1OQPA

Structure of the ca2+/c-terminal domain of caltractin in complex with the cdc31p-binding domain from kar1p
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
77
structure length
77
Chain Sequence
GSGERDSREEILKAFRLFDDDNSGTITIKDLRRVAKELGENLTEEELQEMIAEADRNDDNEIDEDEFIRIMKKTSLF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Caltractin
publication title Unique Features in the C-terminal Domain Provide Caltractin with Target Specificity
pubmed doi rcsb
source organism Chlamydomonas reinhardtii
molecule tags Protein binding
total genus 29
structure length 77
sequence length 77
ec nomenclature
pdb deposition date 2003-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1oqpA00
3NXAA 4MVFA 3LCPC 2KFFA 3WNXB 4HSZA 3WHUB 2PRUA 2LNKA 1IQ5A 2I2RE 1OE9B 2KI6C 1L2OB 1NCYA 4PE1A 1CB1A 1UUSA 1CFFA 1DF0A 1DGVA 2NCPA 5ER5A 1SCVA 1QVIY 2JNFA 1OQPA 1RWYA 1KFXS 2JC2A 3GK2A 1XFZO 1FBVA 1MHOA 1JSAA 2M7NA 1TIZA 2OS8B 4PHMA 4CLNA 2F3ZA 2LCPA 1TNWA 1AP4A 4R1EA 2P6BB 3BUMB 1S5GY 2BL0C 3LL8B 2HQWA 3HCMA 1J55A 4MZKA 1XVJA 1B8CA 1A29A 1U5IB 4OV2A 2K2AA 2PASA 3PM8A 4N5XA 1CFCA 3QRXA 1GJYA 1KQMC 5AXIA 3OX6A 3CR2A 1CDPA 3EVUA 1TTXA 4MBEA 2A4JA 3O6BA 3TUYB 1IQ3A 3VRRA 5D7FA 4GAOA 3I5FC 2JT3A 3OX5A 1WLMA 3MSEB 4GNKB 1IH0A 2GV5A 1PK0D 1J1DA 3IF7A 1QVIZ 2KI6D 2FCDA 1OSAA 2WCFA 1RROA 1KSOA 1BR4B 4QJ4B 3I5IB 1GQMA 1JF0A 5KU1A 2LP3A 1PSBA 2LUXA 1KFUL 1PSRA 1ZACA 2KGBC 1S5GZ 3EK4A 2NZ0A 4P2YB 4PE7A 1OZSA 1C7WA 1U5IA 4A4BA 2FJUB 2K7OA 3PLFB 4MZLA 2KFGA 1KQVA 3I5GC 2EC6B 2L4IA 4C0JA 2JQ6A 2K7BA 1BF5A 2KDHA 1XFXO 2M9GA 3OHMB 1DJWA 2SCPA 2LMUA 4I5KA 1B47A 4FQOA 2LVVA 3FIAA 4AQIA 1W7IB 2QACA 4PHNA 1F71A 2K61A 5F6TA 1DMOA 3I5HB 1QX5B 4CFRA 1FF1A 4L9MA 2LV7A 1CDNA 2BKHB 2DOQA 3BYAA 5I2LA 5IBWA 5HKYA 1QX7A 1M63B 1YVHA 2M1KB 3SG7A 4WQ3A 2JULA 1YVLA 3CR5X 1SRAA 2KOTA 3KF9A 2BCXA 3EK8A 3CR4X 2VRGA 2KNEA 1Y1AA 1LA0A 3SG3A 1SL7A 3FS7A 1AHRA 1N65A 3DVEA 3LK1A 3SIAA 1MF8B 1JFJA 3CS1A 2LC5A 1OMDA 2COLB 2Y5IA 2K8MB 1L2OC 3O4YA 3K21A 1N2DA 1F54A 1ALVA 4YGAA 3NSOA 2ZKMX 3SJSA 2HPSA 1DF0B 2L5XB 1NX2A 2Y1NA 5KSZA 1YX7A 1F4QA 2WORA 5CPVA 1K9PA 1XFVO 1DJHA 2F2PA 1YX8A 1EG4A 3GOFA 3VRPA 3TZ1A 1SCMB 1GGZA 2JPTA 2LVKA 1HQVA 3A8RA 1CKKA 3OP0A 1DJGA 1BOCA 5AFPA 3C1VA 1NCZA 4ZCUA 1MR8A 1K93D 1RFJA 2KQ6A 4GBAA 2LLSA 1SK6D 3CZTX 4OR9B 3F45A 4PE4A 3SG4A 3KEVA 4JPZB 1DT7B 4HREE 1AVSA 4ETOA 1F8HA 1K95A 1YURA 1OMVA 4OCIA 2GGZA 1BMOA 1L7ZA 1SL8A 2LHIA 2I7AA 5HYDA 1QIWA 3TUYC 4WRIA 1TNQA 3JTDB 4JWQA 1SNLA 1XFWO 2H2KA 4OKHA 2CXJA 3DF0B 1XYDA 1A2XA 1S3PA 2GGMA 2H61C 3AKAA 2ISDA 4C0LA 1RK9A 5K89A 1EH2A 1A03A 4AOMA 4DS7A 3VRQA 3WXAA 3E3RA 2F8PA 1IGVA 1B4CA 1XK4C 2CBLA 3I5IC 3HX4A 1FI6A 2F3YA 1K9KA 1QX2A 2JTZA 1B1GA 2KAVA 1CMGA 1BG1A 1KSMA 2K7CA 2LHLA 2MHHA 4XJKA 5HKZA 2OTGC 4AQJA 1IRJA 1GGWA 5GQQC 3DD4A 2KBIA 2LVJA 1Y1UA 4YRUA 2JT8A 3CWGA 2AMIA 4GGFC 4UPGA 4USLA 1QJTA 1K8UA 4NQGA 4M2QA 4MSPA 1ZFSA 2WOSA 2LLTA 1XA5A 1QLSA 3O78A 4ORCB 1SY9A 2QPTA 3ZWHA 5KTYA 1NWDA 3DF0A 1F4OA 1SKTA 1NPQA 1QV0A 4F0ZB 2RGIA 4YGEB 4I5NB 3RM1A 1UP5A 4HRGA 1MUXA 2IS9A 3JVTC 1JC2A 3FWBA 2BBNA 3BUOB 1WRKA 4BY4A 4CPVA 1BODA 1LKJA 1EL4A 3NSLA 1SPYA 2I94A 2JXCA 1K94A 1NCXA 2MLFC 2KFHA 3LK0A 1N0YA 1RECA 2MLEC 1S26D 5TNCA 1DVIA 1KWOC 2L0PA 1KK8B 2JTTA 2PMYA 1J1EA 1IJ6A 1CTRA 5I8NA 3AAJA 4FTGA 5I2OA 1JFKA 2JZIA 4WQ2A 1MXEA 4NDBA 4MN0A 1WLZA 1IWQA 2JRFA 1M45A 1PRWA 1R2UA 2AAOA 2CT9A 3SG5A 1OOJA 1YUTA 2D8NA 2KYCA 4YI9A 1KFUS 1SCMC 4PALA 1RJVA 3LLEA 1S6JA 1RTP1 5DKNA 5AEQA 2HF5A 1QASA 2KI4B 1AJ5A 2CCMA 2K0JA 2AUCA 3BXKA 2LVIA 1Y1XA 2WNDA 3EKHA 2LP2A 3VGOA 3SG2A 3TDUA 2CTNA 1NX1A 4E68A 1TCFA 4P5OE 1S1EA 3ICBA 1ZMZA 2WCEA 2E30A 4M2OA 4C0KA 5D69A 5PALA 1Q80A 1AUIB 2MBXA 2O60A 1QIVA 1XFYO 3M0WA 4NDCA 1H8BA 5CSIA 1TNPA 2M7LA 3JTDC 1V1GA 1CFPA 2ZN8A 3PALA 2KAYA 2K7DA 2LLUA 1NUBA 3FWCA 1J7QA 1QV1A 1TNXA 2I18A 2KAXA 2M1UA 1YRUB 2G2BA 2LAPA 1FW4A 4MZJA 2OS8C 1SBJA 3EVVA 1XO5A 4PDZA 2F33A 4PCWA 5JJGA 2JU0A 3NSIA 1CFDA 5CSJA 4GGFA 2LM5A 1JUOA 1WDCB 1CM4A 3H4SE 2KQYA 4XJKB 4U8DA 2Y4QA 2LMVA 3TS5B 1JF2A 1ZUZA 3BUNB 1M39A 2KGRA 2L98A 2NLNA 1IJ5A 3BOWA 1DJYA 4I5LB 3CTNA 1UHNA 2KHNA 1C07A 2PALA 1S36A 1IG5A 2ZN9A 1ZOTB 5G08A 5JOLA 2OPOA 4N1GA 4MRXA 2ZRSA 2B1UA 4YGDB 1TOPA 4PHKA 1KFXL 4N1FA 1YR5A 4ICBA 2WCBA 2M49B 4DCKA 1MXLC 2BCAA 3PFVA 1CLBA 4CIDA 2BBMA 1UHIA 5FYXA 2FCEA 2JWWA 2M3WA 1PULA 4ORBB 1C7VA 1QTXA 2MRDA 4GGNA 3AAKA 3OB1B 2ZNDA 1YRTB 1QXPA 1W7JB 3GK4X 1TRFA 3EVRA 3BUWB 2LUCA 2M0RA 1J7OA 2BECA 1SR6B 1B8LA 4GUKA 2ZNEA 2R2IA 4GPLB 5CSFA 1Y6WA 1LXFC 1WRLA 2SASA 1S6IA 3KPXA 1JWDA 1F70A 2EC6C 1KK8C 3KHEA 4D1EA 1TCOB 1BT6A 1LINA 2MJWB 3EK7A 5HLVA 1KK7Y 2PVBA 2JXLA 1V1FA 1AK8A 2KBMA 5AERA 2TN4A 3I5HC 2LMTA 3PN7B 1UHJA 4TNCA 3DVJA 1J7PA 1EG3A 1A75A 1DJXA 4ZCVA 1B7TY 1DJZA 1J7RA 4MEWA 5B8IB 3OB2B 2KSPA 2LE9B 4M2PA 2KI4C 1FPWA 1NX0A 3IQOA 3NSKA 1CMFA 4XYNA 2CNPA 2Y1MA 1NP8A 2HQ8A 1UHKA 1F55A 4Q04A 1NX3A 3SIBA 2F2OA 1WRZA 1JBAA 2EHBA 1EXRA 1DTLA 2PSRA 2Q4UA 2MAZA 1DGUA 2L50A 1UURA 3DVKA 5AANA 1TN4A 2G9BA 1KK7Z 1M31A 1G8IA 2EGDA 2JOJA 4DRWA 1SW8A 1PVAA 4PE0A 3BQ3A 1DJIA 1UWOA 5DKRA 1B9AA 1FI5A 1H4BA 1IKUA 2BL0B 3VROA 1D1OA 4YI8A 2OTGB 4I5JA 3SG6A 3EKJA 4GFTA 1BJFA 1K2HA 2Q91A 3IQQA 3GK1A 1B7TZ 3KO0A 1PVBA 1WDCC 3D10A 1SYMA 1QLKA 2BKIB 1CDMA 1KQMB 1OZOA 1K96A 1BLQA 1Y0VH 1S6CA 3TS5C 1CLLA 3VRNA 2ZFDA 1KCYA 1A4PA 1G4YR 1R6PA 4DUQA 1CLMA 2JNXA 3I5FB 3BOWB 1PALA 2H61A 2E6WA 3O2PA 2NXQA 2L2EA 3BUXB 3PSRA 4IL1A 1CNPA 1YUSA 4DIRA 1HT9A 1B8RA 3TDZA 3D0YB 3TDIA 1XK4A 3JVTB 2K2FA 2V53A 4OVNF 3CLNA 2ZRTA 4QJ3B 1CM1A 2BE4A 1NIWA 1ALWA 1YTZC 2L4HA 5DKQA 2JT0A 2WC8A 1K90D 4ORAB 5HLOA 2FOTA 4PHJA 4YGCB 1QATA 2HETA 4HRHA 1M46A 5ER4X 5BPJA 1E8AA 2KYFA 1SL9A 3I5GB 1QS7A 2NCOA 4QJ5B 5I2QA 1KWOB 4MLWA 1MWNA 5J3XA 1SR6C 1MQ1A 2M97A 4JQ0D 4NDDA 4MRYA 1LVCD 1X02A 2BCBA 2M8UA 5CSNA 4BY5A 1WY9A 2M29A 4A4CA 3AKBA 1LA3A 1NYAA 1SMGA 3RLZA 2O5GA 1EJ3A 3ZNIA 4CFQA 3DVMA 2LANA 3D0YA 2L51A 1OMRA 2MA2A 4YBHB 3WHTB 3PN7C 1BR1B 1BU3A 1CDLA 5HKWA 3CGAA 1XFUO 4YGBB 3PATA 1G33A 1ODBA 1UHHA 2BE6A 1YUUA 1A75B 1NSHA 3A4UB 1K9UA 1VRKA 1AJ4A
