS5B 1U5IB 3GK1A 1QTXA 1W7IB 4GAOA 1QLSA 1NP8A 1TCFA 3IQOA 3LK0A 4PCWA 1BJFA 5HKYA 1OMRA 2LC5A 3JVTC 3ZWHA 5DKNA 1KK8C 1RK9A 3TDIA 2MHHA 4FQOA 5D69A 1E8AA 1CM4A 4M2PA 1YURA 2P6BB 1QX5B 3TUYC 2LLSA 2NLNA 3CWGA 4OCIA 1ZUZA 3IQQA 2LAPA 3FWCA 4GGFC 4NDBA 4AQJA 5I8NA 4MRXA 1B9AA 1KFUL 2HQ8A 4OV2A 2GGZA 4I5KA 2LVVA 4BY4A 3EVRA 1N2DA 1V1FA 1K95A 2BCAA 1AVSA 1EG4A 1DVIA 5KTYA 2F2OA 2FCEA 3GOFA 2LE9B 1JWDA 1YRUB 2K7OA 5TNCA 3A4UB 2D8NA 3CR5X 1SNLA 4F0ZB 4C0LA 1B4CA 2JTZA 1DTLA 3NSKA 2KBIA 1OZSA 4UPGA 1RJVA 4D1EA 2M7NA 2MRDA 5CPVA 3EK7A 1F70A 2KAVA 1PSRA 2BCBA 1FI5A 3DVKA 1SK6D 3LK1A 1S5GZ 1ZMZA 2K61A 2LLTA 1TNPA 3PFVA 1XFUO 4YGDB 1OMDA 2SCPA 2KFGA 1F4OA 1H8BA 4JWQA 3VRNA 2BBNA 4YGEB 2GV5A 1J7OA 3NSIA 1A75A 1YX7A 1BODA 2A4JA 3PN7B 1YUTA 2EGDA 2L0PA 4HRGA 2KFHA 3LL8B 3I5IB 3WNXB 1MR8A 1K9PA 1NX1A 2I2RE 1W7JB 1H4BA 1L7ZA 4PHKA 3D0YB 3SG3A 1CDNA 1S36A 1S6CA 2H2KA 1DJGA 2KHNA 3ICBA 1J7QA 1K2HA 1K90D 2QACA 4OKHA 5HYDA 1K8UA 2WCEA 3HCMA 1U5IA 4TNCA 2WOSA 3I5HC 1NX0A 2ISDA 4XYNA 2JRFA 2K7CA 3EKJA 3PN7C 2G2BA 1ZOTB 1NCZA 4MN0A 1F8HA 1SCMC 5F6TA 1B7TZ 2JTTA 1KQVA 2JT0A 1B8LA 2M1KB 1EG3A 2PVBA 1XFYO 1WDCC 3M0WA 4OR9B 1XA5A 1SW8A 3HX4A 2M3WA 1RECA 4WQ3A 2ZN9A 2CT9A 4AQIA 4NDDA 1JUOA 1LA3A 2KI4C 3AKAA 2BECA 1DGUA 1Y6WA 3FS7A 4C0JA
chains in the Genus database with same CATH superfamily
2FCDA 1QS7A 1MXLC 1RFJA 2Y4QA 1FW4A 1S5GY 2F8PA 3BFBA 3BUMB 3L4LA 1KSMA 1QATA 4GNKB 2B1UA 3ZNIA 1B1GA 1PK0D 4I5NB 1JFKA 1B47A 2BL0C 2LLUA 1YX8A 2BKHB 1GJYA 1S1EA 2LMUA 2PSRA 3DF0B 2MAZA 3SS4A 1OZOA 3OX5A 3NXAA 1LS8A 1CFCA 4I5LB 5AEQA 4PHMA 4INWA 1C7VA 4MZKA 3SS3A 1YVHA 1M31A 1EJ3A 1MF8B 5KSZA 4ICBA 2QEHA 1KCYA 1IQ3A 1JSAA 1DJIA 1W9ZA 1QXPA 4PE7A 1F71A 1NCXA 1C7WA 3CGAA 2JXCA 2L50A 2EC6B 3S0EA 2ZNEA 3R1VA 1M39A 3SG5A 4PDZA 3C1VA 4PE1A 2H8VA 5AERA 2L2EA 1KQMC 3CZ2A 2KBMA 2M0RA 4QJ3B 1CDLA 1QJTA 1CDMA 1TOPA 3D77A 2I18A 3EVVA 1C3ZA 1SYMA 3OHMB 4WRIA 2L51A 3D76A 2Q91A 1B7TY 1NX3A 2LVJA 1DQEA 3K21A 3OB1B 3D0YA 4U8DA 3L47A 4DCKA 3RZSA 1C07A 1FI6A 1S6JA 3NHIA 1LVCD 3TS5C 3PM2A 2MBXA 1KFUS 3N7HA 1XK4C 3O2PA 3H4SE 3RM1A 2QPTA 2KSPA 4CPVA 1PALA 3BYAA 4I5JA 3SS5A 1SSEB 2OS8B 1IQ5A 3DYEA 1OQPA 1CLLA 2I94A 2LP2A 1TTXA 2WORA 2L4IA 3OP0A 5CSIA 1CFFA 1WY9A 2LP3A 1DJZA 1J1DA 2CTNA 1UUSA 1BOCA 2WC6A 3BUWB 2Q4UA 2TN4A 1F54A 1PRWA 2JPTA 4ZCVA 5PALA 3WXAA 1RROA 1TIZA 1BF5A 2G9BA 3S0BA 1MXEA 1WLMA 2QDIA 1K94A 1TRFA 1QIWA 2NCPA 1UHKA 2L5XB 3CZ0A 3D75A 4ORAB 1SL8A 1DT7B 2LVKA 1HQVA 4PE4A 5CSNA 5ER5A 5I2LA 2KGBC 2KI6D 1JBAA 1JFJA 2AMIA 4MEWA 1TUJA 1OOGA 2JT3A 3FIAA 3SG4A 1PVAA 3CS1A 5D7FA 2FJYA 1UP5A 1D1OA 2I7AA 4P5OE 3VROA 3DXLA 4CFQA 4YRUA 2E30A 3LCPC 4R1EA 1MHOA 1ALWA 1OOJA 1QV1A 2AUCA 1YUSA 1WLZA 1A29A 4OZDA 3FE8A 2M49B 1K96A 1M46A 3A8RA 1SR6B 3DF0A 3I5FB 4YGCB 1R2UA 2LNKA 3KPXA 3AAKA 5KU1A 2OTGB 3DVJA 2BE4A 3EK4A 3BXKA 1TNXA 3TDUA 3BQ3A 4HREE 4GGNA 3VRQA 1UURA 3D10A 2KDHA 1HT9A 2K7DA 1KSOA 2LHLA 2QEVA 3OBVA 3WHUB 3SG6A 3Q8IA 2HETA 4ORCB 5FYXA 4YGBB 1XK4A 2R2IA 1KK7Z 2CBLA 1DELA 2NZ0A 1OW4A 4P2YB 1SMGA 1XYDA 1QLKA 1Y0VH 2WNDA 3I5GB 3CYZA 1JF2A 1YVLA 3VGOA 3I5IC 3O6BA 4MRYA 4PHJA 3E3RA 1TNQA 3EK8A 3KF9A 5D3OA 5GQQC 3AAJA 3AKBA 3PALA 3R1OA 2OTGC 3KHEA 2BAPA 3S0GA 1Y1XA 3S0FA 3MSEB 3O4XA 3D73A 1J55A 1J7RA 1R6PA 1XVJA 2KQYA 2V53A 2MA2A 1CMGA 2LMTA 3TZ1A 3DVEA 1J7PA 1Y1UA 2K0JA 2PRUA 3DVMA 1AJ4A 2O5GA 3PJIA 4DUQA 4MZLA 3SIBA 4JPZB 4CIDA 5J3XA 1DJXA 1UWOA 2K2AA 3CTNA 4QJ4B 2F3YA 3BOWB 1AK8A 1LKJA 1PSBA 4A4CA 2JQ6A 1BG1A 5I2QA 1KWOB 2QEOA 4NQGA 5ER4X 1NWDA 2JOJA 3CR2A 2CNPA 3KEVA 1F4QA 1DJWA 1MUXA 2LUCA 1B8RA 1DJHA 2JC2A 2H61C 5AANA 1NX2A 2JNFA 4N1FA 5I2OA 4DS7A 1J1EA 1DF0B 2NCOA 1WRZA 2LMVA 1X02A 3VRPA 2M29A 1QX2A 3JTDB 1V1GA 1F55A 4PALA 5JJGA 1SBJA 1QWVA 1CMFA 2PMYA 1L2OB 1VRKA 2ZRTA 3TDZA 1RTP1 5AFPA 2WC8A 1UHJA 4GBAA 3SIAA 4C0KA 1QVIZ 1JC2A 3DD4A 3O4YA 3SG7A 5HLVA 1TCOB 3V2LA 1FBVA 2M9GA 5I94A 3JVTB 3B7AA 1GGWA 2AAOA 1KK8B 1YUUA 2WCFA 1CLMA 2LANA 4FTGA 2M7LA 5K89A 3TUYB 5HL1A 1ODBA 1PVBA 1G4YR 2LM5A 2LVIA 4N1GA 3R1PA 3RLZA 2PASA 3PLFB 1KK7Y 2Y5IA 1M45A 1K93D 2BCXA 1CB1A 1JF0A 1LA0A 1XFXO 1MWNA 4IL1A 2KGRA 1NCYA 1QV0A 2P71A 2BKIB 1SRAA 4PE0A 2M8UA 1QASA 3WHTB 2RGIA 2EC6C 3VB1A 1IG5A 2BE6A 4DRWA 1BLQA 3K1EA 1DMOA 2CCMA 2IS9A 3CR4X 4A4BA 2BBMA 2E6WA 2NXQA 1A03A 1UHHA 2ZFDA 1KFXL 4HSZA 2ZRSA 1KFXS 1IWQA 3GK2A 2L98A 2KOTA 1IRJA 5HKWA 1NYAA 2JNXA 2WCJA 1AUIB 3KO0A 1Y1AA 1TN4A 4NDCA 1TNWA 2H61A 3CZTX 1XFZO 2LHIA 5DKRA 1CNPA 4MBEA 1RWYA 1AJ5A 1G33A 1GM0A 2SASA 1DJYA 2L4HA 2F3ZA 1CTRA 2KPHA 3CZ1A 1K9KA 2OS8C 2KYFA 1BU3A 4KYNA 5DICA 2KI6C 3F45A 1BMOA 1IGVA 1NUBA 2KQ6A 2WCHA 2Y1NA 1IIOA 3BOWA 1SCVA 4JKTA 1OOHA 1SL9A 3GK4X 1XFVO 1QVIY 2M97A 3L4AA 3O78A 4BY5A 4YBHB 2JWWA 4XJKB 4Q04A 1ALVA 1UHIA 4DIRA 1B8CA 1IKUA 4ZCUA 3S0DA 1AHRA 1DF0A 1TWOA 1XO5A 1SL7A 4QJ5B 2PALA 2KNEA 2VRGA 1OSAA 