1OQPA

Structure of the ca2+/c-terminal domain of caltractin in complex with the cdc31p-binding domain from kar1p
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
77
structure length
77
Chain Sequence
GSGERDSREEILKAFRLFDDDNSGTITIKDLRRVAKELGENLTEEELQEMIAEADRNDDNEIDEDEFIRIMKKTSLF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Caltractin
publication title Unique Features in the C-terminal Domain Provide Caltractin with Target Specificity
pubmed doi rcsb
source organism Chlamydomonas reinhardtii
molecule tags Protein binding
total genus 29
structure length 77
sequence length 77
ec nomenclature
pdb deposition date 2003-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1oqpA00
2QACA 5DKRA 2PMYA 4L9MA 5AFPA 3EK4A 1B4CA 2EHBA 1DMOA 4YI9A 2M1KB 1KWOC 3TDIA 1S5GZ 1UHHA 4MSPA 1KWOB 2M7LA 2WCEA 3EKHA 3D0YA 5PALA 1WRZA 2OTGB 1FBVA 2K8MB 3NSLA 4ORBB 2LVIA 1S1EA 4ZCUA 1KFUL 2BL0B 4DS7A 2MJWB 5D7FA 3VROA 2EC6C 3O6BA 2EC6B 3IF7A 1MF8B 2JQ6A 1UHKA 2PALA 2EGDA 1M46A 1PK0D 1RK9A 2WOSA 2LMTA 3FWCA 2H61A 1S6IA 2KYCA 2Y4QA 1CM4A 2KAYA 1SY9A 4I5NB 4DIRA 4GGFA 2F8PA 1CLBA 3LK1A 4NQGA 1QXPA 2BCXA 4NDCA 4PDZA 4DUQA 2JTZA 3CZTX 1R6PA 3KF9A 3PN7C 1JF2A 4GUKA 1GGWA 2LVVA 2DOQA 1CFPA 2KBIA 1NYAA 1CDLA 3BUNB 2KFGA 1TNQA 1V1GA 2LLTA 1IH0A 3O2PA 2O5GA 2JT8A 2K61A 2K0JA 2JULA 1YRUB 4PHNA 4MVFA 1N0YA 2O60A 1NCZA 4ORCB 4PHJA 2L98A 2WC8A 3JVTB 2LCPA 1XA5A 2F3YA 1QV1A 3KPXA 5F6TA 1RJVA 3TZ1A 1YUUA 4AQJA 1BOCA 3BUXB 2K7CA 1R2UA 2LUXA 1IRJA 3DF0A 1B7TY 1KSMA 1PVAA 4GBAA 4OR9B 2A4JA 3EK8A 1X02A 3EVVA 1UWOA 2ZNDA 4HRHA 3I5IB 2BCBA 1J1EA 1LVCD 1SPYA 1WRKA 2V53A 2HF5A 1J55A 1S26D 2GGZA 2B1UA 1DJZA 2G9BA 5HLOA 2AUCA 2NZ0A 2L4IA 2JT3A 2LANA 1A2XA 1D1OA 3PM8A 4FQOA 1IQ5A 1MXEA 3OX6A 2CTNA 2JXLA 1PSBA 1QX5B 2M9GA 1TNXA 1AJ5A 4ORAB 4MZLA 4Q04A 4WQ2A 3GK1A 4E68A 2LNKA 2BKIB 2F33A 4F0ZB 5I2LA 2KGRA 2JZIA 1K96A 3TS5C 4JPZB 2M0RA 1ALWA 2MAZA 2M3WA 4P2YB 1KK8C 1MQ1A 2NXQA 1KK8B 1BR4B 1Y0VH 1YTZC 3I5GC 4CPVA 1KSOA 4WQ3A 3PALA 4WRIA 2K7DA 1NX2A 1DJHA 3OP0A 4CFQA 3F45A 1WDCB 2CT9A 5I2OA 1U5IB 1OMRA 1L7ZA 1ZMZA 2K2AA 1QTXA 5ER5A 1K2HA 1XVJA 2GGMA 1YX7A 3KHEA 2CNPA 5KSZA 1CDNA 2ZN9A 4JQ0D 3NXAA 1DVIA 2L2EA 1ZACA 3BUOB 3PLFB 2KAVA 1QX7A 3ICBA 2CCMA 2JPTA 4PALA 1DF0B 2ISDA 1BG1A 3IQOA 2JNXA 2SASA 2OS8C 1TNWA 2OS8B 3E3RA 4ETOA 2MRDA 4PE7A 1B1GA 1DGUA 1IWQA 1SMGA 1NX3A 3CWGA 1K94A 3OX5A 4FTGA 2MBXA 1CNPA 1TIZA 1CFFA 3AAJA 1K9KA 4M2OA 2LV7A 1OE9B 1SCMC 3CS1A 2KGBC 3KO0A 4BY4A 2LHIA 1QLKA 1M45A 2KOTA 3IQQA 5DKQA 1LINA 3SG3A 4M2PA 4AOMA 1CTRA 2IS9A 3DVMA 1ODBA 1B7TZ 1SK6D 1ZFSA 4CLNA 1HT9A 1KQMC 3DVJA 1KQMB 1XK4A 1L2OC 2HETA 4PE1A 1NX1A 2KQYA 1Y6WA 1IG5A 3ZNIA 3BUWB 1M31A 1F70A 3O78A 1CDMA 2LMUA 4N5XA 4MRXA 1C7VA 2JWWA 4MLWA 2NLNA 3LK0A 1M39A 1NP8A 3M0WA 1FI6A 1DJIA 1IKUA 4YGBB 2CXJA 1KFXS 3HCMA 4A4CA 5CSFA 3VRRA 3SIBA 2BECA 1F4QA 5JJGA 4MZJA 4GAOA 1KCYA 4DCKA 2KSPA 3PN7B 3SG5A 3KEVA 1EL4A 1CMGA 4C0LA 1ZUZA 2E6WA 1F54A 1SL9A 2NCPA 1DGVA 1EG4A 1F71A 1YVLA 4YGEB 1Y1AA 2LLSA 1ALVA 1KFXL 2P6BB 3TS5B 1AJ4A 2LAPA 5AANA 1BLQA 3LLEA 1A75B 1OZOA 1EXRA 4HSZA 3OHMB 1UURA 1OMVA 2ZKMX 4I5JA 2L51A 1SBJA 1C07A 4A4BA 1B8RA 3FWBA 3WHUB 1CKKA 2WCBA 1FPWA 3SJSA 4BY5A 3DVEA 2M49B 4I5LB 1BJFA 1JUOA 1M63B 4USLA 1J7RA 1C7WA 1BT6A 5HYDA 2BE6A 2JTTA 3GK4X 1K9UA 1MXLC 4MBEA 1KQVA 1PULA 1SR6C 1OSAA 1OOJA 1SR6B 1V1FA 1IQ3A 5K89A 1PALA 3TDZA 2KFHA 1DF0A 1UUSA 1YUSA 5GQQC 5AERA 2M7NA 2WORA 1E8AA 2LHLA 3EVRA 4AQIA 1SRAA 1SL8A 3SG7A 4OVNF 4I5KA 4QJ3B 5HKWA 2F3ZA 2KI6C 1YR5A 1J7OA 1JSAA 2LMVA 1DJWA 2BKHB 4YRUA 2CBLA 1TOPA 2GV5A 5CSNA 2H61C 1A03A 1GJYA 3JTDC 2KI4C 3JTDB 2JT0A 4GNKB 1DJGA 2Y1MA 1MHOA 4YGCB 3SG4A 1N2DA 2AMIA 1K8UA 1NIWA 2L0PA 3PATA 1NCXA 4GGFC 3I5GB 2KNEA 4CFRA 1AHRA 1B9AA 1LXFC 2OPOA 1BODA 4P5OE 4D1EA 1IGVA 2E30A 3PSRA 3GOFA 2F2OA 2HQWA 2ZRSA 1W7IB 3D10A 1BR1B 1RFJA 1N65A 1DJYA 1MUXA 1TRFA 1QVIY 4MEWA 1YURA 5KU1A 2ZNEA 4GPLB 5AXIA 1NWDA 1CLLA 1NSHA 3EVUA 4YGAA 2MA2A 2ZFDA 4N1FA 2KFFA 5I2QA 1G4YR 1IJ6A 1NUBA 3WHTB 2LUCA 1TCOB 2ZRTA 1KK7Z 2MLFC 1QLSA 1ZOTB 3CR4X 4PCWA 5HKZA 1XFUO 1MR8A 2Q4UA 4QJ4B 3BYAA 1A75A 3BOWB 1BMOA 3I5HC 1J1DA 2M97A 2F2PA 3I5HB 5D69A 1OMDA 1XYDA 1SCMB 4DRWA 2LM5A 4HRGA 4PHMA 3RLZA 3WXAA 2G2BA 4YI8A 3SIAA 5KTYA 1BF5A 2KAXA 1FW4A 1W7JB 2FCDA 1K90D 5HKYA 1UHIA 1K9PA 1S3PA 3QRXA 1NPQA 1EG3A 1GQMA 1L2OB 2BBNA 1A29A 1S36A 1G33A 1CFDA 4UPGA 1WRLA 1LA0A 4M2QA 2LVKA 3HX4A 4MN0A 2BBMA 4CIDA 1UHNA 2M1UA 2ZN8A 4HREE 1NX0A 2Y1NA 3VRQA 2NCOA 1XFZO 5TNCA 1SNLA 1SYMA 2OTGC 4MZKA 1XFVO 1K93D 2BL0C 4C0JA 2LC5A 4QJ5B 1JF0A 1KK7Y 1YX8A 3LCPC 4OV2A 3CTNA 1JFKA 1PRWA 3H4SE 5CPVA 1JC2A 2JXCA 1SW8A 1LA3A 1PVBA 2R2IA 3CR5X 3EK7A 5IBWA 3TDUA 1OZSA 2KYFA 4C0KA 1VRKA 4IL1A 1QJTA 2RGIA 1U5IA 4ICBA 1QIVA 5BPJA 1XFWO 5B8IB 3VRNA 3A4UB 2M8UA 4OCIA 4U8DA 1B8CA 5CSIA 1CB1A 1QVIZ 1Y1XA 3LL8B 3FS7A 4XJKB 1TCFA 1SL7A 1DJXA 2PSRA 2KQ6A 1Q80A 4XYNA 3GK2A 1QATA 5DKNA 2QPTA 1BU3A 5J3XA 1RECA 2I7AA 3JVTC 2L4HA 3DVKA 2I2RE 1EJ3A 4TNCA 1CMFA 1S5GY 1HQVA 1K95A 1TN4A 2D8NA 2FJUB 2LE9B 3BXKA 3BOWA 3D0YB 2FCEA 1F8HA 2JNFA 2MHHA 3SG6A 2VRGA 2K2FA 2JRFA 2PVBA 1TNPA 2JU0A 2BE4A 1XK4C 2LP3A 2KBMA 1F55A 3I5IC 4GGNA 2JOJA 1F4OA 4MRYA 1EH2A 4NDBA 5ER4X 1Y1UA 1UHJA 2KI4B 1AK8A 2Q91A 3O4YA 1CLMA 2M29A 3OB2B 4N1GA 5HLVA 2HQ8A 1RTP1 1RWYA 1DTLA 2KI6D 2FOTA 2H2KA 1IJ5A 1QX2A 2JC2A 1J7QA 1JWDA 1QV0A 2PRUA 5I8NA 1G8IA 1S6JA 1FI5A 1QASA 2KDHA 2PASA 4NDDA 3PFVA 1GGZA 2KHNA 1H8BA 1XFYO 3I5FC 3DD4A 3I5FB 1QIWA 1OQPA 3AAKA 2L50A 3BQ3A 2K7OA 3VGOA 2WCFA 1WLZA 3SG2A 1MWNA 2LLUA 3ZWHA 1CM1A 3MSEB 2WNDA 2TN4A 1J7PA 1S6CA 2AAOA 3CLNA 3NSIA 1CFCA 1WDCC 1H4BA 1UP5A 2COLB 1CDPA 1A4PA 3FIAA 4PE0A 3AKAA 2I94A 2L5XB 2K7BA 1YVHA 2HPSA 3DF0B 1XO5A 3C1VA 4YGDB 2LP2A 3NSOA 1WLMA 3AKBA 1AVSA 2LVJA 1PSRA 1WY9A 3CGAA 3K21A 3WNXB 5JOLA 2I18A 3CR2A 1RROA 1SKTA 4R1EA 1YRTB 1XFXO 2SCPA 3BUMB 5G08A 2Y5IA 1NCYA 3TUYC 1B47A 3OB1B 5CSJA 1B8LA 3RM1A 3TUYB 3VRPA 1DT7B 1YUTA 4XJKA 1SCVA 4ZCVA 2MLEC 1AUIB 4GFTA 3EKJA 5AEQA 3A8RA 4YBHB 5FYXA 1AP4A 1JBAA 1TTXA 3NSKA 4PE4A 1QS7A 4PHKA 4JWQA 4OKHA 2BCAA 1LKJA 1FF1A 1KFUS 1JFJA