chains in the Genus database with same CATH superfamily
2KLEA 3NXAA 4MVFA 3LCPC 2KFFA 3WNXB 4HSZA 3WHUB 2PRUA 3SS3A 2LNKA 3CABA 1IQ5A 2I2RE 1LS8A 1OE9B 3VB1A 1OOHA 2KI6C 1L2OB 1NCYA 2WC6A 4PE1A 1CB1A 1UUSA 1CFFA 1DF0A 1DGVA 2NCPA 5ER5A 1SCVA 3D76A 1QVIY 2JNFA 5D3OA 1C3YA 1OQPA 1RWYA 1KFXS 2JC2A 3GK2A 1XFZO 2PQLA 1FBVA 1MHOA 1JSAA 2M7NA 1TIZA 2OS8B 4PHMA 4CLNA 2YGUA 2F3ZA 2LCPA 2QEHA 1TNWA 1AP4A 4R1EA 2P6BB 3BUMB 1S5GY 2BL0C 3LL8B 2HQWA 3HCMA 1J55A 4MZKA 1XVJA 1B8CA 1A29A 1U5IB 2PYQA 4OV2A 2K2AA 2PASA 3PM8A 4N5XA 1CFCA 3QRXA 5HL1A 1GJYA 1KQMC 5I94A 3Q8IA 3OX6A 3CR2A 1CDPA 5AXIA 3EVUA 1TTXA 4MBEA 2A4JA 3O6BA 3OGNA 3TUYB 1IQ3A 3VRRA 3CYZA 5D7FA 4GAOA 3I5FC 2JT3A 3OX5A 4JD9A 1WLMA 3MSEB 4GNKB 1IH0A 2GV5A 1PK0D 1J1DA 3IF7A 1QVIZ 2KI6D 2FCDA 1OSAA 2WCLA 2WCFA 1RROA 2KLDA 1KSOA 1BR4B 4QJ4B 3I5IB 1GQMA 1JF0A 5KU1A 2LP3A 1PSBA 2LUXA 1KFUL 1PSRA 1ZACA 2KGBC 1S5GZ 3EK4A 2NZ0A 3PM2A 4P2YB 4PE7A 1OZSA 1C7WA 1U5IA 4A4BA 2FJUB 2K7OA 3PLFB 4MZLA 3RZSA 2KFGA 3B6XA 1KQVA 3I5GC 2EC6B 2L4IA 4C0JA 2JQ6A 2K7BA 1BF5A 2KDHA 1XFXO 2M9GA 3FE6A 1DEKA 3OHMB 1DJWA 2SCPA 2LMUA 4I5KA 1B47A 4FQOA 2LVVA 3FIAA 4AQIA 1W7IB 3R1PA 2QACA 1GM0A 4PHNA 1F71A 2K61A 5F6TA 1DMOA 3I5HB 1QX5B 4CFRA 1FF1A 2BNXA 1Z2CB 4L9MA 2LV7A 1CDNA 2BKHB 2DOQA 3BYAA 5I2LA 5IBWA 5HKYA 3FE8A 3CDNA 1QX7A 1M63B 1OW4A 1YVHA 2M1KB 3SG7A 4WQ3A 2JULA 1YVLA 3CR5X 1SRAA 2KOTA 3KF9A 2BCXA 3EK8A 3CR4X 2VRGA 2KNEA 3BFBA 1Y1AA 1LA0A 3SG3A 1SL7A 3FS7A 1AHRA 1N65A 3DVEA 3LK1A 3SIAA 1MF8B 1JFJA 3CS1A 2LC5A 1DELA 1OMDA 2COLB 2Y5IA 2K8MB 1L2OC 3O4YA 3K21A 1N2DA 5FI6A 1F54A 1ALVA 4YGAA 3NSOA 2ZKMX 3SJSA 2HPSA 1DF0B 2WCHA 3B7AA 2L5XB 1NX2A 2Y1NA 5KSZA 1YX7A 1F4QA 2WORA 5CPVA 1K9PA 1XFVO 1DJHA 2F2PA 1YX8A 3R72A 1EG4A 3GOFA 3VRPA 3TZ1A 3BFHA 1SCMB 1GGZA 2JPTA 2WCJA 2LVKA 1HQVA 3A8RA 1CKKA 3OP0A 1DJGA 4FQTA 5AFPA 1BOCA 1T14A 3C1VA 1NCZA 4ZCUA 3CZ0A 1MR8A 3SS5A 1K93D 1RFJA 2KQ6A 4GBAA 4KYNA 2LLSA 3D75A 1SK6D 3CZTX 4OR9B 3F45A 4PE4A 3SG4A 3KEVA 4JPZB 1DT7B 4HREE 1AVSA 4ETOA 1F8HA 1K95A 1YURA 1OMVA 4OCIA 2GGZA 1BMOA 1L7ZA 1SL8A 2LHIA 2I7AA 5HYDA 1QIWA 3TUYC 3D73A 4WRIA 3S0AA 1TNQA 2QEOA 3JTDB 1SNLA 1W9ZA 4JWQA 1XFWO 2H2KA 4OKHA 2CXJA 3DF0B 1XYDA 1A2XA 1S3PA 2GGMA 2H61C 3AKAA 2ISDA 4C0LA 1RK9A 5K89A 3UO9A 1EH2A 1A03A 4AOMA 4DS7A 3VRQA 3WXAA 3E3RA 2F8PA 1IGVA 2GTEA 1B4CA 1XK4C 2CBLA 3I5IC 3HX4A 1FI6A 2F3YA 1K9KA 1QX2A 2JTZA 1B1GA 2KAVA 1CMGA 1BG1A 1KSMA 2K7CA 2LHLA 2MHHA 4XJKA 5HKZA 2OTGC 4AQJA 1IRJA 1GGWA 5GQQC 3DD4A 2KBIA 2LVJA 1Y1UA 4YRUA 3S0EA 3S0DA 2JT8A 3CWGA 2AMIA 4GGFC 4UPGA 4USLA 1QJTA 1K8UA 4NQGA 4M2QA 4F7FA 3DXLA 4MSPA 1ZFSA 2WOSA 2LLTA 1XA5A 1QLSA 3O78A 4ORCB 1SY9A 2QPTA 3ZWHA 5KTYA 3D77A 1NWDA 3NGVA 3DF0A 1F4OA 1SKTA 1NPQA 1QV0A 4F0ZB 2RGIA 4YGEB 4I5NB 3RM1A 1XFRA 1UP5A 4HRGA 1MUXA 2IS9A 3JVTC 1JC2A 3FWBA 2BBNA 3BUOB 1WRKA 4OZDA 1IIOA 3BJHA 4BY4A 4CPVA 1BODA 1LKJA 1EL4A 3NSLA 1SPYA 2I94A 2JXCA 1K94A 1NCXA 1OOFA 2MLFC 2KFHA 3LK0A 1N0YA 2K60A 1RECA 2MLEC 1S26D 5TNCA 1DVIA 1KWOC 2L0PA 1KK8B 2JTTA 2PMYA 1J1EA 1IJ6A 1CTRA 5I8NA 3AAJA 4FTGA 5I2OA 1JFKA 2JZIA 4WQ2A 1MXEA 4NDBA 4MN0A 1WLZA 1IWQA 2JRFA 1M45A 1PRWA 1R2UA 2AAOA 2CT9A 3SG5A 1OOJA 1YUTA 2D8NA 2KYCA 4YI9A 1KFUS 3S0BA 1SCMC 4PALA 1RJVA 3LLEA 1S6JA 1RTP1 3OBVA 5DKNA 5AEQA 2HF5A 1QASA 2KI4B 1AJ5A 2L2CA 2CCMA 2K0JA 2AUCA 1Z4HA 2JPOA 3BXKA 2LVIA 1Y1XA 2WNDA 3EKHA 3L4LA 2LP2A 3VGOA 3CZ2A 3SG2A 3TDUA 2CTNA 3V2LA 1NX1A 4E68A 1TCFA 4P5OE 1C3ZA 1S1EA 3ICBA 1ZMZA 2WCEA 2E30A 4M2OA 4C0KA 5D69A 5PALA 2QEBA 1Q80A 1AUIB 2MBXA 2O60A 1QIVA 1XFYO 3M0WA 4NDCA 1H8BA 5CSIA 1TNPA 2M7LA 3JTDC 1V1GA 1CFPA 2ZN8A 3PALA 2KAYA 2K7DA 3S0GA 2LLUA 1NUBA 3FWCA 1J7QA 1QV1A 1TNXA 2I18A 2KAXA 2M1UA 1YRUB 2G2BA 2LAPA 1FW4A 4MZJA 2OS8C 3R1VA 1SBJA 3EVVA 1XO5A 4PDZA 2F33A 4PCWA 5JJGA 2JU0A 3NSIA 1CFDA 5CSJA 4GGFA 2LM5A 1JUOA 1WDCB 3NHIA 1CM4A 3H4SE 2KQYA 4XJKB 4U8DA 2Y4QA 5EL2A 2LMVA 3R1OA 1JF2A 1ZUZA 3BUNB 1M39A 3TS5B 2KGRA 2L98A 4INWA 2QDIA 2NLNA 1IJ5A 3BOWA 1DJYA 4I5LB 3CTNA 1UHNA 3K1EA 2KHNA 1C07A 2PALA 1S36A 3L4AA 1IG5A 2H8VA 2ZN9A 1ZOTB 5G08A 5JOLA 3EG5B 2OPOA 4N1GA 2L5YA 2WCKA 4MRXA 2ZRSA 2B1UA 4YGDB 1TOPA 4PHKA 1KFXL 4N1FA 1YR5A 4ICBA 2WCBA 2M49B 4DCKA 1MXLC 2BCAA 3PFVA 1CLBA 4CIDA 2BBMA 1UHIA 4JKTA 5FYXA 2FCEA 2JWWA 3N7HA 2M3WA 1PULA 2P71A 4ORBB 1C7VA 1QTXA 2QEVA 2MRDA 3QMEA 4GGNA 3AAKA 4IJ7A 5DICA 3OB1B 2ZNDA 1YRTB 1QXPA 1W7JB 3GK4X 1TRFA 3EVRA 2KPHA 1TUZA 3BUWB 2LUCA 2M0RA 1P28A 1J7OA 2BECA 3B88A 1SR6B 1B8LA 1TUJA 4GUKA 2ZNEA 3B87A 2R2IA 4GPLB 5CSFA 1Y6WA 1LXFC 1WRLA 2SASA 1S6IA 3BFAA 3KPXA 1JWDA 1F70A 2EC6C 1KK8C 2WC5A 3KHEA 4D1EA 1TCOB 1BT6A 1LINA 2MJWB 3EK7A 5HLVA 1KK7Y 2PVBA 2JXLA 2FJYA 1V1FA 1AK8A 2KBMA 5AERA 2TN4A 3I5HC 2LMTA 3PN7B 1UHJA 4TNCA 3DVJA 1J7PA 1EG3A 2BAPA 1A75A 1DJXA 4ZCVA 4PT1A 