1NSHA 2ZKMX 4GUKA 3QRXA 2JXLA 3BFAA 1CKKA 1DGVA 5JOLA 5HLOA 3B6XA 2OPOA 4YI8A 5CSFA 2JT8A 1AP4A 4ORBB 4E68A 3I5HB 1Q80A 1EL4A 1S26D 4M2QA 4USLA 4WQ2A 2F2PA 1ZACA 3EVUA 2KAYA 5HKZA 1SCMB 4N5XA 1FPWA 1IH0A 1GGZA 2FJUB 4MSPA 2MLFC 1IJ5A 5B8IB 1SR6C 1SY9A 2O60A 3I5FC 2K7BA 1N0YA 1WDCB 1FF1A 2HPSA 1NIWA 2FOTA 2MJWB 2HF5A 4AOMA 5DKQA 4YGAA 2KFFA 1A4PA 1XFWO 1M63B 3PATA 4GGFA 1YTZC 2KYCA 2K60A 4MVFA 4CLNA 2ZNDA 1ZFSA 1PULA 1EH2A 3FE6A 1OOIX 1YR5A 3B87A 2PYQA 1BR1B 1OMVA 4M2OA 4YI9A 1A2XA 2DOQA 2KI4B 3UNWA 3BUOB 1WRLA 1S3PA 3OB2B 1IJ6A 1K9UA 4F7FA 3I5GC 2GGMA 1BT6A 3NGVA 3SG2A 3NSLA 2JZIA 2P70A 2BL0B 3BUNB 1WRKA 3NHTA 1GQMA 1CDPA 5BPJA 5IBWA 2L2CA 3CLNA 3QMEA 4FQTA 1SPYA 4OVNF 3SJSA 4ETOA 2K2FA 2KAXA 4L9MA 1CM1A 1CFDA 2COLB 2JULA 2YGUA 3OX6A 3PSRA 3BJHA 5AXIA 1YRTB 1NPQA 3LLEA 4MLWA 2ZN8A 2EHBA 4JQ0D 1MQ1A 1SKTA 1QIVA 1EXRA 2F33A 3EKHA 2LV7A 1DC1A 1A75B 1QX7A 1BR4B 1OOFA 1S6IA 2LUXA 4GPLB 1KWOC 2Y1MA 3IF7A 3PM8A 3FWBA 2WC5A 3D74A 1CLBA 2WCBA 5FI7A 2LCPA 1KQMB 1UHNA 2K8MB 2CXJA 2MLEC 2JU0A 4PHNA 4MZJA 4XJKA 1CFPA 1N65A 4GFTA 3JTDC 1LXFC 1LINA 3VRRA 3BUXB 3NSOA 2HQWA 1L2OC 1OE9B 2PQLA 5CSJA 4CFRA 2M1UA 5G08A 4HRHA 1G8IA 3TS5B 1U5IB 3GK1A 1QTXA 1W7IB 3CDNA 4IJ7A 4GAOA 1QLSA 1NP8A 1TCFA 3IQOA 3LK0A 4PCWA 1BJFA 5HKYA 1OMRA 2LC5A 3JVTC 2KLDA 3ZWHA 5DKNA 1KK8C 1RK9A 3TDIA 2MHHA 4FQOA 5D69A 5EL2A 1E8AA 1CM4A 4M2PA 1YURA 2P6BB 1QX5B 3TUYC 2LLSA 2NLNA 4JD9A 3CWGA 2QEBA 4OCIA 1ZUZA 3IQQA 2LAPA 3FWCA 3IVTA 4GGFC 1P28A 4NDBA 4AQJA 1Z4HA 5I8NA 4MRXA 1B9AA 1KFUL 2HQ8A 3R72A 4OV2A 2GGZA 4I5KA 2LVVA 4BY4A 3EVRA 1N2DA 1V1FA 1K95A 2BCAA 3D78A 1AVSA 2WCKA 1EG4A 1DVIA 5KTYA 1DEKA 2F2OA 3S0AA 2FCEA 3B88A 2LE9B 3GOFA 1JWDA 1YRUB 2K7OA 5TNCA 1T14A 3A4UB 2D8NA 3CR5X 1SNLA 4F0ZB 4C0LA 1B4CA 2JTZA 1DTLA 3NSKA 2KBIA 1OZSA 4UPGA 1RJVA 1XFRA 3EG5B 4D1EA 2M7NA 2MRDA 5CPVA 3EK7A 1F70A 2KAVA 1PSRA 5FI2A 2BCBA 1FI5A 3DVKA 1SK6D 3LK1A 1S5GZ 1ZMZA 2K61A 2LLTA 1TNPA 3PFVA 1XFUO 4YGDB 2WCMA 1OMDA 2SCPA 2KFGA 1F4OA 1H8BA 4JWQA 3VRNA 2BBNA 4YGEB 2GV5A 1J7OA 1C3YA 3NSIA 1A75A 2WCLA 1YX7A 2L5YA 3CABA 1BODA 2A4JA 3PN7B 1YUTA 2EGDA 2L0PA 4HRGA 2KFHA 3LL8B 3I5IB 3WNXB 1MR8A 3FE9A 1K9PA 2GTEA 1NX1A 5FI6A 2I2RE 1W7JB 3BFHA 1H4BA 1L7ZA 4PHKA 3D0YB 3SG3A 4PT1A 1CDNA 1S36A 1S6CA 2H2KA 1DJGA 2KHNA 3ICBA 1J7QA 1K2HA 1K90D 2QACA 2ERBA 4OKHA 5HYDA 1K8UA 2WCEA 3HCMA 1U5IA 4TNCA 2WOSA 3I5HC 1NX0A 2ISDA 2JPOA 4XYNA 2JRFA 1Z2CB 2K7CA 3EKJA 3PN7C 2G2BA 1ZOTB 1NCZA 4MN0A 1F8HA 1SCMC 5F6TA 1TUZA 1B7TZ 4INXA 2JTTA 1KQVA 2JT0A 1B8LA 2M1KB 1EG3A 2PVBA 1XFYO 3OGNA 2KLEA 1WDCC 3DY9A 3M0WA 4OR9B 1XA5A 1ORGA 1SW8A 3HX4A 2M3WA 1RECA 4WQ3A 3DZTA 2ZN9A 2CT9A 4AQIA 2BNXA 4NDDA 3UO9A 1JUOA 1LA3A 2KI4C 3AKAA 3B86A 2BECA 1DGUA 1Y6WA 3FS7A 4C0JA
chains in the Genus database with same CATH topology
2FCDA 1QS7A 1MXLC 1RFJA 2Y4QA 1FW4A 1S5GY 2F8PA 3BUMB 1KSMA 1QATA 4GNKB 2B1UA 3ZNIA 1B1GA 1PK0D 4I5NB 1JFKA 1B47A 2BL0C 2LLUA 1YX8A 2BKHB 1GJYA 1S1EA 2LMUA 2PSRA 3DF0B 2MAZA 1OZOA 3OX5A 3NXAA 1CFCA 4I5LB 5AEQA 4PHMA 1C7VA 4MZKA 1YVHA 1M31A 1EJ3A 1MF8B 5KSZA 4ICBA 1KCYA 1IQ3A 1JSAA 1DJIA 4PE7A 1QXPA 1F71A 1NCXA 1C7WA 3CGAA 2JXCA 2L50A 2EC6B 2ZNEA 1M39A 3SG5A 4PDZA 3C1VA 4PE1A 5AERA 2L2EA 1KQMC 2KBMA 2M0RA 4QJ3B 1CDLA 1QJTA 1CDMA 1TOPA 2I18A 3EVVA 3OHMB 1SYMA 4WRIA 2L51A 2Q91A 1B7TY 1NX3A 2LVJA 3K21A 3OB1B 3D0YA 4U8DA 4DCKA 1C07A 1FI6A 1S6JA 1LVCD 3TS5C 2MBXA 1KFUS 1XK4C 3O2PA 3H4SE 3RM1A 2QPTA 2KSPA 4CPVA 1PALA 3BYAA 4I5JA 2OS8B 1IQ5A 1OQPA 1CLLA 2I94A 2LP2A 1TTXA 2WORA 2L4IA 3OP0A 5CSIA 1CFFA 1WY9A 2LP3A 1DJZA 1J1DA 2CTNA 1UUSA 1BOCA 3BUWB 2Q4UA 2TN4A 1F54A 1PRWA 2JPTA 4ZCVA 5PALA 3WXAA 1RROA 1TIZA 1BF5A 2G9BA 1MXEA 1WLMA 1K94A 1TRFA 1QIWA 2NCPA 1UHKA 2L5XB 4ORAB 1DT7B 1SL8A 2LVKA 1HQVA 4PE4A 5CSNA 5ER5A 5I2LA 2KGBC 2KI6D 1JBAA 1JFJA 2AMIA 4MEWA 3SG4A 2JT3A 3FIAA 1PVAA 3CS1A 5D7FA 1UP5A 1D1OA 2I7AA 4P5OE 3VROA 4CFQA 4YRUA 2E30A 3LCPC 4R1EA 1MHOA 1ALWA 1OOJA 1QV1A 2AUCA 1YUSA 1WLZA 1A29A 2M49B 1K96A 1M46A 3A8RA 1SR6B 3DF0A 3I5FB 4YGCB 1R2UA 2LNKA 3KPXA 3AAKA 5KU1A 2OTGB 3DVJA 2BE4A 3EK4A 3BXKA 1TNXA 3TDUA 3BQ3A 4HREE 4GGNA 3VRQA 1UURA 3D10A 2KDHA 1HT9A 2K7DA 1KSOA 2LHLA 3WHUB 3SG6A 4ORCB 2HETA 5FYXA 4YGBB 1XK4A 2R2IA 1KK7Z 2CBLA 4P2YB 2NZ0A 1SMGA 1XYDA 1QLKA 1Y0VH 2WNDA 3I5GB 1JF2A 1YVLA 3VGOA 3I5IC 3O6BA 4MRYA 4PHJA 3E3RA 1TNQA 3EK8A 3KF9A 5GQQC 3AAJA 3AKBA 3PALA 2OTGC 3KHEA 1Y1XA 3MSEB 1J55A 1J7RA 1R6PA 1XVJA 2KQYA 2V53A 2MA2A 1CMGA 2LMTA 3TZ1A 3DVEA 1J7PA 1Y1UA 2K0JA 2PRUA 3DVMA 1AJ4A 2O5GA 4DUQA 4MZLA 3SIBA 4JPZB 4CIDA 5J3XA 1DJXA 1UWOA 2K2AA 3CTNA 4QJ4B 2F3YA 3BOWB 1AK8A 1LKJA 1PSBA 4A4CA 2JQ6A 1BG1A 5I2QA 1KWOB 4NQGA 5ER4X 1NWDA 2JOJA 3CR2A 2CNPA 3KEVA 1F4QA 1DJWA 1MUXA 2LUCA 1B8RA 1DJHA 2JC2A 2H61C 5AANA 1NX2A 2JNFA 4N1FA 5I2OA 4DS7A 1J1EA 1DF0B 2NCOA 1WRZA 2LMVA 1X02A 3VRPA 2M29A 1QX2A 