2LMVA

Androcam at high calcium with three explicit ca2+
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
147
structure length
147
Chain Sequence
SELTEEQIAEFKDAFVQFDKEGTGKIATRELGTLMRTLGQNPTEAELQDLIAEAENNNNGQLNFTEFCGIMAKQMRETDTEEEMREAFKIFDRDGDGFISPAELRFVMINLGEKVTDEEIDEMIREADFDGDGMINYEEFVWMISQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Calmodulin-related protein 97A
publication title Structure of androcam supports specialized interactions with myosin VI.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Metal binding protein
total genus 44
structure length 147
sequence length 147
ec nomenclature
pdb deposition date 2011-12-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2lmvA01
3BUXB 4N1GA 3PFVA 1KQMC 1UHNA 2BBNA 4P5OE 4GBAA 1IQ3A 1A4PA 2SASA 2LMTA 3FWCA 2F33A 1Y0VH 2KNEA 2ZRSA 1PSBA 1UP5A 3KF9A 1B47A 1YUSA 3JTDC 1SCMB 2M1KB 2MJWB 2HQ8A 4MZKA 1KCYA 4MBEA 3E3RA 1C7VA 3I5HB 2LV7A 3SG4A 3CR2A 4M2PA 1SL7A 1TIZA 3BOWA 3F45A 3EVUA 1UHKA 1MXLC 1B8CA 2EC6B 2K8MB 1JUOA 5CPVA 1IJ5A 3D0YA 2NXQA 5I2LA 3KO0A 3TDZA 1YX7A 2WORA 1EJ3A 2PVBA 4PCWA 2L50A 2BKHB 2GGZA 2LC5A 5HKWA 1BR1B 1QLKA 1SY9A 1LXFC 3AKBA 3GK1A 5CSJA 1DJXA 2IS9A 3ZWHA 1KQVA 1B7TZ 3QRXA 1Q80A 1DJIA 2Q91A 1PVAA 5DKNA 1JFKA 2KBMA 1KK8C 1QIWA 3OB2B 1SR6C 2F2PA 1WRLA 2FOTA 2MLEC 4M2QA 1EG4A 1IJ6A 2H2KA 3IQQA 2MHHA 3WHUB 1J1DA 1X02A 4AQIA 1QJTA 4MVFA 4GFTA 2V53A 4GGNA 2PSRA 2JTZA 2KI6D 1NUBA 1QXPA 1OSAA 1RROA 3LL8B 1GGWA 3BUNB 3LCPC 4E68A 2E6WA 3NSOA 1NWDA 1NSHA 5I8NA 1H4BA 1EG3A 2M3WA 2JZIA 1RWYA 1K8UA 2K7CA 2LLTA 1WLZA 4P2YB 1YUTA 2LAPA 2PMYA 2VRGA 2AUCA 5CSFA 4USLA 1J55A 2EC6C 1DJHA 1LINA 4JQ0D 2G9BA 3SIBA 1M31A 2I7AA 1UUSA 4DUQA 1EH2A 2ZKMX 3OHMB 4OKHA 2HETA 2K2FA 1Y6WA 1S3PA 3TDUA 1GGZA 1G4YR 1RK9A 2BBMA 1S6IA 2MLFC 3VROA 2EHBA 1QS7A 3PALA 1LVCD 1SBJA 5JJGA 1CNPA 1GJYA 3I5GB 3LK0A 1NX3A 1KFXL 2RGIA 4WRIA 1S5GZ 3I5IB 1OQPA 5D7FA 2KGBC 1KWOB 2KAXA 3I5FB 2BCAA 2I18A 2AMIA 1YVLA 1RFJA 1DT7B 1SMGA 1DF0B 1N65A 2KQYA 4GGFA 1D1OA 1AJ5A 1CFPA 5ER5A 2JRFA 2KAVA 1K90D 1YURA 1CDLA 1K95A 1XK4C 1TCFA 2I94A 3CLNA 3AAKA 4ORBB 1K9UA 2HF5A 3WXAA 2KFGA 3OX6A 4NQGA 3TUYC 1UHIA 4YGAA 3OX5A 3OB1B 2L2EA 3TS5B 2F3ZA 2LUCA 1HQVA 1JWDA 4HREE 2K0JA 2K61A 1WRKA 1XK4A 1IQ5A 1CDPA 2KFFA 3KHEA 4HSZA 4AQJA 5B8IB 1H8BA 1XVJA 1NPQA 1Y1AA 3PN7B 4ZCUA 3SG2A 3DVKA 1RECA 1CDMA 1EXRA 1ALWA 1OZSA 3VRQA 2LNKA 1IGVA 3JVTC 2OS8C 1TN4A 1OE9B 1ZMZA 3MSEB 4PE4A 4XJKB 2LHIA 3CR4X 2A4JA 2ZNDA 1CM4A 4MZJA 4YGCB 4QJ4B 1B8RA 1BT6A 4MLWA 1QV1A 1F70A 1CM1A 2BL0C 1M45A 3GK4X 2L51A 2L4IA 3WNXB 2M49B 1QATA 5D69A 2LUXA 4QJ5B 3PM8A 2O60A 2QACA 3LLEA 2BE4A 1TNQA 4PALA 3VRNA 5HYDA 1AJ4A 2Q4UA 1CLMA 4BY4A 4C0KA 4YRUA 1BODA 2WCBA 2LM5A 4A4BA 1S26D 1EL4A 1XA5A 2HQWA 2LVVA 1KWOC 4HRHA 4YGDB 2BE6A 3I5FC 2NCPA 1K9KA 2JT8A 5KTYA 2DOQA 1KSOA 1SCVA 4OR9B 3SG6A 1QASA 2MBXA 4IL1A 1N0YA 1B8LA 1QTXA 2CXJA 1UHJA 1DGVA 4HRGA 1HT9A 2JWWA 1A03A 4I5KA 1XFZO 3EK8A 2JXCA 1A75A 1B7TY 1ZFSA 2F2OA 3IF7A 4ETOA 1BLQA 5AEQA 4F0ZB 1JF2A 1C7WA 1R2UA 2LANA 1XFXO 3O6BA 5HKYA 4WQ3A 1NCYA 2K2AA 4DS7A 1OMDA 2KGRA 2Y5IA 3FIAA 3RLZA 1TNPA 1MQ1A 1MXEA 1J7RA 4MRYA 4NDCA 3H4SE 1SK6D 3PATA 1B4CA 1KK7Z 4YI9A 2PASA 2KBIA 1FI6A 2G2BA 4XJKA 4MEWA 5AERA 1K2HA 3BQ3A 1XFVO 3HX4A 2WC8A 1SCMC 4ICBA 2WOSA 1AVSA 4BY5A 1SNLA 1J7PA 2M29A 3I5HC 1XFYO 1UWOA 1R6PA 2ZNEA 1LA3A 1PALA 4OCIA 1JSAA 1QX7A 1PSRA 3ICBA 1SRAA 4WQ2A 1F4OA 2JNFA 3BUMB 1IWQA 4MN0A 1L2OB 1KFUL 1QV0A 4ORAB 2KYFA 1WDCB 4C0JA 2Y4QA 1FF1A 2M7LA 1U5IB 1DJGA 2OTGB 3DF0B 1S1EA 1CFCA 4L9MA 2JXLA 1XYDA 1M46A 1YRUB 2LVIA 2E30A 1TCOB 3EK4A 4GGFC 5CSNA 3SIAA 1Y1UA 1BR4B 5I2OA 4CPVA 1F54A 2JTTA 2H61C 4I5JA 2JT0A 1S5GY 1FBVA 1A29A 1DJZA 1S6CA 4PHNA 3ZNIA 1WLMA 4PE0A 2WCEA 1NYAA 1PULA 1BJFA 1KQMB 2JULA 1XO5A 4NDDA 1SL9A 1YR5A 2H61A 1CFFA 2BECA 2M1UA 2KFHA 3BOWB 3K21A 3EK7A 1ODBA 4XYNA 1IG5A 1MWNA 2L5XB 1YUUA 3BXKA 3CWGA 1QVIZ 2F8PA 1TTXA 1YX8A 2JC2A 5HLVA 2JNXA 3C1VA 1W7JB 2WCFA 2JT3A 3SG7A 3GK2A 2ZN9A 1SL8A 2L98A 1K96A 4GAOA 4M2OA 2ZN8A 3SG3A 5BPJA 2FJUB 3SJSA 3DVEA 4PHKA 2KSPA 4MZLA 3OP0A 3EKHA 2KI6C 3BUOB 2L4HA 1G8IA 4UPGA 1XFUO 5AANA 2CTNA 3O4YA 2F3YA 3O2PA 1PRWA 1GQMA 3KPXA 1CKKA 1YRTB 5DKQA 2OPOA 2NLNA 1NX0A 4OV2A 4CIDA 2I2RE 1S6JA 2NCOA 3LK1A 1MF8B 1KK8B 1CMGA 1DVIA 3AKAA 2COLB 5TNCA 3VRRA 1CDNA 3I5GC 4N5XA 4YGEB 4PHMA 2KHNA 3DF0A 3I5IC 5CSIA 2EGDA 1J7OA 2KYCA 5PALA 1DTLA 1PVBA 3D10A 2WNDA 2O5GA 3HCMA 4DIRA 4DRWA 1MUXA 1MHOA 2JQ6A 3GOFA 1NIWA 1ZOTB 5AFPA 1CMFA 4AOMA 2MRDA 1TRFA 1DJYA 1CFDA 4A4CA 1DMOA 1NP8A 1NX2A 2CCMA 2PRUA 1SKTA 2BCXA 3NSLA 1M63B 1KFXS 4TNCA 2JOJA 3O78A 1FI5A 3CGAA 2LMVA 1DJWA 1OMRA 3TS5C 1DF0A 2JU0A 2LVKA 1CLLA 3NSKA 5I2QA 2MA2A 4JWQA 3PSRA 2ZRTA 4FTGA 2M0RA 1V1GA 2LLUA 5IBWA 3DD4A 2P6BB 1NCXA 1BG1A 3PN7C 4YGBB 1K93D 2M7NA 2FCDA 4N1FA 1SYMA 1RJVA 4DCKA 5FYXA 2MAZA 4PHJA 5KU1A 2LHLA 2B1UA 1B1GA 1QIVA 1ALVA 4PDZA 1G33A 4R1EA 1KK7Y 1TOPA 2CBLA 2LP3A 4JPZB 1JF0A 3SG5A 3DVMA 3EVRA 2QPTA 2CNPA 2CT9A 2LLSA 1F71A 2K7OA 1JFJA 1QX5B 2K7DA 2Y1MA 4I5LB 1CTRA 1M39A 4I5NB 3BUWB 3RM1A 4PE7A 2K7BA 3A8RA 3FWBA 3WHTB 1AP4A 1IH0A 4FQOA 3A4UB 2HPSA 4MSPA 1OOJA 5DKRA 4YI8A 2R2IA 1LKJA 1VRKA 4ZCVA 1LA0A 3TUYB 5HLOA 1J7QA 1DGUA 1AUIB 4OVNF 3TDIA 1CB1A 1AHRA 3PLFB 1TNWA 1FPWA 1F8HA 1C07A 5J3XA 2L0PA 3VGOA 5GQQC 1BMOA 1V1FA 1WRZA 2KQ6A 1Y1XA 2JPTA 1UHHA 4PE1A 1L7ZA 1W7IB 1OMVA 2KI4B 2LP2A 1QX2A 5G08A 3JVTB 1J1EA 2OS8B 2BKIB 1A2XA 2ZFDA 1S36A 1NCZA 1IRJA 1WY9A 2BCBA 3EVVA 4C0LA 2LE9B 3TZ1A 1K94A 4GUKA 4CFQA 1IKUA 1ZUZA 4YBHB 2LVJA 4U8DA 2BL0B 1TNXA 2M8UA 2PALA 3CZTX 3JTDB 3CTNA 1YVHA 4Q04A 2M97A 2M9GA 3NXAA 1KSMA 1QVIY 2SCPA 3D0YB 2ISDA 5JOLA 1RTP1 3BYAA 3NSIA 1F55A 3M0WA 2KOTA 5ER4X 3KEVA 2GGMA 1PK0D 1BF5A 2NZ0A 1SPYA 2Y1NA 1XFWO 4GPLB 1F4QA 1ZACA 3EKJA 1K9PA 2KAYA 3AAJA 4ORCB 4CLNA 1B9AA 1OZOA 1MR8A 2TN4A 1A75B 5KSZA 3FS7A 3VRPA 1SW8A 2LCPA 1L2OC 1FW4A 1BU3A 1WDCC 3IQOA 3CS1A 1NX1A 1YTZC 2KDHA 4CFRA 1UURA 2OTGC 5K89A 1JC2A 5AXIA 1AK8A 5HKZA 1N2DA 3DVJA 1BOCA 1QLSA 2FCEA 1E8AA 1SR6B 4GNKB 4NDBA 1JBAA 2AAOA 2KI4C 1U5IA 2GV5A 4QJ3B 2LMUA 1KFUS 5F6TA 2D8NA 4D1EA 4MRXA 1CLBA 3CR5X