chains in the Genus database with same CATH superfamily
2QACA 1TWOA 5DKRA 2PMYA 4L9MA 5AFPA 3EK4A 3BFAA 1B4CA 2EHBA 1DMOA 4YI9A 4FQTA 2M1KB 1KWOC 3TDIA 1S5GZ 1UHHA 4MSPA 1KWOB 2M7LA 2WCEA 3EKHA 3PJIA 3D0YA 1ORGA 1WRZA 5PALA 1TUZA 2OTGB 1FBVA 2K8MB 3NSLA 4ORBB 2LVIA 1S1EA 4ZCUA 1KFUL 2BL0B 4DS7A 2MJWB 5D7FA 3VROA 2EC6C 3O6BA 2EC6B 3IF7A 1MF8B 2JQ6A 1UHKA 2PALA 2EGDA 1M46A 1PK0D 1RK9A 2WOSA 2LMTA 3FWCA 2H61A 5FI2A 3D73A 3FE6A 1Z4HA 1S6IA 2KYCA 2Y4QA 1CM4A 2KAYA 1SY9A 4I5NB 4DIRA 4GGFA 2KLDA 2QEOA 2F8PA 3S0FA 3LK1A 4NQGA 2L2CA 1QXPA 2BCXA 4NDCA 4PDZA 3S0DA 2JTZA 4DUQA 5HL1A 3N7HA 3CZTX 1R6PA 3KF9A 3PN7C 1JF2A 4GUKA 1GGWA 3VB1A 2LVVA 2DOQA 1CFPA 2KBIA 3S0GA 1NYAA 1CDLA 3BUNB 2KFGA 1TNQA 1V1GA 2LLTA 3D78A 1IH0A 3O2PA 2O5GA 2JT8A 1C3YA 2K61A 2K0JA 2JULA 1YRUB 4PHNA 4MVFA 1N0YA 2O60A 1NCZA 4ORCB 4PHJA 2L98A 2WC8A 3JVTB 2LCPA 1XA5A 2F3YA 1QV1A 3KPXA 5F6TA 1RJVA 3TZ1A 1YUUA 4AQJA 1BOCA 3BUXB 2K7CA 1R2UA 2LUXA 1IRJA 3DF0A 1B7TY 5I94A 1KSMA 1PVAA 4GBAA 4OR9B 2A4JA 3EK8A 1X02A 3EVVA 1UWOA 2ZNDA 2QEHA 4HRHA 3I5IB 2BCBA 3DYEA 1J1EA 1LVCD 1SPYA 1WRKA 2V53A 3D76A 2HF5A 1J55A 1S26D 4JKTA 3S0AA 2GGZA 2B1UA 1DJZA 2G9BA 3UNWA 5HLOA 2AUCA 2NZ0A 2KPHA 2L4IA 2JT3A 3NHIA 2LANA 1A2XA 1D1OA 3PM8A 3CZ2A 4FQOA 1IQ5A 2P71A 1MXEA 3OX6A 3D74A 2CTNA 2JXLA 1PSBA 1QX5B 2PYQA 2M9GA 1TNXA 1AJ5A 4ORAB 4MZLA 4Q04A 4WQ2A 3GK1A 3V2LA 4E68A 2LNKA 2BKIB 2F33A 4F0ZB 5I2LA 1Z2CB 2KGRA 2JZIA 1K96A 2WCJA 3TS5C 3S0BA 4JPZB 2M0RA 1ALWA 2MAZA 2M3WA 4P2YB 1KK8C 1MQ1A 2NXQA 1KK8B 1BR4B 1Y0VH 1YTZC 3I5GC 4CPVA 1KSOA 4WQ3A 3PALA 4WRIA 2K7DA 1NX2A 1DJHA 3OP0A 4CFQA 3F45A 1WDCB 2CT9A 5I2OA 1U5IB 1OMRA 1L7ZA 1ZMZA 2K2AA 1QTXA 5ER5A 1K2HA 1XVJA 2GGMA 1YX7A 3KHEA 2CNPA 3B86A 5KSZA 1CDNA 4JD9A 2ZN9A 4JQ0D 2BNXA 3NXAA 1DVIA 2L2EA 1ZACA 3BUOB 3PLFB 2KAVA 1QX7A 3ICBA 2CCMA 2JPTA 4PALA 1DF0B 2ISDA 1BG1A 3IQOA 2JNXA 2SASA 2OS8C 1TNWA 2OS8B 3E3RA 5EL2A 4ETOA 2MRDA 4PE7A 1B1GA 1DGUA 1IWQA 1SMGA 1NX3A 3CWGA 1K94A 3B87A 3OX5A 4FTGA 2MBXA 1CNPA 1TIZA 1CFFA 3AAJA 1K9KA 4M2OA 2WC6A 3S0EA 2LV7A 1GM0A 1OE9B 1SCMC 3CS1A 2KGBC 3KO0A 4BY4A 2LHIA 1QLKA 1M45A 2KOTA 3OBVA 3IQQA 5DKQA 1LINA 3SG3A 4M2PA 3CDNA 3R72A 1CTRA 2IS9A 4AOMA 3DVMA 1ODBA 1B7TZ 1SK6D 1ZFSA 4CLNA 1HT9A 1KQMC 3DVJA 1KQMB 1XK4A 1L2OC 2HETA 4PE1A 1NX1A 2KQYA 1Y6WA 1IG5A 3ZNIA 3BUWB 1M31A 1F70A 3O78A 1CDMA 3DY9A 2LMUA 4N5XA 4MRXA 1C7VA 2JWWA 4MLWA 2NLNA 3SS3A 3LK0A 3NHTA 1W9ZA 1M39A 2QEVA 1NP8A 3M0WA 1FI6A 1DJIA 1IKUA 4YGBB 2CXJA 1KFXS 3HCMA 4A4CA 5CSFA 3VRRA 3SIBA 2BECA 1F4QA 5JJGA 4MZJA 4GAOA 1KCYA 4DCKA 2KSPA 3L4LA 3PN7B 3R1PA 3SG5A 3KEVA 1EL4A 2WCHA 4C0LA 1CMGA 1ZUZA 4PT1A 2E6WA 1F54A 1SL9A 2NCPA 1DGVA 3PM2A 2GTEA 1EG4A 1XFRA 1F71A 1YVLA 4YGEB 1Y1AA 2LLSA 1ALVA 1KFXL 2P6BB 3TS5B 1AJ4A 2LAPA 5AANA 1BLQA 3LLEA 1A75B 1OZOA 1EXRA 4HSZA 3OHMB 1UURA 1OMVA 2ZKMX 4I5JA 2L51A 3DZTA 1SBJA 1C07A 4A4BA 1OOIX 1B8RA 3FWBA 3WHUB 1CKKA 2WCBA 1FPWA 3SJSA 4BY5A 3DVEA 2M49B 4I5LB 1BJFA 1JUOA 1M63B 3B88A 3NGVA 1J7RA 1C7WA 4USLA 2KLEA 1BT6A 5HYDA 2BE6A 2JTTA 3GK4X 1K9UA 1MXLC 4MBEA 1KQVA 1PULA 3K1EA 4INWA 1SR6C 1OSAA 1OOJA 1SR6B 1V1FA 1IQ3A 5K89A 1PALA 3TDZA 2KFHA 1DF0A 1UUSA 3R1OA 1YUSA 5DICA 5GQQC 5AERA 2M7NA 2WORA 1E8AA 2LHLA 3EVRA 4AQIA 1SRAA 1DC1A 1DELA 1SL8A 3SG7A 3SS5A 4OVNF 4I5KA 4QJ3B 5HKWA 2F3ZA 2KI6C 1YR5A 4OZDA 1J7OA 1JSAA 2LMVA 1DJWA 2BKHB 3Q8IA 2QDIA 4YRUA 2CBLA 3BJHA 1TOPA 2GV5A 5CSNA 2H61C 1A03A 1OW4A 1GJYA 3JTDC 1C3ZA 2KI4C 3JTDB 2JT0A 3R1VA 4GNKB 1DJGA 2Y1MA 1MHOA 4YGCB 3SG4A 1N2DA 2AMIA 1K8UA 1NIWA 2L0PA 3PATA 1NCXA 4GGFC 3CYZA 2YGUA 3I5GB 2KNEA 4CFRA 1AHRA 1B9AA 1LXFC 2OPOA 1BODA 4P5OE 4D1EA 1IGVA 4INXA 2E30A 3B7AA 3GOFA 2F2OA 2HQWA 2ZRSA 1W7IB 3PSRA 3D10A 1BR1B 1RFJA 1N65A 1DJYA 1MUXA 1TRFA 1QVIY 1IIOA 4MEWA 1YURA 5KU1A 2ZNEA 4GPLB 5AXIA 1NWDA 3FE8A 1CLLA 1NSHA 3EVUA 4YGAA 2MA2A 2ZFDA 4N1FA 2KFFA 3B6XA 5I2QA 1G4YR 1IJ6A 1NUBA 3WHTB 2P70A 2LUCA 1TCOB 2ZRTA 1KK7Z 2MLFC 1QLSA 1ZOTB 3CR4X 4PCWA 5HKZA 1XFUO 1MR8A 3FE9A 2Q4UA 4QJ4B 3BYAA 5FI7A 1A75A 3BOWB 1BMOA 3I5HC 4KYNA 1J1DA 2M97A 2F2PA 3I5HB 5D69A 3CZ1A 1OMDA 1OOHA 1TUJA 1XYDA 1SCMB 4DRWA 2LM5A 4HRGA 4PHMA 3RLZA 3WXAA 2G2BA 3D77A 4YI8A 3UO9A 3SIAA 5KTYA 1BF5A 2KAXA 1FW4A 1W7JB 2FCDA 1K90D 3SS4A 5HKYA 1UHIA 1K9PA 1S3PA 3QRXA 1NPQA 2QEBA 1EG3A 1GQMA 1L2OB 4F7FA 2BBNA 1A29A 1S36A 1G33A 1CFDA 4UPGA 1WRLA 1LA0A 4M2QA 2LVKA 3HX4A 4MN0A 2BBMA 4CIDA 1UHNA 2M1UA 2ZN8A 2H8VA 4HREE 1NX0A 3L4AA 2Y1NA 3DXLA 3VRQA 2NCOA 1XFZO 5TNCA 1SNLA 1SYMA 2OTGC 4MZKA 1XFVO 1K93D 2BL0C 1SSEB 4C0JA 2LC5A 4QJ5B 1JF0A 1KK7Y 1YX8A 3LCPC 4OV2A 3CTNA 5FI6A 1JFKA 1PRWA 3H4SE 2ERBA 3QMEA 5CPVA 1JC2A 2JXCA 1SW8A 1LA3A 1PVBA 2R2IA 3CR5X 3EK7A 5IBWA 1CLBA 2WCLA 3TDUA 1OZSA 2KYFA 4C0KA 1VRKA 4IL1A 1QJTA 2RGIA 1U5IA 4ICBA 1QIVA 5BPJA 1XFWO 5B8IB 