1OQPA

Structure of the ca2+/c-terminal domain of caltractin in complex with the cdc31p-binding domain from kar1p
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
77
structure length
77
Chain Sequence
GSGERDSREEILKAFRLFDDDNSGTITIKDLRRVAKELGENLTEEELQEMIAEADRNDDNEIDEDEFIRIMKKTSLF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Protein binding
molecule keywords Caltractin
publication title Unique Features in the C-terminal Domain Provide Caltractin with Target Specificity
pubmed doi rcsb
source organism Chlamydomonas reinhardtii
total genus 29
structure length 77
sequence length 77
ec nomenclature
pdb deposition date 2003-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1oqpA00
4OR9B 3PM8A 1DVIA 4FTGA 4OCIA 4GNKB 5HKZA 2PALA 4GGNA 5BPJA 5TNCA 3WHUB 2K0JA 2MHHA 2GGZA 2LVKA 2LLSA 3FWCA 1N2DA 4PHKA 1S5GZ 4GGFA 3DVMA 4GFTA 2BBNA 1UWOA 1SR6B 3OX5A 5AANA 2LV7A 4P2YB 3QRXA 1DGUA 5G08A 4DUQA 4C0JA 2HPSA 2KGRA 3I5FC 2WCFA 4M2PA 4N1GA 1TNWA 3O4YA 1KK8B 3I5IB 2K7DA 2JXCA 2JTZA 1B8CA 1K90D 3AAKA 2JT8A 4YI8A 1LVCD 4ETOA 1F55A 4DRWA 4OKHA 2Y4QA 4MRYA 2MLFC 1DF0B 2LANA 1LXFC 1DJHA 3BYAA 3M0WA 3PATA 3PFVA 2LUCA 2M0RA 1DJGA 1TN4A 1XA5A 2M1UA 3EVVA 1WDCC 2KI6C 2NXQA 1IGVA 1TNQA 1YVLA 2KNEA 4GBAA 2JNXA 1XVJA 4MBEA 2MBXA 1AHRA 4YGAA 1OMDA 1NX2A 1RFJA 3D10A 4XJKB 1HT9A 5F6TA 1KCYA 3CR4X 1QXPA 3WXAA 1R2UA 1JFKA 3VRNA 2CNPA 2BE4A 1MXEA 2BKHB 1AJ5A 4PE7A 3BUOB 1XFYO 2K8MB 3H4SE 1CNPA 4P5OE 2CCMA 1SY9A 4HRGA 1YX8A 3I5FB 1DJXA 1GQMA 1KFXL 1JF0A 2BBMA 4PHMA 1NCZA 1IJ5A 1UUSA 2AMIA 2CT9A 1CLMA 5K89A 3EK8A 1KWOC 3I5HC 4CFQA 3SG6A 1XK4C 3LLEA 2ZNEA 1BODA 1K9KA 1S36A 1SRAA 2NCOA 1QASA 2JOJA 2M7LA 2G2BA 2L5XB 1IQ5A 2SASA 2BCAA 1UHJA 4ORAB 4YGBB 2M9GA 1WDCB 4AQIA 4M2QA 1LA3A 4Q04A 5AEQA 1OSAA 2FCEA 4L9MA 1SL8A 3CS1A 2JZIA 1CMGA 1K94A 4I5JA 2ZFDA 4YI9A 2A4JA 1B47A 3D0YB 3VGOA 2NZ0A 2BE6A 1CDLA 1M31A 1YUTA 2AAOA 3ICBA 3IQOA 2K2FA 3OB2B 3HX4A 3RM1A 3BOWB 3PSRA 1XFWO 4DS7A 1B8RA 1EL4A 1OZOA 1OQPA 3SIAA 1FPWA 2ZN8A 2PRUA 1CFPA 1PVAA 1EG4A 1EH2A 1PVBA 1RK9A 4NQGA 1CFCA 3A4UB 5HLVA 1C7WA 1U5IB 4JPZB 5ER4X 2LC5A 1BMOA 2FOTA 1QVIY 3JTDC 1J7PA 1S1EA 2JU0A 2NLNA 4XYNA 4BY5A 4TNCA 5KU1A 3KEVA 1XFZO 2K61A 1IH0A 1M45A 1QLKA 1RECA 2KFFA 1SYMA 2ZRTA 3SG4A 3SG5A 3JVTC 1LKJA 1ODBA 4YBHB 2L4HA 2KHNA 4I5NB 4DIRA 1D1OA 1TRFA 2BCXA 1J7OA 3LK1A 2I7AA 2LLTA 2L2EA 2H2KA 1FBVA 1BG1A 2HF5A 1PRWA 4ICBA 1S6IA 3OB1B 1QJTA 1CFDA 2V53A 1YTZC 1OOJA 2LVJA 3NSLA 2KAXA 3CGAA 2MAZA 1A75A 2COLB 1KFXS 1X02A 1DJYA 2QPTA 3SJSA 3NSKA 2GGMA 2HQWA 3JTDB 1R6PA 3NXAA 1SL9A 3WHTB 4N5XA 3DVJA 3SG7A 5JOLA 3GK4X 4YGDB 1ZOTB 4MSPA 1NX1A 2LLUA 2M3WA 3LK0A 2P6BB 2KFHA 3JVTB 4MVFA 2WNDA 1M39A 4NDDA 1V1FA 1H4BA 1SBJA 4PE1A 1DTLA 1UHKA 2JNFA 2I2RE 1M46A 3VROA 1G33A 2KQYA 2L4IA 5IBWA 2F3YA 3TS5C 2KFGA 1TTXA 3EKJA 1CLBA 1B8LA 3GK1A 2EHBA 2M49B 2WORA 1Q80A 1H8BA 2QACA 4UPGA 2KAVA 1KQMC 2PASA 1AVSA 1WLZA 1QLSA 5HKWA 1N0YA 4JWQA 5I2QA 2O5GA 1MWNA 1UHNA 1NCXA 2F8PA 1AJ4A 4HRHA 1A2XA 2BKIB 4U8DA 1TIZA 1YURA 2G9BA 2IS9A 2LMTA 3SIBA 1JSAA 1K96A 1SK6D 4QJ5B 1SMGA 4NDBA 1GGWA 2KAYA 4MZKA 3OX6A 1QX7A 2JRFA 2MLEC 2KI6D 1NUBA 4ZCVA 4DCKA 4OVNF 1YRTB 2M29A 3IF7A 1DT7B 1MXLC 3TS5B 3KF9A 4C0KA 2GV5A 3LL8B 2FJUB 1CTRA 1NX3A 5D7FA 1GGZA 1BJFA 1TCFA 1Y6WA 3EK7A 1DF0A 3AKAA 5I2LA 1S6JA 5PALA 4AQJA 1WY9A 1KQMB 2K7CA 1SW8A 1PK0D 2I18A 2ZRSA 4OV2A 3TUYC 1OMVA 1F70A 1TCOB 2I94A 1CDMA 4GPLB 2NCPA 2F2PA 3CR2A 3DF0A 4JQ0D 4YGCB 2K2AA 3O2PA 4XJKA 2KYCA 2WOSA 2HETA 2BCBA 2LP3A 4BY4A 2PSRA 1LINA 3PN7C 1QIWA 4GGFC 2EC6C 2WC8A 1NX0A 3IQQA 1YUSA 