chains in the Genus database with same CATH superfamily
3DZTA 3NGVA 3BUXB 4N1GA 3PFVA 1KQMC 1UHNA 2BBNA 4P5OE 4GBAA 1IQ3A 1A4PA 2SASA 2LMTA 3FWCA 2F33A 1Y0VH 2KNEA 2ZRSA 1PSBA 1UP5A 3KF9A 1B47A 1YUSA 3JTDC 3SS5A 1SCMB 2M1KB 2MJWB 2HQ8A 4MZKA 1KCYA 3PM2A 4MBEA 3E3RA 1C7VA 3I5HB 2LV7A 3SG4A 4D1EA 3CR2A 4M2PA 1ORGA 1SL7A 1TIZA 3NHTA 3BOWA 3F45A 3EVUA 1UHKA 1DQEA 1MXLC 1B8CA 2EC6B 2K8MB 3D74A 1JUOA 2WCJA 1IJ5A 5CPVA 3D0YA 2NXQA 5I2LA 3KO0A 3TDZA 1YX7A 2WORA 1EJ3A 2PVBA 4PCWA 2L50A 2BKHB 2GGZA 2LC5A 5HKWA 1BR1B 1QLKA 1SY9A 1LXFC 3AKBA 3D75A 3GK1A 5CSJA 3B6XA 1DJXA 2IS9A 3ZWHA 1KQVA 1B7TZ 3D73A 3QRXA 1Q80A 1DJIA 2Q91A 1PVAA 5DKNA 1JFKA 2KBMA 1KK8C 1QIWA 3OB2B 5FI7A 1SR6C 2F2PA 1WRLA 2FOTA 2MLEC 4M2QA 1EG4A 1IJ6A 2H2KA 3IQQA 2KPHA 2MHHA 3WHUB 1J1DA 1X02A 4AQIA 1QJTA 4MVFA 4GFTA 2V53A 4GGNA 2PSRA 2JTZA 2KI6D 1NUBA 3K1EA 1OOIX 1QXPA 3BJHA 1OSAA 1RROA 3LL8B 1GGWA 3BFBA 3BUNB 3LCPC 4E68A 2E6WA 3NSOA 1NWDA 1NSHA 5I8NA 1DELA 2BAPA 1H4BA 1EG3A 2M3WA 2JZIA 1RWYA 1K8UA 1OOFA 2K7CA 2LLTA 1WLZA 4P2YB 1YUTA 2LAPA 2PMYA 2VRGA 2AUCA 5CSFA 4USLA 1J55A 3R1PA 2EC6C 1DJHA 1LINA 4JQ0D 2G9BA 3SIBA 1M31A 2I7AA 1UUSA 4DUQA 1EH2A 2ZKMX 3OHMB 4OKHA 3RZSA 2HETA 2K2FA 1Y6WA 1S3PA 3TDUA 1GGZA 1G4YR 1RK9A 2BBMA 1S6IA 2MLFC 2QEOA 2EHBA 3VROA 1QS7A 3PALA 1LVCD 1SBJA 5JJGA 1CNPA 1GJYA 3I5GB 3LK0A 1GM0A 1IIOA 1NX3A 3UO9A 1KFXL 2RGIA 4WRIA 3SS4A 1S5GZ 3I5IB 1OQPA 5D7FA 2KGBC 1KWOB 2KAXA 3I5FB 2BCAA 2I18A 5FI2A 2AMIA 1YVLA 1RFJA 1DT7B 1SMGA 1DF0B 1N65A 2KQYA 4GGFA 1D1OA 1AJ5A 1CFPA 5ER5A 2JRFA 2KAVA 2WCMA 1K90D 1YURA 1CDLA 1K95A 1XK4C 1TCFA 2I94A 3CLNA 3AAKA 4ORBB 1K9UA 2HF5A 3WXAA 2KFGA 3OX6A 4NQGA 3TUYC 1UHIA 4YGAA 3OX5A 3OB1B 2L2EA 3TS5B 2F3ZA 2LUCA 1HQVA 1JWDA 4HREE 2K0JA 2K61A 1WRKA 1XK4A 1IQ5A 1CDPA 2KFFA 3KHEA 4HSZA 4AQJA 5B8IB 1H8BA 1XVJA 1NPQA 1Y1AA 3L4AA 3PN7B 4ZCUA 3DVKA 3SG2A 1RECA 1CDMA 1TWOA 1EXRA 1ALWA 1OZSA 3VRQA 4INWA 2LNKA 1IGVA 3JVTC 2OS8C 1TN4A 1OE9B 1ZMZA 3MSEB 4PE4A 2GTEA 2LHIA 3DYEA 3CR4X 4XJKB 2A4JA 3B86A 2ZNDA 1CM4A 4MZJA 4YGCB 2PYQA 4QJ4B 1B8RA 1BT6A 3UNWA 4MLWA 2WC5A 1QV1A 1F70A 1CM1A 2BL0C 1M45A 3GK4X 2WCLA 2L51A 2L4IA 3WNXB 3S0DA 2M49B 1QATA 3OGNA 5D69A 2LUXA 4QJ5B 3PM8A 2O60A 2QACA 3LLEA 2BE4A 1TNQA 2QDIA 4PALA 3VRNA 1AJ4A 2Q4UA 1CLMA 4BY4A 4C0KA 4YRUA 5HYDA 1BODA 2WCBA 3R1VA 2LM5A 3D78A 4A4BA 1S26D 1EL4A 1XA5A 2H8VA 2HQWA 1KWOC 2LVVA 4HRHA 2BE6A 3I5FC 2NCPA 4YGDB 1K9KA 2JT8A 5KTYA 2DOQA 1XFRA 1KSOA 3B7AA 3CDNA 1SCVA 4OR9B 3SG6A 2QEBA 1QASA 3D76A 2MBXA 4IL1A 1N0YA 1B8LA 1QTXA 1TUJA 2CXJA 1UHJA 1DGVA 2BNXA 4HRGA 1HT9A 2JWWA 1A03A 4I5KA 1XFZO 3EK8A 2JXCA 1A75A 1B7TY 1ZFSA 2F2OA 3IF7A 4ETOA 1BLQA 5AEQA 4F0ZB 1JF2A 2YGUA 4FQTA 1C7WA 1R2UA 2LANA 1XFXO 3O6BA 5HKYA 4WQ3A 1NCYA 2K2AA 4DS7A 2KLDA 1W9ZA 1OMDA 2KGRA 2Y5IA 3FIAA 3RLZA 1TNPA 1MQ1A 3CZ2A 1MXEA 1J7RA 4MRYA 4NDCA 3S0AA 3H4SE 1SK6D 3PATA 1B4CA 1KK7Z 2KLEA 4YI9A 2PASA 2KBIA 3V2LA 3QMEA 1FI6A 3BFHA 4INXA 2G2BA 4XJKA 4MEWA 5AERA 1K2HA 3BQ3A 1XFVO 3HX4A 2WC8A 1T14A 1SCMC 3IVTA 4ICBA 1C3YA 2WOSA 1AVSA 4BY5A 1SNLA 1J7PA 2M29A 3I5HC 1XFYO 1UWOA 1R6PA 2ZNEA 1LA3A 1PALA 4OCIA 1JSAA 1QX7A 1PSRA 3ICBA 1SRAA 4WQ2A 1F4OA 2JNFA 3BUMB 1IWQA 2QEHA 2PQLA 4MN0A 1L2OB 1KFUL 1QWVA 3DY9A 1QV0A 3FE6A 2KYFA 2P70A 1WDCB 4ORAB 2Y4QA 4C0JA 2WCHA 4F7FA 2M7LA 1FF1A 1U5IB 1DJGA 3CABA 2OTGB 3DF0B 1S1EA 3B88A 1CFCA 4L9MA 2JXLA 1XYDA 1M46A 1YRUB 2LVIA 3PJIA 2E30A 1TCOB 3EK4A 4GGFC 1TUZA 5CSNA 3FE8A 3SIAA 1Y1UA 1BR4B 5I2OA 4CPVA 1F54A 2JTTA 2H61C 4I5JA 1DC1A 2JPOA 2JT0A 3DXLA 1S5GY 3S0GA 1FBVA 1A29A 1DJZA 1S6CA 4PHNA 3ZNIA 1WLMA 4PE0A 2P71A 2WCEA 4JKTA 1NYAA 1PULA 1BJFA 1KQMB 2JULA 1XO5A 4NDDA 1SL9A 1YR5A 2H61A 1CFFA 2BECA 2M1UA 2KFHA 3BOWB 3FE9A 3K21A 3R1OA 3CYZA 3EK7A 4PE1A 1ODBA 3N7HA 1IG5A 4XYNA 1MWNA 2L5XB 1YUUA 3BXKA 3CWGA 1QVIZ 2F8PA 1TTXA 1Z2CB 1YX8A 2JC2A 3VB1A 5HLVA 2JNXA 3C1VA 1W7JB 1SSEB 2WCFA 2JT3A 3SG7A 3GK2A 2ZN9A 1SL8A 2L98A 1K96A 4GAOA 4M2OA 2QEVA 2ZN8A 5D3OA 3SG3A 5BPJA 2FJUB 3SJSA 3DVEA 4PHKA 2KSPA 4MZLA 3OP0A 3EKHA 2KI6C 3BUOB 3Q8IA 2L4HA 1G8IA 4UPGA 1XFUO 5AANA 2CTNA 3O4YA 2F3YA 3O2PA 1PRWA 1GQMA 3KPXA 1CKKA 1YRTB 5DKQA 2OPOA 1OOHA 2NLNA 1P28A 1NX0A 4OV2A 4CIDA 2I2RE 1S6JA 2NCOA 3LK1A 1MF8B 4IJ7A 1KK8B 1CMGA 1DVIA 1OOGA 2COLB 3AKAA 5TNCA 3VRRA 1Z4HA 3I5GC 1CDNA 4N5XA 4YGEB 4PHMA 2KHNA 3L47A 3DF0A 3I5IC 1OW4A 5CSIA 2EGDA 1J7OA 2KYCA 5PALA 1DTLA 1PVBA 2WCKA 3D10A 2WNDA 2O5GA 3HCMA 4DIRA 4DRWA 1MUXA 1MHOA 2JQ6A 3GOFA 4OZDA 1NIWA 1ZOTB 5AFPA 1CMFA 4AOMA 2MRDA 1TRFA 1DJYA 1CFDA 4A4CA 1DMOA 1NP8A 1NX2A 2CCMA 2PRUA 1SKTA 2BCXA 3NSLA 1M63B 1KFXS 4TNCA 2JOJA 1C3ZA 3O78A 1FI5A 3CGAA 2LMVA 1DJWA 1OMRA 3TS5C 1DF0A 2JU0A 2LVKA 1CLLA 3D77A 3NSKA 2MA2A 4JWQA 3PSRA 2ZRTA 4FTGA 2M0RA 1V1GA 2LLUA 5IBWA 3DD4A 2P6BB 1NCXA 1BG1A 