1B7TY 1DJZA 3NHTA 1J7RA 4MEWA 5B8IB 3OB2B 2KSPA 2LE9B 4M2PA 2KI4C 3B86A 1FPWA 3DY9A 1NX0A 3IQOA 3NSKA 1CMFA 3O4XA 4XYNA 2CNPA 2Y1MA 1NP8A 2HQ8A 1UHKA 1F55A 1TWOA 3D74A 1NX3A 4Q04A 2F2OA 1WRZA 3SIBA 1JBAA 2EHBA 1EXRA 1DTLA 2PSRA 2Q4UA 2MAZA 2WCMA 1DGUA 2L50A 1UURA 3DVKA 5AANA 1TN4A 2G9BA 3DYEA 1KK7Z 1M31A 1G8IA 2EGDA 2JOJA 4DRWA 1SW8A 1PVAA 3L47A 3BQ3A 4PE0A 1DJIA 1UWOA 5DKRA 3PJIA 1B9AA 3UNWA 1FI5A 1H4BA 1IKUA 2BL0B 3VROA 1D1OA 4YI8A 2OTGB 4I5JA 3SG6A 3EKJA 4GFTA 1BJFA 1K2HA 3IVTA 2Q91A 3IQQA 3GK1A 1B7TZ 3KO0A 1PVBA 1WDCC 3D10A 1SYMA 1QLKA 2BKIB 1OOGA 1CDMA 1KQMB 1OZOA 1K96A 1BLQA 1Y0VH 1S6CA 3TS5C 1CLLA 3VRNA 2ZFDA 1KCYA 1A4PA 1G4YR 5FI7A 1R6PA 4DUQA 1CLMA 2JNXA 3I5FB 3BOWB 1PALA 2H61A 2E6WA 3O2PA 2NXQA 2L2EA 3BUXB 3PSRA 4IL1A 1ORGA 1YUSA 1CNPA 4DIRA 3FE9A 1HT9A 1B8RA 3TDZA 3D0YB 3TDIA 3S0FA 1XK4A 3JVTB 2K2FA 2V53A 4OVNF 3CLNA 2ZRTA 4QJ3B 1CM1A 2BE4A 1NIWA 1ALWA 1YTZC 2L4HA 5DKQA 2JT0A 2WC8A 3D78A 1K90D 3SS4A 4ORAB 5HLOA 2FOTA 4PHJA 4YGCB 1QATA 2HETA 4HRHA 1M46A 5ER4X 5BPJA 1E8AA 2KYFA 1SL9A 3I5GB 1QS7A 2NCOA 3DZTA 4QJ5B 1KWOB 4MLWA 5I2QA 1MWNA 1OOIX 3CZ1A 1SR6C 5J3XA 1MQ1A 2M97A 4JQ0D 4NDDA 4MRYA 1LVCD 1X02A 2BCBA 2M8UA 5CSNA 4BY5A 1WY9A 2M29A 1DQEA 3AKBA 4A4CA 1LA3A 1NYAA 1SMGA 3RLZA 2O5GA 2P70A 1EJ3A 3ZNIA 4CFQA 3DVMA 2LANA 3D0YA 2L51A 1SSEB 5FI2A 1OMRA 2MA2A 4YBHB 3WHTB 1QWVA 1BR1B 1BU3A 1CDLA 3PN7C 5HKWA 3CGAA 1XFUO 4YGBB 3PATA 1G33A 1ODBA 1UHHA 2BE6A 4INXA 1DC1A 1YUUA 1A75B 1NSHA 3A4UB 1K9UA 2ERBA 1VRKA 1AJ4A
chains in the Genus database with same CATH topology
3NXAA 4MVFA 3LCPC 2KFFA 3WNXB 4HSZA 3WHUB 2PRUA 2LNKA 1IQ5A 2I2RE 1OE9B 2KI6C 1L2OB 1NCYA 4PE1A 1CB1A 1UUSA 1CFFA 1DF0A 1DGVA 2NCPA 5ER5A 1SCVA 1QVIY 2JNFA 1OQPA 1RWYA 1KFXS 2JC2A 3GK2A 1XFZO 1FBVA 1MHOA 1JSAA 2M7NA 1TIZA 2OS8B 4PHMA 4CLNA 2F3ZA 2LCPA 1TNWA 1AP4A 4R1EA 2P6BB 3BUMB 1S5GY 2BL0C 3LL8B 2HQWA 3HCMA 1J55A 4MZKA 1XVJA 1B8CA 1A29A 1U5IB 4OV2A 2K2AA 2PASA 3PM8A 4N5XA 1CFCA 3QRXA 1GJYA 1KQMC 5AXIA 3OX6A 3CR2A 1CDPA 3EVUA 1TTXA 4MBEA 2A4JA 3O6BA 3TUYB 1IQ3A 3VRRA 5D7FA 4GAOA 3I5FC 2JT3A 3OX5A 1WLMA 3MSEB 4GNKB 1IH0A 2GV5A 1PK0D 1J1DA 3IF7A 1QVIZ 2KI6D 2FCDA 1OSAA 2WCFA 1RROA 1KSOA 1BR4B 4QJ4B 3I5IB 1GQMA 1JF0A 5KU1A 2LP3A 1PSBA 2LUXA 1KFUL 1PSRA 1ZACA 2KGBC 1S5GZ 3EK4A 2NZ0A 4P2YB 4PE7A 1OZSA 1C7WA 1U5IA 4A4BA 2FJUB 2K7OA 3PLFB 4MZLA 2KFGA 1KQVA 3I5GC 2EC6B 2L4IA 4C0JA 2JQ6A 2K7BA 1BF5A 2KDHA 1XFXO 2M9GA 3OHMB 1DJWA 2SCPA 2LMUA 4I5KA 1B47A 4FQOA 2LVVA 3FIAA 4AQIA 1W7IB 2QACA 4PHNA 1F71A 2K61A 5F6TA 1DMOA 3I5HB 1QX5B 4CFRA 1FF1A 4L9MA 2LV7A 1CDNA 2BKHB 2DOQA 3BYAA 5I2LA 5IBWA 5HKYA 1QX7A 1M63B 1YVHA 2M1KB 3SG7A 4WQ3A 2JULA 1YVLA 3CR5X 1SRAA 2KOTA 3KF9A 2BCXA 3EK8A 3CR4X 2VRGA 2KNEA 1Y1AA 1LA0A 3SG3A 1SL7A 3FS7A 1AHRA 1N65A 3DVEA 3LK1A 3SIAA 1MF8B 1JFJA 3CS1A 2LC5A 1OMDA 2COLB 2Y5IA 2K8MB 1L2OC 3O4YA 3K21A 1N2DA 1F54A 1ALVA 4YGAA 3NSOA 2ZKMX 3SJSA 2HPSA 1DF0B 2L5XB 1NX2A 2Y1NA 5KSZA 1YX7A 1F4QA 2WORA 5CPVA 1K9PA 1XFVO 1DJHA 2F2PA 1YX8A 1EG4A 3GOFA 3VRPA 3TZ1A 1SCMB 1GGZA 2JPTA 2LVKA 1HQVA 3A8RA 1CKKA 3OP0A 1DJGA 1BOCA 5AFPA 3C1VA 1NCZA 4ZCUA 1MR8A 1K93D 1RFJA 2KQ6A 4GBAA 2LLSA 1SK6D 3CZTX 4OR9B 3F45A 4PE4A 3SG4A 3KEVA 4JPZB 1DT7B 4HREE 1AVSA 4ETOA 1F8HA 1K95A 1YURA 1OMVA 4OCIA 2GGZA 1BMOA 1L7ZA 1SL8A 2LHIA 2I7AA 5HYDA 1QIWA 3TUYC 4WRIA 1TNQA 3JTDB 4JWQA 1SNLA 1XFWO 2H2KA 4OKHA 2CXJA 3DF0B 1XYDA 1A2XA 1S3PA 2GGMA 2H61C 3AKAA 2ISDA 4C0LA 1RK9A 5K89A 1EH2A 1A03A 4AOMA 4DS7A 3VRQA 3WXAA 3E3RA 2F8PA 1IGVA 1B4CA 1XK4C 2CBLA 3I5IC 3HX4A 1FI6A 2F3YA 1K9KA 1QX2A 2JTZA 1B1GA 2KAVA 1CMGA 1BG1A 1KSMA 2K7CA 2LHLA 2MHHA 4XJKA 5HKZA 2OTGC 4AQJA 1IRJA 1GGWA 5GQQC 3DD4A 2KBIA 2LVJA 1Y1UA 4YRUA 2JT8A 3CWGA 2AMIA 4GGFC 4UPGA 4USLA 1QJTA 1K8UA 4NQGA 4M2QA 4MSPA 1ZFSA 2WOSA 2LLTA 1XA5A 1QLSA 3O78A 4ORCB 1SY9A 2QPTA 3ZWHA 5KTYA 1NWDA 3DF0A 1F4OA 1SKTA 1NPQA 1QV0A 4F0ZB 2RGIA 4YGEB 4I5NB 3RM1A 1UP5A 4HRGA 1MUXA 2IS9A 3JVTC 1JC2A 3FWBA 2BBNA 3BUOB 1WRKA 4BY4A 4CPVA 1BODA 1LKJA 1EL4A 3NSLA 1SPYA 2I94A 2JXCA 1K94A 1NCXA 2MLFC 2KFHA 3LK0A 1N0YA 1RECA 2MLEC 1S26D 5TNCA 1DVIA 1KWOC 2L0PA 1KK8B 2JTTA 2PMYA 1J1EA 1IJ6A 1CTRA 5I8NA 3AAJA 4FTGA 5I2OA 1JFKA 2JZIA 4WQ2A 1MXEA 4NDBA 4MN0A 1WLZA 1IWQA 2JRFA 1M45A 1PRWA 1R2UA 2AAOA 2CT9A 3SG5A 1OOJA 1YUTA 2D8NA 2KYCA 4YI9A 1KFUS 1SCMC 4PALA 1RJVA 3LLEA 1S6JA 1RTP1 5DKNA 5AEQA 2HF5A 1QASA 2KI4B 1AJ5A 2CCMA 2K0JA 2AUCA 3BXKA 2LVIA 1Y1XA 2WNDA 3EKHA 2LP2A 3VGOA 3SG2A 3TDUA 2CTNA 1NX1A 4E68A 1TCFA 4P5OE 1S1EA 3ICBA 1ZMZA 2WCEA 2E30A 4M2OA 4C0KA 5D69A 5PALA 1Q80A 1AUIB 2MBXA 2O60A 1QIVA 1XFYO 3M0WA 4NDCA 1H8BA 5CSIA 1TNPA 2M7LA 3JTDC 1V1GA 1CFPA 2ZN8A 3PALA 2KAYA 2K7DA 2LLUA 1NUBA 3FWCA 1J7QA 1QV1A 1TNXA 2I18A 2KAXA 2M1UA 1YRUB 2G2BA 2LAPA 1FW4A 4MZJA 2OS8C 1SBJA 3EVVA 1XO5A 4PDZA 2F33A 4PCWA 5JJGA 2JU0A 3NSIA 1CFDA 5CSJA 4GGFA 2LM5A 1JUOA 1WDCB 1CM4A 3H4SE 2KQYA 4XJKB 4U8DA 2Y4QA 2LMVA 3TS5B 1JF2A 1ZUZA 3BUNB 1M39A 2KGRA 2L98A 2NLNA 1IJ5A 3BOWA 1DJYA 4I5LB 3CTNA 1UHNA 2KHNA 1C07A 2PALA 1S36A 1IG5A 2ZN9A 1ZOTB 5G08A 5JOLA 2OPOA 4N1GA 4MRXA 2ZRSA 2B1UA 4YGDB 1TOPA 4PHKA 1KFXL 4N1FA 1YR5A 4ICBA 2WCBA 2M49B 4DCKA 1MXLC 2BCAA 3PFVA 1CLBA 4CIDA 2BBMA 1UHIA 5FYXA 2FCEA 2JWWA 2M3WA 1PULA 4ORBB 1C7VA 1QTXA 2MRDA 4GGNA 3AAKA 3OB1B 2ZNDA 1YRTB 1QXPA 1W7JB 3GK4X 1TRFA 3EVRA 3BUWB 2LUCA 2M0RA 1J7OA 2BECA 1SR6B 1B8LA 4GUKA 2ZNEA 2R2IA 4GPLB 5CSFA 1Y6WA 1LXFC 1WRLA 2SASA 1S6IA 3KPXA 1JWDA 1F70A 2EC6C 