2LVIA 5KSZA 5KTYA 3SG2A 3AKBA 1EJ3A 4D1EA 1RROA 1ZMZA 3F45A 1KK7Y 2BL0C 1KWOB 3I5HB 1XFXO 2KSPA 2PVBA 2JPTA 3KPXA 1ALWA 3OP0A 1QX2A 1QS7A 2JWWA 1EG3A 4WQ2A 1FI6A 3I5GC 1J1EA 2K7BA 4MLWA 1A03A 1J55A 4WQ3A 4QJ4B 1Y1AA 1FW4A 1OE9B 1SL7A 1IQ3A 4MRXA 4N1FA 4PE4A 3BUNB 1B4CA 1PSBA 1CMFA 1PALA 1CB1A 2ZNDA 3TUYB 4FQOA 2LMVA 2L50A 3WNXB 2ZN9A 4A4BA 1YX7A 2JTTA 2KQ6A 2LMUA 1EXRA 1KSMA 1UHHA 5CPVA 2F3ZA 1B9AA 2LNKA 1OMRA 1MHOA 3PN7B 1L2OC 1QATA 1KSOA 2MJWB 3D0YA 4F0ZB 2F33A 2EC6B 2E6WA 4IL1A 4CFRA 1KK7Z 2M97A 1XFVO 4PCWA 1HQVA 3BUXB 3BOWA 3CR5X 1FI5A 1QIVA 5I2OA 1F4QA 2LAPA 2BL0B 1QVIZ 2JXLA 4CPVA 1J7RA 2JT3A 1C7VA 3FWBA 3GOFA 2K7OA 1DMOA 3I5GB 3FIAA 5D69A 4A4CA 1F71A 1JBAA 2KYFA 1W7IB 5AXIA 2KBIA 1XK4A 1MQ1A 4CLNA 1SNLA 3I5IC 3CZTX 3ZWHA 1U5IA 1NPQA 4HSZA 3GK2A 4PE0A 1BOCA 1FF1A 5ER5A 1SCVA 1NYAA 4ZCUA 1SPYA 1IKUA 3EKHA 1CM4A 2E30A 5FYXA 4AOMA 2JT0A 1VRKA 1WRZA 1JF2A 2JULA 1QTXA 3EK4A 3EVRA 4PHJA 2Y5IA 1J7QA 2LUXA 1TNPA 2F2OA 1AUIB 4CIDA 1L2OB 2BECA 1CFFA 1DGVA 2WCBA 5AFPA 3O78A 4MEWA 5J3XA 5DKNA 1S3PA 2KBMA 2Q4UA 1DJZA 2LP2A 1SCMC 2L51A 5CSNA 2ZKMX 1F4OA 1ZACA 1NP8A 4QJ3B 2CTNA 1NIWA 1GJYA 2LM5A 2M7NA 3ZNIA 2B1UA 1TNXA 2LCPA 3KO0A 4I5KA 1A29A 1K93D 3PLFB 2TN4A 4GAOA 1C07A 1Y1UA 1DJWA 3HCMA 5AERA 1CDNA 5CSJA 1QV0A 1IG5A 1M63B 3FS7A 4HREE 1K2HA 3BUWB 1ALVA 1K95A 2FCDA 2MA2A 1CKKA 1S6CA 4USLA 2KGBC 1F8HA 1N65A 1MUXA 4PDZA 2OS8C 5JJGA 1YRUB 1Y0VH 1G8IA 1NCYA 1YUUA 3TDZA 1IWQA 5B8IB 2KI4C 2H61A 1WLMA 3BXKA 3DF0B 3TZ1A 2LHLA 4ORCB 2R2IA 3K21A 1SCMB 1S26D 4MN0A 1YR5A 4YGEB 3BQ3A 1MF8B 2CBLA 3E3RA 3NSOA 1IRJA 1CM1A 3CTNA 5HLOA 1JC2A 1J1DA 3AAJA 3DD4A 5GQQC 2M8UA 2HQ8A 2EGDA 3CLNA 4ORBB 1UURA 1KFUS 2JQ6A 1ZUZA 4MZJA 1XYDA 3LCPC 2KDHA 3MSEB 2LHIA 2MRDA 2LVVA 2OTGC 1BT6A 2M1KB 3DVKA 1ZFSA 2O60A 2SCPA 1BF5A 1A4PA 1YVHA 3C1VA 5DKRA 5CSFA 3VRPA 1PULA 2OS8B 1DJIA 2D8NA 1K9UA 1BLQA 1UP5A 3VRRA 3OHMB 2PMYA 2JC2A 2KI4B 2VRGA 1G4YR 1XFUO 4YRUA 1BU3A 1JUOA 1K8UA 3O6BA 2L0PA 3BUMB 1JFJA 1K9PA 1L7ZA 4I5LB 1CLLA 2Y1NA 1QX5B 1SKTA 1W7JB 3KHEA 1NWDA 1B7TY 3A8RA 2Q91A 1A75B 1E8AA 1WRLA 5CSIA 2WCEA 1F54A 1XO5A 1TOPA 5HKYA 1IJ6A 4WRIA 3EVUA 3TDIA 2OTGB 2L98A 2LE9B 2RGIA 1AP4A 3PALA 1BR1B 1OZSA 1CDPA 1KQVA 3VRQA 1LA0A 1RWYA 3CWGA 3TDUA 4M2OA 1RJVA 1NSHA 1JWDA 2ISDA 1PSRA 1KFUL 4R1EA 4MZLA 4NDCA 3SG3A 1SR6C 3RLZA 4E68A 1S5GY 2CXJA 1QV1A 2AUCA 5I8NA 2OPOA 4C0LA 4GUKA 1RTP1 4PHNA 1KK8C 2KOTA 1B7TZ 5HYDA 1UHIA 1WRKA 2H61C 2Y1MA 4PALA 1B1GA 5DKQA 1MR8A 3NSIA 1V1GA 2DOQA 1BR4B 3DVEA 1AK8A 1Y1XA
chains in the Genus database with same CATH superfamily
2PYQA 4OR9B 3PM8A 1DVIA 4FTGA 4OCIA 4GNKB 5HKZA 2PALA 4GGNA 5BPJA 5TNCA 3WHUB 2K0JA 2MHHA 2GGZA 5DICA 2LVKA 2LLSA 3FWCA 1N2DA 4PHKA 1S5GZ 4GGFA 2QEHA 3DVMA 4GFTA 2BBNA 1UWOA 1SR6B 3OX5A 3R1PA 2LV7A 4P2YB 5FI6A 5AANA 3QRXA 1DGUA 5G08A 4DUQA 4C0JA 2HPSA 2KGRA 3I5FC 2WCFA 4M2PA 4N1GA 1TNWA 3O4YA 1KK8B 3I5IB 2K7DA 2JXCA 3OGNA 3DXLA 2JTZA 1B8CA 1K90D 3FE9A 3AAKA 2JT8A 4YI8A 1LVCD 4ETOA 1F55A 4DRWA 1JSAA 4OKHA 2Y4QA 4MRYA 2MLFC 1DF0B 2LANA 1LXFC 1DJHA 3BYAA 3M0WA 2KPHA 3PATA 2LUCA 2M0RA 3PFVA 1DJGA 1TN4A 4JD9A 4OZDA 1XA5A 3QMEA 2BAPA 2M1UA 1WDCC 2KI6C 2NXQA 3EVVA 1IGVA 1TNQA 1YVLA 2KNEA 4GBAA 2JNXA 1XVJA 4MBEA 2MBXA 1AHRA 4YGAA 1OMDA 1NX2A 1RFJA 5FI2A 3D10A 4XJKB 1HT9A 5F6TA 1KCYA 3CR4X 1QXPA 1T14A 3R1VA 3WXAA 1R2UA 1JFKA 3VRNA 2CNPA 2BE4A 3V2LA 1MXEA 2BKHB 1AJ5A 4PE7A 3BUOB 1XFYO 2K8MB 1W9ZA 1OOFA 1DELA 2CCMA 1SY9A 3H4SE 1YX8A 3I5FB 1DJXA 1GQMA 4HRGA 4P5OE 1KFXL 1JF0A 1C3YA 2BBMA 3L47A 1NCZA 2H8VA 4PHMA 1IJ5A 1UUSA 2AMIA 2CT9A 1CLMA 2L2CA 5K89A 