3PN7C 4YGBB 1K93D 3S0EA 2M7NA 2FCDA 4N1FA 1SYMA 1RJVA 4DCKA 5FYXA 2MAZA 3S0BA 4PHJA 5I94A 5KU1A 2LHLA 2B1UA 1B1GA 1QIVA 3EG5B 1ALVA 4PDZA 1G33A 4R1EA 1KK7Y 2FJYA 1TOPA 2CBLA 2LP3A 4JPZB 1JF0A 3SG5A 3DVMA 3EVRA 2QPTA 2CNPA 2CT9A 2LLSA 1F71A 2K7OA 3O4XA 1JFJA 1QX5B 2K7DA 2Y1MA 5I2QA 4I5LB 1CTRA 1M39A 4I5NB 3BUWB 3RM1A 4PE7A 2K7BA 3A8RA 3FWBA 3WHTB 1AP4A 1IH0A 4FQOA 3A4UB 2HPSA 4MSPA 1OOJA 3L4LA 5DKRA 4YI8A 2R2IA 1LKJA 1VRKA 4ZCVA 1LA0A 3TUYB 5HLOA 1J7QA 4PT1A 1DGUA 1AUIB 2L2CA 4OVNF 3TDIA 1CB1A 1AHRA 2WC6A 3PLFB 1TNWA 1FPWA 3CZ0A 1F8HA 1C07A 5J3XA 2L0PA 3VGOA 5GQQC 1BMOA 1V1FA 1WRZA 2K60A 1Y1XA 2JPTA 1DEKA 1UHHA 2KQ6A 3B87A 1L7ZA 1W7IB 1OMVA 2KI4B 2LP2A 1QX2A 5EL2A 5G08A 3JVTB 5FI6A 1J1EA 2OS8B 2BKIB 5DICA 1A2XA 2ZFDA 1S36A 1NCZA 1IRJA 1WY9A 3BFAA 2BCBA 3EVVA 4C0LA 2LE9B 3TZ1A 1K94A 4GUKA 4CFQA 1IKUA 1ZUZA 4YBHB 3NHIA 2LVJA 4U8DA 2BL0B 1TNXA 2M8UA 3SS3A 2PALA 3CZTX 3JTDB 3CTNA 3OBVA 1YVHA 4Q04A 2M97A 2M9GA 3NXAA 1KSMA 1QVIY 2SCPA 3D0YB 2ISDA 5JOLA 1RTP1 3BYAA 3NSIA 1F55A 3M0WA 2KOTA 5ER4X 3KEVA 2GGMA 3S0FA 1PK0D 1BF5A 2NZ0A 1SPYA 2Y1NA 1XFWO 4JD9A 4GPLB 1F4QA 1ZACA 3EKJA 1K9PA 2KAYA 3AAJA 4ORCB 4CLNA 1B9AA 1OZOA 1MR8A 2L5YA 1A75B 2TN4A 3FS7A 3VRPA 5KSZA 1SW8A 2LCPA 1L2OC 1FW4A 1BU3A 3R72A 1WDCC 3IQOA 3CS1A 3CZ1A 1NX1A 1YTZC 1LS8A 2KDHA 4CFRA 1UURA 2ERBA 2OTGC 5K89A 1JC2A 5AXIA 1AK8A 5HKZA 1N2DA 3DVJA 1BOCA 1QLSA 2FCEA 1E8AA 1SR6B 4GNKB 4NDBA 1JBAA 2AAOA 2KI4C 1U5IA 2GV5A 4QJ3B 2LMUA 1KFUS 5HL1A 4KYNA 2D8NA 5F6TA 4MRXA 1CLBA 3CR5X
chains in the Genus database with same CATH topology
3BUXB 4N1GA 3PFVA 1KQMC 1UHNA 2BBNA 4P5OE 4GBAA 1IQ3A 1A4PA 2SASA 2LMTA 3FWCA 2F33A 1Y0VH 2KNEA 2ZRSA 1PSBA 1UP5A 3KF9A 1B47A 1YUSA 3JTDC 1SCMB 2M1KB 2MJWB 2HQ8A 4MZKA 1KCYA 4MBEA 3E3RA 1C7VA 3I5HB 2LV7A 3SG4A 3CR2A 4M2PA 1SL7A 1TIZA 3BOWA 3F45A 3EVUA 1UHKA 1MXLC 1B8CA 2EC6B 2K8MB 1JUOA 5CPVA 1IJ5A 3D0YA 2NXQA 5I2LA 3KO0A 3TDZA 1YX7A 2WORA 1EJ3A 2PVBA 4PCWA 2L50A 2BKHB 2GGZA 2LC5A 5HKWA 1BR1B 1QLKA 1SY9A 1LXFC 3AKBA 3GK1A 5CSJA 1DJXA 2IS9A 3ZWHA 1KQVA 1B7TZ 3QRXA 1Q80A 1DJIA 2Q91A 1PVAA 5DKNA 1JFKA 2KBMA 1KK8C 1QIWA 3OB2B 1SR6C 2F2PA 1WRLA 2FOTA 2MLEC 4M2QA 1EG4A 1IJ6A 2H2KA 3IQQA 2MHHA 3WHUB 1J1DA 1X02A 4AQIA 1QJTA 4MVFA 4GFTA 2V53A 4GGNA 2PSRA 2JTZA 2KI6D 1NUBA 1QXPA 1OSAA 1RROA 3LL8B 1GGWA 3BUNB 3LCPC 4E68A 2E6WA 3NSOA 1NWDA 1NSHA 5I8NA 1H4BA 1EG3A 2M3WA 2JZIA 1RWYA 1K8UA 2K7CA 2LLTA 1WLZA 4P2YB 1YUTA 2LAPA 2PMYA 2VRGA 2AUCA 5CSFA 4USLA 1J55A 2EC6C 1DJHA 1LINA 4JQ0D 2G9BA 3SIBA 1M31A 2I7AA 1UUSA 4DUQA 1EH2A 2ZKMX 3OHMB 4OKHA 2HETA 2K2FA 1Y6WA 1S3PA 3TDUA 1GGZA 1G4YR 1RK9A 2BBMA 1S6IA 2MLFC 3VROA 2EHBA 1QS7A 3PALA 1LVCD 1SBJA 5JJGA 1CNPA 1GJYA 3I5GB 3LK0A 1NX3A 1KFXL 2RGIA 4WRIA 1S5GZ 3I5IB 1OQPA 5D7FA 2KGBC 1KWOB 2KAXA 3I5FB 2BCAA 2I18A 2AMIA 1YVLA 1RFJA 1DT7B 1SMGA 1DF0B 1N65A 2KQYA 4GGFA 1D1OA 1AJ5A 1CFPA 5ER5A 2JRFA 2KAVA 1K90D 1YURA 1CDLA 1K95A 1XK4C 1TCFA 2I94A 3CLNA 3AAKA 4ORBB 1K9UA 2HF5A 3WXAA 2KFGA 3OX6A 4NQGA 3TUYC 1UHIA 4YGAA 3OX5A 3OB1B 2L2EA 3TS5B 2F3ZA 2LUCA 1HQVA 1JWDA 4HREE 2K0JA 2K61A 1WRKA 1XK4A 1IQ5A 1CDPA 2KFFA 3KHEA 4HSZA 4AQJA 5B8IB 1H8BA 1XVJA 1NPQA 1Y1AA 3PN7B 4ZCUA 3SG2A 3DVKA 1RECA 1CDMA 1EXRA 1ALWA 1OZSA 3VRQA 2LNKA 1IGVA 3JVTC 2OS8C 1TN4A 1OE9B 1ZMZA 3MSEB 4PE4A 4XJKB 2LHIA 3CR4X 2A4JA 2ZNDA 1CM4A 4MZJA 4YGCB 4QJ4B 1B8RA 1BT6A 4MLWA 1QV1A 1F70A 1CM1A 2BL0C 1M45A 3GK4X 2L51A 2L4IA 3WNXB 2M49B 1QATA 5D69A 2LUXA 4QJ5B 3PM8A 2O60A 2QACA 3LLEA 2BE4A 1TNQA 4PALA 3VRNA 5HYDA 1AJ4A 2Q4UA 1CLMA 4BY4A 4C0KA 4YRUA 1BODA 2WCBA 2LM5A 4A4BA 1S26D 1EL4A 1XA5A 2HQWA 2LVVA 1KWOC 4HRHA 4YGDB 2BE6A 3I5FC 2NCPA 1K9KA 2JT8A 5KTYA 2DOQA 1KSOA 1SCVA 4OR9B 3SG6A 1QASA 2MBXA 4IL1A 1N0YA 1B8LA 1QTXA 2CXJA 1UHJA 1DGVA 4HRGA 1HT9A 2JWWA 1A03A 4I5KA 1XFZO 3EK8A 2JXCA 1A75A 1B7TY 1ZFSA 2F2OA 3IF7A 4ETOA 1BLQA 5AEQA 4F0ZB 1JF2A 1C7WA 1R2UA 2LANA 1XFXO 3O6BA 5HKYA 4WQ3A 1NCYA 2K2AA 4DS7A 1OMDA 2KGRA 2Y5IA 3FIAA 3RLZA 1TNPA 1MQ1A 1MXEA 1J7RA 4MRYA 4NDCA 3H4SE 1SK6D 3PATA 1B4CA 1KK7Z 4YI9A 2PASA 2KBIA 1FI6A 2G2BA 4XJKA 4MEWA 5AERA 1K2HA 3BQ3A 1XFVO 3HX4A 2WC8A 1SCMC 4ICBA 2WOSA 1AVSA 4BY5A 1SNLA 1J7PA 2M29A 3I5HC 1XFYO 1UWOA 1R6PA 2ZNEA 1LA3A 1PALA 4OCIA 1JSAA 1QX7A 1PSRA 3ICBA 1SRAA 4WQ2A 1F4OA 2JNFA 3BUMB 1IWQA 4MN0A 1L2OB 1KFUL 1QV0A 4ORAB 2KYFA 1WDCB 4C0JA 2Y4QA 1FF1A 2M7LA 1U5IB 1DJGA 2OTGB 3DF0B 1S1EA 1CFCA 4L9MA 2JXLA 1XYDA 1M46A 1YRUB 2LVIA 2E30A 1TCOB 3EK4A 4GGFC 5CSNA 3SIAA 1Y1UA 1BR4B 5I2OA 4CPVA 1F54A 2JTTA 2H61C 4I5JA 2JT0A 1S5GY 1FBVA 1A29A 1DJZA 1S6CA 4PHNA 3ZNIA 1WLMA 4PE0A 2WCEA 1NYAA 1PULA 1BJFA 1KQMB 2JULA 1XO5A 4NDDA 1SL9A 1YR5A 2H61A 1CFFA 2BECA 2M1UA 2KFHA 3BOWB 3K21A 3EK7A 1ODBA 4XYNA 1IG5A 1MWNA 2L5XB 1YUUA 3BXKA 3CWGA 1QVIZ 2F8PA 1TTXA 1YX8A 2JC2A 5HLVA 2JNXA 3C1VA 1W7JB 2WCFA 2JT3A 3SG7A 3GK2A 2ZN9A 1SL8A 2L98A 1K96A 4GAOA 4M2OA 2ZN8A 3SG3A 5BPJA 2FJUB 3SJSA 3DVEA 4PHKA 2KSPA 4MZLA 3OP0A 3EKHA 2KI6C 3BUOB 2L4HA 1G8IA 4UPGA 1XFUO 5AANA 2CTNA 3O4YA 2F3YA 3O2PA 1PRWA 1GQMA 3KPXA 1CKKA 1YRTB 5DKQA 2OPOA 2NLNA 1NX0A 4OV2A 4CIDA 2I2RE 1S6JA 2NCOA 3LK1A 1MF8B 1KK8B 1CMGA 1DVIA 3AKAA 2COLB 5TNCA 3VRRA 1CDNA 3I5GC 4N5XA 4YGEB 4PHMA 2KHNA 3DF0A 3I5IC 5CSIA 2EGDA 1J7OA 2KYCA 5PALA 1DTLA 1PVBA 3D10A 2WNDA 2O5GA 3HCMA 4DIRA 4DRWA 1MUXA 1MHOA 2JQ6A 3GOFA 1NIWA 1ZOTB 5AFPA 1CMFA 4AOMA 2MRDA 1TRFA 1DJYA 1CFDA 4A4CA 1DMOA 1NP8A 1NX2A 2CCMA 2PRUA 1SKTA 2BCXA 3NSLA 1M63B 1KFXS 4TNCA 2JOJA 