3VRNA 3A4UB 2M8UA 4OCIA 4U8DA 1B8CA 5CSIA 1CB1A 2JPOA 1QVIZ 1Y1XA 3LL8B 3FS7A 4XJKB 1TCFA 1SL7A 1DJXA 2PSRA 2KQ6A 1Q80A 4XYNA 3GK2A 1QATA 1OOFA 5DKNA 2QPTA 4IJ7A 1BU3A 5J3XA 3CZ0A 2BAPA 1RECA 2I7AA 3JVTC 2L4HA 3DVKA 2I2RE 1EJ3A 4TNCA 1CMFA 1S5GY 1HQVA 1K95A 1TN4A 2D8NA 2FJUB 2LE9B 3IVTA 3BXKA 3BOWA 3D0YB 2FCEA 3D75A 2JNFA 1F8HA 2MHHA 3SG6A 1T14A 2VRGA 2K2FA 2JRFA 2PVBA 1TNPA 2JU0A 2BE4A 1XK4C 2LP3A 2KBMA 1F55A 3I5IC 4GGNA 2JOJA 2L5YA 2PQLA 1F4OA 4MRYA 1EH2A 2WCKA 3O4XA 4NDBA 5ER4X 1Y1UA 1UHJA 3EG5B 1DEKA 2KI4B 1AK8A 2Q91A 3O4YA 1CLMA 2M29A 3OB2B 4N1GA 5HLVA 2HQ8A 1P28A 1RTP1 1RWYA 1DTLA 1OOGA 2FOTA 2H2KA 2KI6D 1IJ5A 1QX2A 2JC2A 2WC5A 1J7QA 1JWDA 1QV0A 2PRUA 5I8NA 1G8IA 1S6JA 1FI5A 1QASA 2KDHA 2FJYA 2PASA 4NDDA 3PFVA 1GGZA 2KHNA 1H8BA 1XFYO 3I5FC 3DD4A 3I5FB 1QIWA 1OQPA 3AAKA 2L50A 3BQ3A 2K7OA 3RZSA 3VGOA 2WCFA 3OGNA 1WLZA 3SG2A 1MWNA 2LLUA 3ZWHA 1CM1A 3MSEB 2WNDA 2TN4A 5D3OA 1S6CA 3L47A 2AAOA 3CLNA 3NSIA 1CFCA 1WDCC 3BFBA 1J7PA 1H4BA 1UP5A 2COLB 1CDPA 1A4PA 3FIAA 4PE0A 3AKAA 2I94A 2L5XB 2K7BA 1DQEA 1YVHA 2HPSA 3DF0B 1XO5A 1LS8A 3C1VA 4YGDB 2LP2A 3NSOA 1WLMA 3AKBA 1AVSA 2LVJA 1PSRA 1WY9A 2WCMA 3CGAA 3K21A 3WNXB 5JOLA 2I18A 3CR2A 1RROA 1SKTA 4R1EA 1YRTB 1XFXO 2SCPA 3BUMB 5G08A 2Y5IA 1NCYA 3TUYC 3BFHA 1B47A 3OB1B 5CSJA 1B8LA 3RM1A 3TUYB 3VRPA 1DT7B 1QWVA 1YUTA 4XJKA 1SCVA 2K60A 4ZCVA 2MLEC 1AUIB 3CABA 3EKJA 4GFTA 5AEQA 3A8RA 4YBHB 5FYXA 1AP4A 1JBAA 1TTXA 3NSKA 4PE4A 1QS7A 4PHKA 4JWQA 4OKHA 2BCAA 1LKJA 1FF1A 1KFUS 1JFJA
chains in the Genus database with same CATH topology
2QACA 5DKRA 2PMYA 4L9MA 5AFPA 3EK4A 1B4CA 2EHBA 1DMOA 4YI9A 2M1KB 1KWOC 3TDIA 1S5GZ 1UHHA 4MSPA 1KWOB 2M7LA 2WCEA 3EKHA 3D0YA 5PALA 1WRZA 2OTGB 1FBVA 2K8MB 3NSLA 4ORBB 2LVIA 1S1EA 4ZCUA 1KFUL 2BL0B 4DS7A 2MJWB 5D7FA 3VROA 2EC6C 3O6BA 2EC6B 3IF7A 1MF8B 2JQ6A 1UHKA 2PALA 2EGDA 1M46A 1PK0D 1RK9A 2WOSA 2LMTA 3FWCA 2H61A 1S6IA 2KYCA 2Y4QA 1CM4A 2KAYA 1SY9A 4I5NB 4DIRA 4GGFA 2F8PA 1CLBA 3LK1A 4NQGA 1QXPA 2BCXA 4NDCA 4PDZA 4DUQA 2JTZA 3CZTX 1R6PA 3KF9A 3PN7C 1JF2A 4GUKA 1GGWA 2LVVA 2DOQA 1CFPA 2KBIA 1NYAA 1CDLA 3BUNB 2KFGA 1TNQA 1V1GA 2LLTA 1IH0A 3O2PA 2O5GA 2JT8A 2K61A 2K0JA 2JULA 1YRUB 4PHNA 4MVFA 1N0YA 2O60A 1NCZA 4ORCB 4PHJA 2L98A 2WC8A 3JVTB 2LCPA 1XA5A 2F3YA 1QV1A 3KPXA 5F6TA 1RJVA 3TZ1A 1YUUA 4AQJA 1BOCA 3BUXB 2K7CA 1R2UA 2LUXA 1IRJA 3DF0A 1B7TY 1KSMA 1PVAA 4GBAA 4OR9B 2A4JA 3EK8A 1X02A 3EVVA 1UWOA 2ZNDA 4HRHA 3I5IB 2BCBA 1J1EA 1LVCD 1SPYA 1WRKA 2V53A 2HF5A 1J55A 1S26D 2GGZA 2B1UA 1DJZA 2G9BA 5HLOA 2AUCA 2NZ0A 2L4IA 2JT3A 2LANA 1A2XA 1D1OA 3PM8A 4FQOA 1IQ5A 1MXEA 3OX6A 2CTNA 2JXLA 1PSBA 1QX5B 2M9GA 1TNXA 1AJ5A 4ORAB 4MZLA 4Q04A 4WQ2A 3GK1A 4E68A 2LNKA 2BKIB 2F33A 4F0ZB 5I2LA 2KGRA 2JZIA 1K96A 3TS5C 4JPZB 2M0RA 1ALWA 2MAZA 2M3WA 4P2YB 1KK8C 1MQ1A 2NXQA 1KK8B 1BR4B 1Y0VH 1YTZC 3I5GC 4CPVA 1KSOA 4WQ3A 3PALA 4WRIA 2K7DA 1NX2A 1DJHA 3OP0A 4CFQA 3F45A 1WDCB 2CT9A 5I2OA 1U5IB 1OMRA 1L7ZA 1ZMZA 2K2AA 1QTXA 5ER5A 1K2HA 1XVJA 2GGMA 1YX7A 3KHEA 2CNPA 5KSZA 1CDNA 2ZN9A 4JQ0D 3NXAA 1DVIA 2L2EA 1ZACA 3BUOB 3PLFB 2KAVA 1QX7A 3ICBA 2CCMA 2JPTA 4PALA 1DF0B 2ISDA 1BG1A 3IQOA 2JNXA 2SASA 2OS8C 1TNWA 2OS8B 3E3RA 4ETOA 2MRDA 4PE7A 1B1GA 1DGUA 1IWQA 1SMGA 1NX3A 3CWGA 1K94A 3OX5A 4FTGA 2MBXA 1CNPA 1TIZA 1CFFA 3AAJA 1K9KA 4M2OA 2LV7A 1OE9B 1SCMC 3CS1A 2KGBC 3KO0A 4BY4A 2LHIA 1QLKA 1M45A 2KOTA 3IQQA 5DKQA 1LINA 3SG3A 4M2PA 4AOMA 1CTRA 2IS9A 3DVMA 1ODBA 1B7TZ 1SK6D 1ZFSA 4CLNA 1HT9A 1KQMC 3DVJA 1KQMB 1XK4A 1L2OC 2HETA 4PE1A 1NX1A 2KQYA 1Y6WA 1IG5A 3ZNIA 3BUWB 1M31A 1F70A 3O78A 1CDMA 2LMUA 4N5XA 4MRXA 1C7VA 2JWWA 4MLWA 2NLNA 3LK0A 1M39A 1NP8A 3M0WA 1FI6A 1DJIA 1IKUA 4YGBB 2CXJA 1KFXS 3HCMA 4A4CA 5CSFA 3VRRA 3SIBA 2BECA 1F4QA 5JJGA 4MZJA 4GAOA 1KCYA 4DCKA 2KSPA 3PN7B 3SG5A 3KEVA 1EL4A 1CMGA 4C0LA 1ZUZA 2E6WA 1F54A 1SL9A 2NCPA 1DGVA 1EG4A 1F71A 1YVLA 4YGEB 1Y1AA 2LLSA 1ALVA 1KFXL 2P6BB 3TS5B 1AJ4A 2LAPA 5AANA 1BLQA 3LLEA 1A75B 1OZOA 1EXRA 4HSZA 3OHMB 1UURA 1OMVA 2ZKMX 4I5JA 2L51A 1SBJA 1C07A 4A4BA 1B8RA 3FWBA 3WHUB 1CKKA 2WCBA 1FPWA 3SJSA 4BY5A 3DVEA 2M49B 4I5LB 1BJFA 1JUOA 1M63B 4USLA 1J7RA 1C7WA 1BT6A 5HYDA 2BE6A 2JTTA 3GK4X 1K9UA 1MXLC 4MBEA 1KQVA 1PULA 1SR6C 1OSAA 1OOJA 1SR6B 1V1FA 1IQ3A 5K89A 1PALA 3TDZA 2KFHA 1DF0A 1UUSA 1YUSA 5GQQC 5AERA 2M7NA 2WORA 1E8AA 2LHLA 3EVRA 4AQIA 1SRAA 1SL8A 3SG7A 4OVNF 4I5KA 4QJ3B 5HKWA 2F3ZA 2KI6C 1YR5A 1J7OA 1JSAA 2LMVA 1DJWA 2BKHB 4YRUA 2CBLA 1TOPA 2GV5A 5CSNA 2H61C 1A03A 1GJYA 3JTDC 2KI4C 3JTDB 2JT0A 4GNKB 1DJGA 2Y1MA 1MHOA 4YGCB 3SG4A 1N2DA 2AMIA 1K8UA 1NIWA 2L0PA 3PATA 1NCXA 4GGFC 3I5GB 2KNEA 4CFRA 1AHRA 1B9AA 1LXFC 2OPOA 1BODA 4P5OE 4D1EA 1IGVA 2E30A 3PSRA 3GOFA 2F2OA 2HQWA 2ZRSA 1W7IB 3D10A 1BR1B 1RFJA 1N65A 1DJYA 1MUXA 1TRFA 1QVIY 4MEWA 1YURA 5KU1A 2ZNEA 4GPLB 5AXIA 1NWDA 1CLLA 1NSHA 3EVUA 4YGAA 2MA2A 2ZFDA 4N1FA 2KFFA 5I2QA 1G4YR 1IJ6A 1NUBA 3WHTB 2LUCA 1TCOB 2ZRTA 1KK7Z 2MLFC 1QLSA 1ZOTB 3CR4X 4PCWA 5HKZA 1XFUO 1MR8A 2Q4UA 4QJ4B 3BYAA 1A75A 3BOWB 1BMOA 3I5HC 1J1DA 2M97A 2F2PA 3I5HB 5D69A 1OMDA 1XYDA 1SCMB 4DRWA 2LM5A 4HRGA 4PHMA 3RLZA 3WXAA 2G2BA 4YI8A 3SIAA 5KTYA 1BF5A 2KAXA 1FW4A 1W7JB 2FCDA 1K90D 5HKYA 1UHIA 1K9PA 1S3PA 3QRXA 1NPQA 1EG3A 1GQMA 1L2OB 2BBNA 1A29A 1S36A 1G33A 1CFDA 4UPGA 1WRLA 1LA0A 4M2QA 2LVKA 3HX4A 4MN0A 2BBMA 4CIDA 1UHNA 2M1UA 2ZN8A 4HREE 1NX0A 2Y1NA 3VRQA 2NCOA 1XFZO 5TNCA 1SNLA 1SYMA 2OTGC 4MZKA 1XFVO 1K93D 2BL0C 4C0JA 2LC5A 4QJ5B 1JF0A 1KK7Y 1YX8A 3LCPC 4OV2A 