3EK8A 1KWOC 3I5HC 3BFHA 3Q8IA 4CFQA 3SG6A 1XK4C 3LLEA 2ZNEA 1BODA 1K9KA 1S36A 1SRAA 2NCOA 1QASA 2JOJA 2M7LA 2G2BA 2L5XB 1IQ5A 2SASA 3B87A 2BCAA 1UHJA 4ORAB 4YGBB 2M9GA 1WDCB 4AQIA 4M2QA 1LA3A 4Q04A 5AEQA 1OSAA 2FCEA 4L9MA 1SL8A 3CS1A 2JZIA 1CMGA 1K94A 4I5JA 2ZFDA 4YI9A 2A4JA 1B47A 2JPOA 3D0YB 3NGVA 3VGOA 2NZ0A 2BE6A 1CDLA 1M31A 1YUTA 2AAOA 3ICBA 3IQOA 2K2FA 3OB2B 3UNWA 3HX4A 3RM1A 3BOWB 3PSRA 1XFWO 4DS7A 1B8RA 3CABA 1EL4A 1OZOA 1OQPA 3SIAA 1FPWA 3R72A 2ZN8A 2PRUA 1QWVA 1CFPA 1PVAA 1EG4A 1EH2A 1PVBA 1RK9A 4NQGA 3SS5A 1CFCA 1TWOA 3A4UB 5HLVA 1C7WA 1OW4A 3OBVA 1U5IB 4JPZB 5ER4X 2LC5A 1BMOA 2FOTA 1QVIY 3JTDC 1J7PA 1S1EA 2JU0A 2NLNA 4XYNA 4BY5A 4TNCA 5KU1A 3KEVA 1XFZO 2K61A 1IH0A 1M45A 1QLKA 1RECA 3NHIA 2KFFA 1SYMA 2ZRTA 3S0DA 3SG4A 3SG5A 3JVTC 3S0EA 2QEVA 1LKJA 1ODBA 4YBHB 2L4HA 2KHNA 4I5NB 4DIRA 1OOIX 1D1OA 1TUJA 1TRFA 2BCXA 1J7OA 3LK1A 1OOHA 2I7AA 2LLTA 2L2EA 1DC1A 2H2KA 1FBVA 1BG1A 2HF5A 1PRWA 4ICBA 1S6IA 3OB1B 2BNXA 1QJTA 1CFDA 2V53A 5I94A 1YTZC 1OOJA 2LVJA 3NSLA 2KAXA 3CGAA 3CZ0A 2MAZA 1A75A 2COLB 1KFXS 1X02A 1DJYA 2QPTA 3SJSA 3NSKA 2GGMA 2HQWA 3JTDB 3B88A 1R6PA 3NXAA 1SL9A 3WHTB 4N5XA 3DVJA 3SG7A 5JOLA 3UO9A 3GK4X 4YGDB 1ZOTB 4MSPA 1NX1A 2LLUA 2M3WA 1CNPA 3LK0A 2P6BB 1P28A 2KFHA 3JVTB 4MVFA 2WNDA 1M39A 3BFAA 3L4LA 4NDDA 1V1FA 1H4BA 1SBJA 4PE1A 1DTLA 5FI7A 3NHTA 1Z4HA 1UHKA 2ERBA 2JNFA 2I2RE 1M46A 3VROA 1G33A 2KQYA 2L4IA 5IBWA 2F3YA 3TS5C 2KFGA 3D74A 1TTXA 3EKJA 1CLBA 1B8LA 3GK1A 2EHBA 2WCJA 2M49B 2WORA 1Q80A 1H8BA 2QACA 4UPGA 2KAVA 1KQMC 2PASA 1XFRA 1AVSA 3D73A 1WLZA 1QLSA 5HKWA 1N0YA 4JWQA 5I2QA 2O5GA 1MWNA 1UHNA 3B6XA 1NCXA 3CYZA 2F8PA 1AJ4A 4HRHA 1A2XA 2BKIB 2QEBA 1TIZA 1YURA 2G9BA 2IS9A 2LMTA 4U8DA 3SIBA 1K96A 1SK6D 4IJ7A 4JKTA 2P71A 4QJ5B 1SMGA 3CZ1A 4NDBA 2KAYA 1GGWA 4MZKA 3OX6A 1QX7A 2JRFA 2MLEC 2KI6D 3RZSA 1NUBA 3CZ2A 4ZCVA 4DCKA 4OVNF 1YRTB 3IVTA 2M29A 3IF7A 1DT7B 1MXLC 3TS5B 3KF9A 4C0KA 2GV5A 3LL8B 3S0FA 1DEKA 1TUZA 2FJUB 1CTRA 1NX3A 3O4XA 5D7FA 1GGZA 1BJFA 3BFBA 1TCFA 1Y6WA 3EK7A 1DF0A 3AKAA 5I2LA 1S6JA 5PALA 4AQJA 1WY9A 1KQMB 2K7CA 1SW8A 5EL2A 1PK0D 2I18A 2ZRSA 4OV2A 3TUYC 1OOGA 1OMVA 1F70A 1TCOB 2I94A 3PJIA 3PM2A 1CDMA 3DY9A 2NCPA 2F2PA 3CR2A 3DF0A 4GPLB 4JQ0D 2K2AA 3O2PA 4XJKA 4YGCB 2KYCA 2WOSA 2HETA 2BCBA 2LP3A 4BY4A 2PSRA 1LINA 3PN7C 1QIWA 4GGFC 2EC6C 2WC8A 1NX0A 3IQQA 2WCLA 1YUSA 5HL1A 2LVIA 5KSZA 5KTYA 3SG2A 3AKBA 1EJ3A 3N7HA 4D1EA 1RROA 1ZMZA 3F45A 1KK7Y 2BL0C 1KWOB 3I5HB 1XFXO 2KSPA 2PVBA 2JPTA 3DZTA 1ALWA 3KPXA 1QX2A 1QS7A 2JWWA 1EG3A 3OP0A 4WQ2A 3I5GC 1FI6A 1J1EA 2K7BA 4MLWA 3S0GA 1A03A 1J55A 4WQ3A 4QJ4B 1Y1AA 1FW4A 2YGUA 3BJHA 1OE9B 1SL7A 4FQTA 4MRXA 1DQEA 4N1FA 4PE4A 3BUNB 1IQ3A 1PSBA 1B4CA 1CMFA 1PALA 1CB1A 2ZNDA 3TUYB 4FQOA 2LMVA 2L50A 3WNXB 2ZN9A 4A4BA 1YX7A 2GTEA 2JTTA 2KQ6A 2LMUA 1EXRA 3VB1A 1KSMA 1UHHA 5CPVA 2F3ZA 1B9AA 2LNKA 2P70A 3D76A 2KLEA 1OMRA 1MHOA 3PN7B 1L2OC 1QATA 1KSOA 2MJWB 3D0YA 4F0ZB 2F33A 2EC6B 2E6WA 4IL1A 4CFRA 1KK7Z 2M97A 1XFVO 4PCWA 1HQVA 3BUXB 3BOWA 3CR5X 1FI5A 1QIVA 2WCKA 5I2OA 1F4QA 2LAPA 3DYEA 2BL0B 1QVIZ 2JXLA 4CPVA 1J7RA 2JT3A 4INXA 1C7VA 3FWBA 3GOFA 2K7OA 1DMOA 3I5GB 3FIAA 5D69A 4A4CA 1F71A 1JBAA 2KYFA 1W7IB 5AXIA 2KBIA 1XK4A 1MQ1A 4CLNA 1LS8A 1SNLA 3I5IC 3CZTX 3ZWHA 1U5IA 1NPQA 4HSZA 3GK2A 4PE0A 1BOCA 1FF1A 5ER5A 1SCVA 1ORGA 1NYAA 4ZCUA 1SPYA 1IKUA 3EKHA 1CM4A 2E30A 5FYXA 4AOMA 1Z2CB 2JT0A 1VRKA 1WRZA 4KYNA 1JF2A 2JULA 1QTXA 3EK4A 3EVRA 4PHJA 2Y5IA 1J7QA 4F7FA 2LUXA 2WC6A 1TNPA 2F2OA 1AUIB 4CIDA 1L2OB 2BECA 1CFFA 1DGVA 2WCBA 3EG5B 3O78A 4MEWA 5J3XA 5AFPA 5DKNA 1IIOA 1S3PA 2KBMA 