3O78A 1FI5A 3CGAA 2LMVA 1DJWA 1OMRA 3TS5C 1DF0A 2JU0A 2LVKA 1CLLA 3NSKA 5I2QA 2MA2A 4JWQA 3PSRA 2ZRTA 4FTGA 2M0RA 1V1GA 2LLUA 5IBWA 3DD4A 2P6BB 1NCXA 1BG1A 3PN7C 4YGBB 1K93D 2M7NA 2FCDA 4N1FA 1SYMA 1RJVA 4DCKA 5FYXA 2MAZA 4PHJA 5KU1A 2LHLA 2B1UA 1B1GA 1QIVA 1ALVA 4PDZA 1G33A 4R1EA 1KK7Y 1TOPA 2CBLA 2LP3A 4JPZB 1JF0A 3SG5A 3DVMA 3EVRA 2QPTA 2CNPA 2CT9A 2LLSA 1F71A 2K7OA 1JFJA 1QX5B 2K7DA 2Y1MA 4I5LB 1CTRA 1M39A 4I5NB 3BUWB 3RM1A 4PE7A 2K7BA 3A8RA 3FWBA 3WHTB 1AP4A 1IH0A 4FQOA 3A4UB 2HPSA 4MSPA 1OOJA 5DKRA 4YI8A 2R2IA 1LKJA 1VRKA 4ZCVA 1LA0A 3TUYB 5HLOA 1J7QA 1DGUA 1AUIB 4OVNF 3TDIA 1CB1A 1AHRA 3PLFB 1TNWA 1FPWA 1F8HA 1C07A 5J3XA 2L0PA 3VGOA 5GQQC 1BMOA 1V1FA 1WRZA 2KQ6A 1Y1XA 2JPTA 1UHHA 4PE1A 1L7ZA 1W7IB 1OMVA 2KI4B 2LP2A 1QX2A 5G08A 3JVTB 1J1EA 2OS8B 2BKIB 1A2XA 2ZFDA 1S36A 1NCZA 1IRJA 1WY9A 2BCBA 3EVVA 4C0LA 2LE9B 3TZ1A 1K94A 4GUKA 4CFQA 1IKUA 1ZUZA 4YBHB 2LVJA 4U8DA 2BL0B 1TNXA 2M8UA 2PALA 3CZTX 3JTDB 3CTNA 1YVHA 4Q04A 2M97A 2M9GA 3NXAA 1KSMA 1QVIY 2SCPA 3D0YB 2ISDA 5JOLA 1RTP1 3BYAA 3NSIA 1F55A 3M0WA 2KOTA 5ER4X 3KEVA 2GGMA 1PK0D 1BF5A 2NZ0A 1SPYA 2Y1NA 1XFWO 4GPLB 1F4QA 1ZACA 3EKJA 1K9PA 2KAYA 3AAJA 4ORCB 4CLNA 1B9AA 1OZOA 1MR8A 2TN4A 1A75B 5KSZA 3FS7A 3VRPA 1SW8A 2LCPA 1L2OC 1FW4A 1BU3A 1WDCC 3IQOA 3CS1A 1NX1A 1YTZC 2KDHA 4CFRA 1UURA 2OTGC 5K89A 1JC2A 5AXIA 1AK8A 5HKZA 1N2DA 3DVJA 1BOCA 1QLSA 2FCEA 1E8AA 1SR6B 4GNKB 4NDBA 1JBAA 2AAOA 2KI4C 1U5IA 2GV5A 4QJ3B 2LMUA 1KFUS 5F6TA 2D8NA 4D1EA 4MRXA 1CLBA 3CR5X
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BUX B;  4N1G A;  3PFV A;  1KQM C;  1UHN A;  2BBN A;  4P5O E;  4GBA A;  1IQ3 A;  1A4P A;  2SAS A;  2LMT A;  3FWC A;  2F33 A;  1Y0V H;  2KNE A;  2ZRS A;  1PSB A;  1UP5 A;  3KF9 A;  1B47 A;  1YUS A;  3JTD C;  1SCM B;  2M1K B;  2MJW B;  2HQ8 A;  4MZK A;  1KCY A;  4MBE A;  3E3R A;  1C7V A;  3I5H B;  2LV7 A;  3SG4 A;  3CR2 A;  4M2P A;  1SL7 A;  1TIZ A;  3BOW A;  3F45 A;  3EVU A;  1UHK A;  1MXL C;  1B8C A;  2EC6 B;  2K8M B;  1JUO A;  5CPV A;  1IJ5 A;  3D0Y A;  2NXQ A;  5I2L A;  3KO0 A;  3TDZ A;  1YX7 A;  2WOR A;  1EJ3 A;  2PVB A;  4PCW A;  2L50 A;  2BKH B;  2GGZ A;  2LC5 A;  5HKW A;  1BR1 B;  1QLK A;  1SY9 A;  1LXF C;  3AKB A;  3GK1 A;  5CSJ A;  1DJX A;  2IS9 A;  3ZWH A;  1KQV A;  1B7T Z;  3QRX A;  1Q80 A;  1DJI A;  2Q91 A;  1PVA A;  5DKN A;  1JFK A;  2KBM A;  1KK8 C;  1QIW A;  3OB2 B;  1SR6 C;  2F2P A;  1WRL A;  2FOT A;  2MLE C;  4M2Q A;  1EG4 A;  1IJ6 A;  2H2K A;  3IQQ A;  2MHH A;  3WHU B;  1J1D A;  1X02 A;  4AQI A;  1QJT A;  4MVF A;  4GFT A;  2V53 A;  4GGN A;  2PSR A;  2JTZ A;  2KI6 D;  1NUB A;  1QXP A;  1OSA A;  1RRO A;  3LL8 B;  1GGW A;  3BUN B;  3LCP C;  4E68 A;  2E6W A;  3NSO A;  1NWD A;  1NSH A;  5I8N A;  1H4B A;  1EG3 A;  2M3W A;  2JZI A;  1RWY A;  1K8U A;  2K7C A;  2LLT A;  1WLZ A;  4P2Y B;  1YUT A;  2LAP A;  2PMY A;  2VRG A;  2AUC A;  5CSF A;  4USL A;  1J55 A;  2EC6 C;  1DJH A;  1LIN A;  4JQ0 D;  2G9B A;  3SIB A;  1M31 A;  2I7A A;  1UUS A;  4DUQ A;  1EH2 A;  2ZKM X;  3OHM B;  4OKH A;  2HET A;  2K2F A;  1Y6W A;  1S3P A;  3TDU A;  1GGZ A;  1G4Y R;  1RK9 A;  2BBM A;  1S6I A;  2MLF C;  3VRO A;  2EHB A;  1QS7 A;  3PAL A;  1LVC D;  1SBJ A;  5JJG A;  1CNP A;  1GJY A;  3I5G B;  3LK0 A;  1NX3 A;  1KFX L;  2RGI A;  4WRI A;  1S5G Z;  3I5I B;  1OQP A;  5D7F A;  2KGB C;  1KWO B;  2KAX A;  3I5F B;  2BCA A;  2I18 A;  2AMI A;  1YVL A;  1RFJ A;  1DT7 B;  1SMG A;  1DF0 B;  1N65 A;  2KQY A;  4GGF A;  1D1O A;  1AJ5 A;  1CFP A;  5ER5 A;  2JRF A;  2KAV A;  1K90 D;  1YUR A;  1CDL A;  1K95 A;  1XK4 C;  1TCF A;  2I94 A;  3CLN A;  3AAK A;  4ORB B;  1K9U A;  2HF5 A;  3WXA A;  2KFG A;  3OX6 A;  4NQG A;  3TUY C;  1UHI A;  4YGA A;  3OX5 A;  3OB1 B;  2L2E A;  3TS5 B;  2F3Z A;  2LUC A;  1HQV A;  1JWD A;  4HRE E;  2K0J A;  2K61 A;  1WRK A;  1XK4 A;  1IQ5 A;  1CDP A;  2KFF A;  3KHE A;  4HSZ A;  4AQJ A;  5B8I B;  1H8B A;  1XVJ A;  1NPQ A;  1Y1A A;  3PN7 B;  4ZCU A;  3SG2 A;  3DVK A;  1REC A;  1CDM A;  1EXR A;  1ALW A;  1OZS A;  3VRQ A;  2LNK A;  1IGV A;  3JVT C;  2OS8 C;  1TN4 A;  1OE9 B;  1ZMZ A;  3MSE B;  4PE4 A;  4XJK B;  2LHI A;  3CR4 X;  2A4J A;  2ZND A;  1CM4 A;  4MZJ A;  4YGC B;  4QJ4 B;  1B8R A;  1BT6 A;  4MLW A;  1QV1 A;  1F70 A;  1CM1 A;  2BL0 C;  1M45 A;  3GK4 X;  2L51 A;  2L4I A;  3WNX B;  2M49 B;  1QAT A;  5D69 A;  2LUX A;  4QJ5 B;  3PM8 A;  2O60 A;  2QAC A;  3LLE A;  2BE4 A;  1TNQ A;  4PAL A;  3VRN A;  5HYD A;  1AJ4 A;  2Q4U A;  1CLM A;  4BY4 A;  4C0K A;  4YRU A;  1BOD A;  2WCB A;  2LM5 A;  4A4B A;  1S26 D;  1EL4 A;  1XA5 A;  2HQW A;  2LVV A;  1KWO C;  4HRH A;  4YGD B;  2BE6 A;  3I5F C;  2NCP A;  1K9K A;  2JT8 A;  5KTY A;  2DOQ A;  1KSO A;  1SCV A;  4OR9 B;  3SG6 A;  1QAS A;  2MBX A;  4IL1 A;  1N0Y A;  1B8L A;  1QTX A;  2CXJ A;  1UHJ A;  1DGV A;  4HRG A;  1HT9 A;  2JWW A;  1A03 A;  4I5K A;  1XFZ O;  3EK8 A;  2JXC A;  1A75 A;  1B7T Y;  1ZFS A;  2F2O A;  3IF7 A;  4ETO A;  1BLQ A;  5AEQ A;  4F0Z B;  1JF2 A;  1C7W A;  1R2U A;  2LAN A;  1XFX O;  3O6B A;  5HKY A;  4WQ3 A;  1NCY A;  2K2A A;  4DS7 A;  1OMD A;  2KGR A;  2Y5I A;  3FIA A;  3RLZ A;  1TNP A;  1MQ1 A;  1MXE A;  1J7R A;  4MRY A;  4NDC A;  3H4S E;  1SK6 D;  3PAT A;  1B4C A;  1KK7 Z;  4YI9 A;  2PAS A;  2KBI A;  1FI6 A;  2G2B A;  4XJK A;  4MEW A;  5AER A;  1K2H A;  3BQ3 A;  1XFV O;  3HX4 A;  2WC8 A;  1SCM C;  4ICB A;  2WOS A;  1AVS A;  4BY5 A;  1SNL A;  1J7P A;  2M29 A;  