3CTNA 1JFKA 1PRWA 3H4SE 5CPVA 1JC2A 2JXCA 1SW8A 1LA3A 1PVBA 2R2IA 3CR5X 3EK7A 5IBWA 3TDUA 1OZSA 2KYFA 4C0KA 1VRKA 4IL1A 1QJTA 2RGIA 1U5IA 4ICBA 1QIVA 5BPJA 1XFWO 5B8IB 3VRNA 3A4UB 2M8UA 4OCIA 4U8DA 1B8CA 5CSIA 1CB1A 1QVIZ 1Y1XA 3LL8B 3FS7A 4XJKB 1TCFA 1SL7A 1DJXA 2PSRA 2KQ6A 1Q80A 4XYNA 3GK2A 1QATA 5DKNA 2QPTA 1BU3A 5J3XA 1RECA 2I7AA 3JVTC 2L4HA 3DVKA 2I2RE 1EJ3A 4TNCA 1CMFA 1S5GY 1HQVA 1K95A 1TN4A 2D8NA 2FJUB 2LE9B 3BXKA 3BOWA 3D0YB 2FCEA 1F8HA 2JNFA 2MHHA 3SG6A 2VRGA 2K2FA 2JRFA 2PVBA 1TNPA 2JU0A 2BE4A 1XK4C 2LP3A 2KBMA 1F55A 3I5IC 4GGNA 2JOJA 1F4OA 4MRYA 1EH2A 4NDBA 5ER4X 1Y1UA 1UHJA 2KI4B 1AK8A 2Q91A 3O4YA 1CLMA 2M29A 3OB2B 4N1GA 5HLVA 2HQ8A 1RTP1 1RWYA 1DTLA 2KI6D 2FOTA 2H2KA 1IJ5A 1QX2A 2JC2A 1J7QA 1JWDA 1QV0A 2PRUA 5I8NA 1G8IA 1S6JA 1FI5A 1QASA 2KDHA 2PASA 4NDDA 3PFVA 1GGZA 2KHNA 1H8BA 1XFYO 3I5FC 3DD4A 3I5FB 1QIWA 1OQPA 3AAKA 2L50A 3BQ3A 2K7OA 3VGOA 2WCFA 1WLZA 3SG2A 1MWNA 2LLUA 3ZWHA 1CM1A 3MSEB 2WNDA 2TN4A 1J7PA 1S6CA 2AAOA 3CLNA 3NSIA 1CFCA 1WDCC 1H4BA 1UP5A 2COLB 1CDPA 1A4PA 3FIAA 4PE0A 3AKAA 2I94A 2L5XB 2K7BA 1YVHA 2HPSA 3DF0B 1XO5A 3C1VA 4YGDB 2LP2A 3NSOA 1WLMA 3AKBA 1AVSA 2LVJA 1PSRA 1WY9A 3CGAA 3K21A 3WNXB 5JOLA 2I18A 3CR2A 1RROA 1SKTA 4R1EA 1YRTB 1XFXO 2SCPA 3BUMB 5G08A 2Y5IA 1NCYA 3TUYC 1B47A 3OB1B 5CSJA 1B8LA 3RM1A 3TUYB 3VRPA 1DT7B 1YUTA 4XJKA 1SCVA 4ZCVA 2MLEC 1AUIB 4GFTA 3EKJA 5AEQA 3A8RA 4YBHB 5FYXA 1AP4A 1JBAA 1TTXA 3NSKA 4PE4A 1QS7A 4PHKA 4JWQA 4OKHA 2BCAA 1LKJA 1FF1A 1KFUS 1JFJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QAC A;  5DKR A;  2PMY A;  4L9M A;  5AFP A;  3EK4 A;  1B4C A;  2EHB A;  1DMO A;  4YI9 A;  2M1K B;  1KWO C;  3TDI A;  1S5G Z;  1UHH A;  4MSP A;  1KWO B;  2M7L A;  2WCE A;  3EKH A;  3D0Y A;  5PAL A;  1WRZ A;  2OTG B;  1FBV A;  2K8M B;  3NSL A;  4ORB B;  2LVI A;  1S1E A;  4ZCU A;  1KFU L;  2BL0 B;  4DS7 A;  2MJW B;  5D7F A;  3VRO A;  2EC6 C;  3O6B A;  2EC6 B;  3IF7 A;  1MF8 B;  2JQ6 A;  1UHK A;  2PAL A;  2EGD A;  1M46 A;  1PK0 D;  1RK9 A;  2WOS A;  2LMT A;  3FWC A;  2H61 A;  1S6I A;  2KYC A;  2Y4Q A;  1CM4 A;  2KAY A;  1SY9 A;  4I5N B;  4DIR A;  4GGF A;  2F8P A;  1CLB A;  3LK1 A;  4NQG A;  1QXP A;  2BCX A;  4NDC A;  4PDZ A;  4DUQ A;  2JTZ A;  3CZT X;  1R6P A;  3KF9 A;  3PN7 C;  1JF2 A;  4GUK A;  1GGW A;  2LVV A;  2DOQ A;  1CFP A;  2KBI A;  1NYA A;  1CDL A;  3BUN B;  2KFG A;  1TNQ A;  1V1G A;  2LLT A;  1IH0 A;  3O2P A;  2O5G A;  2JT8 A;  2K61 A;  2K0J A;  2JUL A;  1YRU B;  4PHN A;  4MVF A;  1N0Y A;  2O60 A;  1NCZ A;  4ORC B;  4PHJ A;  2L98 A;  2WC8 A;  3JVT B;  2LCP A;  1XA5 A;  2F3Y A;  1QV1 A;  3KPX A;  5F6T A;  1RJV A;  3TZ1 A;  1YUU A;  4AQJ A;  1BOC A;  3BUX B;  2K7C A;  1R2U A;  2LUX A;  1IRJ A;  3DF0 A;  1B7T Y;  1KSM A;  1PVA A;  4GBA A;  4OR9 B;  2A4J A;  3EK8 A;  1X02 A;  3EVV A;  1UWO A;  2ZND A;  4HRH A;  3I5I B;  2BCB A;  1J1E A;  1LVC D;  1SPY A;  1WRK A;  2V53 A;  2HF5 A;  1J55 A;  1S26 D;  2GGZ A;  2B1U A;  1DJZ A;  2G9B A;  5HLO A;  2AUC A;  2NZ0 A;  2L4I A;  2JT3 A;  2LAN A;  1A2X A;  1D1O A;  3PM8 A;  4FQO A;  1IQ5 A;  1MXE A;  3OX6 A;  2CTN A;  2JXL A;  1PSB A;  1QX5 B;  2M9G A;  1TNX A;  1AJ5 A;  4ORA B;  4MZL A;  4Q04 A;  4WQ2 A;  3GK1 A;  4E68 A;  2LNK A;  2BKI B;  2F33 A;  4F0Z B;  5I2L A;  2KGR A;  2JZI A;  1K96 A;  3TS5 C;  4JPZ B;  2M0R A;  1ALW A;  2MAZ A;  2M3W A;  4P2Y B;  1KK8 C;  1MQ1 A;  2NXQ A;  1KK8 B;  1BR4 B;  1Y0V H;  1YTZ C;  3I5G C;  4CPV A;  1KSO A;  4WQ3 A;  3PAL A;  4WRI A;  2K7D A;  1NX2 A;  1DJH A;  3OP0 A;  4CFQ A;  3F45 A;  1WDC B;  2CT9 A;  5I2O A;  1U5I B;  1OMR A;  1L7Z A;  1ZMZ A;  2K2A A;  1QTX A;  5ER5 A;  1K2H A;  1XVJ A;  2GGM A;  1YX7 A;  3KHE A;  2CNP A;  5KSZ A;  1CDN A;  2ZN9 A;  4JQ0 D;  3NXA A;  1DVI A;  2L2E A;  1ZAC A;  3BUO B;  3PLF B;  2KAV A;  1QX7 A;  3ICB A;  2CCM A;  2JPT A;  4PAL A;  1DF0 B;  2ISD A;  1BG1 A;  3IQO A;  2JNX A;  2SAS A;  2OS8 C;  1TNW A;  2OS8 B;  3E3R A;  4ETO A;  2MRD A;  4PE7 A;  1B1G A;  1DGU A;  1IWQ A;  1SMG A;  1NX3 A;  3CWG A;  1K94 A;  3OX5 A;  4FTG A;  2MBX A;  1CNP A;  1TIZ A;  1CFF A;  3AAJ A;  1K9K A;  4M2O A;  2LV7 A;  1OE9 B;  1SCM C;  3CS1 A;  2KGB C;  3KO0 A;  4BY4 A;  2LHI A;  1QLK A;  1M45 A;  2KOT A;  3IQQ A;  5DKQ A;  1LIN A;  3SG3 A;  4M2P A;  4AOM A;  1CTR A;  2IS9 A;  3DVM A;  1ODB A;  1B7T Z;  1SK6 D;  1ZFS A;  4CLN A;  1HT9 A;  1KQM C;  3DVJ A;  1KQM B;  1XK4 A;  1L2O C;  2HET A;  4PE1 A;  1NX1 A;  2KQY A;  1Y6W A;  1IG5 A;  3ZNI A;  3BUW B;  1M31 A;  1F70 A;  3O78 A;  1CDM A;  2LMU A;  4N5X A;  4MRX A;  1C7V A;  2JWW A;  4MLW A;  2NLN A;  3LK0 A;  1M39 A;  1NP8 A;  3M0W A;  1FI6 A;  1DJI A;  1IKU A;  4YGB B;  2CXJ A;  1KFX S;  3HCM A;  4A4C A;  5CSF A;  3VRR A;  3SIB A;  2BEC A;  1F4Q A;  5JJG A;  4MZJ A;  4GAO A;  1KCY A;  4DCK A;  2KSP A;  3PN7 B;  3SG5 A;  3KEV A;  1EL4 A;  1CMG A;  4C0L A;  1ZUZ A;  2E6W A;  1F54 A;  1SL9 A;  2NCP A;  1DGV A;  1EG4 A;  1F71 A;  1YVL A;  4YGE B;  1Y1A A;  2LLS A;  1ALV A;  1KFX L;  2P6B B;  3TS5 B;  1AJ4 A;  2LAP A;  5AAN A;  1BLQ A;  3LLE A;  1A75 B;  1OZO A;  1EXR A;  4HSZ A;  3OHM B;  1UUR A;  1OMV A;  2ZKM X;  4I5J A;  2L51 A;  1SBJ A;  1C07 A;  4A4B A;  1B8R A;  3FWB A;  3WHU B;  1CKK A;  2WCB A;  1FPW A;  3SJS A;  4BY5 A;  3DVE A;  2M49 B;  4I5L B;  1BJF A;  1JUO A;  1M63 B;  4USL A;  1J7R A;  1C7W A;  1BT6 A;  5HYD A;  2BE6 A;  2JTT A;  3GK4 X;  1K9U A;  1MXL C;  