2Q4UA 1DJZA 2LP2A 2L5YA 1SCMC 2L51A 5CSNA 2ZKMX 1F4OA 1ZACA 1NP8A 4QJ3B 2CTNA 1NIWA 1GJYA 2LM5A 2M7NA 3ZNIA 2B1UA 2WCHA 1TNXA 2LCPA 3KO0A 3FE8A 1A29A 1K93D 4I5KA 3CDNA 3PLFB 2TN4A 4GAOA 1C07A 3R1OA 1Y1UA 1DJWA 3D78A 3HCMA 5AERA 1CDNA 5CSJA 1QV0A 1IG5A 1M63B 3FS7A 4HREE 1K2HA 3BUWB 2FJYA 1ALVA 1K95A 2FCDA 2MA2A 2QEOA 1CKKA 1S6CA 4USLA 2KGBC 1F8HA 1N65A 1MUXA 4PDZA 2OS8C 5JJGA 1YRUB 1Y0VH 1G8IA 1GM0A 1NCYA 1YUUA 3B86A 3TDZA 1IWQA 5B8IB 2KI4C 2H61A 1WLMA 3BXKA 3DF0B 3TZ1A 2LHLA 4ORCB 2R2IA 3K21A 1SCMB 1S26D 4MN0A 1YR5A 4YGEB 3BQ3A 1MF8B 2CBLA 3E3RA 3NSOA 1IRJA 1CM1A 3CTNA 3D75A 5HLOA 1JC2A 1J1DA 3AAJA 3DD4A 5GQQC 2M8UA 2HQ8A 2EGDA 3CLNA 4ORBB 1UURA 1KFUS 3S0AA 2JQ6A 1ZUZA 4MZJA 1XYDA 3LCPC 2KDHA 3S0BA 3MSEB 2KLDA 2LHIA 2MRDA 2LVVA 2OTGC 3K1EA 1BT6A 2M1KB 3DVKA 1ZFSA 2O60A 2SCPA 1BF5A 1A4PA 1YVHA 3C1VA 5DKRA 5CSFA 3VRPA 1PULA 2WCMA 2OS8B 1SSEB 1DJIA 3L4AA 2D8NA 1K9UA 1BLQA 1UP5A 3B7AA 3VRRA 3OHMB 2PMYA 2JC2A 2KI4B 2VRGA 1G4YR 2QDIA 1XFUO 4YRUA 1BU3A 1JUOA 1K8UA 3O6BA 4INWA 2L0PA 3BUMB 1JFJA 1K9PA 1L7ZA 4I5LB 1CLLA 2Y1NA 1QX5B 1SKTA 1W7JB 3KHEA 1NWDA 1B7TY 5D3OA 3A8RA 4PT1A 2Q91A 1A75B 1E8AA 1WRLA 5CSIA 2WCEA 1F54A 2PQLA 1XO5A 3SS4A 1TOPA 5HKYA 1IJ6A 4WRIA 3EVUA 3TDIA 2OTGB 2L98A 2LE9B 2RGIA 3D77A 1AP4A 3PALA 1BR1B 1OZSA 3FE6A 1CDPA 1KQVA 3VRQA 3SS3A 1LA0A 1RWYA 3CWGA 3TDUA 2WC5A 1RJVA 1NSHA 4M2OA 2ISDA 1JWDA 1PSRA 1KFUL 4R1EA 4MZLA 4NDCA 3SG3A 1SR6C 3RLZA 4E68A 1S5GY 2CXJA 1QV1A 2AUCA 5I8NA 2OPOA 4C0LA 4GUKA 1RTP1 4PHNA 1KK8C 2KOTA 1B7TZ 5HYDA 1UHIA 1WRKA 2H61C 1C3ZA 2Y1MA 4PALA 1B1GA 5DKQA 1MR8A 3NSIA 1V1GA 2DOQA 1BR4B 3DVEA 1AK8A 2K60A 1Y1XA
chains in the Genus database with same CATH topology
4OR9B 3PM8A 1DVIA 4FTGA 4OCIA 4GNKB 5HKZA 2PALA 4GGNA 5BPJA 5TNCA 3WHUB 2K0JA 2MHHA 2GGZA 2LVKA 2LLSA 3FWCA 1N2DA 4PHKA 1S5GZ 4GGFA 3DVMA 4GFTA 2BBNA 1UWOA 1SR6B 3OX5A 5AANA 2LV7A 4P2YB 3QRXA 1DGUA 5G08A 4DUQA 4C0JA 2HPSA 2KGRA 3I5FC 2WCFA 4M2PA 4N1GA 1TNWA 3O4YA 1KK8B 3I5IB 2K7DA 2JXCA 2JTZA 1B8CA 1K90D 3AAKA 2JT8A 4YI8A 1LVCD 4ETOA 1F55A 4DRWA 4OKHA 2Y4QA 4MRYA 2MLFC 1DF0B 2LANA 1LXFC 1DJHA 3BYAA 3M0WA 3PATA 3PFVA 2LUCA 2M0RA 1DJGA 1TN4A 1XA5A 2M1UA 3EVVA 1WDCC 2KI6C 2NXQA 1IGVA 1TNQA 1YVLA 2KNEA 4GBAA 2JNXA 1XVJA 4MBEA 2MBXA 1AHRA 4YGAA 1OMDA 1NX2A 1RFJA 3D10A 4XJKB 1HT9A 5F6TA 1KCYA 3CR4X 1QXPA 3WXAA 1R2UA 1JFKA 3VRNA 2CNPA 2BE4A 1MXEA 2BKHB 1AJ5A 4PE7A 3BUOB 1XFYO 2K8MB 3H4SE 1CNPA 4P5OE 2CCMA 1SY9A 4HRGA 1YX8A 3I5FB 1DJXA 1GQMA 1KFXL 1JF0A 2BBMA 4PHMA 1NCZA 1IJ5A 1UUSA 2AMIA 2CT9A 1CLMA 5K89A 3EK8A 1KWOC 3I5HC 4CFQA 3SG6A 1XK4C 3LLEA 2ZNEA 1BODA 1K9KA 1S36A 1SRAA 2NCOA 1QASA 2JOJA 2M7LA 2G2BA 2L5XB 1IQ5A 2SASA 2BCAA 1UHJA 4ORAB 4YGBB 2M9GA 1WDCB 4AQIA 4M2QA 1LA3A 4Q04A 5AEQA 1OSAA 2FCEA 4L9MA 1SL8A 3CS1A 2JZIA 1CMGA 1K94A 4I5JA 2ZFDA 4YI9A 2A4JA 1B47A 3D0YB 3VGOA 2NZ0A 2BE6A 1CDLA 1M31A 1YUTA 2AAOA 3ICBA 3IQOA 2K2FA 3OB2B 3HX4A 3RM1A 3BOWB 3PSRA 1XFWO 4DS7A 1B8RA 1EL4A 1OZOA 1OQPA 3SIAA 1FPWA 2ZN8A 2PRUA 1CFPA 1PVAA 1EG4A 1EH2A 1PVBA 1RK9A 4NQGA 1CFCA 3A4UB 5HLVA 1C7WA 1U5IB 4JPZB 5ER4X 2LC5A 1BMOA 2FOTA 1QVIY 3JTDC 1J7PA 1S1EA 2JU0A 2NLNA 4XYNA 4BY5A 4TNCA 5KU1A 3KEVA 1XFZO 2K61A 1IH0A 1M45A 1QLKA 1RECA 2KFFA 1SYMA 2ZRTA 3SG4A 3SG5A 3JVTC 1LKJA 1ODBA 4YBHB 2L4HA 2KHNA 4I5NB 4DIRA 1D1OA 1TRFA 2BCXA 1J7OA 3LK1A 2I7AA 2LLTA 2L2EA 2H2KA 1FBVA 1BG1A 2HF5A 1PRWA 4ICBA 1S6IA 3OB1B 1QJTA 1CFDA 2V53A 1YTZC 1OOJA 2LVJA 3NSLA 2KAXA 3CGAA 2MAZA 1A75A 2COLB 1KFXS 1X02A 1DJYA 2QPTA 3SJSA 3NSKA 2GGMA 2HQWA 3JTDB 1R6PA 3NXAA 1SL9A 3WHTB 4N5XA 3DVJA 3SG7A 5JOLA 