3I5H C;  1XFY O;  1UWO A;  1R6P A;  2ZNE A;  1LA3 A;  1PAL A;  4OCI A;  1JSA A;  1QX7 A;  1PSR A;  3ICB A;  1SRA A;  4WQ2 A;  1F4O A;  2JNF A;  3BUM B;  1IWQ A;  4MN0 A;  1L2O B;  1KFU L;  1QV0 A;  4ORA B;  2KYF A;  1WDC B;  4C0J A;  2Y4Q A;  1FF1 A;  2M7L A;  1U5I B;  1DJG A;  2OTG B;  3DF0 B;  1S1E A;  1CFC A;  4L9M A;  2JXL A;  1XYD A;  1M46 A;  1YRU B;  2LVI A;  2E30 A;  1TCO B;  3EK4 A;  4GGF C;  5CSN A;  3SIA A;  1Y1U A;  1BR4 B;  5I2O A;  4CPV A;  1F54 A;  2JTT A;  2H61 C;  4I5J A;  2JT0 A;  1S5G Y;  1FBV A;  1A29 A;  1DJZ A;  1S6C A;  4PHN A;  3ZNI A;  1WLM A;  4PE0 A;  2WCE A;  1NYA A;  1PUL A;  1BJF A;  1KQM B;  2JUL A;  1XO5 A;  4NDD A;  1SL9 A;  1YR5 A;  2H61 A;  1CFF A;  2BEC A;  2M1U A;  2KFH A;  3BOW B;  3K21 A;  3EK7 A;  1ODB A;  4XYN A;  1IG5 A;  1MWN A;  2L5X B;  1YUU A;  3BXK A;  3CWG A;  1QVI Z;  2F8P A;  1TTX A;  1YX8 A;  2JC2 A;  5HLV A;  2JNX A;  3C1V A;  1W7J B;  2WCF A;  2JT3 A;  3SG7 A;  3GK2 A;  2ZN9 A;  1SL8 A;  2L98 A;  1K96 A;  4GAO A;  4M2O A;  2ZN8 A;  3SG3 A;  5BPJ A;  2FJU B;  3SJS A;  3DVE A;  4PHK A;  2KSP A;  4MZL A;  3OP0 A;  3EKH A;  2KI6 C;  3BUO B;  2L4H A;  1G8I A;  4UPG A;  1XFU O;  5AAN A;  2CTN A;  3O4Y A;  2F3Y A;  3O2P A;  1PRW A;  1GQM A;  3KPX A;  1CKK A;  1YRT B;  5DKQ A;  2OPO A;  2NLN A;  1NX0 A;  4OV2 A;  4CID A;  2I2R E;  1S6J A;  2NCO A;  3LK1 A;  1MF8 B;  1KK8 B;  1CMG A;  1DVI A;  3AKA A;  2COL B;  5TNC A;  3VRR A;  1CDN A;  3I5G C;  4N5X A;  4YGE B;  4PHM A;  2KHN A;  3DF0 A;  3I5I C;  5CSI A;  2EGD A;  1J7O A;  2KYC A;  5PAL A;  1DTL A;  1PVB A;  3D10 A;  2WND A;  2O5G A;  3HCM A;  4DIR A;  4DRW A;  1MUX A;  1MHO A;  2JQ6 A;  3GOF A;  1NIW A;  1ZOT B;  5AFP A;  1CMF A;  4AOM A;  2MRD A;  1TRF A;  1DJY A;  1CFD A;  4A4C A;  1DMO A;  1NP8 A;  1NX2 A;  2CCM A;  2PRU A;  1SKT A;  2BCX A;  3NSL A;  1M63 B;  1KFX S;  4TNC A;  2JOJ A;  3O78 A;  1FI5 A;  3CGA A;  2LMV A;  1DJW A;  1OMR A;  3TS5 C;  1DF0 A;  2JU0 A;  2LVK A;  1CLL A;  3NSK A;  5I2Q A;  2MA2 A;  4JWQ A;  3PSR A;  2ZRT A;  4FTG A;  2M0R A;  1V1G A;  2LLU A;  5IBW A;  3DD4 A;  2P6B B;  1NCX A;  1BG1 A;  3PN7 C;  4YGB B;  1K93 D;  2M7N A;  2FCD A;  4N1F A;  1SYM A;  1RJV A;  4DCK A;  5FYX A;  2MAZ A;  4PHJ A;  5KU1 A;  2LHL A;  2B1U A;  1B1G A;  1QIV A;  1ALV A;  4PDZ A;  1G33 A;  4R1E A;  1KK7 Y;  1TOP A;  2CBL A;  2LP3 A;  4JPZ B;  1JF0 A;  3SG5 A;  3DVM A;  3EVR A;  2QPT A;  2CNP A;  2CT9 A;  2LLS A;  1F71 A;  2K7O A;  1JFJ A;  1QX5 B;  2K7D A;  2Y1M A;  4I5L B;  1CTR A;  1M39 A;  4I5N B;  3BUW B;  3RM1 A;  4PE7 A;  2K7B A;  3A8R A;  3FWB A;  3WHT B;  1AP4 A;  1IH0 A;  4FQO A;  3A4U B;  2HPS A;  4MSP A;  1OOJ A;  5DKR A;  4YI8 A;  2R2I A;  1LKJ A;  1VRK A;  4ZCV A;  1LA0 A;  3TUY B;  5HLO A;  1J7Q A;  1DGU A;  1AUI B;  4OVN F;  3TDI A;  1CB1 A;  1AHR A;  3PLF B;  1TNW A;  1FPW A;  1F8H A;  1C07 A;  5J3X A;  2L0P A;  3VGO A;  5GQQ C;  1BMO A;  1V1F A;  1WRZ A;  2KQ6 A;  1Y1X A;  2JPT A;  1UHH A;  4PE1 A;  1L7Z A;  1W7I B;  1OMV A;  2KI4 B;  2LP2 A;  1QX2 A;  5G08 A;  3JVT B;  1J1E A;  2OS8 B;  2BKI B;  1A2X A;  2ZFD A;  1S36 A;  1NCZ A;  1IRJ A;  1WY9 A;  2BCB A;  3EVV A;  4C0L A;  2LE9 B;  3TZ1 A;  1K94 A;  4GUK A;  4CFQ A;  1IKU A;  1ZUZ A;  4YBH B;  2LVJ A;  4U8D A;  2BL0 B;  1TNX A;  2M8U A;  2PAL A;  3CZT X;  3JTD B;  3CTN A;  1YVH A;  4Q04 A;  2M97 A;  2M9G A;  3NXA A;  1KSM A;  1QVI Y;  2SCP A;  3D0Y B;  2ISD A;  5JOL A;  1RTP 1;  3BYA A;  3NSI A;  1F55 A;  3M0W A;  2KOT A;  5ER4 X;  3KEV A;  2GGM A;  1PK0 D;  1BF5 A;  2NZ0 A;  1SPY A;  2Y1N A;  1XFW O;  4GPL B;  1F4Q A;  1ZAC A;  3EKJ A;  1K9P A;  2KAY A;  3AAJ A;  4ORC B;  4CLN A;  1B9A A;  1OZO A;  1MR8 A;  2TN4 A;  1A75 B;  5KSZ A;  3FS7 A;  3VRP A;  1SW8 A;  2LCP A;  1L2O C;  1FW4 A;  1BU3 A;  1WDC C;  3IQO A;  3CS1 A;  1NX1 A;  1YTZ C;  2KDH A;  4CFR A;  1UUR A;  2OTG C;  5K89 A;  1JC2 A;  5AXI A;  1AK8 A;  5HKZ A;  1N2D A;  3DVJ A;  1BOC A;  1QLS A;  2FCE A;  1E8A A;  1SR6 B;  4GNK B;  4NDB A;  1JBA A;  2AAO A;  2KI4 C;  1U5I A;  2GV5 A;  4QJ3 B;  2LMU A;  1KFU S;  5F6T A;  2D8N A;  4D1E A;  4MRX A;  1CLB A;  3CR5 X; 
#chains in the Genus database with same CATH topology
 3DZT A;  3NGV A;  3BUX B;  4N1G A;  3PFV A;  1KQM C;  1UHN A;  2BBN A;  4P5O E;  4GBA A;  1IQ3 A;  1A4P A;  2SAS A;  2LMT A;  3FWC A;  2F33 A;  1Y0V H;  2KNE A;  2ZRS A;  1PSB A;  1UP5 A;  3KF9 A;  1B47 A;  1YUS A;  3JTD C;  3SS5 A;  1SCM B;  2M1K B;  2MJW B;  2HQ8 A;  4MZK A;  1KCY A;  3PM2 A;  4MBE A;  3E3R A;  1C7V A;  3I5H B;  2LV7 A;  3SG4 A;  4D1E A;  3CR2 A;  4M2P A;  1ORG A;  1SL7 A;  1TIZ A;  3NHT A;  3BOW A;  3F45 A;  3EVU A;  1UHK A;  1DQE A;  1MXL C;  1B8C A;  2EC6 B;  2K8M B;  3D74 A;  1JUO A;  2WCJ A;  1IJ5 A;  5CPV A;  3D0Y A;  2NXQ A;  5I2L A;  3KO0 A;  3TDZ A;  1YX7 A;  2WOR A;  1EJ3 A;  2PVB A;  4PCW A;  2L50 A;  2BKH B;  2GGZ A;  2LC5 A;  5HKW A;  1BR1 B;  1QLK A;  1SY9 A;  1LXF C;  3AKB A;  3D75 A;  3GK1 A;  5CSJ A;  3B6X A;  1DJX A;  2IS9 A;  3ZWH A;  1KQV A;  1B7T Z;  3D73 A;  3QRX A;  1Q80 A;  1DJI A;  2Q91 A;  1PVA A;  5DKN A;  1JFK A;  2KBM A;  1KK8 C;  1QIW A;  3OB2 B;  5FI7 A;  1SR6 C;  2F2P A;  1WRL A;  2FOT A;  2MLE C;  4M2Q A;  1EG4 A;  1IJ6 A;  2H2K A;  3IQQ A;  2KPH A;  2MHH A;  3WHU B;  1J1D A;  1X02 A;  4AQI A;  1QJT A;  4MVF A;  4GFT A;  2V53 A;  4GGN A;  2PSR A;  2JTZ A;  2KI6 D;  1NUB