1KK8C 3KHEA 4D1EA 1TCOB 1BT6A 1LINA 2MJWB 3EK7A 5HLVA 1KK7Y 2PVBA 2JXLA 1V1FA 1AK8A 2KBMA 5AERA 2TN4A 3I5HC 2LMTA 3PN7B 1UHJA 4TNCA 3DVJA 1J7PA 1EG3A 1A75A 1DJXA 4ZCVA 1B7TY 1DJZA 1J7RA 4MEWA 5B8IB 3OB2B 2KSPA 2LE9B 4M2PA 2KI4C 1FPWA 1NX0A 3IQOA 3NSKA 1CMFA 4XYNA 2CNPA 2Y1MA 1NP8A 2HQ8A 1UHKA 1F55A 4Q04A 1NX3A 3SIBA 2F2OA 1WRZA 1JBAA 2EHBA 1EXRA 1DTLA 2PSRA 2Q4UA 2MAZA 1DGUA 2L50A 1UURA 3DVKA 5AANA 1TN4A 2G9BA 1KK7Z 1M31A 1G8IA 2EGDA 2JOJA 4DRWA 1SW8A 1PVAA 4PE0A 3BQ3A 1DJIA 1UWOA 5DKRA 1B9AA 1FI5A 1H4BA 1IKUA 2BL0B 3VROA 1D1OA 4YI8A 2OTGB 4I5JA 3SG6A 3EKJA 4GFTA 1BJFA 1K2HA 2Q91A 3IQQA 3GK1A 1B7TZ 3KO0A 1PVBA 1WDCC 3D10A 1SYMA 1QLKA 2BKIB 1CDMA 1KQMB 1OZOA 1K96A 1BLQA 1Y0VH 1S6CA 3TS5C 1CLLA 3VRNA 2ZFDA 1KCYA 1A4PA 1G4YR 1R6PA 4DUQA 1CLMA 2JNXA 3I5FB 3BOWB 1PALA 2H61A 2E6WA 3O2PA 2NXQA 2L2EA 3BUXB 3PSRA 4IL1A 1CNPA 1YUSA 4DIRA 1HT9A 1B8RA 3TDZA 3D0YB 3TDIA 1XK4A 3JVTB 2K2FA 2V53A 4OVNF 3CLNA 2ZRTA 4QJ3B 1CM1A 2BE4A 1NIWA 1ALWA 1YTZC 2L4HA 5DKQA 2JT0A 2WC8A 1K90D 4ORAB 5HLOA 2FOTA 4PHJA 4YGCB 1QATA 2HETA 4HRHA 1M46A 5ER4X 5BPJA 1E8AA 2KYFA 1SL9A 3I5GB 1QS7A 2NCOA 4QJ5B 5I2QA 1KWOB 4MLWA 1MWNA 5J3XA 1SR6C 1MQ1A 2M97A 4JQ0D 4NDDA 4MRYA 1LVCD 1X02A 2BCBA 2M8UA 5CSNA 4BY5A 1WY9A 2M29A 4A4CA 3AKBA 1LA3A 1NYAA 1SMGA 3RLZA 2O5GA 1EJ3A 3ZNIA 4CFQA 3DVMA 2LANA 3D0YA 2L51A 1OMRA 2MA2A 4YBHB 3WHTB 3PN7C 1BR1B 1BU3A 1CDLA 5HKWA 3CGAA 1XFUO 4YGBB 3PATA 1G33A 1ODBA 1UHHA 2BE6A 1YUUA 1A75B 1NSHA 3A4UB 1K9UA 1VRKA 1AJ4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NXA A;  4MVF A;  3LCP C;  2KFF A;  3WNX B;  4HSZ A;  3WHU B;  2PRU A;  2LNK A;  1IQ5 A;  2I2R E;  1OE9 B;  2KI6 C;  1L2O B;  1NCY A;  4PE1 A;  1CB1 A;  1UUS A;  1CFF A;  1DF0 A;  1DGV A;  2NCP A;  5ER5 A;  1SCV A;  1QVI Y;  2JNF A;  1OQP A;  1RWY A;  1KFX S;  2JC2 A;  3GK2 A;  1XFZ O;  1FBV A;  1MHO A;  1JSA A;  2M7N A;  1TIZ A;  2OS8 B;  4PHM A;  4CLN A;  2F3Z A;  2LCP A;  1TNW A;  1AP4 A;  4R1E A;  2P6B B;  3BUM B;  1S5G Y;  2BL0 C;  3LL8 B;  2HQW A;  3HCM A;  1J55 A;  4MZK A;  1XVJ A;  1B8C A;  1A29 A;  1U5I B;  4OV2 A;  2K2A A;  2PAS A;  3PM8 A;  4N5X A;  1CFC A;  3QRX A;  1GJY A;  1KQM C;  5AXI A;  3OX6 A;  3CR2 A;  1CDP A;  3EVU A;  1TTX A;  4MBE A;  2A4J A;  3O6B A;  3TUY B;  1IQ3 A;  3VRR A;  5D7F A;  4GAO A;  3I5F C;  2JT3 A;  3OX5 A;  1WLM A;  3MSE B;  4GNK B;  1IH0 A;  2GV5 A;  1PK0 D;  1J1D A;  3IF7 A;  1QVI Z;  2KI6 D;  2FCD A;  1OSA A;  2WCF A;  1RRO A;  1KSO A;  1BR4 B;  4QJ4 B;  3I5I B;  1GQM A;  1JF0 A;  5KU1 A;  2LP3 A;  1PSB A;  2LUX A;  1KFU L;  1PSR A;  1ZAC A;  2KGB C;  1S5G Z;  3EK4 A;  2NZ0 A;  4P2Y B;  4PE7 A;  1OZS A;  1C7W A;  1U5I A;  4A4B A;  2FJU B;  2K7O A;  3PLF B;  4MZL A;  2KFG A;  1KQV A;  3I5G C;  2EC6 B;  2L4I A;  4C0J A;  2JQ6 A;  2K7B A;  1BF5 A;  2KDH A;  1XFX O;  2M9G A;  3OHM B;  1DJW A;  2SCP A;  2LMU A;  4I5K A;  1B47 A;  4FQO A;  2LVV A;  3FIA A;  4AQI A;  1W7I B;  2QAC A;  4PHN A;  1F71 A;  2K61 A;  5F6T A;  1DMO A;  3I5H B;  1QX5 B;  4CFR A;  1FF1 A;  4L9M A;  2LV7 A;  1CDN A;  2BKH B;  2DOQ A;  3BYA A;  5I2L A;  5IBW A;  5HKY A;  1QX7 A;  1M63 B;  1YVH A;  2M1K B;  3SG7 A;  4WQ3 A;  2JUL A;  1YVL A;  3CR5 X;  1SRA A;  2KOT A;  3KF9 A;  2BCX A;  3EK8 A;  3CR4 X;  2VRG A;  2KNE A;  1Y1A A;  1LA0 A;  3SG3 A;  1SL7 A;  3FS7 A;  1AHR A;  1N65 A;  3DVE A;  3LK1 A;  3SIA A;  1MF8 B;  1JFJ A;  3CS1 A;  2LC5 A;  1OMD A;  2COL B;  2Y5I A;  2K8M B;  1L2O C;  3O4Y A;  3K21 A;  1N2D A;  1F54 A;  1ALV A;  4YGA A;  3NSO A;  2ZKM X;  3SJS A;  2HPS A;  1DF0 B;  2L5X B;  1NX2 A;  2Y1N A;  5KSZ A;  1YX7 A;  1F4Q A;  2WOR A;  5CPV A;  1K9P A;  1XFV O;  1DJH A;  2F2P A;  1YX8 A;  1EG4 A;  3GOF A;  3VRP A;  3TZ1 A;  1SCM B;  1GGZ A;  2JPT A;  2LVK A;  1HQV A;  3A8R A;  1CKK A;  3OP0 A;  1DJG A;  1BOC A;  5AFP A;  3C1V A;  1NCZ A;  4ZCU A;  1MR8 A;  1K93 D;  1RFJ A;  2KQ6 A;  4GBA A;  2LLS A;  1SK6 D;  3CZT X;  4OR9 B;  3F45 A;  4PE4 A;  3SG4 A;  3KEV A;  4JPZ B;  1DT7 B;  4HRE E;  1AVS A;  4ETO A;  1F8H A;  1K95 A;  1YUR A;  1OMV A;  4OCI A;  2GGZ A;  1BMO A;  1L7Z A;  1SL8 A;  2LHI A;  2I7A A;  5HYD A;  1QIW A;  3TUY C;  4WRI A;  1TNQ A;  3JTD B;  4JWQ A;  1SNL A;  1XFW O;  2H2K A;  4OKH A;  2CXJ A;  3DF0 B;  1XYD A;  1A2X A;  1S3P A;  2GGM A;  2H61 C;  3AKA A;  2ISD A;  4C0L A;  1RK9 A;  5K89 A;  1EH2 A;  1A03 A;  4AOM A;  4DS7 A;  3VRQ A;  3WXA A;  3E3R A;  2F8P A;  1IGV A;  1B4C A;  1XK4 C;  2CBL A;  3I5I C;  3HX4 A;  1FI6 A;  2F3Y A;  1K9K A;  1QX2 A;  2JTZ A;  1B1G A;  2KAV A;  1CMG A;  1BG1 A;  1KSM A;  2K7C A;  2LHL A;  2MHH A;  4XJK A;  5HKZ A;  2OTG C;  4AQJ A;  1IRJ A;  1GGW A;  5GQQ C;  3DD4 A;  2KBI A;  2LVJ A;  1Y1U A;  4YRU A;  2JT8 A;  3CWG A;  2AMI A;  4GGF C;  4UPG A;  4USL A;  1QJT A;  1K8U A;  4NQG A;  4M2Q A;  4MSP A;  1ZFS A;  2WOS A;  2LLT A;  1XA5 A;  1QLS A;  3O78 A;  4ORC B;  1SY9 A;  2QPT A;  3ZWH A;  5KTY A;  1NWD A;  3DF0 A;  1F4O A;  1SKT A;  1NPQ A;  1QV0 A;  4F0Z B;  2RGI A;  4YGE B;  4I5N B;  3RM1 A;  1UP5 A;  4HRG A;  1MUX A;  2IS9 A;  3JVT C;  1JC2 A;  3FWB A;  2BBN A;  3BUO B;  1WRK A;  4BY4 A;  4CPV A;  1BOD A;  1LKJ A;  1EL4 A;  3NSL A;  1SPY A;  2I94 A;  2JXC A;  1K94 A;  1NCX A;  2MLF C;  2KFH A;  3LK0 A;  1N0Y A;  1REC A;  2MLE C;  1S26 D;  5TNC A;  1DVI A;  1KWO C;  2L0P A;  1KK8 B;  2JTT A;  2PMY A;  1J1E A;  1IJ6 A;  1CTR A;  5I8N A;  3AAJ A;  