3GK4X 4YGDB 1ZOTB 4MSPA 1NX1A 2LLUA 2M3WA 3LK0A 2P6BB 2KFHA 3JVTB 4MVFA 2WNDA 1M39A 4NDDA 1V1FA 1H4BA 1SBJA 4PE1A 1DTLA 1UHKA 2JNFA 2I2RE 1M46A 3VROA 1G33A 2KQYA 2L4IA 5IBWA 2F3YA 3TS5C 2KFGA 1TTXA 3EKJA 1CLBA 1B8LA 3GK1A 2EHBA 2M49B 2WORA 1Q80A 1H8BA 2QACA 4UPGA 2KAVA 1KQMC 2PASA 1AVSA 1WLZA 1QLSA 5HKWA 1N0YA 4JWQA 5I2QA 2O5GA 1MWNA 1UHNA 1NCXA 2F8PA 1AJ4A 4HRHA 1A2XA 2BKIB 4U8DA 1TIZA 1YURA 2G9BA 2IS9A 2LMTA 3SIBA 1JSAA 1K96A 1SK6D 4QJ5B 1SMGA 4NDBA 1GGWA 2KAYA 4MZKA 3OX6A 1QX7A 2JRFA 2MLEC 2KI6D 1NUBA 4ZCVA 4DCKA 4OVNF 1YRTB 2M29A 3IF7A 1DT7B 1MXLC 3TS5B 3KF9A 4C0KA 2GV5A 3LL8B 2FJUB 1CTRA 1NX3A 5D7FA 1GGZA 1BJFA 1TCFA 1Y6WA 3EK7A 1DF0A 3AKAA 5I2LA 1S6JA 5PALA 4AQJA 1WY9A 1KQMB 2K7CA 1SW8A 1PK0D 2I18A 2ZRSA 4OV2A 3TUYC 1OMVA 1F70A 1TCOB 2I94A 1CDMA 4GPLB 2NCPA 2F2PA 3CR2A 3DF0A 4JQ0D 4YGCB 2K2AA 3O2PA 4XJKA 2KYCA 2WOSA 2HETA 2BCBA 2LP3A 4BY4A 2PSRA 1LINA 3PN7C 1QIWA 4GGFC 2EC6C 2WC8A 1NX0A 3IQQA 1YUSA 2LVIA 5KSZA 5KTYA 3SG2A 3AKBA 1EJ3A 4D1EA 1RROA 1ZMZA 3F45A 1KK7Y 2BL0C 1KWOB 3I5HB 1XFXO 2KSPA 2PVBA 2JPTA 3KPXA 1ALWA 3OP0A 1QX2A 1QS7A 2JWWA 1EG3A 4WQ2A 1FI6A 3I5GC 1J1EA 2K7BA 4MLWA 1A03A 1J55A 4WQ3A 4QJ4B 1Y1AA 1FW4A 1OE9B 1SL7A 1IQ3A 4MRXA 4N1FA 4PE4A 3BUNB 1B4CA 1PSBA 1CMFA 1PALA 1CB1A 2ZNDA 3TUYB 4FQOA 2LMVA 2L50A 3WNXB 2ZN9A 4A4BA 1YX7A 2JTTA 2KQ6A 2LMUA 1EXRA 1KSMA 1UHHA 5CPVA 2F3ZA 1B9AA 2LNKA 1OMRA 1MHOA 3PN7B 1L2OC 1QATA 1KSOA 2MJWB 3D0YA 4F0ZB 2F33A 2EC6B 2E6WA 4IL1A 4CFRA 1KK7Z 2M97A 1XFVO 4PCWA 1HQVA 3BUXB 3BOWA 3CR5X 1FI5A 1QIVA 5I2OA 1F4QA 2LAPA 2BL0B 1QVIZ 2JXLA 4CPVA 1J7RA 2JT3A 1C7VA 3FWBA 3GOFA 2K7OA 1DMOA 3I5GB 3FIAA 5D69A 4A4CA 1F71A 1JBAA 2KYFA 1W7IB 5AXIA 2KBIA 1XK4A 1MQ1A 4CLNA 1SNLA 3I5IC 3CZTX 3ZWHA 1U5IA 1NPQA 4HSZA 3GK2A 4PE0A 1BOCA 1FF1A 5ER5A 1SCVA 1NYAA 4ZCUA 1SPYA 1IKUA 3EKHA 1CM4A 2E30A 5FYXA 4AOMA 2JT0A 1VRKA 1WRZA 1JF2A 2JULA 1QTXA 3EK4A 3EVRA 4PHJA 2Y5IA 1J7QA 2LUXA 1TNPA 2F2OA 1AUIB 4CIDA 1L2OB 2BECA 1CFFA 1DGVA 2WCBA 5AFPA 3O78A 4MEWA 5J3XA 5DKNA 1S3PA 2KBMA 2Q4UA 1DJZA 2LP2A 1SCMC 2L51A 5CSNA 2ZKMX 1F4OA 1ZACA 1NP8A 4QJ3B 2CTNA 1NIWA 1GJYA 2LM5A 2M7NA 3ZNIA 2B1UA 1TNXA 2LCPA 3KO0A 4I5KA 1A29A 1K93D 3PLFB 2TN4A 4GAOA 1C07A 1Y1UA 1DJWA 3HCMA 5AERA 1CDNA 5CSJA 1QV0A 1IG5A 1M63B 3FS7A 4HREE 1K2HA 3BUWB 1ALVA 1K95A 2FCDA 2MA2A 1CKKA 1S6CA 4USLA 2KGBC 1F8HA 1N65A 1MUXA 4PDZA 2OS8C 5JJGA 1YRUB 1Y0VH 1G8IA 1NCYA 1YUUA 3TDZA 1IWQA 5B8IB 2KI4C 2H61A 1WLMA 3BXKA 3DF0B 3TZ1A 2LHLA 4ORCB 2R2IA 3K21A 1SCMB 1S26D 4MN0A 1YR5A 4YGEB 3BQ3A 1MF8B 2CBLA 3E3RA 3NSOA 1IRJA 1CM1A 3CTNA 5HLOA 1JC2A 1J1DA 3AAJA 3DD4A 5GQQC 2M8UA 2HQ8A 2EGDA 3CLNA 4ORBB 1UURA 1KFUS 2JQ6A 1ZUZA 4MZJA 1XYDA 3LCPC 2KDHA 3MSEB 2LHIA 2MRDA 2LVVA 2OTGC 1BT6A 2M1KB 3DVKA 1ZFSA 2O60A 2SCPA 1BF5A 1A4PA 1YVHA 3C1VA 5DKRA 5CSFA 3VRPA 1PULA 2OS8B 1DJIA 2D8NA 1K9UA 1BLQA 1UP5A 3VRRA 3OHMB 2PMYA 2JC2A 2KI4B 2VRGA 1G4YR 1XFUO 4YRUA 1BU3A 1JUOA 1K8UA 3O6BA 2L0PA 3BUMB 1JFJA 1K9PA 1L7ZA 4I5LB 1CLLA 2Y1NA 1QX5B 1SKTA 1W7JB 3KHEA 1NWDA 1B7TY 3A8RA 2Q91A 1A75B 1E8AA 1WRLA 5CSIA 2WCEA 1F54A 1XO5A 1TOPA 5HKYA 1IJ6A 4WRIA 3EVUA 3TDIA 2OTGB 2L98A 2LE9B 2RGIA 1AP4A 3PALA 1BR1B 1OZSA 1CDPA 1KQVA 3VRQA 1LA0A 1RWYA 3CWGA 3TDUA 4M2OA 1RJVA 1NSHA 1JWDA 2ISDA 1PSRA 1KFUL 4R1EA 4MZLA 4NDCA 3SG3A 1SR6C 3RLZA 4E68A 1S5GY 2CXJA 1QV1A 2AUCA 5I8NA 2OPOA 4C0LA 4GUKA 1RTP1 4PHNA 1KK8C 2KOTA 1B7TZ 5HYDA 1UHIA 1WRKA 2H61C 2Y1MA 4PALA 1B1GA 5DKQA 1MR8A 3NSIA 1V1GA 2DOQA 1BR4B 3DVEA 1AK8A 1Y1XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OR9 B;  3PM8 A;  1DVI A;  4FTG A;  4OCI