A;  3K1E A;  1OOI X;  1QXP A;  3BJH A;  1OSA A;  1RRO A;  3LL8 B;  1GGW A;  3BFB A;  3BUN B;  3LCP C;  4E68 A;  2E6W A;  3NSO A;  1NWD A;  1NSH A;  5I8N A;  1DEL A;  2BAP A;  1H4B A;  1EG3 A;  2M3W A;  2JZI A;  1RWY A;  1K8U A;  1OOF A;  2K7C A;  2LLT A;  1WLZ A;  4P2Y B;  1YUT A;  2LAP A;  2PMY A;  2VRG A;  2AUC A;  5CSF A;  4USL A;  1J55 A;  3R1P A;  2EC6 C;  1DJH A;  1LIN A;  4JQ0 D;  2G9B A;  3SIB A;  1M31 A;  2I7A A;  1UUS A;  4DUQ A;  1EH2 A;  2ZKM X;  3OHM B;  4OKH A;  3RZS A;  2HET A;  2K2F A;  1Y6W A;  1S3P A;  3TDU A;  1GGZ A;  1G4Y R;  1RK9 A;  2BBM A;  1S6I A;  2MLF C;  2QEO A;  2EHB A;  3VRO A;  1QS7 A;  3PAL A;  1LVC D;  1SBJ A;  5JJG A;  1CNP A;  1GJY A;  3I5G B;  3LK0 A;  1GM0 A;  1IIO A;  1NX3 A;  3UO9 A;  1KFX L;  2RGI A;  4WRI A;  3SS4 A;  1S5G Z;  3I5I B;  1OQP A;  5D7F A;  2KGB C;  1KWO B;  2KAX A;  3I5F B;  2BCA A;  2I18 A;  5FI2 A;  2AMI A;  1YVL A;  1RFJ A;  1DT7 B;  1SMG A;  1DF0 B;  1N65 A;  2KQY A;  4GGF A;  1D1O A;  1AJ5 A;  1CFP A;  5ER5 A;  2JRF A;  2KAV A;  2WCM A;  1K90 D;  1YUR A;  1CDL A;  1K95 A;  1XK4 C;  1TCF A;  2I94 A;  3CLN A;  3AAK A;  4ORB B;  1K9U A;  2HF5 A;  3WXA A;  2KFG A;  3OX6 A;  4NQG A;  3TUY C;  1UHI A;  4YGA A;  3OX5 A;  3OB1 B;  2L2E A;  3TS5 B;  2F3Z A;  2LUC A;  1HQV A;  1JWD A;  4HRE E;  2K0J A;  2K61 A;  1WRK A;  1XK4 A;  1IQ5 A;  1CDP A;  2KFF A;  3KHE A;  4HSZ A;  4AQJ A;  5B8I B;  1H8B A;  1XVJ A;  1NPQ A;  1Y1A A;  3L4A A;  3PN7 B;  4ZCU A;  3DVK A;  3SG2 A;  1REC A;  1CDM A;  1TWO A;  1EXR A;  1ALW A;  1OZS A;  3VRQ A;  4INW A;  2LNK A;  1IGV A;  3JVT C;  2OS8 C;  1TN4 A;  1OE9 B;  1ZMZ A;  3MSE B;  4PE4 A;  2GTE A;  2LHI A;  3DYE A;  3CR4 X;  4XJK B;  2A4J A;  3B86 A;  2ZND A;  1CM4 A;  4MZJ A;  4YGC B;  2PYQ A;  4QJ4 B;  1B8R A;  1BT6 A;  3UNW A;  4MLW A;  2WC5 A;  1QV1 A;  1F70 A;  1CM1 A;  2BL0 C;  1M45 A;  3GK4 X;  2WCL A;  2L51 A;  2L4I A;  3WNX B;  3S0D A;  2M49 B;  1QAT A;  3OGN A;  5D69 A;  2LUX A;  4QJ5 B;  3PM8 A;  2O60 A;  2QAC A;  3LLE A;  2BE4 A;  1TNQ A;  2QDI A;  4PAL A;  3VRN A;  1AJ4 A;  2Q4U A;  1CLM A;  4BY4 A;  4C0K A;  4YRU A;  5HYD A;  1BOD A;  2WCB A;  3R1V A;  2LM5 A;  3D78 A;  4A4B A;  1S26 D;  1EL4 A;  1XA5 A;  2H8V A;  2HQW A;  1KWO C;  2LVV A;  4HRH A;  2BE6 A;  3I5F C;  2NCP A;  4YGD B;  1K9K A;  2JT8 A;  5KTY A;  2DOQ A;  1XFR A;  1KSO A;  3B7A A;  3CDN A;  1SCV A;  4OR9 B;  3SG6 A;  2QEB A;  1QAS A;  3D76 A;  2MBX A;  4IL1 A;  1N0Y A;  1B8L A;  1QTX A;  1TUJ A;  2CXJ A;  1UHJ A;  1DGV A;  2BNX A;  4HRG A;  1HT9 A;  2JWW A;  1A03 A;  4I5K A;  1XFZ O;  3EK8 A;  2JXC A;  1A75 A;  1B7T Y;  1ZFS A;  2F2O A;  3IF7 A;  4ETO A;  1BLQ A;  5AEQ A;  4F0Z B;  1JF2 A;  2YGU A;  4FQT A;  1C7W A;  1R2U A;  2LAN A;  1XFX O;  3O6B A;  5HKY A;  4WQ3 A;  1NCY A;  2K2A A;  4DS7 A;  2KLD A;  1W9Z A;  1OMD A;  2KGR A;  2Y5I A;  3FIA A;  3RLZ A;  1TNP A;  1MQ1 A;  3CZ2 A;  1MXE A;  1J7R A;  4MRY A;  4NDC A;  3S0A A;  3H4S E;  1SK6 D;  3PAT A;  1B4C A;  1KK7 Z;  2KLE A;  4YI9 A;  2PAS A;  2KBI A;  3V2L A;  3QME A;  1FI6 A;  3BFH A;  4INX A;  2G2B A;  4XJK A;  4MEW A;  5AER A;  1K2H A;  3BQ3 A;  1XFV O;  3HX4 A;  2WC8 A;  1T14 A;  1SCM C;  3IVT A;  4ICB A;  1C3Y A;  2WOS A;  1AVS A;  4BY5 A;  1SNL A;  1J7P A;  2M29 A;  3I5H C;  1XFY O;  1UWO A;  1R6P A;  2ZNE A;  1LA3 A;  1PAL A;  4OCI A;  1JSA A;  1QX7 A;  1PSR A;  3ICB A;  1SRA A;  4WQ2 A;  1F4O A;  2JNF A;  3BUM B;  1IWQ A;  2QEH A;  2PQL A;  4MN0 A;  1L2O B;  1KFU L;  1QWV A;  3DY9 A;  1QV0 A;  3FE6 A;  2KYF A;  2P70 A;  1WDC B;  4ORA B;  2Y4Q A;  4C0J A;  2WCH A;  4F7F A;  2M7L A;  1FF1 A;  1U5I B;  1DJG A;  3CAB A;  2OTG B;  3DF0 B;  1S1E A;  3B88 A;  1CFC A;  4L9M A;  2JXL A;  1XYD A;  1M46 A;  1YRU B;  2LVI A;  3PJI A;  2E30 A;  1TCO B;  3EK4 A;  4GGF C;  1TUZ A;  5CSN A;  3FE8 A;  3SIA A;  1Y1U A;  1BR4 B;  5I2O A;  4CPV A;  1F54 A;  2JTT A;  2H61 C;  4I5J A;  1DC1 A;  2JPO A;  2JT0 A;  3DXL A;  1S5G Y;  3S0G A;  1FBV A;  1A29 A;  1DJZ A;  1S6C A;  4PHN A;  3ZNI A;  1WLM A;  4PE0 A;  2P71 A;  2WCE A;  4JKT A;  1NYA A;  1PUL A;  1BJF A;  1KQM B;  2JUL A;  1XO5 A;  4NDD A;  1SL9 A;  1YR5 A;  2H61 A;  1CFF A;  2BEC A;  2M1U A;  2KFH A;  3BOW B;  3FE9 A;  3K21 A;  3R1O A;  3CYZ A;  3EK7 A;  4PE1 A;  1ODB A;  3N7H A;  1IG5 A;  4XYN A;  1MWN A;  2L5X B;  1YUU A;  3BXK A;  3CWG A;  1QVI Z;  2F8P A;  1TTX A;  1Z2C B;  1YX8 A;  2JC2 A;  3VB1 A;  5HLV A;  2JNX A;  3C1V A;  1W7J B;  1SSE B;  2WCF A;  2JT3 A;  3SG7 A;  3GK2 A;  2ZN9 A;  1SL8 A;  2L98 A;  1K96 A;  4GAO A;  4M2O A;  2QEV A;  2ZN8 A;  5D3O A;  3SG3 A;  5BPJ A;  2FJU B;  3SJS A;  3DVE A;  4PHK A;  2KSP A;  4MZL A;  3OP0 A;  3EKH A;  2KI6 C;  3BUO B;  3Q8I A;  2L4H A;  1G8I A;  4UPG A;  1XFU O;  5AAN A;  2CTN A;  3O4Y A;  2F3Y A;  3O2P A;  1PRW A;  1GQM A;  3KPX A;  1CKK A;  1YRT B;  5DKQ A;  2OPO A;  1OOH A;  2NLN A;  1P28 A;  1NX0 A;  4OV2 A;  4CID A;  2I2R E;  1S6J A;  2NCO A;  3LK1 A;  1MF8 B;  4IJ7 A;  1KK8 B;  1CMG A;  1DVI A;  1OOG A;  2COL B;  3AKA A;  5TNC A;  3VRR A;  1Z4H A;  3I5G C;  1CDN A;  4N5X A;  4YGE B;  4PHM A;  2KHN A;  3L47 A;  3DF0 A;  3I5I C;  1OW4 A;  5CSI A;  2EGD A;  1J7O A;  2KYC A;  5PAL A;  1DTL A;  1PVB A;  2WCK A;  3D10 A;  2WND A;  2O5G A;  3HCM A;  4DIR A;  4DRW A;  1MUX A;  1MHO A;  2JQ6 A;  3GOF A;  4OZD A;  1NIW A;  1ZOT B;  5AFP A;  1CMF A;  4AOM A;  