4FTG A;  5I2O A;  1JFK A;  2JZI A;  4WQ2 A;  1MXE A;  4NDB A;  4MN0 A;  1WLZ A;  1IWQ A;  2JRF A;  1M45 A;  1PRW A;  1R2U A;  2AAO A;  2CT9 A;  3SG5 A;  1OOJ A;  1YUT A;  2D8N A;  2KYC A;  4YI9 A;  1KFU S;  1SCM C;  4PAL A;  1RJV A;  3LLE A;  1S6J A;  1RTP 1;  5DKN A;  5AEQ A;  2HF5 A;  1QAS A;  2KI4 B;  1AJ5 A;  2CCM A;  2K0J A;  2AUC A;  3BXK A;  2LVI A;  1Y1X A;  2WND A;  3EKH A;  2LP2 A;  3VGO A;  3SG2 A;  3TDU A;  2CTN A;  1NX1 A;  4E68 A;  1TCF A;  4P5O E;  1S1E A;  3ICB A;  1ZMZ A;  2WCE A;  2E30 A;  4M2O A;  4C0K A;  5D69 A;  5PAL A;  1Q80 A;  1AUI B;  2MBX A;  2O60 A;  1QIV A;  1XFY O;  3M0W A;  4NDC A;  1H8B A;  5CSI A;  1TNP A;  2M7L A;  3JTD C;  1V1G A;  1CFP A;  2ZN8 A;  3PAL A;  2KAY A;  2K7D A;  2LLU A;  1NUB A;  3FWC A;  1J7Q A;  1QV1 A;  1TNX A;  2I18 A;  2KAX A;  2M1U A;  1YRU B;  2G2B A;  2LAP A;  1FW4 A;  4MZJ A;  2OS8 C;  1SBJ A;  3EVV A;  1XO5 A;  4PDZ A;  2F33 A;  4PCW A;  5JJG A;  2JU0 A;  3NSI A;  1CFD A;  5CSJ A;  4GGF A;  2LM5 A;  1JUO A;  1WDC B;  1CM4 A;  3H4S E;  2KQY A;  4XJK B;  4U8D A;  2Y4Q A;  2LMV A;  3TS5 B;  1JF2 A;  1ZUZ A;  3BUN B;  1M39 A;  2KGR A;  2L98 A;  2NLN A;  1IJ5 A;  3BOW A;  1DJY A;  4I5L B;  3CTN A;  1UHN A;  2KHN A;  1C07 A;  2PAL A;  1S36 A;  1IG5 A;  2ZN9 A;  1ZOT B;  5G08 A;  5JOL A;  2OPO A;  4N1G A;  4MRX A;  2ZRS A;  2B1U A;  4YGD B;  1TOP A;  4PHK A;  1KFX L;  4N1F A;  1YR5 A;  4ICB A;  2WCB A;  2M49 B;  4DCK A;  1MXL C;  2BCA A;  3PFV A;  1CLB A;  4CID A;  2BBM A;  1UHI A;  5FYX A;  2FCE A;  2JWW A;  2M3W A;  1PUL A;  4ORB B;  1C7V A;  1QTX A;  2MRD A;  4GGN A;  3AAK A;  3OB1 B;  2ZND A;  1YRT B;  1QXP A;  1W7J B;  3GK4 X;  1TRF A;  3EVR A;  3BUW B;  2LUC A;  2M0R A;  1J7O A;  2BEC A;  1SR6 B;  1B8L A;  4GUK A;  2ZNE A;  2R2I A;  4GPL B;  5CSF A;  1Y6W A;  1LXF C;  1WRL A;  2SAS A;  1S6I A;  3KPX A;  1JWD A;  1F70 A;  2EC6 C;  1KK8 C;  3KHE A;  4D1E A;  1TCO B;  1BT6 A;  1LIN A;  2MJW B;  3EK7 A;  5HLV A;  1KK7 Y;  2PVB A;  2JXL A;  1V1F A;  1AK8 A;  2KBM A;  5AER A;  2TN4 A;  3I5H C;  2LMT A;  3PN7 B;  1UHJ A;  4TNC A;  3DVJ A;  1J7P A;  1EG3 A;  1A75 A;  1DJX A;  4ZCV A;  1B7T Y;  1DJZ A;  1J7R A;  4MEW A;  5B8I B;  3OB2 B;  2KSP A;  2LE9 B;  4M2P A;  2KI4 C;  1FPW A;  1NX0 A;  3IQO A;  3NSK A;  1CMF A;  4XYN A;  2CNP A;  2Y1M A;  1NP8 A;  2HQ8 A;  1UHK A;  1F55 A;  4Q04 A;  1NX3 A;  3SIB A;  2F2O A;  1WRZ A;  1JBA A;  2EHB A;  1EXR A;  1DTL A;  2PSR A;  2Q4U A;  2MAZ A;  1DGU A;  2L50 A;  1UUR A;  3DVK A;  5AAN A;  1TN4 A;  2G9B A;  1KK7 Z;  1M31 A;  1G8I A;  2EGD A;  2JOJ A;  4DRW A;  1SW8 A;  1PVA A;  4PE0 A;  3BQ3 A;  1DJI A;  1UWO A;  5DKR A;  1B9A A;  1FI5 A;  1H4B A;  1IKU A;  2BL0 B;  3VRO A;  1D1O A;  4YI8 A;  2OTG B;  4I5J A;  3SG6 A;  3EKJ A;  4GFT A;  1BJF A;  1K2H A;  2Q91 A;  3IQQ A;  3GK1 A;  1B7T Z;  3KO0 A;  1PVB A;  1WDC C;  3D10 A;  1SYM A;  1QLK A;  2BKI B;  1CDM A;  1KQM B;  1OZO A;  1K96 A;  1BLQ A;  1Y0V H;  1S6C A;  3TS5 C;  1CLL A;  3VRN A;  2ZFD A;  1KCY A;  1A4P A;  1G4Y R;  1R6P A;  4DUQ A;  1CLM A;  2JNX A;  3I5F B;  3BOW B;  1PAL A;  2H61 A;  2E6W A;  3O2P A;  2NXQ A;  2L2E A;  3BUX B;  3PSR A;  4IL1 A;  1CNP A;  1YUS A;  4DIR A;  1HT9 A;  1B8R A;  3TDZ A;  3D0Y B;  3TDI A;  1XK4 A;  3JVT B;  2K2F A;  2V53 A;  4OVN F;  3CLN A;  2ZRT A;  4QJ3 B;  1CM1 A;  2BE4 A;  1NIW A;  1ALW A;  1YTZ C;  2L4H A;  5DKQ A;  2JT0 A;  2WC8 A;  1K90 D;  4ORA B;  5HLO A;  2FOT A;  4PHJ A;  4YGC B;  1QAT A;  2HET A;  4HRH A;  1M46 A;  5ER4 X;  5BPJ A;  1E8A A;  2KYF A;  1SL9 A;  3I5G B;  1QS7 A;  2NCO A;  4QJ5 B;  5I2Q A;  1KWO B;  4MLW A;  1MWN A;  5J3X A;  1SR6 C;  1MQ1 A;  2M97 A;  4JQ0 D;  4NDD A;  4MRY A;  1LVC D;  1X02 A;  2BCB A;  2M8U A;  5CSN A;  4BY5 A;  1WY9 A;  2M29 A;  4A4C A;  3AKB A;  1LA3 A;  1NYA A;  1SMG A;  3RLZ A;  2O5G A;  1EJ3 A;  3ZNI A;  4CFQ A;  3DVM A;  2LAN A;  3D0Y A;  2L51 A;  1OMR A;  2MA2 A;  4YBH B;  3WHT B;  3PN7 C;  1BR1 B;  1BU3 A;  1CDL A;  5HKW A;  3CGA A;  1XFU O;  4YGB B;  3PAT A;  1G33 A;  1ODB A;  1UHH A;  2BE6 A;  1YUU A;  1A75 B;  1NSH A;  3A4U B;  1K9U A;  1VRK A;  1AJ4 A; 
#chains in the Genus database with same CATH topology
 2KLE A;  3NXA A;  4MVF A;  3LCP C;  2KFF A;  3WNX B;  4HSZ A;  3WHU B;  2PRU A;  3SS3 A;  2LNK A;  3CAB A;  1IQ5 A;  2I2R E;  1LS8 A;  1OE9 B;  3VB1 A;  1OOH A;  2KI6 C;  1L2O B;  1NCY A;  2WC6 A;  4PE1 A;  1CB1 A;  1UUS A;  1CFF A;  1DF0 A;  1DGV A;  2NCP A;  5ER5 A;  1SCV A;  3D76 A;  1QVI Y;  2JNF A;  5D3O A;  1C3Y A;  1OQP A;  1RWY A;  1KFX S;  2JC2 A;  3GK2 A;  1XFZ O;  2PQL A;  1FBV A;  1MHO A;  1JSA A;  2M7N A;  1TIZ A;  2OS8 B;  4PHM A;  4CLN A;  2YGU A;  2F3Z A;  2LCP A;  2QEH A;  1TNW A;  1AP4 A;  4R1E A;  2P6B B;  3BUM B;  1S5G Y;  2BL0 C;  3LL8 B;  2HQW A;  3HCM A;  1J55 A;  4MZK A;  1XVJ A;  1B8C A;  1A29 A;  1U5I B;  2PYQ A;  4OV2 A;  2K2A A;  2PAS A;  3PM8 A;  4N5X A;  1CFC A;  3QRX A;  5HL1 A;  1GJY A;  1KQM C;  5I94 A;  3Q8I A;  3OX6 A;  3CR2 A;  1CDP A;  5AXI A;  3EVU A;  1TTX A;  4MBE A;  2A4J A;  3O6B A;  3OGN A;  3TUY B;  1IQ3 A;  3VRR A;  3CYZ A;  5D7F A;  4GAO A;  3I5F C;  2JT3 A;  3OX5 A;  4JD9 A;  1WLM A;  3MSE B;  4GNK B;  1IH0 A;  2GV5 A;  1PK0 D;  1J1D A;  3IF7 A;  1QVI Z;  2KI6 D;  2FCD A;  1OSA A;  2WCL A;  2WCF A;  1RRO A;  2KLD A;  1KSO A;  1BR4 B;  4QJ4 B;  3I5I B;  1GQM A;  1JF0 A;  5KU1 A;  