A;  4GNK B;  5HKZ A;  2PAL A;  4GGN A;  5BPJ A;  5TNC A;  3WHU B;  2K0J A;  2MHH A;  2GGZ A;  2LVK A;  2LLS A;  3FWC A;  1N2D A;  4PHK A;  1S5G Z;  4GGF A;  3DVM A;  4GFT A;  2BBN A;  1UWO A;  1SR6 B;  3OX5 A;  5AAN A;  2LV7 A;  4P2Y B;  3QRX A;  1DGU A;  5G08 A;  4DUQ A;  4C0J A;  2HPS A;  2KGR A;  3I5F C;  2WCF A;  4M2P A;  4N1G A;  1TNW A;  3O4Y A;  1KK8 B;  3I5I B;  2K7D A;  2JXC A;  2JTZ A;  1B8C A;  1K90 D;  3AAK A;  2JT8 A;  4YI8 A;  1LVC D;  4ETO A;  1F55 A;  4DRW A;  4OKH A;  2Y4Q A;  4MRY A;  2MLF C;  1DF0 B;  2LAN A;  1LXF C;  1DJH A;  3BYA A;  3M0W A;  3PAT A;  3PFV A;  2LUC A;  2M0R A;  1DJG A;  1TN4 A;  1XA5 A;  2M1U A;  3EVV A;  1WDC C;  2KI6 C;  2NXQ A;  1IGV A;  1TNQ A;  1YVL A;  2KNE A;  4GBA A;  2JNX A;  1XVJ A;  4MBE A;  2MBX A;  1AHR A;  4YGA A;  1OMD A;  1NX2 A;  1RFJ A;  3D10 A;  4XJK B;  1HT9 A;  5F6T A;  1KCY A;  3CR4 X;  1QXP A;  3WXA A;  1R2U A;  1JFK A;  3VRN A;  2CNP A;  2BE4 A;  1MXE A;  2BKH B;  1AJ5 A;  4PE7 A;  3BUO B;  1XFY O;  2K8M B;  3H4S E;  1CNP A;  4P5O E;  2CCM A;  1SY9 A;  4HRG A;  1YX8 A;  3I5F B;  1DJX A;  1GQM A;  1KFX L;  1JF0 A;  2BBM A;  4PHM A;  1NCZ A;  1IJ5 A;  1UUS A;  2AMI A;  2CT9 A;  1CLM A;  5K89 A;  3EK8 A;  1KWO C;  3I5H C;  4CFQ A;  3SG6 A;  1XK4 C;  3LLE A;  2ZNE A;  1BOD A;  1K9K A;  1S36 A;  1SRA A;  2NCO A;  1QAS A;  2JOJ A;  2M7L A;  2G2B A;  2L5X B;  1IQ5 A;  2SAS A;  2BCA A;  1UHJ A;  4ORA B;  4YGB B;  2M9G A;  1WDC B;  4AQI A;  4M2Q A;  1LA3 A;  4Q04 A;  5AEQ A;  1OSA A;  2FCE A;  4L9M A;  1SL8 A;  3CS1 A;  2JZI A;  1CMG A;  1K94 A;  4I5J A;  2ZFD A;  4YI9 A;  2A4J A;  1B47 A;  3D0Y B;  3VGO A;  2NZ0 A;  2BE6 A;  1CDL A;  1M31 A;  1YUT A;  2AAO A;  3ICB A;  3IQO A;  2K2F A;  3OB2 B;  3HX4 A;  3RM1 A;  3BOW B;  3PSR A;  1XFW O;  4DS7 A;  1B8R A;  1EL4 A;  1OZO A;  1OQP A;  3SIA A;  1FPW A;  2ZN8 A;  2PRU A;  1CFP A;  1PVA A;  1EG4 A;  1EH2 A;  1PVB A;  1RK9 A;  4NQG A;  1CFC A;  3A4U B;  5HLV A;  1C7W A;  1U5I B;  4JPZ B;  5ER4 X;  2LC5 A;  1BMO A;  2FOT A;  1QVI Y;  3JTD C;  1J7P A;  1S1E A;  2JU0 A;  2NLN A;  4XYN A;  4BY5 A;  4TNC A;  5KU1 A;  3KEV A;  1XFZ O;  2K61 A;  1IH0 A;  1M45 A;  1QLK A;  1REC A;  2KFF A;  1SYM A;  2ZRT A;  3SG4 A;  3SG5 A;  3JVT C;  1LKJ A;  1ODB A;  4YBH B;  2L4H A;  2KHN A;  4I5N B;  4DIR A;  1D1O A;  1TRF A;  2BCX A;  1J7O A;  3LK1 A;  2I7A A;  2LLT A;  2L2E A;  2H2K A;  1FBV A;  1BG1 A;  2HF5 A;  1PRW A;  4ICB A;  1S6I A;  3OB1 B;  1QJT A;  1CFD A;  2V53 A;  1YTZ C;  1OOJ A;  2LVJ A;  3NSL A;  2KAX A;  3CGA A;  2MAZ A;  1A75 A;  2COL B;  1KFX S;  1X02 A;  1DJY A;  2QPT A;  3SJS A;  3NSK A;  2GGM A;  2HQW A;  3JTD B;  1R6P A;  3NXA A;  1SL9 A;  3WHT B;  4N5X A;  3DVJ A;  3SG7 A;  5JOL A;  3GK4 X;  4YGD B;  1ZOT B;  4MSP A;  1NX1 A;  2LLU A;  2M3W A;  3LK0 A;  2P6B B;  2KFH A;  3JVT B;  4MVF A;  2WND A;  1M39 A;  4NDD A;  1V1F A;  1H4B A;  1SBJ A;  4PE1 A;  1DTL A;  1UHK A;  2JNF A;  2I2R E;  1M46 A;  3VRO A;  1G33 A;  2KQY A;  2L4I A;  5IBW A;  2F3Y A;  3TS5 C;  2KFG A;  1TTX A;  3EKJ A;  1CLB A;  1B8L A;  3GK1 A;  2EHB A;  2M49 B;  2WOR A;  1Q80 A;  1H8B A;  2QAC A;  4UPG A;  2KAV A;  1KQM C;  2PAS A;  1AVS A;  1WLZ A;  1QLS A;  5HKW A;  1N0Y A;  4JWQ A;  5I2Q A;  2O5G A;  1MWN A;  1UHN A;  1NCX A;  2F8P A;  1AJ4 A;  4HRH A;  1A2X A;  2BKI B;  4U8D A;  1TIZ A;  1YUR A;  2G9B A;  2IS9 A;  2LMT A;  3SIB A;  1JSA A;  1K96 A;  1SK6 D;  4QJ5 B;  1SMG A;  4NDB A;  1GGW A;  2KAY A;  4MZK A;  3OX6 A;  1QX7 A;  2JRF A;  2MLE C;  2KI6 D;  1NUB A;  