3JTDB 1V1GA 1F55A 4PALA 5JJGA 1SBJA 1CMFA 2PMYA 1L2OB 1VRKA 2ZRTA 3TDZA 1RTP1 5AFPA 2WC8A 1UHJA 4GBAA 3SIAA 4C0KA 1QVIZ 1JC2A 3DD4A 3O4YA 3SG7A 5HLVA 1TCOB 1FBVA 2M9GA 3JVTB 1GGWA 2AAOA 1KK8B 1YUUA 2WCFA 1CLMA 2LANA 4FTGA 2M7LA 5K89A 3TUYB 1ODBA 1PVBA 1G4YR 2LM5A 2LVIA 4N1GA 3RLZA 2PASA 3PLFB 1KK7Y 2Y5IA 1M45A 1K93D 2BCXA 1CB1A 1JF0A 1LA0A 1XFXO 1MWNA 4IL1A 2KGRA 1NCYA 1QV0A 2BKIB 1SRAA 4PE0A 2M8UA 1QASA 3WHTB 2RGIA 2EC6C 1IG5A 2BE6A 4DRWA 1BLQA 1DMOA 2CCMA 2IS9A 3CR4X 4A4BA 2BBMA 2E6WA 2NXQA 1A03A 1UHHA 2ZFDA 1KFXL 4HSZA 2ZRSA 1KFXS 1IWQA 3GK2A 2L98A 2KOTA 1IRJA 5HKWA 1NYAA 2JNXA 1AUIB 3KO0A 1Y1AA 1TN4A 4NDCA 1TNWA 2H61A 3CZTX 1XFZO 2LHIA 5DKRA 1CNPA 4MBEA 1RWYA 1AJ5A 1G33A 2SASA 1DJYA 2L4HA 2F3ZA 1CTRA 1K9KA 2OS8C 2KYFA 1BU3A 2KI6C 3F45A 1BMOA 1IGVA 1NUBA 2KQ6A 2Y1NA 3BOWA 1SCVA 3GK4X 1SL9A 1XFVO 1QVIY 2M97A 3O78A 4BY5A 4YBHB 2JWWA 4XJKB 4Q04A 1ALVA 1UHIA 4DIRA 1B8CA 1IKUA 4ZCUA 1AHRA 1DF0A 1XO5A 1SL7A 4QJ5B 2PALA 2KNEA 2VRGA 1OSAA 1NSHA 2ZKMX 4GUKA 3QRXA 2JXLA 1CKKA 1DGVA 5JOLA 5HLOA 2OPOA 4YI8A 5CSFA 2JT8A 1AP4A 4ORBB 4E68A 3I5HB 1Q80A 1EL4A 1S26D 4M2QA 4USLA 4WQ2A 2F2PA 1ZACA 3EVUA 2KAYA 5HKZA 1SCMB 4N5XA 1FPWA 1IH0A 1GGZA 2FJUB 4MSPA 2MLFC 1IJ5A 5B8IB 1SR6C 1SY9A 2O60A 3I5FC 2K7BA 1N0YA 1WDCB 1FF1A 2HPSA 1NIWA 2FOTA 2MJWB 2HF5A 4AOMA 5DKQA 4YGAA 2KFFA 1A4PA 1XFWO 1M63B 3PATA 4GGFA 1YTZC 2KYCA 4MVFA 4CLNA 2ZNDA 1ZFSA 1PULA 1EH2A 1YR5A 4YI9A 4M2OA 1BR1B 1OMVA 1A2XA 2DOQA 2KI4B 3BUOB 1WRLA 1S3PA 3OB2B 1IJ6A 1K9UA 3I5GC 2GGMA 1BT6A 3SG2A 3NSLA 2JZIA 3BUNB 2BL0B 5IBWA 1WRKA 5BPJA 1GQMA 1CDPA 3CLNA 4ETOA 1SPYA 4OVNF 3SJSA 2K2FA 2KAXA 4L9MA 1CM1A 1CFDA 2COLB 2JULA 3OX6A 3PSRA 5AXIA 1YRTB 1NPQA 3LLEA 4MLWA 2ZN8A 2EHBA 4JQ0D 1MQ1A 1SKTA 1QIVA 1EXRA 2F33A 3EKHA 2LV7A 1A75B 1QX7A 1BR4B 1S6IA 2LUXA 4GPLB 1KWOC 2Y1MA 3IF7A 3PM8A 3FWBA 1CLBA 2WCBA 2LCPA 1KQMB 1UHNA 2K8MB 2CXJA 2MLEC 2JU0A 4PHNA 4MZJA 4XJKA 1CFPA 1N65A 4GFTA 3JTDC 1LXFC 1LINA 3VRRA 3BUXB 3NSOA 2HQWA 1L2OC 1OE9B 5CSJA 4CFRA 2M1UA 5G08A 4HRHA 1G8IA 3TS5B 1U5IB 3GK1A 1QTXA 1W7IB 4GAOA 1QLSA 1NP8A 1TCFA 3IQOA 3LK0A 4PCWA 1BJFA 5HKYA 1OMRA 2LC5A 3JVTC 3ZWHA 5DKNA 1KK8C 1RK9A 3TDIA 2MHHA 4FQOA 5D69A 1E8AA 1CM4A 4M2PA 1YURA 2P6BB 1QX5B 3TUYC 2LLSA 2NLNA 3CWGA 4OCIA 1ZUZA 3IQQA 2LAPA 3FWCA 4GGFC 4NDBA 4AQJA 5I8NA 4MRXA 1B9AA 1KFUL 2HQ8A 4OV2A 2GGZA 4I5KA 2LVVA 4BY4A 3EVRA 1N2DA 1V1FA 1K95A 2BCAA 1AVSA 1EG4A 1DVIA 5KTYA 2F2OA 2FCEA 3GOFA 2LE9B 1JWDA 1YRUB 2K7OA 5TNCA 3A4UB 2D8NA 3CR5X 1SNLA 4F0ZB 4C0LA 1B4CA 2JTZA 1DTLA 3NSKA 2KBIA 1OZSA 4UPGA 1RJVA 4D1EA 2M7NA 2MRDA 5CPVA 3EK7A 1F70A 2KAVA 1PSRA 2BCBA 1FI5A 3DVKA 1SK6D 3LK1A 1S5GZ 1ZMZA 2K61A 2LLTA 1TNPA 3PFVA 1XFUO 4YGDB 1OMDA 2SCPA 2KFGA 1F4OA 1H8BA 4JWQA 3VRNA 2BBNA 4YGEB 2GV5A 1J7OA 3NSIA 1A75A 1YX7A 1BODA 2A4JA 3PN7B 1YUTA 2EGDA 2L0PA 4HRGA 2KFHA 3LL8B 3I5IB 3WNXB 1MR8A 1K9PA 1NX1A 2I2RE 1W7JB 1H4BA 1L7ZA 4PHKA 3D0YB 3SG3A 1CDNA 1S36A 1S6CA 2H2KA 1DJGA 2KHNA 3ICBA 1J7QA 1K2HA 1K90D 2QACA 4OKHA 5HYDA 1K8UA 2WCEA 3HCMA 1U5IA 4TNCA 2WOSA 3I5HC 1NX0A 2ISDA 4XYNA 2JRFA 2K7CA 3EKJA 3PN7C 2G2BA 1ZOTB 1NCZA 4MN0A 1F8HA 1SCMC 5F6TA 1B7TZ 2JTTA 1KQVA 2JT0A 1B8LA 2M1KB 1EG3A 2PVBA 1XFYO 1WDCC 3M0WA 4OR9B 1XA5A 1SW8A 3HX4A 2M3WA 1RECA 4WQ3A 2ZN9A 2CT9A 4AQIA 4NDDA 1JUOA 1LA3A 2KI4C 3AKAA 2BECA 1DGUA 1Y6WA 3FS7A 4C0JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FCD A;  1QS7 A;  1MXL C;  1RFJ A;  2Y4Q A;  1FW4 A;  1S5G Y;  2F8P A;  3BUM B;  1KSM A;  1QAT A;  4GNK B;  2B1U A;  3ZNI A;  1B1G A;  1PK0 D;  4I5N B;  1JFK A;  1B47 A;  2BL0 C;  2LLU A;  1YX8 A;  2BKH B;  1GJY A;  1S1E A;  2LMU A;  2PSR A;  3DF0 B;  2MAZ A;  1OZO A;  3OX5 A;  3NXA A;  1CFC A;  4I5L B;  5AEQ A;  4PHM A;  1C7V A;  4MZK A;  1YVH A;  1M31 A;  1EJ3 A;  1MF8 B;  5KSZ A;  4ICB A;  1KCY A;  1IQ3 A;  1JSA A;  1DJI A;  4PE7 A;  1QXP A;  1F71 A;  1NCX A;  1C7W A;  3CGA A;  2JXC A;  2L50 A;  2EC6 B;  2ZNE A;  1M39 A;  3SG5 A;  4PDZ A;  3C1V A;  4PE1 A;  5AER A;  2L2E A;  1KQM C;  2KBM A;  2M0R A;  4QJ3 B;  1CDL A;  1QJT A;  1CDM A;  1TOP A;  2I18 A;  3EVV A;  3OHM B;  1SYM A;  4WRI A;  2L51 A;  2Q91 A;  1B7T Y;  1NX3 A;  2LVJ A;  3K21 A;  3OB1 B;  3D0Y A;  4U8D A;  4DCK A;  1C07 A;  1FI6 A;  1S6J A;  1LVC D;  3TS5 C;  2MBX A;  1KFU S;  1XK4 C;  3O2P A;  3H4S E;  3RM1 A;  2QPT A;  2KSP A;  4CPV A;  1PAL A;  3BYA A;  4I5J A;  2OS8 B;  1IQ5 A;  1OQP A;  1CLL A;  2I94 A;  2LP2 A;  1TTX A;  2WOR A;  2L4I A;  3OP0 A;  5CSI A;  1CFF A;  1WY9 A;  2LP3 A;  1DJZ A;  1J1D A;  2CTN A;  1UUS A;  1BOC A;  3BUW B;  2Q4U A;  2TN4 A;  1F54 A;  1PRW A;  2JPT A;  4ZCV A;  5PAL A;  3WXA A;  1RRO A;  1TIZ A;  1BF5 A;  2G9B A;  1MXE A;  1WLM A;  1K94 A;  1TRF A;  1QIW A;  2NCP A;  1UHK A;  2L5X B;  4ORA B;  1DT7 B;  1SL8 A;  2LVK A;  1HQV A;  4PE4 A;  5CSN A;  5ER5 