2LP3 A;  1PSB A;  2LUX A;  1KFU L;  1PSR A;  1ZAC A;  2KGB C;  1S5G Z;  3EK4 A;  2NZ0 A;  3PM2 A;  4P2Y B;  4PE7 A;  1OZS A;  1C7W A;  1U5I A;  4A4B A;  2FJU B;  2K7O A;  3PLF B;  4MZL A;  3RZS A;  2KFG A;  3B6X A;  1KQV A;  3I5G C;  2EC6 B;  2L4I A;  4C0J A;  2JQ6 A;  2K7B A;  1BF5 A;  2KDH A;  1XFX O;  2M9G A;  3FE6 A;  1DEK A;  3OHM B;  1DJW A;  2SCP A;  2LMU A;  4I5K A;  1B47 A;  4FQO A;  2LVV A;  3FIA A;  4AQI A;  1W7I B;  3R1P A;  2QAC A;  1GM0 A;  4PHN A;  1F71 A;  2K61 A;  5F6T A;  1DMO A;  3I5H B;  1QX5 B;  4CFR A;  1FF1 A;  2BNX A;  1Z2C B;  4L9M A;  2LV7 A;  1CDN A;  2BKH B;  2DOQ A;  3BYA A;  5I2L A;  5IBW A;  5HKY A;  3FE8 A;  3CDN A;  1QX7 A;  1M63 B;  1OW4 A;  1YVH A;  2M1K B;  3SG7 A;  4WQ3 A;  2JUL A;  1YVL A;  3CR5 X;  1SRA A;  2KOT A;  3KF9 A;  2BCX A;  3EK8 A;  3CR4 X;  2VRG A;  2KNE A;  3BFB A;  1Y1A A;  1LA0 A;  3SG3 A;  1SL7 A;  3FS7 A;  1AHR A;  1N65 A;  3DVE A;  3LK1 A;  3SIA A;  1MF8 B;  1JFJ A;  3CS1 A;  2LC5 A;  1DEL A;  1OMD A;  2COL B;  2Y5I A;  2K8M B;  1L2O C;  3O4Y A;  3K21 A;  1N2D A;  5FI6 A;  1F54 A;  1ALV A;  4YGA A;  3NSO A;  2ZKM X;  3SJS A;  2HPS A;  1DF0 B;  2WCH A;  3B7A A;  2L5X B;  1NX2 A;  2Y1N A;  5KSZ A;  1YX7 A;  1F4Q A;  2WOR A;  5CPV A;  1K9P A;  1XFV O;  1DJH A;  2F2P A;  1YX8 A;  3R72 A;  1EG4 A;  3GOF A;  3VRP A;  3TZ1 A;  3BFH A;  1SCM B;  1GGZ A;  2JPT A;  2WCJ A;  2LVK A;  1HQV A;  3A8R A;  1CKK A;  3OP0 A;  1DJG A;  4FQT A;  5AFP A;  1BOC A;  1T14 A;  3C1V A;  1NCZ A;  4ZCU A;  3CZ0 A;  1MR8 A;  3SS5 A;  1K93 D;  1RFJ A;  2KQ6 A;  4GBA A;  4KYN A;  2LLS A;  3D75 A;  1SK6 D;  3CZT X;  4OR9 B;  3F45 A;  4PE4 A;  3SG4 A;  3KEV A;  4JPZ B;  1DT7 B;  4HRE E;  1AVS A;  4ETO A;  1F8H A;  1K95 A;  1YUR A;  1OMV A;  4OCI A;  2GGZ A;  1BMO A;  1L7Z A;  1SL8 A;  2LHI A;  2I7A A;  5HYD A;  1QIW A;  3TUY C;  3D73 A;  4WRI A;  3S0A A;  1TNQ A;  2QEO A;  3JTD B;  1SNL A;  1W9Z A;  4JWQ A;  1XFW O;  2H2K A;  4OKH A;  2CXJ A;  3DF0 B;  1XYD A;  1A2X A;  1S3P A;  2GGM A;  2H61 C;  3AKA A;  2ISD A;  4C0L A;  1RK9 A;  5K89 A;  3UO9 A;  1EH2 A;  1A03 A;  4AOM A;  4DS7 A;  3VRQ A;  3WXA A;  3E3R A;  2F8P A;  1IGV A;  2GTE A;  1B4C A;  1XK4 C;  2CBL A;  3I5I C;  3HX4 A;  1FI6 A;  2F3Y A;  1K9K A;  1QX2 A;  2JTZ A;  1B1G A;  2KAV A;  1CMG A;  1BG1 A;  1KSM A;  2K7C A;  2LHL A;  2MHH A;  4XJK A;  5HKZ A;  2OTG C;  4AQJ A;  1IRJ A;  1GGW A;  5GQQ C;  3DD4 A;  2KBI A;  2LVJ A;  1Y1U A;  4YRU A;  3S0E A;  3S0D A;  2JT8 A;  3CWG A;  2AMI A;  4GGF C;  4UPG A;  4USL A;  1QJT A;  1K8U A;  4NQG A;  4M2Q A;  4F7F A;  3DXL A;  4MSP A;  1ZFS A;  2WOS A;  2LLT A;  1XA5 A;  1QLS A;  3O78 A;  4ORC B;  1SY9 A;  2QPT A;  3ZWH A;  5KTY A;  3D77 A;  1NWD A;  3NGV A;  3DF0 A;  1F4O A;  1SKT A;  1NPQ A;  1QV0 A;  4F0Z B;  2RGI A;  4YGE B;  4I5N B;  3RM1 A;  1XFR A;  1UP5 A;  4HRG A;  1MUX A;  2IS9 A;  3JVT C;  1JC2 A;  3FWB A;  2BBN A;  3BUO B;  1WRK A;  4OZD A;  1IIO A;  3BJH A;  4BY4 A;  4CPV A;  1BOD A;  1LKJ A;  1EL4 A;  3NSL A;  1SPY A;  2I94 A;  2JXC A;  1K94 A;  1NCX A;  1OOF A;  2MLF C;  2KFH A;  3LK0 A;  1N0Y A;  2K60 A;  1REC A;  2MLE C;  1S26 D;  5TNC A;  1DVI A;  1KWO C;  2L0P A;  1KK8 B;  2JTT A;  2PMY A;  1J1E A;  1IJ6 A;  1CTR A;  5I8N A;  3AAJ A;  4FTG A;  5I2O A;  1JFK A;  2JZI A;  4WQ2 A;  1MXE A;  4NDB A;  4MN0 A;  1WLZ A;  1IWQ A;  2JRF A;  1M45 A;  1PRW A;  1R2U A;  2AAO A;  2CT9 A;  3SG5 A;  1OOJ A;  1YUT A;  2D8N A;  2KYC A;  4YI9 A;  1KFU S;  3S0B A;  1SCM C;  4PAL A;  1RJV A;  3LLE A;  1S6J A;  1RTP 1;  3OBV A;  5DKN A;  5AEQ A;  2HF5 A;  1QAS A;  2KI4 B;  1AJ5 A;  2L2C A;  2CCM A;  2K0J A;  2AUC A;  1Z4H A;  2JPO A;  3BXK A;  2LVI A;  1Y1X A;  2WND A;  3EKH A;  3L4L A;  2LP2 A;  3VGO A;  3CZ2 A;  3SG2 A;  3TDU A;  2CTN A;  3V2L A;  1NX1 A;  4E68 A;  1TCF A;  4P5O E;  1C3Z A;  1S1E A;  3ICB A;  1ZMZ A;  2WCE A;  2E30 A;  4M2O A;  4C0K A;  5D69 A;  5PAL A;  2QEB A;  1Q80 A;  1AUI B;  2MBX A;  2O60 A;  1QIV A;  1XFY O;  3M0W A;  4NDC A;  1H8B A;  5CSI A;  1TNP A;  2M7L A;  3JTD C;  1V1G A;  1CFP A;  2ZN8 A;  3PAL A;  2KAY A;  2K7D A;  3S0G A;  2LLU A;  1NUB A;  3FWC A;  1J7Q A;  1QV1 A;  1TNX A;  2I18 A;  2KAX A;  2M1U A;  1YRU B;  2G2B A;  2LAP A;  1FW4 A;  4MZJ A;  2OS8 C;  3R1V A;  1SBJ A;  3EVV A;  1XO5 A;  4PDZ A;  2F33 A;  4PCW A;  5JJG A;  2JU0 A;  3NSI A;  1CFD A;  5CSJ A;  4GGF A;  2LM5 A;  1JUO A;  1WDC B;  3NHI A;  1CM4 A;  3H4S E;  2KQY A;  4XJK B;  4U8D A;  2Y4Q A;  5EL2 A;  2LMV A;  3R1O A;  1JF2 A;  1ZUZ A;  3BUN B;  1M39 A;  3TS5 B;  2KGR A;  2L98 A;  4INW A;  2QDI A;  2NLN A;  1IJ5 A;  3BOW A;  1DJY A;  4I5L B;  3CTN A;  1UHN A;  3K1E A;  2KHN A;  1C07 A;  2PAL A;  1S36 A;  3L4A A;  1IG5 A;  2H8V A;  2ZN9 A;  1ZOT B;  5G08 A;  5JOL A;  3EG5 B;  2OPO A;  4N1G A;  2L5Y A;  2WCK A;  4MRX A;  2ZRS A;  2B1U A;  4YGD B;  1TOP A;  4PHK A;  1KFX L;  4N1F A;  1YR5 A;  4ICB A;  2WCB A;  2M49 B;  4DCK A;  1MXL C;  2BCA A;  3PFV A;  1CLB A;  4CID A;  2BBM A;  1UHI A;  4JKT A;  5FYX A;  2FCE A;  2JWW A;  3N7H A;  2M3W A;  1PUL A;  2P71 A;  4ORB B;  1C7V A;  1QTX A;  2QEV A;  2MRD A;  3QME A;  4GGN A;  3AAK A;  4IJ7 A;  5DIC A;  3OB1 B;  2ZND A;  1YRT B;  1QXP A;  1W7J B;  3GK4 X;  1TRF A;  3EVR A;  2KPH A;  1TUZ A;  3BUW B;  2LUC A;  2M0R A;  1P28 A;  1J7O A;  2BEC A;  3B88 A;  1SR6 B;  1B8L A;  1TUJ A;  4GUK A;  2ZNE A;  3B87 