2MRD A;  1TRF A;  1DJY A;  1CFD A;  4A4C A;  1DMO A;  1NP8 A;  1NX2 A;  2CCM A;  2PRU A;  1SKT A;  2BCX A;  3NSL A;  1M63 B;  1KFX S;  4TNC A;  2JOJ A;  1C3Z A;  3O78 A;  1FI5 A;  3CGA A;  2LMV A;  1DJW A;  1OMR A;  3TS5 C;  1DF0 A;  2JU0 A;  2LVK A;  1CLL A;  3D77 A;  3NSK A;  2MA2 A;  4JWQ A;  3PSR A;  2ZRT A;  4FTG A;  2M0R A;  1V1G A;  2LLU A;  5IBW A;  3DD4 A;  2P6B B;  1NCX A;  1BG1 A;  3PN7 C;  4YGB B;  1K93 D;  3S0E A;  2M7N A;  2FCD A;  4N1F A;  1SYM A;  1RJV A;  4DCK A;  5FYX A;  2MAZ A;  3S0B A;  4PHJ A;  5I94 A;  5KU1 A;  2LHL A;  2B1U A;  1B1G A;  1QIV A;  3EG5 B;  1ALV A;  4PDZ A;  1G33 A;  4R1E A;  1KK7 Y;  2FJY A;  1TOP A;  2CBL A;  2LP3 A;  4JPZ B;  1JF0 A;  3SG5 A;  3DVM A;  3EVR A;  2QPT A;  2CNP A;  2CT9 A;  2LLS A;  1F71 A;  2K7O A;  3O4X A;  1JFJ A;  1QX5 B;  2K7D A;  2Y1M A;  5I2Q A;  4I5L B;  1CTR A;  1M39 A;  4I5N B;  3BUW B;  3RM1 A;  4PE7 A;  2K7B A;  3A8R A;  3FWB A;  3WHT B;  1AP4 A;  1IH0 A;  4FQO A;  3A4U B;  2HPS A;  4MSP A;  1OOJ A;  3L4L A;  5DKR A;  4YI8 A;  2R2I A;  1LKJ A;  1VRK A;  4ZCV A;  1LA0 A;  3TUY B;  5HLO A;  1J7Q A;  4PT1 A;  1DGU A;  1AUI B;  2L2C A;  4OVN F;  3TDI A;  1CB1 A;  1AHR A;  2WC6 A;  3PLF B;  1TNW A;  1FPW A;  3CZ0 A;  1F8H A;  1C07 A;  5J3X A;  2L0P A;  3VGO A;  5GQQ C;  1BMO A;  1V1F A;  1WRZ A;  2K60 A;  1Y1X A;  2JPT A;  1DEK A;  1UHH A;  2KQ6 A;  3B87 A;  1L7Z A;  1W7I B;  1OMV A;  2KI4 B;  2LP2 A;  1QX2 A;  5EL2 A;  5G08 A;  3JVT B;  5FI6 A;  1J1E A;  2OS8 B;  2BKI B;  5DIC A;  1A2X A;  2ZFD A;  1S36 A;  1NCZ A;  1IRJ A;  1WY9 A;  3BFA A;  2BCB A;  3EVV A;  4C0L A;  2LE9 B;  3TZ1 A;  1K94 A;  4GUK A;  4CFQ A;  1IKU A;  1ZUZ A;  4YBH B;  3NHI A;  2LVJ A;  4U8D A;  2BL0 B;  1TNX A;  2M8U A;  3SS3 A;  2PAL A;  3CZT X;  3JTD B;  3CTN A;  3OBV A;  1YVH A;  4Q04 A;  2M97 A;  2M9G A;  3NXA A;  1KSM A;  1QVI Y;  2SCP A;  3D0Y B;  2ISD A;  5JOL A;  1RTP 1;  3BYA A;  3NSI A;  1F55 A;  3M0W A;  2KOT A;  5ER4 X;  3KEV A;  2GGM A;  3S0F A;  1PK0 D;  1BF5 A;  2NZ0 A;  1SPY A;  2Y1N A;  1XFW O;  4JD9 A;  4GPL B;  1F4Q A;  1ZAC A;  3EKJ A;  1K9P A;  2KAY A;  3AAJ A;  4ORC B;  4CLN A;  1B9A A;  1OZO A;  1MR8 A;  2L5Y A;  1A75 B;  2TN4 A;  3FS7 A;  3VRP A;  5KSZ A;  1SW8 A;  2LCP A;  1L2O C;  1FW4 A;  1BU3 A;  3R72 A;  1WDC C;  3IQO A;  3CS1 A;  3CZ1 A;  1NX1 A;  1YTZ C;  1LS8 A;  2KDH A;  4CFR A;  1UUR A;  2ERB A;  2OTG C;  5K89 A;  1JC2 A;  5AXI A;  1AK8 A;  5HKZ A;  1N2D A;  3DVJ A;  1BOC A;  1QLS A;  2FCE A;  1E8A A;  1SR6 B;  4GNK B;  4NDB A;  1JBA A;  2AAO A;  2KI4 C;  1U5I A;  2GV5 A;  4QJ3 B;  2LMU A;  1KFU S;  5HL1 A;  4KYN A;  2D8N A;  5F6T A;  4MRX A;  1CLB A;  3CR5 X; 
#chains in the Genus database with same CATH homology
 3BUX B;  4N1G A;  3PFV A;  1KQM C;  1UHN A;  2BBN A;  4P5O E;  4GBA A;  1IQ3 A;  1A4P A;  2SAS A;  2LMT A;  3FWC A;  2F33 A;  1Y0V H;  2KNE A;  2ZRS A;  1PSB A;  1UP5 A;  3KF9 A;  1B47 A;  1YUS A;  3JTD C;  1SCM B;  2M1K B;  2MJW B;  2HQ8 A;  4MZK A;  1KCY A;  4MBE A;  3E3R A;  1C7V A;  3I5H B;  2LV7 A;  3SG4 A;  3CR2 A;  4M2P A;  1SL7 A;  1TIZ A;  3BOW A;  3F45 A;  3EVU A;  1UHK A;  1MXL C;  1B8C A;  2EC6 B;  2K8M B;  1JUO A;  5CPV A;  1IJ5 A;  3D0Y A;  2NXQ A;  5I2L A;  3KO0 A;  3TDZ A;  1YX7 A;  2WOR A;  1EJ3 A;  2PVB A;  4PCW A;  2L50 A;  2BKH B;  2GGZ A;  2LC5 A;  5HKW A;  1BR1 B;  1QLK A;  1SY9 A;  1LXF C;  3AKB A;  3GK1 A;  5CSJ A;  1DJX A;  2IS9 A;  3ZWH A;  1KQV A;  1B7T Z;  3QRX A;  1Q80 A;  1DJI A;  2Q91 A;  1PVA A;  5DKN A;  1JFK A;  2KBM A;  1KK8 C;  1QIW A;  3OB2 B;  1SR6 C;  2F2P A;  1WRL A;  2FOT A;  2MLE C;  4M2Q A;  1EG4 A;  1IJ6 A;  2H2K A;  3IQQ A;  2MHH A;  3WHU B;  1J1D A;  1X02 A;  4AQI A;  1QJT A;  4MVF A;  4GFT A;  2V53 A;  4GGN A;  2PSR A;  2JTZ A;  2KI6 D;  1NUB A;  1QXP A;  1OSA A;  1RRO A;  3LL8 B;  1GGW A;  3BUN B;  3LCP C;  4E68 A;  2E6W A;  3NSO A;  1NWD A;  1NSH A;  5I8N A;  1H4B A;  1EG3 A;  2M3W A;  2JZI A;  1RWY A;  1K8U A;  2K7C A;  2LLT A;  1WLZ A;  4P2Y B;  1YUT A;  2LAP A;  2PMY A;  2VRG A;  2AUC A;  5CSF A;  4USL A;  1J55 A;  2EC6 C;  1DJH A;  1LIN A;  4JQ0 D;  2G9B A;  3SIB A;  1M31 A;  2I7A A;  1UUS A;  4DUQ A;  1EH2 A;  2ZKM X;  3OHM B;  4OKH A;  2HET A;  2K2F A;  1Y6W A;  1S3P A;  3TDU A;  1GGZ A;  1G4Y R;  1RK9 A;  2BBM A;  1S6I A;  2MLF C;  3VRO A;  2EHB A;  1QS7 A;  3PAL A;  1LVC D;  1SBJ A;  5JJG A;  1CNP A;  1GJY A;  3I5G B;  3LK0 A;  1NX3 A;  1KFX L;  2RGI A;  4WRI A;  1S5G Z;  3I5I B;  1OQP A;  5D7F A;  2KGB C;  1KWO B;  2KAX A;  3I5F B;  2BCA A;  2I18 A;  2AMI A;  1YVL A;  1RFJ A;  1DT7 B;  1SMG A;  1DF0 B;  1N65 A;  2KQY A;  4GGF A;  1D1O A;  1AJ5 A;  1CFP A;  5ER5 A;  2JRF A;  2KAV A;  1K90 D;  1YUR A;  1CDL A;  1K95 A;  1XK4 C;  1TCF A;  2I94 A;  3CLN A;  3AAK A;  4ORB B;  1K9U A;  2HF5 A;  3WXA A;  2KFG A;  3OX6 A;  4NQG A;  3TUY C;  1UHI A;  4YGA A;  3OX5 A;  3OB1 B;  2L2E A;  3TS5 B;  2F3Z A;  2LUC A;  1HQV A;  1JWD A;  4HRE E;  2K0J A;  2K61 A;  1WRK A;  1XK4 A;  1IQ5 A;  1CDP A;  2KFF A;  3KHE A;  4HSZ A;  4AQJ A;  5B8I B;  1H8B A;  1XVJ A;  1NPQ A;  1Y1A A;  3PN7 B;  4ZCU A;  3SG2 A;  3DVK A;  1REC A;  1CDM A;  1EXR A;  1ALW A;  1OZS A;  3VRQ A;  2LNK A;  1IGV A;  3JVT C;  2OS8 C;  1TN4 A;  1OE9 B;  1ZMZ A;  3MSE B;  4PE4 A;  4XJK B;  2LHI A;  3CR4 X;  2A4J A;  2ZND A;  1CM4 A;  4MZJ A;  4YGC B;  4QJ4 B;  1B8R A;  1BT6 A;  4MLW