4ZCV A;  4DCK A;  4OVN F;  1YRT B;  2M29 A;  3IF7 A;  1DT7 B;  1MXL C;  3TS5 B;  3KF9 A;  4C0K A;  2GV5 A;  3LL8 B;  2FJU B;  1CTR A;  1NX3 A;  5D7F A;  1GGZ A;  1BJF A;  1TCF A;  1Y6W A;  3EK7 A;  1DF0 A;  3AKA A;  5I2L A;  1S6J A;  5PAL A;  4AQJ A;  1WY9 A;  1KQM B;  2K7C A;  1SW8 A;  1PK0 D;  2I18 A;  2ZRS A;  4OV2 A;  3TUY C;  1OMV A;  1F70 A;  1TCO B;  2I94 A;  1CDM A;  4GPL B;  2NCP A;  2F2P A;  3CR2 A;  3DF0 A;  4JQ0 D;  4YGC B;  2K2A A;  3O2P A;  4XJK A;  2KYC A;  2WOS A;  2HET A;  2BCB A;  2LP3 A;  4BY4 A;  2PSR A;  1LIN A;  3PN7 C;  1QIW A;  4GGF C;  2EC6 C;  2WC8 A;  1NX0 A;  3IQQ A;  1YUS A;  2LVI A;  5KSZ A;  5KTY A;  3SG2 A;  3AKB A;  1EJ3 A;  4D1E A;  1RRO A;  1ZMZ A;  3F45 A;  1KK7 Y;  2BL0 C;  1KWO B;  3I5H B;  1XFX O;  2KSP A;  2PVB A;  2JPT A;  3KPX A;  1ALW A;  3OP0 A;  1QX2 A;  1QS7 A;  2JWW A;  1EG3 A;  4WQ2 A;  1FI6 A;  3I5G C;  1J1E A;  2K7B A;  4MLW A;  1A03 A;  1J55 A;  4WQ3 A;  4QJ4 B;  1Y1A A;  1FW4 A;  1OE9 B;  1SL7 A;  1IQ3 A;  4MRX A;  4N1F A;  4PE4 A;  3BUN B;  1B4C A;  1PSB A;  1CMF A;  1PAL A;  1CB1 A;  2ZND A;  3TUY B;  4FQO A;  2LMV A;  2L50 A;  3WNX B;  2ZN9 A;  4A4B A;  1YX7 A;  2JTT A;  2KQ6 A;  2LMU A;  1EXR A;  1KSM A;  1UHH A;  5CPV A;  2F3Z A;  1B9A A;  2LNK A;  1OMR A;  1MHO A;  3PN7 B;  1L2O C;  1QAT A;  1KSO A;  2MJW B;  3D0Y A;  4F0Z B;  2F33 A;  2EC6 B;  2E6W A;  4IL1 A;  4CFR A;  1KK7 Z;  2M97 A;  1XFV O;  4PCW A;  1HQV A;  3BUX B;  3BOW A;  3CR5 X;  1FI5 A;  1QIV A;  5I2O A;  1F4Q A;  2LAP A;  2BL0 B;  1QVI Z;  2JXL A;  4CPV A;  1J7R A;  2JT3 A;  1C7V A;  3FWB A;  3GOF A;  2K7O A;  1DMO A;  3I5G B;  3FIA A;  5D69 A;  4A4C A;  1F71 A;  1JBA A;  2KYF A;  1W7I B;  5AXI A;  2KBI A;  1XK4 A;  1MQ1 A;  4CLN A;  1SNL A;  3I5I C;  3CZT X;  3ZWH A;  1U5I A;  1NPQ A;  4HSZ A;  3GK2 A;  4PE0 A;  1BOC A;  1FF1 A;  5ER5 A;  1SCV A;  1NYA A;  4ZCU A;  1SPY A;  1IKU A;  3EKH A;  1CM4 A;  2E30 A;  5FYX A;  4AOM A;  2JT0 A;  1VRK A;  1WRZ A;  1JF2 A;  2JUL A;  1QTX A;  3EK4 A;  3EVR A;  4PHJ A;  2Y5I A;  1J7Q A;  2LUX A;  1TNP A;  2F2O A;  1AUI B;  4CID A;  1L2O B;  2BEC A;  1CFF A;  1DGV A;  2WCB A;  5AFP A;  3O78 A;  4MEW A;  5J3X A;  5DKN A;  1S3P A;  2KBM A;  2Q4U A;  1DJZ A;  2LP2 A;  1SCM C;  2L51 A;  5CSN A;  2ZKM X;  1F4O A;  1ZAC A;  1NP8 A;  4QJ3 B;  2CTN A;  1NIW A;  1GJY A;  2LM5 A;  2M7N A;  3ZNI A;  2B1U A;  1TNX A;  2LCP A;  3KO0 A;  4I5K A;  1A29 A;  1K93 D;  3PLF B;  2TN4 A;  4GAO A;  1C07 A;  1Y1U A;  1DJW A;  3HCM A;  5AER A;  1CDN A;  5CSJ A;  1QV0 A;  1IG5 A;  1M63 B;  3FS7 A;  4HRE E;  1K2H A;  3BUW B;  1ALV A;  1K95 A;  2FCD A;  2MA2 A;  1CKK A;  1S6C A;  4USL A;  2KGB C;  1F8H A;  1N65 A;  1MUX A;  4PDZ A;  2OS8 C;  5JJG A;  1YRU B;  1Y0V H;  1G8I A;  1NCY A;  1YUU A;  3TDZ A;  1IWQ A;  5B8I B;  2KI4 C;  2H61 A;  1WLM A;  3BXK A;  3DF0 B;  3TZ1 A;  2LHL A;  4ORC B;  2R2I A;  3K21 A;  1SCM B;  1S26 D;  4MN0 A;  1YR5 A;  4YGE B;  3BQ3 A;  1MF8 B;  2CBL A;  3E3R A;  3NSO A;  1IRJ A;  1CM1 A;  3CTN A;  5HLO A;  1JC2 A;  1J1D A;  3AAJ A;  3DD4 A;  5GQQ C;  2M8U A;  2HQ8 A;  2EGD A;  3CLN A;  4ORB B;  1UUR A;  1KFU S;  2JQ6 A;  1ZUZ A;  4MZJ A;  1XYD A;  3LCP C;  2KDH A;  3MSE B;  2LHI A;  2MRD A;  2LVV A;  2OTG C;  1BT6 A;  2M1K B;  3DVK A;  1ZFS A;  2O60 A;  2SCP A;  1BF5 A;  1A4P A;  1YVH A;  3C1V A;  5DKR A;  5CSF A;  3VRP A;  1PUL A;  2OS8 B;  1DJI A;  2D8N A;  1K9U A;  1BLQ A;  1UP5 A;  3VRR A;  3OHM B;  2PMY A;  2JC2 A;  2KI4 B;  2VRG A;  1G4Y R;  1XFU O;  4YRU A;  1BU3 A;  1JUO A;  