A;  5I2L A;  2KGB C;  2KI6 D;  1JBA A;  1JFJ A;  2AMI A;  4MEW A;  3SG4 A;  2JT3 A;  3FIA A;  1PVA A;  3CS1 A;  5D7F A;  1UP5 A;  1D1O A;  2I7A A;  4P5O E;  3VRO A;  4CFQ A;  4YRU A;  2E30 A;  3LCP C;  4R1E A;  1MHO A;  1ALW A;  1OOJ A;  1QV1 A;  2AUC A;  1YUS A;  1WLZ A;  1A29 A;  2M49 B;  1K96 A;  1M46 A;  3A8R A;  1SR6 B;  3DF0 A;  3I5F B;  4YGC B;  1R2U A;  2LNK A;  3KPX A;  3AAK A;  5KU1 A;  2OTG B;  3DVJ A;  2BE4 A;  3EK4 A;  3BXK A;  1TNX A;  3TDU A;  3BQ3 A;  4HRE E;  4GGN A;  3VRQ A;  1UUR A;  3D10 A;  2KDH A;  1HT9 A;  2K7D A;  1KSO A;  2LHL A;  3WHU B;  3SG6 A;  4ORC B;  2HET A;  5FYX A;  4YGB B;  1XK4 A;  2R2I A;  1KK7 Z;  2CBL A;  4P2Y B;  2NZ0 A;  1SMG A;  1XYD A;  1QLK A;  1Y0V H;  2WND A;  3I5G B;  1JF2 A;  1YVL A;  3VGO A;  3I5I C;  3O6B A;  4MRY A;  4PHJ A;  3E3R A;  1TNQ A;  3EK8 A;  3KF9 A;  5GQQ C;  3AAJ A;  3AKB A;  3PAL A;  2OTG C;  3KHE A;  1Y1X A;  3MSE B;  1J55 A;  1J7R A;  1R6P A;  1XVJ A;  2KQY A;  2V53 A;  2MA2 A;  1CMG A;  2LMT A;  3TZ1 A;  3DVE A;  1J7P A;  1Y1U A;  2K0J A;  2PRU A;  3DVM A;  1AJ4 A;  2O5G A;  4DUQ A;  4MZL A;  3SIB A;  4JPZ B;  4CID A;  5J3X A;  1DJX A;  1UWO A;  2K2A A;  3CTN A;  4QJ4 B;  2F3Y A;  3BOW B;  1AK8 A;  1LKJ A;  1PSB A;  4A4C A;  2JQ6 A;  1BG1 A;  5I2Q A;  1KWO B;  4NQG A;  5ER4 X;  1NWD A;  2JOJ A;  3CR2 A;  2CNP A;  3KEV A;  1F4Q A;  1DJW A;  1MUX A;  2LUC A;  1B8R A;  1DJH A;  2JC2 A;  2H61 C;  5AAN A;  1NX2 A;  2JNF A;  4N1F A;  5I2O A;  4DS7 A;  1J1E A;  1DF0 B;  2NCO A;  1WRZ A;  2LMV A;  1X02 A;  3VRP A;  2M29 A;  1QX2 A;  3JTD B;  1V1G A;  1F55 A;  4PAL A;  5JJG A;  1SBJ A;  1CMF A;  2PMY A;  1L2O B;  1VRK A;  2ZRT A;  3TDZ A;  1RTP 1;  5AFP A;  2WC8 A;  1UHJ A;  4GBA A;  3SIA A;  4C0K A;  1QVI Z;  1JC2 A;  3DD4 A;  3O4Y A;  3SG7 A;  5HLV A;  1TCO B;  1FBV A;  2M9G A;  3JVT B;  1GGW A;  2AAO A;  1KK8 B;  1YUU A;  2WCF A;  1CLM A;  2LAN A;  4FTG A;  2M7L A;  5K89 A;  3TUY B;  1ODB A;  1PVB A;  1G4Y R;  2LM5 A;  2LVI A;  4N1G A;  3RLZ A;  2PAS A;  3PLF B;  1KK7 Y;  2Y5I A;  1M45 A;  1K93 D;  2BCX A;  1CB1 A;  1JF0 A;  1LA0 A;  1XFX O;  1MWN A;  4IL1 A;  2KGR A;  1NCY A;  1QV0 A;  2BKI B;  1SRA A;  4PE0 A;  2M8U A;  1QAS A;  3WHT B;  2RGI A;  2EC6 C;  1IG5 A;  2BE6 A;  4DRW A;  1BLQ A;  1DMO A;  2CCM A;  2IS9 A;  3CR4 X;  4A4B A;  2BBM A;  2E6W A;  2NXQ A;  1A03 A;  1UHH A;  2ZFD A;  1KFX L;  4HSZ A;  2ZRS A;  1KFX S;  1IWQ A;  3GK2 A;  2L98 A;  2KOT A;  1IRJ A;  5HKW A;  1NYA A;  2JNX A;  1AUI B;  3KO0 A;  1Y1A A;  1TN4 A;  4NDC A;  1TNW A;  2H61 A;  3CZT X;  1XFZ O;  2LHI A;  5DKR A;  1CNP A;  4MBE A;  1RWY A;  1AJ5 A;  1G33 A;  2SAS A;  1DJY A;  2L4H A;  2F3Z A;  1CTR A;  1K9K A;  2OS8 C;  2KYF A;  1BU3 A;  2KI6 C;  3F45 A;  1BMO A;  1IGV A;  1NUB A;  2KQ6 A;  2Y1N A;  3BOW A;  1SCV A;  3GK4 X;  1SL9 A;  1XFV O;  1QVI Y;  2M97 A;  3O78 A;  4BY5 A;  4YBH B;  2JWW A;  4XJK B;  4Q04 A;  1ALV A;  1UHI A;  4DIR A;  1B8C A;  1IKU A;  4ZCU A;  1AHR A;  1DF0 A;  1XO5 A;  1SL7 A;  4QJ5 B;  2PAL A;  2KNE A;  2VRG A;  1OSA A;  1NSH A;  2ZKM X;  4GUK A;  3QRX A;  2JXL A;  1CKK A;  1DGV A;  5JOL A;  5HLO A;  2OPO A;  4YI8 A;  5CSF A;  2JT8 A;  1AP4 A;  4ORB B;  4E68 A;  3I5H B;  1Q80 A;  1EL4 A;  1S26 D;  4M2Q A;  4USL A;  4WQ2 A;  2F2P A;  1ZAC A;  3EVU A;  2KAY A;  5HKZ A;  1SCM B;  4N5X A;  1FPW A;  1IH0 A;  1GGZ A;  2FJU B;  4MSP A;  2MLF C;  1IJ5 A;  5B8I B;  1SR6 C;  1SY9 A;  2O60 A;  3I5F C;  2K7B A;  1N0Y A;  1WDC B;  1FF1 A;  2HPS A;  1NIW A;  2FOT A;  2MJW B;  2HF5 A;  4AOM A;  5DKQ A;  4YGA A;  2KFF A;  1A4P A;  1XFW O;  1M63 B;  3PAT A;  4GGF A;  1YTZ C;  2KYC A;  4MVF A;  4CLN A;  2ZND A;  1ZFS A;  1PUL A;  1EH2 A;  1YR5 A;  4YI9 A;  4M2O A;  1BR1 B;  1OMV A;  1A2X A;  2DOQ A;  2KI4 B;  3BUO B;  1WRL A;  1S3P A;  3OB2 B;  1IJ6 A;  1K9U A;  3I5G C;  2GGM A;  1BT6 A;  3SG2 A;  3NSL A;  2JZI A;  3BUN B;  2BL0 B;  5IBW A;  1WRK A;  5BPJ A;  1GQM A;  1CDP A;  3CLN A;  4ETO A;  1SPY A;  4OVN F;  3SJS A;  2K2F A;  2KAX A;  4L9M A;  1CM1 A;  1CFD A;  2COL B;  2JUL A;  3OX6 A;  3PSR A;  5AXI A;  1YRT B;  1NPQ A;  3LLE A;  4MLW A;  2ZN8 A;  2EHB A;  4JQ0 D;  1MQ1 A;  1SKT A;  1QIV A;  1EXR A;  2F33 A;  3EKH A;  2LV7 A;  1A75 B;  1QX7 A;  1BR4 B;  1S6I A;  2LUX A;  4GPL B;  1KWO C;  2Y1M A;  3IF7 A;  3PM8 A;  3FWB A;  1CLB A;  2WCB A;  2LCP A;  1KQM B;  1UHN A;  2K8M B;  2CXJ A;  2MLE C;  2JU0 A;  4PHN A;  4MZJ A;  4XJK A;  1CFP A;  1N65 A;  4GFT A;  3JTD C;  1LXF C;  1LIN A;  3VRR A;  3BUX B;  3NSO A;  2HQW A;  1L2O C;  1OE9 B;  5CSJ A;  4CFR A;  2M1U A;  5G08 A;  4HRH A;  1G8I A;  3TS5 B;  1U5I B;  3GK1 A;  1QTX A;  1W7I B;  4GAO A;  1QLS A;  1NP8 A;  1TCF A;  3IQO A;  3LK0 A;  4PCW A;  1BJF A;  5HKY A;  1OMR A;  2LC5 A;  3JVT C;  3ZWH A;  