4MBE A;  1KQV A;  1PUL A;  1SR6 C;  1OSA A;  1OOJ A;  1SR6 B;  1V1F A;  1IQ3 A;  5K89 A;  1PAL A;  3TDZ A;  2KFH A;  1DF0 A;  1UUS A;  1YUS A;  5GQQ C;  5AER A;  2M7N A;  2WOR A;  1E8A A;  2LHL A;  3EVR A;  4AQI A;  1SRA A;  1SL8 A;  3SG7 A;  4OVN F;  4I5K A;  4QJ3 B;  5HKW A;  2F3Z A;  2KI6 C;  1YR5 A;  1J7O A;  1JSA A;  2LMV A;  1DJW A;  2BKH B;  4YRU A;  2CBL A;  1TOP A;  2GV5 A;  5CSN A;  2H61 C;  1A03 A;  1GJY A;  3JTD C;  2KI4 C;  3JTD B;  2JT0 A;  4GNK B;  1DJG A;  2Y1M A;  1MHO A;  4YGC B;  3SG4 A;  1N2D A;  2AMI A;  1K8U A;  1NIW A;  2L0P A;  3PAT A;  1NCX A;  4GGF C;  3I5G B;  2KNE A;  4CFR A;  1AHR A;  1B9A A;  1LXF C;  2OPO A;  1BOD A;  4P5O E;  4D1E A;  1IGV A;  2E30 A;  3PSR A;  3GOF A;  2F2O A;  2HQW A;  2ZRS A;  1W7I B;  3D10 A;  1BR1 B;  1RFJ A;  1N65 A;  1DJY A;  1MUX A;  1TRF A;  1QVI Y;  4MEW A;  1YUR A;  5KU1 A;  2ZNE A;  4GPL B;  5AXI A;  1NWD A;  1CLL A;  1NSH A;  3EVU A;  4YGA A;  2MA2 A;  2ZFD A;  4N1F A;  2KFF A;  5I2Q A;  1G4Y R;  1IJ6 A;  1NUB A;  3WHT B;  2LUC A;  1TCO B;  2ZRT A;  1KK7 Z;  2MLF C;  1QLS A;  1ZOT B;  3CR4 X;  4PCW A;  5HKZ A;  1XFU O;  1MR8 A;  2Q4U A;  4QJ4 B;  3BYA A;  1A75 A;  3BOW B;  1BMO A;  3I5H C;  1J1D A;  2M97 A;  2F2P A;  3I5H B;  5D69 A;  1OMD A;  1XYD A;  1SCM B;  4DRW A;  2LM5 A;  4HRG A;  4PHM A;  3RLZ A;  3WXA A;  2G2B A;  4YI8 A;  3SIA A;  5KTY A;  1BF5 A;  2KAX A;  1FW4 A;  1W7J B;  2FCD A;  1K90 D;  5HKY A;  1UHI A;  1K9P A;  1S3P A;  3QRX A;  1NPQ A;  1EG3 A;  1GQM A;  1L2O B;  2BBN A;  1A29 A;  1S36 A;  1G33 A;  1CFD A;  4UPG A;  1WRL A;  1LA0 A;  4M2Q A;  2LVK A;  3HX4 A;  4MN0 A;  2BBM A;  4CID A;  1UHN A;  2M1U A;  2ZN8 A;  4HRE E;  1NX0 A;  2Y1N A;  3VRQ A;  2NCO A;  1XFZ O;  5TNC A;  1SNL A;  1SYM A;  2OTG C;  4MZK A;  1XFV O;  1K93 D;  2BL0 C;  4C0J A;  2LC5 A;  4QJ5 B;  1JF0 A;  1KK7 Y;  1YX8 A;  3LCP C;  4OV2 A;  3CTN A;  1JFK A;  1PRW A;  3H4S E;  5CPV A;  1JC2 A;  2JXC A;  1SW8 A;  1LA3 A;  1PVB A;  2R2I A;  3CR5 X;  3EK7 A;  5IBW A;  3TDU A;  1OZS A;  2KYF A;  4C0K A;  1VRK A;  4IL1 A;  1QJT A;  2RGI A;  1U5I A;  4ICB A;  1QIV A;  5BPJ A;  1XFW O;  5B8I B;  3VRN A;  3A4U B;  2M8U A;  4OCI A;  4U8D A;  1B8C A;  5CSI A;  1CB1 A;  1QVI Z;  1Y1X A;  3LL8 B;  3FS7 A;  4XJK B;  1TCF A;  1SL7 A;  1DJX A;  2PSR A;  2KQ6 A;  1Q80 A;  4XYN A;  3GK2 A;  1QAT A;  5DKN A;  2QPT A;  1BU3 A;  5J3X A;  1REC A;  2I7A A;  3JVT C;  2L4H A;  3DVK A;  2I2R E;  1EJ3 A;  4TNC A;  1CMF A;  1S5G Y;  1HQV A;  1K95 A;  1TN4 A;  2D8N A;  2FJU B;  2LE9 B;  3BXK A;  3BOW A;  3D0Y B;  2FCE A;  1F8H A;  2JNF A;  2MHH A;  3SG6 A;  2VRG A;  2K2F A;  2JRF A;  2PVB A;  1TNP A;  2JU0 A;  2BE4 A;  1XK4 C;  2LP3 A;  2KBM A;  1F55 A;  3I5I C;  4GGN A;  2JOJ A;  1F4O A;  4MRY A;  1EH2 A;  4NDB A;  5ER4 X;  1Y1U A;  1UHJ A;  2KI4 B;  1AK8 A;  2Q91 A;  3O4Y A;  1CLM A;  2M29 A;  3OB2 B;  4N1G A;  5HLV A;  2HQ8 A;  1RTP 1;  1RWY A;  1DTL A;  2KI6 D;  2FOT A;  2H2K A;  1IJ5 A;  1QX2 A;  2JC2 A;  1J7Q A;  1JWD A;  1QV0 A;  2PRU A;  5I8N A;  1G8I A;  1S6J A;  1FI5 A;  1QAS A;  2KDH A;  2PAS A;  4NDD A;  3PFV A;  1GGZ A;  2KHN A;  1H8B A;  1XFY O;  3I5F C;  3DD4 A;  3I5F B;  1QIW A;  1OQP A;  3AAK A;  2L50 A;  3BQ3 A;  2K7O A;  3VGO A;  2WCF A;  1WLZ A;  3SG2 A;  1MWN A;  2LLU A;  3ZWH A;  1CM1 A;  3MSE B;  2WND A;  2TN4 A;  1J7P A;  1S6C A;  2AAO A;  3CLN A;  3NSI A;  1CFC A;  1WDC C;  1H4B A;  1UP5 A;  2COL B;  1CDP A;  1A4P A;  3FIA A;  4PE0 A;  3AKA A;  2I94 A;  2L5X B;  2K7B A;  1YVH A;  2HPS A;  3DF0 B;  1XO5 A;  3C1V A;  4YGD B;  2LP2 A;  3NSO A;  1WLM A;  3AKB A;  1AVS A;  2LVJ A;  1PSR A;  1WY9 A;  3CGA A;  3K21 A;  3WNX B;  5JOL A;  2I18 A;  3CR2 A;  1RRO A;  1SKT A;  4R1E A;  1YRT B;  1XFX O;  2SCP A;  3BUM B;  5G08 A;  2Y5I A;  1NCY A;  3TUY C;  1B47 A;  3OB1 B;  5CSJ A;  1B8L A;  3RM1 A;  3TUY B;  3VRP A;  1DT7 B;  1YUT A;  4XJK A;  1SCV A;  4ZCV A;  2MLE C;  1AUI B;  4GFT A;  3EKJ A;  5AEQ A;  3A8R A;  4YBH B;  5FYX A;  1AP4 A;  1JBA A;  1TTX A;  3NSK A;  4PE4 A;  1QS7 A;  4PHK A;  4JWQ A;  4OKH A;  2BCA A;  1LKJ A;  1FF1 A;  1KFU S;  1JFJ A; 
#chains in the Genus database with same CATH topology
 2QAC A;  1TWO A;  5DKR A;  2PMY A;  4L9M A;  5AFP A;  3EK4 A;  3BFA A;  1B4C A;  2EHB A;  1DMO A;  4YI9 A;  4FQT A;  2M1K B;  1KWO C;  3TDI A;  1S5G Z;  1UHH A;  4MSP A;  1KWO B;  2M7L A;  2WCE A;  3EKH A;  3PJI A;  3D0Y A;  1ORG A;  1WRZ A;  5PAL A;  1TUZ A;  2OTG B;  1FBV A;  2K8M B;  3NSL A;  4ORB B;  2LVI A;  1S1E A;  4ZCU A;  1KFU L;  2BL0 B;  4DS7 A;  2MJW B;  5D7F A;  3VRO A;  2EC6 C;  3O6B A;  2EC6 B;  3IF7 A;  1MF8 B;  2JQ6 A;  1UHK A;  2PAL A;  2EGD A;  1M46 A;  1PK0 D;  1RK9 A;  2WOS A;  2LMT A;  3FWC A;  2H61 A;  5FI2 A;  3D73 A;  3FE6 A;  1Z4H A;  1S6I A;  2KYC A;  2Y4Q A;  1CM4 A;  2KAY A;  1SY9 A;  4I5N B;  4DIR A;  4GGF A;  2KLD A;  2QEO A;  2F8P A;  3S0F A;  3LK1 A;  4NQG A;  2L2C A;  1QXP A;  2BCX A;  4NDC A;  4PDZ A;  3S0D A;  2JTZ A;  4DUQ A;  5HL1 A;  3N7H A;  3CZT X;  1R6P A;  3KF9 A;  3PN7 C;  1JF2 A;  4GUK A;  1GGW A;  3VB1 A;  2LVV A;  2DOQ A;  1CFP A;  2KBI A;  3S0G A;  1NYA A;  1CDL A;  3BUN B;  2KFG A;  1TNQ A;  1V1G A;  2LLT A;  3D78 A;  1IH0 A;  3O2P A;  2O5G A;  2JT8 A;  1C3Y A;  2K61 A;  2K0J A;  2JUL A;  1YRU B;  4PHN A;  4MVF A;  1N0Y A;  2O60 A;  1NCZ A;  4ORC B;  4PHJ A;  2L98 A;  2WC8 A;  