A;  2R2I A;  4GPL B;  5CSF A;  1Y6W A;  1LXF C;  1WRL A;  2SAS A;  1S6I A;  3BFA A;  3KPX A;  1JWD A;  1F70 A;  2EC6 C;  1KK8 C;  2WC5 A;  3KHE A;  4D1E A;  1TCO B;  1BT6 A;  1LIN A;  2MJW B;  3EK7 A;  5HLV A;  1KK7 Y;  2PVB A;  2JXL A;  2FJY A;  1V1F A;  1AK8 A;  2KBM A;  5AER A;  2TN4 A;  3I5H C;  2LMT A;  3PN7 B;  1UHJ A;  4TNC A;  3DVJ A;  1J7P A;  1EG3 A;  2BAP A;  1A75 A;  1DJX A;  4ZCV A;  4PT1 A;  1B7T Y;  1DJZ A;  3NHT A;  1J7R A;  4MEW A;  5B8I B;  3OB2 B;  2KSP A;  2LE9 B;  4M2P A;  2KI4 C;  3B86 A;  1FPW A;  3DY9 A;  1NX0 A;  3IQO A;  3NSK A;  1CMF A;  3O4X A;  4XYN A;  2CNP A;  2Y1M A;  1NP8 A;  2HQ8 A;  1UHK A;  1F55 A;  1TWO A;  3D74 A;  1NX3 A;  4Q04 A;  2F2O A;  1WRZ A;  3SIB A;  1JBA A;  2EHB A;  1EXR A;  1DTL A;  2PSR A;  2Q4U A;  2MAZ A;  2WCM A;  1DGU A;  2L50 A;  1UUR A;  3DVK A;  5AAN A;  1TN4 A;  2G9B A;  3DYE A;  1KK7 Z;  1M31 A;  1G8I A;  2EGD A;  2JOJ A;  4DRW A;  1SW8 A;  1PVA A;  3L47 A;  3BQ3 A;  4PE0 A;  1DJI A;  1UWO A;  5DKR A;  3PJI A;  1B9A A;  3UNW A;  1FI5 A;  1H4B A;  1IKU A;  2BL0 B;  3VRO A;  1D1O A;  4YI8 A;  2OTG B;  4I5J A;  3SG6 A;  3EKJ A;  4GFT A;  1BJF A;  1K2H A;  3IVT A;  2Q91 A;  3IQQ A;  3GK1 A;  1B7T Z;  3KO0 A;  1PVB A;  1WDC C;  3D10 A;  1SYM A;  1QLK A;  2BKI B;  1OOG A;  1CDM A;  1KQM B;  1OZO A;  1K96 A;  1BLQ A;  1Y0V H;  1S6C A;  3TS5 C;  1CLL A;  3VRN A;  2ZFD A;  1KCY A;  1A4P A;  1G4Y R;  5FI7 A;  1R6P A;  4DUQ A;  1CLM A;  2JNX A;  3I5F B;  3BOW B;  1PAL A;  2H61 A;  2E6W A;  3O2P A;  2NXQ A;  2L2E A;  3BUX B;  3PSR A;  4IL1 A;  1ORG A;  1YUS A;  1CNP A;  4DIR A;  3FE9 A;  1HT9 A;  1B8R A;  3TDZ A;  3D0Y B;  3TDI A;  3S0F A;  1XK4 A;  3JVT B;  2K2F A;  2V53 A;  4OVN F;  3CLN A;  2ZRT A;  4QJ3 B;  1CM1 A;  2BE4 A;  1NIW A;  1ALW A;  1YTZ C;  2L4H A;  5DKQ A;  2JT0 A;  2WC8 A;  3D78 A;  1K90 D;  3SS4 A;  4ORA B;  5HLO A;  2FOT A;  4PHJ A;  4YGC B;  1QAT A;  2HET A;  4HRH A;  1M46 A;  5ER4 X;  5BPJ A;  1E8A A;  2KYF A;  1SL9 A;  3I5G B;  1QS7 A;  2NCO A;  3DZT A;  4QJ5 B;  1KWO B;  4MLW A;  5I2Q A;  1MWN A;  1OOI X;  3CZ1 A;  1SR6 C;  5J3X A;  1MQ1 A;  2M97 A;  4JQ0 D;  4NDD A;  4MRY A;  1LVC D;  1X02 A;  2BCB A;  2M8U A;  5CSN A;  4BY5 A;  1WY9 A;  2M29 A;  1DQE A;  3AKB A;  4A4C A;  1LA3 A;  1NYA A;  1SMG A;  3RLZ A;  2O5G A;  2P70 A;  1EJ3 A;  3ZNI A;  4CFQ A;  3DVM A;  2LAN A;  3D0Y A;  2L51 A;  1SSE B;  5FI2 A;  1OMR A;  2MA2 A;  4YBH B;  3WHT B;  1QWV A;  1BR1 B;  1BU3 A;  1CDL A;  3PN7 C;  5HKW A;  3CGA A;  1XFU O;  4YGB B;  3PAT A;  1G33 A;  1ODB A;  1UHH A;  2BE6 A;  4INX A;  1DC1 A;  1YUU A;  1A75 B;  1NSH A;  3A4U B;  1K9U A;  2ERB A;  1VRK A;  1AJ4 A; 
#chains in the Genus database with same CATH homology
 3NXA A;  4MVF A;  3LCP C;  2KFF A;  3WNX B;  4HSZ A;  3WHU B;  2PRU A;  2LNK A;  1IQ5 A;  2I2R E;  1OE9 B;  2KI6 C;  1L2O B;  1NCY A;  4PE1 A;  1CB1 A;  1UUS A;  1CFF A;  1DF0 A;  1DGV A;  2NCP A;  5ER5 A;  1SCV A;  1QVI Y;  2JNF A;  1OQP A;  1RWY A;  1KFX S;  2JC2 A;  3GK2 A;  1XFZ O;  1FBV A;  1MHO A;  1JSA A;  2M7N A;  1TIZ A;  2OS8 B;  4PHM A;  4CLN A;  2F3Z A;  2LCP A;  1TNW A;  1AP4 A;  4R1E A;  2P6B B;  3BUM B;  1S5G Y;  2BL0 C;  3LL8 B;  2HQW A;  3HCM A;  1J55 A;  4MZK A;  1XVJ A;  1B8C A;  1A29 A;  1U5I B;  4OV2 A;  2K2A A;  2PAS A;  3PM8 A;  4N5X A;  1CFC A;  3QRX A;  1GJY A;  1KQM C;  5AXI A;  3OX6 A;  3CR2 A;  1CDP A;  3EVU A;  1TTX A;  4MBE A;  2A4J A;  3O6B A;  3TUY B;  1IQ3 A;  3VRR A;  5D7F A;  4GAO A;  3I5F C;  2JT3 A;  3OX5 A;  1WLM A;  3MSE B;  4GNK B;  1IH0 A;  2GV5 A;  1PK0 D;  1J1D A;  3IF7 A;  1QVI Z;  2KI6 D;  2FCD A;  1OSA A;  2WCF A;  1RRO A;  1KSO A;  1BR4 B;  4QJ4 B;  3I5I B;  1GQM A;  1JF0 A;  5KU1 A;  2LP3 A;  1PSB A;  2LUX A;  1KFU L;  1PSR A;  1ZAC A;  2KGB C;  1S5G Z;  3EK4 A;  2NZ0 A;  4P2Y B;  4PE7 A;  1OZS A;  1C7W A;  1U5I A;  4A4B A;  2FJU B;  2K7O A;  3PLF B;  4MZL A;  2KFG A;  1KQV A;  3I5G C;  2EC6 B;  2L4I A;  4C0J A;  2JQ6 A;  2K7B A;  1BF5 A;  2KDH A;  1XFX O;  2M9G A;  3OHM B;  1DJW A;  2SCP A;  2LMU A;  4I5K A;  1B47 A;  4FQO A;  2LVV A;  3FIA A;  4AQI A;  1W7I B;  2QAC A;  4PHN A;  1F71 A;  2K61 A;  5F6T A;  1DMO A;  3I5H B;  1QX5 B;  4CFR A;  1FF1 A;  4L9M A;  2LV7 A;  1CDN A;  2BKH B;  2DOQ A;  3BYA A;  5I2L A;  5IBW A;  5HKY A;  1QX7 A;  1M63 B;  1YVH A;  2M1K B;  3SG7 A;  4WQ3 A;  2JUL A;  1YVL A;  3CR5 X;  1SRA A;  2KOT A;  3KF9 A;  2BCX A;  3EK8 A;  3CR4 X;  2VRG A;  2KNE A;  1Y1A A;  1LA0 A;  3SG3 A;  1SL7 A;  3FS7 A;  1AHR A;  1N65 A;  3DVE A;  3LK1 A;  3SIA A;  1MF8 B;  1JFJ A;  3CS1 A;  2LC5 A;  1OMD A;  2COL B;  2Y5I A;  2K8M B;  1L2O C;  3O4Y A;  3K21 A;  1N2D A;  1F54 A;  1ALV A;  4YGA A;  3NSO A;  2ZKM X;  3SJS A;  2HPS A;  1DF0 B;  2L5X B;  1NX2 A;  2Y1N A;  5KSZ A;  1YX7 A;  1F4Q A;  2WOR A;  5CPV A;  1K9P A;  1XFV O;  1DJH A;  2F2P A;  1YX8 A;  1EG4 A;  3GOF A;  3VRP A;  3TZ1 A;  1SCM B;  1GGZ A;  2JPT A;  2LVK A;  1HQV A;  3A8R A;  1CKK A;  3OP0 A;  1DJG A;  1BOC A;  5AFP A;  3C1V A;  1NCZ A;  4ZCU A;  1MR8 A;  1K93 D;  1RFJ A;  2KQ6 A;  4GBA A;  2LLS A;  1SK6 D;  3CZT X;  4OR9 B;  3F45 A;  4PE4 A;  3SG4 A;  3KEV A;  4JPZ B;  1DT7 B;  4HRE E;  1AVS A;  4ETO A;  1F8H A;  1K95 A;  1YUR A;  1OMV A;  4OCI A;  2GGZ A;  1BMO A;  1L7Z A;  1SL8 A;  2LHI A;  2I7A A;  5HYD A;  1QIW A;  3TUY C;  4WRI A;  1TNQ A;  3JTD B;  4JWQ A;  1SNL