5DKN A;  1KK8 C;  1RK9 A;  3TDI A;  2MHH A;  4FQO A;  5D69 A;  1E8A A;  1CM4 A;  4M2P A;  1YUR A;  2P6B B;  1QX5 B;  3TUY C;  2LLS A;  2NLN A;  3CWG A;  4OCI A;  1ZUZ A;  3IQQ A;  2LAP A;  3FWC A;  4GGF C;  4NDB A;  4AQJ A;  5I8N A;  4MRX A;  1B9A A;  1KFU L;  2HQ8 A;  4OV2 A;  2GGZ A;  4I5K A;  2LVV A;  4BY4 A;  3EVR A;  1N2D A;  1V1F A;  1K95 A;  2BCA A;  1AVS A;  1EG4 A;  1DVI A;  5KTY A;  2F2O A;  2FCE A;  3GOF A;  2LE9 B;  1JWD A;  1YRU B;  2K7O A;  5TNC A;  3A4U B;  2D8N A;  3CR5 X;  1SNL A;  4F0Z B;  4C0L A;  1B4C A;  2JTZ A;  1DTL A;  3NSK A;  2KBI A;  1OZS A;  4UPG A;  1RJV A;  4D1E A;  2M7N A;  2MRD A;  5CPV A;  3EK7 A;  1F70 A;  2KAV A;  1PSR A;  2BCB A;  1FI5 A;  3DVK A;  1SK6 D;  3LK1 A;  1S5G Z;  1ZMZ A;  2K61 A;  2LLT A;  1TNP A;  3PFV A;  1XFU O;  4YGD B;  1OMD A;  2SCP A;  2KFG A;  1F4O A;  1H8B A;  4JWQ A;  3VRN A;  2BBN A;  4YGE B;  2GV5 A;  1J7O A;  3NSI A;  1A75 A;  1YX7 A;  1BOD A;  2A4J A;  3PN7 B;  1YUT A;  2EGD A;  2L0P A;  4HRG A;  2KFH A;  3LL8 B;  3I5I B;  3WNX B;  1MR8 A;  1K9P A;  1NX1 A;  2I2R E;  1W7J B;  1H4B A;  1L7Z A;  4PHK A;  3D0Y B;  3SG3 A;  1CDN A;  1S36 A;  1S6C A;  2H2K A;  1DJG A;  2KHN A;  3ICB A;  1J7Q A;  1K2H A;  1K90 D;  2QAC A;  4OKH A;  5HYD A;  1K8U A;  2WCE A;  3HCM A;  1U5I A;  4TNC A;  2WOS A;  3I5H C;  1NX0 A;  2ISD A;  4XYN A;  2JRF A;  2K7C A;  3EKJ A;  3PN7 C;  2G2B A;  1ZOT B;  1NCZ A;  4MN0 A;  1F8H A;  1SCM C;  5F6T A;  1B7T Z;  2JTT A;  1KQV A;  2JT0 A;  1B8L A;  2M1K B;  1EG3 A;  2PVB A;  1XFY O;  1WDC C;  3M0W A;  4OR9 B;  1XA5 A;  1SW8 A;  3HX4 A;  2M3W A;  1REC A;  4WQ3 A;  2ZN9 A;  2CT9 A;  4AQI A;  4NDD A;  1JUO A;  1LA3 A;  2KI4 C;  3AKA A;  2BEC A;  1DGU A;  1Y6W A;  3FS7 A;  4C0J A; 
#chains in the Genus database with same CATH topology
 2FCD A;  1QS7 A;  1MXL C;  1RFJ A;  2Y4Q A;  1FW4 A;  1S5G Y;  2F8P A;  3BFB A;  3BUM B;  3L4L A;  1KSM A;  1QAT A;  4GNK B;  2B1U A;  3ZNI A;  1B1G A;  1PK0 D;  4I5N B;  1JFK A;  1B47 A;  2BL0 C;  2LLU A;  1YX8 A;  2BKH B;  1GJY A;  1S1E A;  2LMU A;  2PSR A;  3DF0 B;  2MAZ A;  3SS4 A;  1OZO A;  3OX5 A;  3NXA A;  1LS8 A;  1CFC A;  4I5L B;  5AEQ A;  4PHM A;  4INW A;  1C7V A;  4MZK A;  3SS3 A;  1YVH A;  1M31 A;  1EJ3 A;  1MF8 B;  5KSZ A;  4ICB A;  2QEH A;  1KCY A;  1IQ3 A;  1JSA A;  1DJI A;  1W9Z A;  1QXP A;  4PE7 A;  1F71 A;  1NCX A;  1C7W A;  3CGA A;  2JXC A;  2L50 A;  2EC6 B;  3S0E A;  2ZNE A;  3R1V A;  1M39 A;  3SG5 A;  4PDZ A;  3C1V A;  4PE1 A;  2H8V A;  5AER A;  2L2E A;  1KQM C;  3CZ2 A;  2KBM A;  2M0R A;  4QJ3 B;  1CDL A;  1QJT A;  1CDM A;  1TOP A;  3D77 A;  2I18 A;  3EVV A;  1C3Z A;  1SYM A;  3OHM B;  4WRI A;  2L51 A;  3D76 A;  2Q91 A;  1B7T Y;  1NX3 A;  2LVJ A;  1DQE A;  3K21 A;  3OB1 B;  3D0Y A;  4U8D A;  3L47 A;  4DCK A;  3RZS A;  1C07 A;  1FI6 A;  1S6J A;  3NHI A;  1LVC D;  3TS5 C;  3PM2 A;  2MBX A;  1KFU S;  3N7H A;  1XK4 C;  3O2P A;  3H4S E;  3RM1 A;  2QPT A;  2KSP A;  4CPV A;  1PAL A;  3BYA A;  4I5J A;  3SS5 A;  1SSE B;  2OS8 B;  1IQ5 A;  3DYE A;  1OQP A;  1CLL A;  2I94 A;  2LP2 A;  1TTX A;  2WOR A;  2L4I A;  3OP0 A;  5CSI A;  1CFF A;  1WY9 A;  2LP3 A;  1DJZ A;  1J1D A;  2CTN A;  1UUS A;  1BOC A;  2WC6 A;  3BUW B;  2Q4U A;  2TN4 A;  1F54 A;  1PRW A;  2JPT A;  4ZCV A;  5PAL A;  3WXA A;  1RRO A;  1TIZ A;  1BF5 A;  2G9B A;  3S0B A;  1MXE A;  1WLM A;  2QDI A;  1K94 A;  1TRF A;  1QIW A;  2NCP A;  1UHK A;  2L5X B;  3CZ0 A;  3D75 A;  4ORA B;  1SL8 A;  1DT7 B;  2LVK A;  1HQV A;  4PE4 A;  5CSN A;  5ER5 A;  5I2L A;  2KGB C;  2KI6 D;  1JBA A;  1JFJ A;  2AMI A;  4MEW A;  1TUJ A;  1OOG A;  2JT3 A;  3FIA A;  3SG4 A;  1PVA A;  3CS1 A;  5D7F A;  2FJY A;  1UP5 A;  1D1O A;  2I7A A;  4P5O E;  3VRO A;  3DXL A;  4CFQ A;  4YRU A;  2E30 A;  3LCP C;  4R1E A;  1MHO A;  1ALW A;  1OOJ A;  1QV1 A;  2AUC A;  1YUS A;  1WLZ A;  1A29 A;  4OZD A;  3FE8 A;  2M49 B;  1K96 A;  1M46 A;  3A8R A;  1SR6 B;  3DF0 A;  3I5F B;  4YGC B;  1R2U A;  2LNK A;  3KPX A;  3AAK A;  5KU1 A;  2OTG B;  3DVJ A;  2BE4 A;  3EK4 A;  3BXK A;  1TNX A;  3TDU A;  3BQ3 A;  4HRE E;  4GGN A;  3VRQ A;  1UUR A;  3D10 A;  2KDH A;  1HT9 A;  2K7D A;  1KSO A;  2LHL A;  2QEV A;  3OBV A;  3WHU B;  3SG6 A;  3Q8I A;  2HET A;  4ORC B;  5FYX A;  4YGB B;  1XK4 A;  2R2I A;  1KK7 Z;  2CBL A;  1DEL A;  2NZ0 A;  1OW4 A;  4P2Y B;  1SMG A;  1XYD A;  1QLK A;  1Y0V H;  2WND A;  3I5G B;  3CYZ A;  1JF2 A;  1YVL A;  3VGO A;  3I5I C;  3O6B A;  4MRY A;  4PHJ A;  3E3R A;  1TNQ A;  3EK8 A;  3KF9 A;  5D3O A;  5GQQ C;  3AAJ A;  3AKB A;  3PAL A;  3R1O A;  2OTG C;  3KHE A;  2BAP A;  3S0G A;  1Y1X A;  3S0F A;  3MSE B;  3O4X A;  3D73 A;  1J55 A;  1J7R A;  1R6P A;  1XVJ A;  2KQY A;  2V53 A;  2MA2 A;  1CMG A;  2LMT A;  3TZ1 A;  3DVE A;  1J7P A;  1Y1U A;  2K0J A;  2PRU A;  3DVM A;  1AJ4 A;  