3JVT B;  2LCP A;  1XA5 A;  2F3Y A;  1QV1 A;  3KPX A;  5F6T A;  1RJV A;  3TZ1 A;  1YUU A;  4AQJ A;  1BOC A;  3BUX B;  2K7C A;  1R2U A;  2LUX A;  1IRJ A;  3DF0 A;  1B7T Y;  5I94 A;  1KSM A;  1PVA A;  4GBA A;  4OR9 B;  2A4J A;  3EK8 A;  1X02 A;  3EVV A;  1UWO A;  2ZND A;  2QEH A;  4HRH A;  3I5I B;  2BCB A;  3DYE A;  1J1E A;  1LVC D;  1SPY A;  1WRK A;  2V53 A;  3D76 A;  2HF5 A;  1J55 A;  1S26 D;  4JKT A;  3S0A A;  2GGZ A;  2B1U A;  1DJZ A;  2G9B A;  3UNW A;  5HLO A;  2AUC A;  2NZ0 A;  2KPH A;  2L4I A;  2JT3 A;  3NHI A;  2LAN A;  1A2X A;  1D1O A;  3PM8 A;  3CZ2 A;  4FQO A;  1IQ5 A;  2P71 A;  1MXE A;  3OX6 A;  3D74 A;  2CTN A;  2JXL A;  1PSB A;  1QX5 B;  2PYQ A;  2M9G A;  1TNX A;  1AJ5 A;  4ORA B;  4MZL A;  4Q04 A;  4WQ2 A;  3GK1 A;  3V2L A;  4E68 A;  2LNK A;  2BKI B;  2F33 A;  4F0Z B;  5I2L A;  1Z2C B;  2KGR A;  2JZI A;  1K96 A;  2WCJ A;  3TS5 C;  3S0B A;  4JPZ B;  2M0R A;  1ALW A;  2MAZ A;  2M3W A;  4P2Y B;  1KK8 C;  1MQ1 A;  2NXQ A;  1KK8 B;  1BR4 B;  1Y0V H;  1YTZ C;  3I5G C;  4CPV A;  1KSO A;  4WQ3 A;  3PAL A;  4WRI A;  2K7D A;  1NX2 A;  1DJH A;  3OP0 A;  4CFQ A;  3F45 A;  1WDC B;  2CT9 A;  5I2O A;  1U5I B;  1OMR A;  1L7Z A;  1ZMZ A;  2K2A A;  1QTX A;  5ER5 A;  1K2H A;  1XVJ A;  2GGM A;  1YX7 A;  3KHE A;  2CNP A;  3B86 A;  5KSZ A;  1CDN A;  4JD9 A;  2ZN9 A;  4JQ0 D;  2BNX A;  3NXA A;  1DVI A;  2L2E A;  1ZAC A;  3BUO B;  3PLF B;  2KAV A;  1QX7 A;  3ICB A;  2CCM A;  2JPT A;  4PAL A;  1DF0 B;  2ISD A;  1BG1 A;  3IQO A;  2JNX A;  2SAS A;  2OS8 C;  1TNW A;  2OS8 B;  3E3R A;  5EL2 A;  4ETO A;  2MRD A;  4PE7 A;  1B1G A;  1DGU A;  1IWQ A;  1SMG A;  1NX3 A;  3CWG A;  1K94 A;  3B87 A;  3OX5 A;  4FTG A;  2MBX A;  1CNP A;  1TIZ A;  1CFF A;  3AAJ A;  1K9K A;  4M2O A;  2WC6 A;  3S0E A;  2LV7 A;  1GM0 A;  1OE9 B;  1SCM C;  3CS1 A;  2KGB C;  3KO0 A;  4BY4 A;  2LHI A;  1QLK A;  1M45 A;  2KOT A;  3OBV A;  3IQQ A;  5DKQ A;  1LIN A;  3SG3 A;  4M2P A;  3CDN A;  3R72 A;  1CTR A;  2IS9 A;  4AOM A;  3DVM A;  1ODB A;  1B7T Z;  1SK6 D;  1ZFS A;  4CLN A;  1HT9 A;  1KQM C;  3DVJ A;  1KQM B;  1XK4 A;  1L2O C;  2HET A;  4PE1 A;  1NX1 A;  2KQY A;  1Y6W A;  1IG5 A;  3ZNI A;  3BUW B;  1M31 A;  1F70 A;  3O78 A;  1CDM A;  3DY9 A;  2LMU A;  4N5X A;  4MRX A;  1C7V A;  2JWW A;  4MLW A;  2NLN A;  3SS3 A;  3LK0 A;  3NHT A;  1W9Z A;  1M39 A;  2QEV A;  1NP8 A;  3M0W A;  1FI6 A;  1DJI A;  1IKU A;  4YGB B;  2CXJ A;  1KFX S;  3HCM A;  4A4C A;  5CSF A;  3VRR A;  3SIB A;  2BEC A;  1F4Q A;  5JJG A;  4MZJ A;  4GAO A;  1KCY A;  4DCK A;  2KSP A;  3L4L A;  3PN7 B;  3R1P A;  3SG5 A;  3KEV A;  1EL4 A;  2WCH A;  4C0L A;  1CMG A;  1ZUZ A;  4PT1 A;  2E6W A;  1F54 A;  1SL9 A;  2NCP A;  1DGV A;  3PM2 A;  2GTE A;  1EG4 A;  1XFR A;  1F71 A;  1YVL A;  4YGE B;  1Y1A A;  2LLS A;  1ALV A;  1KFX L;  2P6B B;  3TS5 B;  1AJ4 A;  2LAP A;  5AAN A;  1BLQ A;  3LLE A;  1A75 B;  1OZO A;  1EXR A;  4HSZ A;  3OHM B;  1UUR A;  1OMV A;  2ZKM X;  4I5J A;  2L51 A;  3DZT A;  1SBJ A;  1C07 A;  4A4B A;  1OOI X;  1B8R A;  3FWB A;  3WHU B;  1CKK A;  2WCB A;  1FPW A;  3SJS A;  4BY5 A;  3DVE A;  2M49 B;  4I5L B;  1BJF A;  1JUO A;  1M63 B;  3B88 A;  3NGV A;  1J7R A;  1C7W A;  4USL A;  2KLE A;  1BT6 A;  5HYD A;  2BE6 A;  2JTT A;  3GK4 X;  1K9U A;  1MXL C;  4MBE A;  1KQV A;  1PUL A;  3K1E A;  4INW A;  1SR6 C;  1OSA A;  1OOJ A;  1SR6 B;  1V1F A;  1IQ3 A;  5K89 A;  1PAL A;  3TDZ A;  2KFH A;  1DF0 A;  1UUS A;  3R1O A;  1YUS A;  5DIC A;  5GQQ C;  5AER A;  2M7N A;  2WOR A;  1E8A A;  2LHL A;  3EVR A;  4AQI A;  1SRA A;  1DC1 A;  1DEL A;  1SL8 A;  3SG7 A;  3SS5 A;  4OVN F;  4I5K A;  4QJ3 B;  5HKW A;  2F3Z A;  2KI6 C;  1YR5 A;  4OZD A;  1J7O A;  1JSA A;  2LMV A;  1DJW A;  2BKH B;  3Q8I A;  2QDI A;  4YRU A;  2CBL A;  3BJH A;  1TOP A;  2GV5 A;  5CSN A;  2H61 C;  1A03 A;  1OW4 A;  1GJY A;  3JTD C;  1C3Z A;  2KI4 C;  3JTD B;  2JT0 A;  3R1V A;  4GNK B;  1DJG A;  2Y1M A;  1MHO A;  4YGC B;  3SG4 A;  1N2D A;  2AMI A;  1K8U A;  1NIW A;  2L0P A;  3PAT A;  1NCX A;  4GGF C;  3CYZ A;  2YGU A;  3I5G B;  2KNE A;  4CFR A;  1AHR A;  1B9A A;  1LXF C;  2OPO A;  1BOD A;  4P5O E;  4D1E A;  1IGV A;  4INX A;  2E30 A;  3B7A A;  3GOF A;  2F2O A;  2HQW A;  2ZRS A;  1W7I B;  3PSR A;  3D10 A;  1BR1 B;  1RFJ A;  1N65 A;  1DJY A;  1MUX A;  1TRF A;  1QVI Y;  1IIO A;  4MEW A;  1YUR A;  5KU1 A;  2ZNE A;  4GPL B;  5AXI A;  1NWD A;  3FE8 A;  1CLL A;  1NSH A;  3EVU A;  4YGA A;  2MA2 A;  2ZFD A;  4N1F A;  2KFF A;  3B6X A;  5I2Q A;  1G4Y R;  1IJ6 A;  1NUB A;  3WHT B;  2P70 A;  2LUC A;  1TCO B;  2ZRT A;  1KK7 Z;  2MLF C;  1QLS A;  1ZOT B;  3CR4 X;  4PCW A;  5HKZ A;  1XFU O;  1MR8 A;  3FE9 A;  2Q4U A;  4QJ4 B;  3BYA A;  5FI7 A;  1A75 A;  3BOW B;  1BMO A;  3I5H C;  4KYN A;  1J1D A;  2M97 A;  2F2P A;  3I5H B;  5D69 A;  3CZ1 A;  1OMD A;  1OOH A;  1TUJ A;  1XYD A;  1SCM B;  4DRW A;  2LM5 A;  4HRG A;  4PHM A;  3RLZ A;  3WXA A;  2G2B A;  3D77 A;  4YI8 A;  3UO9 A;  3SIA A;  5KTY A;  1BF5 A;  2KAX A;  1FW4 A;  1W7J B;  2FCD A;  1K90 D;  3SS4 A;  5HKY A;  1UHI A;  1K9P A;  1S3P A;  3QRX A;  1NPQ A;  2QEB A;  1EG3 A;  1GQM A;  1L2O B;  4F7F A;  2BBN A;  1A29 A;  1S36 A;  1G33 A;  1CFD A;  4UPG A;  1WRL A;  1LA0 A;  4M2Q A;  2LVK A;  3HX4 A;  4MN0 A;  2BBM A;  4CID A;  1UHN A;  2M1U A;  2ZN8 A;  2H8V A;  4HRE E;  1NX0 A;  3L4A A;  2Y1N A;  3DXL A;  3VRQ A;  2NCO A;  1XFZ O;  5TNC A;  1SNL A;  1SYM A;  2OTG C;  4MZK