A;  1XFW O;  2H2K A;  4OKH A;  2CXJ A;  3DF0 B;  1XYD A;  1A2X A;  1S3P A;  2GGM A;  2H61 C;  3AKA A;  2ISD A;  4C0L A;  1RK9 A;  5K89 A;  1EH2 A;  1A03 A;  4AOM A;  4DS7 A;  3VRQ A;  3WXA A;  3E3R A;  2F8P A;  1IGV A;  1B4C A;  1XK4 C;  2CBL A;  3I5I C;  3HX4 A;  1FI6 A;  2F3Y A;  1K9K A;  1QX2 A;  2JTZ A;  1B1G A;  2KAV A;  1CMG A;  1BG1 A;  1KSM A;  2K7C A;  2LHL A;  2MHH A;  4XJK A;  5HKZ A;  2OTG C;  4AQJ A;  1IRJ A;  1GGW A;  5GQQ C;  3DD4 A;  2KBI A;  2LVJ A;  1Y1U A;  4YRU A;  2JT8 A;  3CWG A;  2AMI A;  4GGF C;  4UPG A;  4USL A;  1QJT A;  1K8U A;  4NQG A;  4M2Q A;  4MSP A;  1ZFS A;  2WOS A;  2LLT A;  1XA5 A;  1QLS A;  3O78 A;  4ORC B;  1SY9 A;  2QPT A;  3ZWH A;  5KTY A;  1NWD A;  3DF0 A;  1F4O A;  1SKT A;  1NPQ A;  1QV0 A;  4F0Z B;  2RGI A;  4YGE B;  4I5N B;  3RM1 A;  1UP5 A;  4HRG A;  1MUX A;  2IS9 A;  3JVT C;  1JC2 A;  3FWB A;  2BBN A;  3BUO B;  1WRK A;  4BY4 A;  4CPV A;  1BOD A;  1LKJ A;  1EL4 A;  3NSL A;  1SPY A;  2I94 A;  2JXC A;  1K94 A;  1NCX A;  2MLF C;  2KFH A;  3LK0 A;  1N0Y A;  1REC A;  2MLE C;  1S26 D;  5TNC A;  1DVI A;  1KWO C;  2L0P A;  1KK8 B;  2JTT A;  2PMY A;  1J1E A;  1IJ6 A;  1CTR A;  5I8N A;  3AAJ A;  4FTG A;  5I2O A;  1JFK A;  2JZI A;  4WQ2 A;  1MXE A;  4NDB A;  4MN0 A;  1WLZ A;  1IWQ A;  2JRF A;  1M45 A;  1PRW A;  1R2U A;  2AAO A;  2CT9 A;  3SG5 A;  1OOJ A;  1YUT A;  2D8N A;  2KYC A;  4YI9 A;  1KFU S;  1SCM C;  4PAL A;  1RJV A;  3LLE A;  1S6J A;  1RTP 1;  5DKN A;  5AEQ A;  2HF5 A;  1QAS A;  2KI4 B;  1AJ5 A;  2CCM A;  2K0J A;  2AUC A;  3BXK A;  2LVI A;  1Y1X A;  2WND A;  3EKH A;  2LP2 A;  3VGO A;  3SG2 A;  3TDU A;  2CTN A;  1NX1 A;  4E68 A;  1TCF A;  4P5O E;  1S1E A;  3ICB A;  1ZMZ A;  2WCE A;  2E30 A;  4M2O A;  4C0K A;  5D69 A;  5PAL A;  1Q80 A;  1AUI B;  2MBX A;  2O60 A;  1QIV A;  1XFY O;  3M0W A;  4NDC A;  1H8B A;  5CSI A;  1TNP A;  2M7L A;  3JTD C;  1V1G A;  1CFP A;  2ZN8 A;  3PAL A;  2KAY A;  2K7D A;  2LLU A;  1NUB A;  3FWC A;  1J7Q A;  1QV1 A;  1TNX A;  2I18 A;  2KAX A;  2M1U A;  1YRU B;  2G2B A;  2LAP A;  1FW4 A;  4MZJ A;  2OS8 C;  1SBJ A;  3EVV A;  1XO5 A;  4PDZ A;  2F33 A;  4PCW A;  5JJG A;  2JU0 A;  3NSI A;  1CFD A;  5CSJ A;  4GGF A;  2LM5 A;  1JUO A;  1WDC B;  1CM4 A;  3H4S E;  2KQY A;  4XJK B;  4U8D A;  2Y4Q A;  2LMV A;  3TS5 B;  1JF2 A;  1ZUZ A;  3BUN B;  1M39 A;  2KGR A;  2L98 A;  2NLN A;  1IJ5 A;  3BOW A;  1DJY A;  4I5L B;  3CTN A;  1UHN A;  2KHN A;  1C07 A;  2PAL A;  1S36 A;  1IG5 A;  2ZN9 A;  1ZOT B;  5G08 A;  5JOL A;  2OPO A;  4N1G A;  4MRX A;  2ZRS A;  2B1U A;  4YGD B;  1TOP A;  4PHK A;  1KFX L;  4N1F A;  1YR5 A;  4ICB A;  2WCB A;  2M49 B;  4DCK A;  1MXL C;  2BCA A;  3PFV A;  1CLB A;  4CID A;  2BBM A;  1UHI A;  5FYX A;  2FCE A;  2JWW A;  2M3W A;  1PUL A;  4ORB B;  1C7V A;  1QTX A;  2MRD A;  4GGN A;  3AAK A;  3OB1 B;  2ZND A;  1YRT B;  1QXP A;  1W7J B;  3GK4 X;  1TRF A;  3EVR A;  3BUW B;  2LUC A;  2M0R A;  1J7O A;  2BEC A;  1SR6 B;  1B8L A;  4GUK A;  2ZNE A;  2R2I A;  4GPL B;  5CSF A;  1Y6W A;  1LXF C;  1WRL A;  2SAS A;  1S6I A;  3KPX A;  1JWD A;  1F70 A;  2EC6 C;  1KK8 C;  3KHE A;  4D1E A;  1TCO B;  1BT6 A;  1LIN A;  2MJW B;  3EK7 A;  5HLV A;  1KK7 Y;  2PVB A;  2JXL A;  1V1F A;  1AK8 A;  2KBM A;  5AER A;  2TN4 A;  3I5H C;  2LMT A;  3PN7 B;  1UHJ A;  4TNC A;  3DVJ A;  1J7P A;  1EG3 A;  1A75 A;  1DJX A;  4ZCV A;  1B7T Y;  1DJZ A;  1J7R A;  4MEW A;  5B8I B;  3OB2 B;  2KSP A;  2LE9 B;  4M2P A;  2KI4 C;  1FPW A;  1NX0 A;  3IQO A;  3NSK A;  1CMF A;  4XYN A;  2CNP A;  2Y1M A;  1NP8 A;  2HQ8 A;  1UHK A;  1F55 A;  4Q04 A;  1NX3 A;  3SIB A;  2F2O A;  1WRZ A;  1JBA A;  2EHB A;  1EXR A;  1DTL A;  2PSR A;  2Q4U A;  2MAZ A;  1DGU A;  2L50 A;  1UUR A;  3DVK A;  5AAN A;  1TN4 A;  2G9B A;  1KK7 Z;  1M31 A;  1G8I A;  2EGD A;  2JOJ A;  4DRW A;  1SW8 A;  1PVA A;  4PE0 A;  3BQ3 A;  1DJI A;  1UWO A;  5DKR A;  1B9A A;  1FI5 A;  1H4B A;  1IKU A;  2BL0 B;  3VRO A;  1D1O A;  4YI8 A;  2OTG B;  4I5J A;  3SG6 A;  3EKJ A;  4GFT A;  1BJF A;  1K2H A;  2Q91 A;  3IQQ A;  3GK1 A;  1B7T Z;  3KO0 A;  1PVB A;  1WDC C;  3D10 A;  1SYM A;  1QLK A;  2BKI B;  1CDM A;  1KQM B;  1OZO A;  1K96 A;  1BLQ A;  1Y0V H;  1S6C A;  3TS5 C;  1CLL A;  3VRN A;  2ZFD A;  1KCY A;  1A4P A;  1G4Y R;  1R6P A;  4DUQ A;  1CLM A;  2JNX A;  3I5F B;  3BOW B;  1PAL A;  2H61 A;  2E6W A;  3O2P A;  2NXQ A;  2L2E A;  3BUX B;  3PSR A;  4IL1 A;  1CNP A;  1YUS A;  4DIR A;  1HT9 A;  1B8R A;  3TDZ A;  3D0Y B;  3TDI A;  1XK4 A;  3JVT B;  2K2F A;  2V53 A;  4OVN F;  3CLN A;  2ZRT A;  4QJ3 B;  1CM1 A;  2BE4 A;  1NIW A;  1ALW A;  1YTZ C;  2L4H A;  5DKQ A;  2JT0 A;  2WC8 A;  1K90 D;  4ORA B;  5HLO A;  2FOT A;  4PHJ A;  4YGC B;  1QAT A;  2HET A;  4HRH A;  1M46 A;  5ER4 X;  5BPJ A;  1E8A A;  2KYF A;  1SL9 A;  3I5G B;  1QS7 A;  2NCO A;  4QJ5 B;  5I2Q A;  1KWO B;  4MLW A;  1MWN A;  5J3X A;  1SR6 C;  1MQ1 A;  2M97 A;  4JQ0 D;  4NDD A;  4MRY A;  1LVC D;  1X02 A;  2BCB A;  2M8U A;  5CSN A;  4BY5 A;  1WY9 A;  2M29 A;  4A4C A;  3AKB A;  1LA3 A;  1NYA A;  1SMG A;  3RLZ A;  2O5G A;  1EJ3 A;  3ZNI A;  4CFQ A;  3DVM A;  2LAN A;  3D0Y A;  2L51 A;  1OMR A;  2MA2 A;  4YBH B;  3WHT B;  3PN7 C;  1BR1 B;  1BU3 A;  1CDL A;  5HKW A;  3CGA A;  1XFU O;  4YGB B;  3PAT A;  1G33 A;  1ODB A;  1UHH A;  2BE6 A;  1YUU A;  1A75 B;  1NSH A;  3A4U B;  1K9U A;  1VRK A;  1AJ4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...