2O5G A;  3PJI A;  4DUQ A;  4MZL A;  3SIB A;  4JPZ B;  4CID A;  5J3X A;  1DJX A;  1UWO A;  2K2A A;  3CTN A;  4QJ4 B;  2F3Y A;  3BOW B;  1AK8 A;  1LKJ A;  1PSB A;  4A4C A;  2JQ6 A;  1BG1 A;  5I2Q A;  1KWO B;  2QEO A;  4NQG A;  5ER4 X;  1NWD A;  2JOJ A;  3CR2 A;  2CNP A;  3KEV A;  1F4Q A;  1DJW A;  1MUX A;  2LUC A;  1B8R A;  1DJH A;  2JC2 A;  2H61 C;  5AAN A;  1NX2 A;  2JNF A;  4N1F A;  5I2O A;  4DS7 A;  1J1E A;  1DF0 B;  2NCO A;  1WRZ A;  2LMV A;  1X02 A;  3VRP A;  2M29 A;  1QX2 A;  3JTD B;  1V1G A;  1F55 A;  4PAL A;  5JJG A;  1SBJ A;  1QWV A;  1CMF A;  2PMY A;  1L2O B;  1VRK A;  2ZRT A;  3TDZ A;  1RTP 1;  5AFP A;  2WC8 A;  1UHJ A;  4GBA A;  3SIA A;  4C0K A;  1QVI Z;  1JC2 A;  3DD4 A;  3O4Y A;  3SG7 A;  5HLV A;  1TCO B;  3V2L A;  1FBV A;  2M9G A;  5I94 A;  3JVT B;  3B7A A;  1GGW A;  2AAO A;  1KK8 B;  1YUU A;  2WCF A;  1CLM A;  2LAN A;  4FTG A;  2M7L A;  5K89 A;  3TUY B;  5HL1 A;  1ODB A;  1PVB A;  1G4Y R;  2LM5 A;  2LVI A;  4N1G A;  3R1P A;  3RLZ A;  2PAS A;  3PLF B;  1KK7 Y;  2Y5I A;  1M45 A;  1K93 D;  2BCX A;  1CB1 A;  1JF0 A;  1LA0 A;  1XFX O;  1MWN A;  4IL1 A;  2KGR A;  1NCY A;  1QV0 A;  2P71 A;  2BKI B;  1SRA A;  4PE0 A;  2M8U A;  1QAS A;  3WHT B;  2RGI A;  2EC6 C;  3VB1 A;  1IG5 A;  2BE6 A;  4DRW A;  1BLQ A;  3K1E A;  1DMO A;  2CCM A;  2IS9 A;  3CR4 X;  4A4B A;  2BBM A;  2E6W A;  2NXQ A;  1A03 A;  1UHH A;  2ZFD A;  1KFX L;  4HSZ A;  2ZRS A;  1KFX S;  1IWQ A;  3GK2 A;  2L98 A;  2KOT A;  1IRJ A;  5HKW A;  1NYA A;  2JNX A;  2WCJ A;  1AUI B;  3KO0 A;  1Y1A A;  1TN4 A;  4NDC A;  1TNW A;  2H61 A;  3CZT X;  1XFZ O;  2LHI A;  5DKR A;  1CNP A;  4MBE A;  1RWY A;  1AJ5 A;  1G33 A;  1GM0 A;  2SAS A;  1DJY A;  2L4H A;  2F3Z A;  1CTR A;  2KPH A;  3CZ1 A;  1K9K A;  2OS8 C;  2KYF A;  1BU3 A;  4KYN A;  5DIC A;  2KI6 C;  3F45 A;  1BMO A;  1IGV A;  1NUB A;  2KQ6 A;  2WCH A;  2Y1N A;  1IIO A;  3BOW A;  1SCV A;  4JKT A;  1OOH A;  1SL9 A;  3GK4 X;  1XFV O;  1QVI Y;  2M97 A;  3L4A A;  3O78 A;  4BY5 A;  4YBH B;  2JWW A;  4XJK B;  4Q04 A;  1ALV A;  1UHI A;  4DIR A;  1B8C A;  1IKU A;  4ZCU A;  3S0D A;  1AHR A;  1DF0 A;  1TWO A;  1XO5 A;  1SL7 A;  4QJ5 B;  2PAL A;  2KNE A;  2VRG A;  1OSA A;  1NSH A;  2ZKM X;  4GUK A;  3QRX A;  2JXL A;  3BFA A;  1CKK A;  1DGV A;  5JOL A;  5HLO A;  3B6X A;  2OPO A;  4YI8 A;  5CSF A;  2JT8 A;  1AP4 A;  4ORB B;  4E68 A;  3I5H B;  1Q80 A;  1EL4 A;  1S26 D;  4M2Q A;  4USL A;  4WQ2 A;  2F2P A;  1ZAC A;  3EVU A;  2KAY A;  5HKZ A;  1SCM B;  4N5X A;  1FPW A;  1IH0 A;  1GGZ A;  2FJU B;  4MSP A;  2MLF C;  1IJ5 A;  5B8I B;  1SR6 C;  1SY9 A;  2O60 A;  3I5F C;  2K7B A;  1N0Y A;  1WDC B;  1FF1 A;  2HPS A;  1NIW A;  2FOT A;  2MJW B;  2HF5 A;  4AOM A;  5DKQ A;  4YGA A;  2KFF A;  1A4P A;  1XFW O;  1M63 B;  3PAT A;  4GGF A;  1YTZ C;  2KYC A;  2K60 A;  4MVF A;  4CLN A;  2ZND A;  1ZFS A;  1PUL A;  1EH2 A;  3FE6 A;  1OOI X;  1YR5 A;  3B87 A;  2PYQ A;  1BR1 B;  1OMV A;  4M2O A;  4YI9 A;  1A2X A;  2DOQ A;  2KI4 B;  3UNW A;  3BUO B;  1WRL A;  1S3P A;  3OB2 B;  1IJ6 A;  1K9U A;  4F7F A;  3I5G C;  2GGM A;  1BT6 A;  3NGV A;  3SG2 A;  3NSL A;  2JZI A;  2P70 A;  2BL0 B;  3BUN B;  1WRK A;  3NHT A;  1GQM A;  1CDP A;  5BPJ A;  5IBW A;  2L2C A;  3CLN A;  3QME A;  4FQT A;  1SPY A;  4OVN F;  3SJS A;  4ETO A;  2K2F A;  2KAX A;  4L9M A;  1CM1 A;  1CFD A;  2COL B;  2JUL A;  2YGU A;  3OX6 A;  3PSR A;  3BJH A;  5AXI A;  1YRT B;  1NPQ A;  3LLE A;  4MLW A;  2ZN8 A;  2EHB A;  4JQ0 D;  1MQ1 A;  1SKT A;  1QIV A;  1EXR A;  2F33 A;  3EKH A;  2LV7 A;  1DC1 A;  1A75 B;  1QX7 A;  1BR4 B;  1OOF A;  1S6I A;  2LUX A;  4GPL B;  1KWO C;  2Y1M A;  3IF7 A;  3PM8 A;  3FWB A;  2WC5 A;  3D74 A;  1CLB A;  2WCB A;  5FI7 A;  2LCP A;  1KQM B;  1UHN A;  2K8M B;  2CXJ A;  2MLE C;  2JU0 A;  4PHN A;  4MZJ A;  4XJK A;  1CFP A;  1N65 A;  4GFT A;  3JTD C;  1LXF C;  1LIN A;  3VRR A;  3BUX B;  3NSO A;  2HQW A;  1L2O C;  1OE9 B;  2PQL A;  5CSJ A;  4CFR A;  2M1U A;  5G08 A;  4HRH A;  1G8I A;  3TS5 B;  1U5I B;  3GK1 A;  1QTX A;  1W7I B;  3CDN A;  4IJ7 A;  4GAO A;  1QLS A;  1NP8 A;  1TCF A;  3IQO A;  3LK0 A;  4PCW A;  1BJF A;  5HKY A;  1OMR A;  2LC5 A;  3JVT C;  2KLD A;  3ZWH A;  5DKN A;  1KK8 C;  1RK9 A;  3TDI A;  2MHH A;  4FQO A;  5D69 A;  5EL2 A;  1E8A A;  1CM4 A;  4M2P A;  1YUR A;  2P6B B;  1QX5 B;  3TUY C;  2LLS A;  2NLN A;  4JD9 A;  3CWG A;  2QEB A;  4OCI A;  1ZUZ A;  3IQQ A;  2LAP A;  3FWC A;  3IVT A;  4GGF C;  1P28 A;  4NDB A;  4AQJ A;  1Z4H A;  5I8N A;  4MRX A;  1B9A A;  1KFU L;  2HQ8 A;  3R72 A;  4OV2 A;  2GGZ A;  4I5K A;  2LVV A;  4BY4 A;  3EVR A;  1N2D A;  1V1F A;  1K95 A;  2BCA A;  3D78 A;  1AVS A;  2WCK A;  1EG4 A;  1DVI A;  5KTY A;  1DEK A;  2F2O A;  3S0A A;  2FCE A;  3B88 A;  2LE9 B;  3GOF A;  1JWD A;  1YRU B;  2K7O A;  5TNC A;  1T14 A;  3A4U B;  2D8N A;  