A;  1XFV O;  1K93 D;  2BL0 C;  1SSE B;  4C0J A;  2LC5 A;  4QJ5 B;  1JF0 A;  1KK7 Y;  1YX8 A;  3LCP C;  4OV2 A;  3CTN A;  5FI6 A;  1JFK A;  1PRW A;  3H4S E;  2ERB A;  3QME A;  5CPV A;  1JC2 A;  2JXC A;  1SW8 A;  1LA3 A;  1PVB A;  2R2I A;  3CR5 X;  3EK7 A;  5IBW A;  1CLB A;  2WCL A;  3TDU A;  1OZS A;  2KYF A;  4C0K A;  1VRK A;  4IL1 A;  1QJT A;  2RGI A;  1U5I A;  4ICB A;  1QIV A;  5BPJ A;  1XFW O;  5B8I B;  3VRN A;  3A4U B;  2M8U A;  4OCI A;  4U8D A;  1B8C A;  5CSI A;  1CB1 A;  2JPO A;  1QVI Z;  1Y1X A;  3LL8 B;  3FS7 A;  4XJK B;  1TCF A;  1SL7 A;  1DJX A;  2PSR A;  2KQ6 A;  1Q80 A;  4XYN A;  3GK2 A;  1QAT A;  1OOF A;  5DKN A;  2QPT A;  4IJ7 A;  1BU3 A;  5J3X A;  3CZ0 A;  2BAP A;  1REC A;  2I7A A;  3JVT C;  2L4H A;  3DVK A;  2I2R E;  1EJ3 A;  4TNC A;  1CMF A;  1S5G Y;  1HQV A;  1K95 A;  1TN4 A;  2D8N A;  2FJU B;  2LE9 B;  3IVT A;  3BXK A;  3BOW A;  3D0Y B;  2FCE A;  3D75 A;  2JNF A;  1F8H A;  2MHH A;  3SG6 A;  1T14 A;  2VRG A;  2K2F A;  2JRF A;  2PVB A;  1TNP A;  2JU0 A;  2BE4 A;  1XK4 C;  2LP3 A;  2KBM A;  1F55 A;  3I5I C;  4GGN A;  2JOJ A;  2L5Y A;  2PQL A;  1F4O A;  4MRY A;  1EH2 A;  2WCK A;  3O4X A;  4NDB A;  5ER4 X;  1Y1U A;  1UHJ A;  3EG5 B;  1DEK A;  2KI4 B;  1AK8 A;  2Q91 A;  3O4Y A;  1CLM A;  2M29 A;  3OB2 B;  4N1G A;  5HLV A;  2HQ8 A;  1P28 A;  1RTP 1;  1RWY A;  1DTL A;  1OOG A;  2FOT A;  2H2K A;  2KI6 D;  1IJ5 A;  1QX2 A;  2JC2 A;  2WC5 A;  1J7Q A;  1JWD A;  1QV0 A;  2PRU A;  5I8N A;  1G8I A;  1S6J A;  1FI5 A;  1QAS A;  2KDH A;  2FJY A;  2PAS A;  4NDD A;  3PFV A;  1GGZ A;  2KHN A;  1H8B A;  1XFY O;  3I5F C;  3DD4 A;  3I5F B;  1QIW A;  1OQP A;  3AAK A;  2L50 A;  3BQ3 A;  2K7O A;  3RZS A;  3VGO A;  2WCF A;  3OGN A;  1WLZ A;  3SG2 A;  1MWN A;  2LLU A;  3ZWH A;  1CM1 A;  3MSE B;  2WND A;  2TN4 A;  5D3O A;  1S6C A;  3L47 A;  2AAO A;  3CLN A;  3NSI A;  1CFC A;  1WDC C;  3BFB A;  1J7P A;  1H4B A;  1UP5 A;  2COL B;  1CDP A;  1A4P A;  3FIA A;  4PE0 A;  3AKA A;  2I94 A;  2L5X B;  2K7B A;  1DQE A;  1YVH A;  2HPS A;  3DF0 B;  1XO5 A;  1LS8 A;  3C1V A;  4YGD B;  2LP2 A;  3NSO A;  1WLM A;  3AKB A;  1AVS A;  2LVJ A;  1PSR A;  1WY9 A;  2WCM A;  3CGA A;  3K21 A;  3WNX B;  5JOL A;  2I18 A;  3CR2 A;  1RRO A;  1SKT A;  4R1E A;  1YRT B;  1XFX O;  2SCP A;  3BUM B;  5G08 A;  2Y5I A;  1NCY A;  3TUY C;  3BFH A;  1B47 A;  3OB1 B;  5CSJ A;  1B8L A;  3RM1 A;  3TUY B;  3VRP A;  1DT7 B;  1QWV A;  1YUT A;  4XJK A;  1SCV A;  2K60 A;  4ZCV A;  2MLE C;  1AUI B;  3CAB A;  3EKJ A;  4GFT A;  5AEQ A;  3A8R A;  4YBH B;  5FYX A;  1AP4 A;  1JBA A;  1TTX A;  3NSK A;  4PE4 A;  1QS7 A;  4PHK A;  4JWQ A;  4OKH A;  2BCA A;  1LKJ A;  1FF1 A;  1KFU S;  1JFJ A; 
#chains in the Genus database with same CATH homology
 2QAC A;  5DKR A;  2PMY A;  4L9M A;  5AFP A;  3EK4 A;  1B4C A;  2EHB A;  1DMO A;  4YI9 A;  2M1K B;  1KWO C;  3TDI A;  1S5G Z;  1UHH A;  4MSP A;  1KWO B;  2M7L A;  2WCE A;  3EKH A;  3D0Y A;  5PAL A;  1WRZ A;  2OTG B;  1FBV A;  2K8M B;  3NSL A;  4ORB B;  2LVI A;  1S1E A;  4ZCU A;  1KFU L;  2BL0 B;  4DS7 A;  2MJW B;  5D7F A;  3VRO A;  2EC6 C;  3O6B A;  2EC6 B;  3IF7 A;  1MF8 B;  2JQ6 A;  1UHK A;  2PAL A;  2EGD A;  1M46 A;  1PK0 D;  1RK9 A;  2WOS A;  2LMT A;  3FWC A;  2H61 A;  1S6I A;  2KYC A;  2Y4Q A;  1CM4 A;  2KAY A;  1SY9 A;  4I5N B;  4DIR A;  4GGF A;  2F8P A;  1CLB A;  3LK1 A;  4NQG A;  1QXP A;  2BCX A;  4NDC A;  4PDZ A;  4DUQ A;  2JTZ A;  3CZT X;  1R6P A;  3KF9 A;  3PN7 C;  1JF2 A;  4GUK A;  1GGW A;  2LVV A;  2DOQ A;  1CFP A;  2KBI A;  1NYA A;  1CDL A;  3BUN B;  2KFG A;  1TNQ A;  1V1G A;  2LLT A;  1IH0 A;  3O2P A;  2O5G A;  2JT8 A;  2K61 A;  2K0J A;  2JUL A;  1YRU B;  4PHN A;  4MVF A;  1N0Y A;  2O60 A;  1NCZ A;  4ORC B;  4PHJ A;  2L98 A;  2WC8 A;  3JVT B;  2LCP A;  1XA5 A;  2F3Y A;  1QV1 A;  3KPX A;  5F6T A;  1RJV A;  3TZ1 A;  1YUU A;  4AQJ A;  1BOC A;  3BUX B;  2K7C A;  1R2U A;  2LUX A;  1IRJ A;  3DF0 A;  1B7T Y;  1KSM A;  1PVA A;  4GBA A;  4OR9 B;  2A4J A;  3EK8 A;  1X02 A;  3EVV A;  1UWO A;  2ZND A;  4HRH A;  3I5I B;  2BCB A;  1J1E A;  1LVC D;  1SPY A;  1WRK A;  2V53 A;  2HF5 A;  1J55 A;  1S26 D;  2GGZ A;  2B1U A;  1DJZ A;  2G9B A;  5HLO A;  2AUC A;  2NZ0 A;  2L4I A;  2JT3 A;  2LAN A;  1A2X A;  1D1O A;  3PM8 A;  4FQO A;  1IQ5 A;  1MXE A;  3OX6 A;  2CTN A;  2JXL A;  1PSB A;  1QX5 B;  2M9G A;  1TNX A;  1AJ5 A;  4ORA B;  4MZL A;  4Q04 A;  4WQ2 A;  3GK1 A;  4E68 A;  2LNK A;  2BKI B;  2F33 A;  4F0Z B;  5I2L A;  2KGR A;  2JZI A;  1K96 A;  3TS5 C;  4JPZ B;  2M0R A;  1ALW A;  2MAZ A;  2M3W A;  4P2Y B;  1KK8 C;  1MQ1 A;  2NXQ A;  1KK8 B;  1BR4 B;  1Y0V H;  1YTZ C;  3I5G C;  4CPV A;  1KSO A;  4WQ3 A;  3PAL A;  4WRI A;  2K7D A;  1NX2 A;  1DJH A;  3OP0 A;  4CFQ A;  3F45 A;  1WDC B;  2CT9 A;  5I2O A;  1U5I B;  1OMR A;  1L7Z A;  1ZMZ A;  2K2A A;  1QTX A;  5ER5 A;  1K2H A;  1XVJ A;  2GGM A;  1YX7 A;  3KHE A;  2CNP A;  5KSZ A;  1CDN A;  2ZN9 A;  4JQ0 D;  3NXA A;  1DVI A;  2L2E A;  1ZAC A;  3BUO B;  3PLF B;  2KAV A;  1QX7 A;  3ICB A;  2CCM A;  2JPT A;  4PAL A;  1DF0 B;  2ISD A;  1BG1 A;  3IQO A;  2JNX A;  2SAS A;  2OS8 C;  1TNW A;  2OS8 B;  3E3R A;  4ETO A;  2MRD A;  4PE7 A;  1B1G A;  1DGU A;  1IWQ A;  1SMG A;  1NX3 A;  3CWG A;  1K94 A;  3OX5 A;  4FTG A;  2MBX A;  1CNP A;  1TIZ A;  1CFF A;  3AAJ A;  1K9K A;  4M2O A;  2LV7 A;  1OE9 B;  1SCM C;  3CS1 A;  2KGB C;  3KO0 A;  4BY4 A;  2LHI A;  1QLK A;  1M45 