A;  1QV1 A;  1F70 A;  1CM1 A;  2BL0 C;  1M45 A;  3GK4 X;  2L51 A;  2L4I A;  3WNX B;  2M49 B;  1QAT A;  5D69 A;  2LUX A;  4QJ5 B;  3PM8 A;  2O60 A;  2QAC A;  3LLE A;  2BE4 A;  1TNQ A;  4PAL A;  3VRN A;  5HYD A;  1AJ4 A;  2Q4U A;  1CLM A;  4BY4 A;  4C0K A;  4YRU A;  1BOD A;  2WCB A;  2LM5 A;  4A4B A;  1S26 D;  1EL4 A;  1XA5 A;  2HQW A;  2LVV A;  1KWO C;  4HRH A;  4YGD B;  2BE6 A;  3I5F C;  2NCP A;  1K9K A;  2JT8 A;  5KTY A;  2DOQ A;  1KSO A;  1SCV A;  4OR9 B;  3SG6 A;  1QAS A;  2MBX A;  4IL1 A;  1N0Y A;  1B8L A;  1QTX A;  2CXJ A;  1UHJ A;  1DGV A;  4HRG A;  1HT9 A;  2JWW A;  1A03 A;  4I5K A;  1XFZ O;  3EK8 A;  2JXC A;  1A75 A;  1B7T Y;  1ZFS A;  2F2O A;  3IF7 A;  4ETO A;  1BLQ A;  5AEQ A;  4F0Z B;  1JF2 A;  1C7W A;  1R2U A;  2LAN A;  1XFX O;  3O6B A;  5HKY A;  4WQ3 A;  1NCY A;  2K2A A;  4DS7 A;  1OMD A;  2KGR A;  2Y5I A;  3FIA A;  3RLZ A;  1TNP A;  1MQ1 A;  1MXE A;  1J7R A;  4MRY A;  4NDC A;  3H4S E;  1SK6 D;  3PAT A;  1B4C A;  1KK7 Z;  4YI9 A;  2PAS A;  2KBI A;  1FI6 A;  2G2B A;  4XJK A;  4MEW A;  5AER A;  1K2H A;  3BQ3 A;  1XFV O;  3HX4 A;  2WC8 A;  1SCM C;  4ICB A;  2WOS A;  1AVS A;  4BY5 A;  1SNL A;  1J7P A;  2M29 A;  3I5H C;  1XFY O;  1UWO A;  1R6P A;  2ZNE A;  1LA3 A;  1PAL A;  4OCI A;  1JSA A;  1QX7 A;  1PSR A;  3ICB A;  1SRA A;  4WQ2 A;  1F4O A;  2JNF A;  3BUM B;  1IWQ A;  4MN0 A;  1L2O B;  1KFU L;  1QV0 A;  4ORA B;  2KYF A;  1WDC B;  4C0J A;  2Y4Q A;  1FF1 A;  2M7L A;  1U5I B;  1DJG A;  2OTG B;  3DF0 B;  1S1E A;  1CFC A;  4L9M A;  2JXL A;  1XYD A;  1M46 A;  1YRU B;  2LVI A;  2E30 A;  1TCO B;  3EK4 A;  4GGF C;  5CSN A;  3SIA A;  1Y1U A;  1BR4 B;  5I2O A;  4CPV A;  1F54 A;  2JTT A;  2H61 C;  4I5J A;  2JT0 A;  1S5G Y;  1FBV A;  1A29 A;  1DJZ A;  1S6C A;  4PHN A;  3ZNI A;  1WLM A;  4PE0 A;  2WCE A;  1NYA A;  1PUL A;  1BJF A;  1KQM B;  2JUL A;  1XO5 A;  4NDD A;  1SL9 A;  1YR5 A;  2H61 A;  1CFF A;  2BEC A;  2M1U A;  2KFH A;  3BOW B;  3K21 A;  3EK7 A;  1ODB A;  4XYN A;  1IG5 A;  1MWN A;  2L5X B;  1YUU A;  3BXK A;  3CWG A;  1QVI Z;  2F8P A;  1TTX A;  1YX8 A;  2JC2 A;  5HLV A;  2JNX A;  3C1V A;  1W7J B;  2WCF A;  2JT3 A;  3SG7 A;  3GK2 A;  2ZN9 A;  1SL8 A;  2L98 A;  1K96 A;  4GAO A;  4M2O A;  2ZN8 A;  3SG3 A;  5BPJ A;  2FJU B;  3SJS A;  3DVE A;  4PHK A;  2KSP A;  4MZL A;  3OP0 A;  3EKH A;  2KI6 C;  3BUO B;  2L4H A;  1G8I A;  4UPG A;  1XFU O;  5AAN A;  2CTN A;  3O4Y A;  2F3Y A;  3O2P A;  1PRW A;  1GQM A;  3KPX A;  1CKK A;  1YRT B;  5DKQ A;  2OPO A;  2NLN A;  1NX0 A;  4OV2 A;  4CID A;  2I2R E;  1S6J A;  2NCO A;  3LK1 A;  1MF8 B;  1KK8 B;  1CMG A;  1DVI A;  3AKA A;  2COL B;  5TNC A;  3VRR A;  1CDN A;  3I5G C;  4N5X A;  4YGE B;  4PHM A;  2KHN A;  3DF0 A;  3I5I C;  5CSI A;  2EGD A;  1J7O A;  2KYC A;  5PAL A;  1DTL A;  1PVB A;  3D10 A;  2WND A;  2O5G A;  3HCM A;  4DIR A;  4DRW A;  1MUX A;  1MHO A;  2JQ6 A;  3GOF A;  1NIW A;  1ZOT B;  5AFP A;  1CMF A;  4AOM A;  2MRD A;  1TRF A;  1DJY A;  1CFD A;  4A4C A;  1DMO A;  1NP8 A;  1NX2 A;  2CCM A;  2PRU A;  1SKT A;  2BCX A;  3NSL A;  1M63 B;  1KFX S;  4TNC A;  2JOJ A;  3O78 A;  1FI5 A;  3CGA A;  2LMV A;  1DJW A;  1OMR A;  3TS5 C;  1DF0 A;  2JU0 A;  2LVK A;  1CLL A;  3NSK A;  5I2Q A;  2MA2 A;  4JWQ A;  3PSR A;  2ZRT A;  4FTG A;  2M0R A;  1V1G A;  2LLU A;  5IBW A;  3DD4 A;  2P6B B;  1NCX A;  1BG1 A;  3PN7 C;  4YGB B;  1K93 D;  2M7N A;  2FCD A;  4N1F A;  1SYM A;  1RJV A;  4DCK A;  5FYX A;  2MAZ A;  4PHJ A;  5KU1 A;  2LHL A;  2B1U A;  1B1G A;  1QIV A;  1ALV A;  4PDZ A;  1G33 A;  4R1E A;  1KK7 Y;  1TOP A;  2CBL A;  2LP3 A;  4JPZ B;  1JF0 A;  3SG5 A;  3DVM A;  3EVR A;  2QPT A;  2CNP A;  2CT9 A;  2LLS A;  1F71 A;  2K7O A;  1JFJ A;  1QX5 B;  2K7D A;  2Y1M A;  4I5L B;  1CTR A;  1M39 A;  4I5N B;  3BUW B;  3RM1 A;  4PE7 A;  2K7B A;  3A8R A;  3FWB A;  3WHT B;  1AP4 A;  1IH0 A;  4FQO A;  3A4U B;  2HPS A;  4MSP A;  1OOJ A;  5DKR A;  4YI8 A;  2R2I A;  1LKJ A;  1VRK A;  4ZCV A;  1LA0 A;  3TUY B;  5HLO A;  1J7Q A;  1DGU A;  1AUI B;  4OVN F;  3TDI A;  1CB1 A;  1AHR A;  3PLF B;  1TNW A;  1FPW A;  1F8H A;  1C07 A;  5J3X A;  2L0P A;  3VGO A;  5GQQ C;  1BMO A;  1V1F A;  1WRZ A;  2KQ6 A;  1Y1X A;  2JPT A;  1UHH A;  4PE1 A;  1L7Z A;  1W7I B;  1OMV A;  2KI4 B;  2LP2 A;  1QX2 A;  5G08 A;  3JVT B;  1J1E A;  2OS8 B;  2BKI B;  1A2X A;  2ZFD A;  1S36 A;  1NCZ A;  1IRJ A;  1WY9 A;  2BCB A;  3EVV A;  4C0L A;  2LE9 B;  3TZ1 A;  1K94 A;  4GUK A;  4CFQ A;  1IKU A;  1ZUZ A;  4YBH B;  2LVJ A;  4U8D A;  2BL0 B;  1TNX A;  2M8U A;  2PAL A;  3CZT X;  3JTD B;  3CTN A;  1YVH A;  4Q04 A;  2M97 A;  2M9G A;  3NXA A;  1KSM A;  1QVI Y;  2SCP A;  3D0Y B;  2ISD A;  5JOL A;  1RTP 1;  3BYA A;  3NSI A;  1F55 A;  3M0W A;  2KOT A;  5ER4 X;  3KEV A;  2GGM A;  1PK0 D;  1BF5 A;  2NZ0 A;  1SPY A;  2Y1N A;  1XFW O;  4GPL B;  1F4Q A;  1ZAC A;  3EKJ A;  1K9P A;  2KAY A;  3AAJ A;  4ORC B;  4CLN A;  1B9A A;  1OZO A;  1MR8 A;  2TN4 A;  1A75 B;  5KSZ A;  3FS7 A;  3VRP A;  1SW8 A;  2LCP A;  1L2O C;  1FW4 A;  1BU3 A;  1WDC C;  3IQO A;  3CS1 A;  1NX1 A;  1YTZ C;  2KDH A;  4CFR A;  1UUR A;  2OTG C;  5K89 A;  1JC2 A;  5AXI A;  1AK8 A;  5HKZ A;  1N2D A;  3DVJ A;  1BOC A;  1QLS A;  2FCE A;  1E8A A;  1SR6 B;  4GNK B;  4NDB A;  1JBA A;  2AAO A;  2KI4 C;  1U5I A;  2GV5 A;  4QJ3 B;  2LMU A;  1KFU S;  5F6T A;  2D8N A;  4D1E A;  4MRX A;  1CLB A;  3CR5 X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...