3CR5 X;  1SNL A;  4F0Z B;  4C0L A;  1B4C A;  2JTZ A;  1DTL A;  3NSK A;  2KBI A;  1OZS A;  4UPG A;  1RJV A;  1XFR A;  3EG5 B;  4D1E A;  2M7N A;  2MRD A;  5CPV A;  3EK7 A;  1F70 A;  2KAV A;  1PSR A;  5FI2 A;  2BCB A;  1FI5 A;  3DVK A;  1SK6 D;  3LK1 A;  1S5G Z;  1ZMZ A;  2K61 A;  2LLT A;  1TNP A;  3PFV A;  1XFU O;  4YGD B;  2WCM A;  1OMD A;  2SCP A;  2KFG A;  1F4O A;  1H8B A;  4JWQ A;  3VRN A;  2BBN A;  4YGE B;  2GV5 A;  1J7O A;  1C3Y A;  3NSI A;  1A75 A;  2WCL A;  1YX7 A;  2L5Y A;  3CAB A;  1BOD A;  2A4J A;  3PN7 B;  1YUT A;  2EGD A;  2L0P A;  4HRG A;  2KFH A;  3LL8 B;  3I5I B;  3WNX B;  1MR8 A;  3FE9 A;  1K9P A;  2GTE A;  1NX1 A;  5FI6 A;  2I2R E;  1W7J B;  3BFH A;  1H4B A;  1L7Z A;  4PHK A;  3D0Y B;  3SG3 A;  4PT1 A;  1CDN A;  1S36 A;  1S6C A;  2H2K A;  1DJG A;  2KHN A;  3ICB A;  1J7Q A;  1K2H A;  1K90 D;  2QAC A;  2ERB A;  4OKH A;  5HYD A;  1K8U A;  2WCE A;  3HCM A;  1U5I A;  4TNC A;  2WOS A;  3I5H C;  1NX0 A;  2ISD A;  2JPO A;  4XYN A;  2JRF A;  1Z2C B;  2K7C A;  3EKJ A;  3PN7 C;  2G2B A;  1ZOT B;  1NCZ A;  4MN0 A;  1F8H A;  1SCM C;  5F6T A;  1TUZ A;  1B7T Z;  4INX A;  2JTT A;  1KQV A;  2JT0 A;  1B8L A;  2M1K B;  1EG3 A;  2PVB A;  1XFY O;  3OGN A;  2KLE A;  1WDC C;  3DY9 A;  3M0W A;  4OR9 B;  1XA5 A;  1ORG A;  1SW8 A;  3HX4 A;  2M3W A;  1REC A;  4WQ3 A;  3DZT A;  2ZN9 A;  2CT9 A;  4AQI A;  2BNX A;  4NDD A;  3UO9 A;  1JUO A;  1LA3 A;  2KI4 C;  3AKA A;  3B86 A;  2BEC A;  1DGU A;  1Y6W A;  3FS7 A;  4C0J A; 
#chains in the Genus database with same CATH homology
 2FCD A;  1QS7 A;  1MXL C;  1RFJ A;  2Y4Q A;  1FW4 A;  1S5G Y;  2F8P A;  3BUM B;  1KSM A;  1QAT A;  4GNK B;  2B1U A;  3ZNI A;  1B1G A;  1PK0 D;  4I5N B;  1JFK A;  1B47 A;  2BL0 C;  2LLU A;  1YX8 A;  2BKH B;  1GJY A;  1S1E A;  2LMU A;  2PSR A;  3DF0 B;  2MAZ A;  1OZO A;  3OX5 A;  3NXA A;  1CFC A;  4I5L B;  5AEQ A;  4PHM A;  1C7V A;  4MZK A;  1YVH A;  1M31 A;  1EJ3 A;  1MF8 B;  5KSZ A;  4ICB A;  1KCY A;  1IQ3 A;  1JSA A;  1DJI A;  4PE7 A;  1QXP A;  1F71 A;  1NCX A;  1C7W A;  3CGA A;  2JXC A;  2L50 A;  2EC6 B;  2ZNE A;  1M39 A;  3SG5 A;  4PDZ A;  3C1V A;  4PE1 A;  5AER A;  2L2E A;  1KQM C;  2KBM A;  2M0R A;  4QJ3 B;  1CDL A;  1QJT A;  1CDM A;  1TOP A;  2I18 A;  3EVV A;  3OHM B;  1SYM A;  4WRI A;  2L51 A;  2Q91 A;  1B7T Y;  1NX3 A;  2LVJ A;  3K21 A;  3OB1 B;  3D0Y A;  4U8D A;  4DCK A;  1C07 A;  1FI6 A;  1S6J A;  1LVC D;  3TS5 C;  2MBX A;  1KFU S;  1XK4 C;  3O2P A;  3H4S E;  3RM1 A;  2QPT A;  2KSP A;  4CPV A;  1PAL A;  3BYA A;  4I5J A;  2OS8 B;  1IQ5 A;  1OQP A;  1CLL A;  2I94 A;  2LP2 A;  1TTX A;  2WOR A;  2L4I A;  3OP0 A;  5CSI A;  1CFF A;  1WY9 A;  2LP3 A;  1DJZ A;  1J1D A;  2CTN A;  1UUS A;  1BOC A;  3BUW B;  2Q4U A;  2TN4 A;  1F54 A;  1PRW A;  2JPT A;  4ZCV A;  5PAL A;  3WXA A;  1RRO A;  1TIZ A;  1BF5 A;  2G9B A;  1MXE A;  1WLM A;  1K94 A;  1TRF A;  1QIW A;  2NCP A;  1UHK A;  2L5X B;  4ORA B;  1DT7 B;  1SL8 A;  2LVK A;  1HQV A;  4PE4 A;  5CSN A;  5ER5 A;  5I2L A;  2KGB C;  2KI6 D;  1JBA A;  1JFJ A;  2AMI A;  4MEW A;  3SG4 A;  2JT3 A;  3FIA A;  1PVA A;  3CS1 A;  5D7F A;  1UP5 A;  1D1O A;  2I7A A;  4P5O E;  3VRO A;  4CFQ A;  4YRU A;  2E30 A;  3LCP C;  4R1E A;  1MHO A;  1ALW A;  1OOJ A;  1QV1 A;  2AUC A;  1YUS A;  1WLZ A;  1A29 A;  2M49 B;  1K96 A;  1M46 A;  3A8R A;  1SR6 B;  3DF0 A;  3I5F B;  4YGC B;  1R2U A;  2LNK A;  3KPX A;  3AAK A;  5KU1 A;  2OTG B;  3DVJ A;  2BE4 A;  3EK4 A;  3BXK A;  1TNX A;  3TDU A;  3BQ3 A;  4HRE E;  4GGN A;  3VRQ A;  1UUR A;  3D10 A;  2KDH A;  1HT9 A;  2K7D A;  1KSO A;  2LHL A;  3WHU B;  3SG6 A;  4ORC B;  2HET A;  5FYX A;  4YGB B;  1XK4 A;  2R2I A;  1KK7 Z;  2CBL A;  4P2Y B;  2NZ0 A;  1SMG A;  1XYD A;  1QLK A;  1Y0V H;  2WND A;  3I5G B;  1JF2 A;  1YVL A;  3VGO A;  3I5I C;  3O6B A;  4MRY A;  4PHJ A;  3E3R A;  1TNQ A;  3EK8 A;  3KF9 A;  5GQQ C;  3AAJ A;  3AKB A;  3PAL A;  2OTG C;  3KHE A;  1Y1X A;  3MSE B;  1J55 A;  1J7R A;  1R6P A;  1XVJ A;  2KQY A;  2V53 A;  2MA2 A;  1CMG A;  2LMT A;  3TZ1 A;  3DVE A;  1J7P A;  1Y1U A;  2K0J A;  2PRU A;  3DVM A;  1AJ4 A;  2O5G A;  4DUQ A;  4MZL A;  3SIB A;  4JPZ B;  4CID A;  5J3X A;  1DJX A;  1UWO A;  2K2A A;  3CTN A;  4QJ4 B;  2F3Y A;  3BOW B;  1AK8 A;  1LKJ A;  1PSB A;  4A4C A;  2JQ6 A;  1BG1 A;  5I2Q A;  1KWO B;  4NQG A;  5ER4 X;  1NWD A;  2JOJ A;  3CR2 A;  2CNP A;  3KEV A;  1F4Q A;  1DJW A;  1MUX A;  2LUC A;  1B8R A;  1DJH A;  2JC2 A;  2H61 C;  5AAN A;  1NX2 A;  2JNF A;  4N1F A;  5I2O A;  4DS7 A;  1J1E A;  1DF0 B;  2NCO A;  1WRZ A;  2LMV A;  1X02 A;  3VRP A;  2M29 A;  1QX2 A;  3JTD B;  1V1G A;  1F55 A;  4PAL A;  5JJG A;  1SBJ A;  1CMF A;  2PMY A;  1L2O B;  1VRK A;  2ZRT A;  3TDZ A;  1RTP 1;  5AFP A;  2WC8 A;  1UHJ A;  4GBA A;  3SIA A;  4C0K A;  1QVI Z;  1JC2 A;  3DD4 A;  3O4Y A;  3SG7 