A;  2KOT A;  3IQQ A;  5DKQ A;  1LIN A;  3SG3 A;  4M2P A;  4AOM A;  1CTR A;  2IS9 A;  3DVM A;  1ODB A;  1B7T Z;  1SK6 D;  1ZFS A;  4CLN A;  1HT9 A;  1KQM C;  3DVJ A;  1KQM B;  1XK4 A;  1L2O C;  2HET A;  4PE1 A;  1NX1 A;  2KQY A;  1Y6W A;  1IG5 A;  3ZNI A;  3BUW B;  1M31 A;  1F70 A;  3O78 A;  1CDM A;  2LMU A;  4N5X A;  4MRX A;  1C7V A;  2JWW A;  4MLW A;  2NLN A;  3LK0 A;  1M39 A;  1NP8 A;  3M0W A;  1FI6 A;  1DJI A;  1IKU A;  4YGB B;  2CXJ A;  1KFX S;  3HCM A;  4A4C A;  5CSF A;  3VRR A;  3SIB A;  2BEC A;  1F4Q A;  5JJG A;  4MZJ A;  4GAO A;  1KCY A;  4DCK A;  2KSP A;  3PN7 B;  3SG5 A;  3KEV A;  1EL4 A;  1CMG A;  4C0L A;  1ZUZ A;  2E6W A;  1F54 A;  1SL9 A;  2NCP A;  1DGV A;  1EG4 A;  1F71 A;  1YVL A;  4YGE B;  1Y1A A;  2LLS A;  1ALV A;  1KFX L;  2P6B B;  3TS5 B;  1AJ4 A;  2LAP A;  5AAN A;  1BLQ A;  3LLE A;  1A75 B;  1OZO A;  1EXR A;  4HSZ A;  3OHM B;  1UUR A;  1OMV A;  2ZKM X;  4I5J A;  2L51 A;  1SBJ A;  1C07 A;  4A4B A;  1B8R A;  3FWB A;  3WHU B;  1CKK A;  2WCB A;  1FPW A;  3SJS A;  4BY5 A;  3DVE A;  2M49 B;  4I5L B;  1BJF A;  1JUO A;  1M63 B;  4USL A;  1J7R A;  1C7W A;  1BT6 A;  5HYD A;  2BE6 A;  2JTT A;  3GK4 X;  1K9U A;  1MXL C;  4MBE A;  1KQV A;  1PUL A;  1SR6 C;  1OSA A;  1OOJ A;  1SR6 B;  1V1F A;  1IQ3 A;  5K89 A;  1PAL A;  3TDZ A;  2KFH A;  1DF0 A;  1UUS A;  1YUS A;  5GQQ C;  5AER A;  2M7N A;  2WOR A;  1E8A A;  2LHL A;  3EVR A;  4AQI A;  1SRA A;  1SL8 A;  3SG7 A;  4OVN F;  4I5K A;  4QJ3 B;  5HKW A;  2F3Z A;  2KI6 C;  1YR5 A;  1J7O A;  1JSA A;  2LMV A;  1DJW A;  2BKH B;  4YRU A;  2CBL A;  1TOP A;  2GV5 A;  5CSN A;  2H61 C;  1A03 A;  1GJY A;  3JTD C;  2KI4 C;  3JTD B;  2JT0 A;  4GNK B;  1DJG A;  2Y1M A;  1MHO A;  4YGC B;  3SG4 A;  1N2D A;  2AMI A;  1K8U A;  1NIW A;  2L0P A;  3PAT A;  1NCX A;  4GGF C;  3I5G B;  2KNE A;  4CFR A;  1AHR A;  1B9A A;  1LXF C;  2OPO A;  1BOD A;  4P5O E;  4D1E A;  1IGV A;  2E30 A;  3PSR A;  3GOF A;  2F2O A;  2HQW A;  2ZRS A;  1W7I B;  3D10 A;  1BR1 B;  1RFJ A;  1N65 A;  1DJY A;  1MUX A;  1TRF A;  1QVI Y;  4MEW A;  1YUR A;  5KU1 A;  2ZNE A;  4GPL B;  5AXI A;  1NWD A;  1CLL A;  1NSH A;  3EVU A;  4YGA A;  2MA2 A;  2ZFD A;  4N1F A;  2KFF A;  5I2Q A;  1G4Y R;  1IJ6 A;  1NUB A;  3WHT B;  2LUC A;  1TCO B;  2ZRT A;  1KK7 Z;  2MLF C;  1QLS A;  1ZOT B;  3CR4 X;  4PCW A;  5HKZ A;  1XFU O;  1MR8 A;  2Q4U A;  4QJ4 B;  3BYA A;  1A75 A;  3BOW B;  1BMO A;  3I5H C;  1J1D A;  2M97 A;  2F2P A;  3I5H B;  5D69 A;  1OMD A;  1XYD A;  1SCM B;  4DRW A;  2LM5 A;  4HRG A;  4PHM A;  3RLZ A;  3WXA A;  2G2B A;  4YI8 A;  3SIA A;  5KTY A;  1BF5 A;  2KAX A;  1FW4 A;  1W7J B;  2FCD A;  1K90 D;  5HKY A;  1UHI A;  1K9P A;  1S3P A;  3QRX A;  1NPQ A;  1EG3 A;  1GQM A;  1L2O B;  2BBN A;  1A29 A;  1S36 A;  1G33 A;  1CFD A;  4UPG A;  1WRL A;  1LA0 A;  4M2Q A;  2LVK A;  3HX4 A;  4MN0 A;  2BBM A;  4CID A;  1UHN A;  2M1U A;  2ZN8 A;  4HRE E;  1NX0 A;  2Y1N A;  3VRQ A;  2NCO A;  1XFZ O;  5TNC A;  1SNL A;  1SYM A;  2OTG C;  4MZK A;  1XFV O;  1K93 D;  2BL0 C;  4C0J A;  2LC5 A;  4QJ5 B;  1JF0 A;  1KK7 Y;  1YX8 A;  3LCP C;  4OV2 A;  3CTN A;  1JFK A;  1PRW A;  3H4S E;  5CPV A;  1JC2 A;  2JXC A;  1SW8 A;  1LA3 A;  1PVB A;  2R2I A;  3CR5 X;  3EK7 A;  5IBW A;  3TDU A;  1OZS A;  2KYF A;  4C0K A;  1VRK A;  4IL1 A;  1QJT A;  2RGI A;  1U5I A;  4ICB A;  1QIV A;  5BPJ A;  1XFW O;  5B8I B;  3VRN A;  3A4U B;  2M8U A;  4OCI A;  4U8D A;  1B8C A;  5CSI A;  1CB1 A;  1QVI Z;  1Y1X A;  3LL8 B;  3FS7 A;  4XJK B;  1TCF A;  1SL7 A;  1DJX A;  2PSR A;  2KQ6 A;  1Q80 A;  4XYN A;  3GK2 A;  1QAT A;  5DKN A;  2QPT A;  1BU3 A;  5J3X A;  1REC A;  2I7A A;  3JVT C;  2L4H A;  3DVK A;  2I2R E;  1EJ3 A;  4TNC A;  1CMF A;  1S5G Y;  1HQV A;  1K95 A;  1TN4 A;  2D8N A;  2FJU B;  2LE9 B;  3BXK A;  3BOW A;  3D0Y B;  2FCE A;  1F8H A;  2JNF A;  2MHH A;  3SG6 A;  2VRG A;  2K2F A;  2JRF A;  2PVB A;  1TNP A;  2JU0 A;  2BE4 A;  1XK4 C;  2LP3 A;  2KBM A;  1F55 A;  3I5I C;  4GGN A;  2JOJ A;  1F4O A;  4MRY A;  1EH2 A;  4NDB A;  5ER4 X;  1Y1U A;  1UHJ A;  2KI4 B;  1AK8 A;  2Q91 A;  3O4Y A;  1CLM A;  2M29 A;  3OB2 B;  4N1G A;  5HLV A;  2HQ8 A;  1RTP 1;  1RWY A;  1DTL A;  2KI6 D;  2FOT A;  2H2K A;  1IJ5 A;  1QX2 A;  2JC2 A;  1J7Q A;  1JWD A;  1QV0 A;  2PRU A;  5I8N A;  1G8I A;  1S6J A;  1FI5 A;  1QAS A;  2KDH A;  2PAS A;  4NDD A;  3PFV A;  1GGZ A;  2KHN A;  1H8B A;  1XFY O;  3I5F C;  3DD4 A;  3I5F B;  1QIW A;  1OQP A;  3AAK A;  2L50 A;  3BQ3 A;  2K7O A;  3VGO A;  2WCF A;  1WLZ A;  3SG2 A;  1MWN A;  2LLU A;  3ZWH A;  1CM1 A;  3MSE B;  2WND A;  2TN4 A;  1J7P A;  1S6C A;  2AAO A;  3CLN A;  3NSI A;  1CFC A;  1WDC C;  1H4B A;  1UP5 A;  2COL B;  1CDP A;  1A4P A;  3FIA A;  4PE0 A;  3AKA A;  2I94 A;  2L5X B;  2K7B A;  1YVH A;  2HPS A;  3DF0 B;  1XO5 A;  3C1V A;  4YGD B;  2LP2 A;  3NSO A;  1WLM A;  3AKB A;  1AVS A;  2LVJ A;  1PSR A;  1WY9 A;  3CGA A;  3K21 A;  3WNX B;  5JOL A;  2I18 A;  3CR2 A;  1RRO A;  1SKT A;  4R1E A;  1YRT B;  1XFX O;  2SCP A;  3BUM B;  5G08 A;  2Y5I A;  1NCY A;  3TUY C;  1B47 A;  3OB1 B;  5CSJ A;  1B8L A;  3RM1 A;  3TUY B;  3VRP A;  1DT7 B;  1YUT A;  4XJK A;  1SCV A;  4ZCV A;  2MLE C;  1AUI B;  4GFT A;  3EKJ A;  5AEQ A;  3A8R A;  4YBH B;  5FYX A;  1AP4 A;  1JBA A;  1TTX A;  3NSK A;  4PE4 A;  1QS7 A;  4PHK A;  4JWQ A;  4OKH A;  2BCA A;  1LKJ A;  1FF1 A;  1KFU S;  1JFJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...