A;  5HLV A;  1TCO B;  1FBV A;  2M9G A;  3JVT B;  1GGW A;  2AAO A;  1KK8 B;  1YUU A;  2WCF A;  1CLM A;  2LAN A;  4FTG A;  2M7L A;  5K89 A;  3TUY B;  1ODB A;  1PVB A;  1G4Y R;  2LM5 A;  2LVI A;  4N1G A;  3RLZ A;  2PAS A;  3PLF B;  1KK7 Y;  2Y5I A;  1M45 A;  1K93 D;  2BCX A;  1CB1 A;  1JF0 A;  1LA0 A;  1XFX O;  1MWN A;  4IL1 A;  2KGR A;  1NCY A;  1QV0 A;  2BKI B;  1SRA A;  4PE0 A;  2M8U A;  1QAS A;  3WHT B;  2RGI A;  2EC6 C;  1IG5 A;  2BE6 A;  4DRW A;  1BLQ A;  1DMO A;  2CCM A;  2IS9 A;  3CR4 X;  4A4B A;  2BBM A;  2E6W A;  2NXQ A;  1A03 A;  1UHH A;  2ZFD A;  1KFX L;  4HSZ A;  2ZRS A;  1KFX S;  1IWQ A;  3GK2 A;  2L98 A;  2KOT A;  1IRJ A;  5HKW A;  1NYA A;  2JNX A;  1AUI B;  3KO0 A;  1Y1A A;  1TN4 A;  4NDC A;  1TNW A;  2H61 A;  3CZT X;  1XFZ O;  2LHI A;  5DKR A;  1CNP A;  4MBE A;  1RWY A;  1AJ5 A;  1G33 A;  2SAS A;  1DJY A;  2L4H A;  2F3Z A;  1CTR A;  1K9K A;  2OS8 C;  2KYF A;  1BU3 A;  2KI6 C;  3F45 A;  1BMO A;  1IGV A;  1NUB A;  2KQ6 A;  2Y1N A;  3BOW A;  1SCV A;  3GK4 X;  1SL9 A;  1XFV O;  1QVI Y;  2M97 A;  3O78 A;  4BY5 A;  4YBH B;  2JWW A;  4XJK B;  4Q04 A;  1ALV A;  1UHI A;  4DIR A;  1B8C A;  1IKU A;  4ZCU A;  1AHR A;  1DF0 A;  1XO5 A;  1SL7 A;  4QJ5 B;  2PAL A;  2KNE A;  2VRG A;  1OSA A;  1NSH A;  2ZKM X;  4GUK A;  3QRX A;  2JXL A;  1CKK A;  1DGV A;  5JOL A;  5HLO A;  2OPO A;  4YI8 A;  5CSF A;  2JT8 A;  1AP4 A;  4ORB B;  4E68 A;  3I5H B;  1Q80 A;  1EL4 A;  1S26 D;  4M2Q A;  4USL A;  4WQ2 A;  2F2P A;  1ZAC A;  3EVU A;  2KAY A;  5HKZ A;  1SCM B;  4N5X A;  1FPW A;  1IH0 A;  1GGZ A;  2FJU B;  4MSP A;  2MLF C;  1IJ5 A;  5B8I B;  1SR6 C;  1SY9 A;  2O60 A;  3I5F C;  2K7B A;  1N0Y A;  1WDC B;  1FF1 A;  2HPS A;  1NIW A;  2FOT A;  2MJW B;  2HF5 A;  4AOM A;  5DKQ A;  4YGA A;  2KFF A;  1A4P A;  1XFW O;  1M63 B;  3PAT A;  4GGF A;  1YTZ C;  2KYC A;  4MVF A;  4CLN A;  2ZND A;  1ZFS A;  1PUL A;  1EH2 A;  1YR5 A;  4YI9 A;  4M2O A;  1BR1 B;  1OMV A;  1A2X A;  2DOQ A;  2KI4 B;  3BUO B;  1WRL A;  1S3P A;  3OB2 B;  1IJ6 A;  1K9U A;  3I5G C;  2GGM A;  1BT6 A;  3SG2 A;  3NSL A;  2JZI A;  3BUN B;  2BL0 B;  5IBW A;  1WRK A;  5BPJ A;  1GQM A;  1CDP A;  3CLN A;  4ETO A;  1SPY A;  4OVN F;  3SJS A;  2K2F A;  2KAX A;  4L9M A;  1CM1 A;  1CFD A;  2COL B;  2JUL A;  3OX6 A;  3PSR A;  5AXI A;  1YRT B;  1NPQ A;  3LLE A;  4MLW A;  2ZN8 A;  2EHB A;  4JQ0 D;  1MQ1 A;  1SKT A;  1QIV A;  1EXR A;  2F33 A;  3EKH A;  2LV7 A;  1A75 B;  1QX7 A;  1BR4 B;  1S6I A;  2LUX A;  4GPL B;  1KWO C;  2Y1M A;  3IF7 A;  3PM8 A;  3FWB A;  1CLB A;  2WCB A;  2LCP A;  1KQM B;  1UHN A;  2K8M B;  2CXJ A;  2MLE C;  2JU0 A;  4PHN A;  4MZJ A;  4XJK A;  1CFP A;  1N65 A;  4GFT A;  3JTD C;  1LXF C;  1LIN A;  3VRR A;  3BUX B;  3NSO A;  2HQW A;  1L2O C;  1OE9 B;  5CSJ A;  4CFR A;  2M1U A;  5G08 A;  4HRH A;  1G8I A;  3TS5 B;  1U5I B;  3GK1 A;  1QTX A;  1W7I B;  4GAO A;  1QLS A;  1NP8 A;  1TCF A;  3IQO A;  3LK0 A;  4PCW A;  1BJF A;  5HKY A;  1OMR A;  2LC5 A;  3JVT C;  3ZWH A;  5DKN A;  1KK8 C;  1RK9 A;  3TDI A;  2MHH A;  4FQO A;  5D69 A;  1E8A A;  1CM4 A;  4M2P A;  1YUR A;  2P6B B;  1QX5 B;  3TUY C;  2LLS A;  2NLN A;  3CWG A;  4OCI A;  1ZUZ A;  3IQQ A;  2LAP A;  3FWC A;  4GGF C;  4NDB A;  4AQJ A;  5I8N A;  4MRX A;  1B9A A;  1KFU L;  2HQ8 A;  4OV2 A;  2GGZ A;  4I5K A;  2LVV A;  4BY4 A;  3EVR A;  1N2D A;  1V1F A;  1K95 A;  2BCA A;  1AVS A;  1EG4 A;  1DVI A;  5KTY A;  2F2O A;  2FCE A;  3GOF A;  2LE9 B;  1JWD A;  1YRU B;  2K7O A;  5TNC A;  3A4U B;  2D8N A;  3CR5 X;  1SNL A;  4F0Z B;  4C0L A;  1B4C A;  2JTZ A;  1DTL A;  3NSK A;  2KBI A;  1OZS A;  4UPG A;  1RJV A;  4D1E A;  2M7N A;  2MRD A;  5CPV A;  3EK7 A;  1F70 A;  2KAV A;  1PSR A;  2BCB A;  1FI5 A;  3DVK A;  1SK6 D;  3LK1 A;  1S5G Z;  1ZMZ A;  2K61 A;  2LLT A;  1TNP A;  3PFV A;  1XFU O;  4YGD B;  1OMD A;  2SCP A;  2KFG A;  1F4O A;  1H8B A;  4JWQ A;  3VRN A;  2BBN A;  4YGE B;  2GV5 A;  1J7O A;  3NSI A;  1A75 A;  1YX7 A;  1BOD A;  2A4J A;  3PN7 B;  1YUT A;  2EGD A;  2L0P A;  4HRG A;  2KFH A;  3LL8 B;  3I5I B;  3WNX B;  1MR8 A;  1K9P A;  1NX1 A;  2I2R E;  1W7J B;  1H4B A;  1L7Z A;  4PHK A;  3D0Y B;  3SG3 A;  1CDN A;  1S36 A;  1S6C A;  2H2K A;  1DJG A;  2KHN A;  3ICB A;  1J7Q A;  1K2H A;  1K90 D;  2QAC A;  4OKH A;  5HYD A;  1K8U A;  2WCE A;  3HCM A;  1U5I A;  4TNC A;  2WOS A;  3I5H C;  1NX0 A;  2ISD A;  4XYN A;  2JRF A;  2K7C A;  3EKJ A;  3PN7 C;  2G2B A;  1ZOT B;  1NCZ A;  4MN0 A;  1F8H A;  1SCM C;  5F6T A;  1B7T Z;  2JTT A;  1KQV A;  2JT0 A;  1B8L A;  2M1K B;  1EG3 A;  2PVB A;  1XFY O;  1WDC C;  3M0W A;  4OR9 B;  1XA5 A;  1SW8 A;  3HX4 A;  2M3W A;  1REC A;  4WQ3 A;  2ZN9 A;  2CT9 A;  4AQI A;  4NDD A;  1JUO A;  1LA3 A;  2KI4 C;  3AKA A;  2BEC A;  1DGU A;  1Y6W A;  3FS7 A;  4C0J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...