1K8U A;  3O6B A;  2L0P A;  3BUM B;  1JFJ A;  1K9P A;  1L7Z A;  4I5L B;  1CLL A;  2Y1N A;  1QX5 B;  1SKT A;  1W7J B;  3KHE A;  1NWD A;  1B7T Y;  3A8R A;  2Q91 A;  1A75 B;  1E8A A;  1WRL A;  5CSI A;  2WCE A;  1F54 A;  1XO5 A;  1TOP A;  5HKY A;  1IJ6 A;  4WRI A;  3EVU A;  3TDI A;  2OTG B;  2L98 A;  2LE9 B;  2RGI A;  1AP4 A;  3PAL A;  1BR1 B;  1OZS A;  1CDP A;  1KQV A;  3VRQ A;  1LA0 A;  1RWY A;  3CWG A;  3TDU A;  4M2O A;  1RJV A;  1NSH A;  1JWD A;  2ISD A;  1PSR A;  1KFU L;  4R1E A;  4MZL A;  4NDC A;  3SG3 A;  1SR6 C;  3RLZ A;  4E68 A;  1S5G Y;  2CXJ A;  1QV1 A;  2AUC A;  5I8N A;  2OPO A;  4C0L A;  4GUK A;  1RTP 1;  4PHN A;  1KK8 C;  2KOT A;  1B7T Z;  5HYD A;  1UHI A;  1WRK A;  2H61 C;  2Y1M A;  4PAL A;  1B1G A;  5DKQ A;  1MR8 A;  3NSI A;  1V1G A;  2DOQ A;  1BR4 B;  3DVE A;  1AK8 A;  1Y1X A; 
#chains in the Genus database with same CATH topology
 2PYQ A;  4OR9 B;  3PM8 A;  1DVI A;  4FTG A;  4OCI A;  4GNK B;  5HKZ A;  2PAL A;  4GGN A;  5BPJ A;  5TNC A;  3WHU B;  2K0J A;  2MHH A;  2GGZ A;  5DIC A;  2LVK A;  2LLS A;  3FWC A;  1N2D A;  4PHK A;  1S5G Z;  4GGF A;  2QEH A;  3DVM A;  4GFT A;  2BBN A;  1UWO A;  1SR6 B;  3OX5 A;  3R1P A;  2LV7 A;  4P2Y B;  5FI6 A;  5AAN A;  3QRX A;  1DGU A;  5G08 A;  4DUQ A;  4C0J A;  2HPS A;  2KGR A;  3I5F C;  2WCF A;  4M2P A;  4N1G A;  1TNW A;  3O4Y A;  1KK8 B;  3I5I B;  2K7D A;  2JXC A;  3OGN A;  3DXL A;  2JTZ A;  1B8C A;  1K90 D;  3FE9 A;  3AAK A;  2JT8 A;  4YI8 A;  1LVC D;  4ETO A;  1F55 A;  4DRW A;  1JSA A;  4OKH A;  2Y4Q A;  4MRY A;  2MLF C;  1DF0 B;  2LAN A;  1LXF C;  1DJH A;  3BYA A;  3M0W A;  2KPH A;  3PAT A;  2LUC A;  2M0R A;  3PFV A;  1DJG A;  1TN4 A;  4JD9 A;  4OZD A;  1XA5 A;  3QME A;  2BAP A;  2M1U A;  1WDC C;  2KI6 C;  2NXQ A;  3EVV A;  1IGV A;  1TNQ A;  1YVL A;  2KNE A;  4GBA A;  2JNX A;  1XVJ A;  4MBE A;  2MBX A;  1AHR A;  4YGA A;  1OMD A;  1NX2 A;  1RFJ A;  5FI2 A;  3D10 A;  4XJK B;  1HT9 A;  5F6T A;  1KCY A;  3CR4 X;  1QXP A;  1T14 A;  3R1V A;  3WXA A;  1R2U A;  1JFK A;  3VRN A;  2CNP A;  2BE4 A;  3V2L A;  1MXE A;  2BKH B;  1AJ5 A;  4PE7 A;  3BUO B;  1XFY O;  2K8M B;  1W9Z A;  1OOF A;  1DEL A;  2CCM A;  1SY9 A;  3H4S E;  1YX8 A;  3I5F B;  1DJX A;  1GQM A;  4HRG A;  4P5O E;  1KFX L;  1JF0 A;  1C3Y A;  2BBM A;  3L47 A;  1NCZ A;  2H8V A;  4PHM A;  1IJ5 A;  1UUS A;  2AMI A;  2CT9 A;  1CLM A;  2L2C A;  5K89 A;  3EK8 A;  1KWO C;  3I5H C;  3BFH A;  3Q8I A;  4CFQ A;  3SG6 A;  1XK4 C;  3LLE A;  2ZNE A;  1BOD A;  1K9K A;  1S36 A;  1SRA A;  2NCO A;  1QAS A;  2JOJ A;  2M7L A;  2G2B A;  2L5X B;  1IQ5 A;  2SAS A;  3B87 A;  2BCA A;  1UHJ A;  4ORA B;  4YGB B;  2M9G A;  1WDC B;  4AQI A;  4M2Q A;  1LA3 A;  4Q04 A;  5AEQ A;  1OSA A;  2FCE A;  4L9M A;  1SL8 A;  3CS1 A;  2JZI A;  1CMG A;  1K94 A;  4I5J A;  2ZFD A;  4YI9 A;  2A4J A;  1B47 A;  2JPO A;  3D0Y B;  3NGV A;  3VGO A;  2NZ0 A;  2BE6 A;  1CDL A;  1M31 A;  1YUT A;  2AAO A;  3ICB A;  3IQO A;  2K2F A;  3OB2 B;  3UNW A;  3HX4 A;  3RM1 A;  3BOW B;  3PSR A;  1XFW O;  4DS7 A;  1B8R A;  3CAB A;  1EL4 A;  1OZO A;  1OQP A;  3SIA A;  1FPW A;  3R72 A;  2ZN8 A;  2PRU A;  1QWV A;  1CFP A;  1PVA A;  1EG4 A;  1EH2 A;  1PVB A;  1RK9 A;  4NQG A;  3SS5 A;  1CFC A;  1TWO A;  3A4U B;  5HLV A;  1C7W A;  1OW4 A;  3OBV A;  1U5I B;  4JPZ B;  5ER4 X;  2LC5 A;  1BMO A;  2FOT A;  1QVI Y;  3JTD C;  1J7P A;  1S1E A;  2JU0 A;  2NLN A;  4XYN A;  4BY5 A;  4TNC A;  5KU1 A;  3KEV A;  1XFZ O;  2K61 A;  1IH0 A;  1M45 A;  1QLK A;  1REC A;  3NHI A;  2KFF A;  1SYM A;  2ZRT A;  3S0D A;  3SG4 A;  3SG5 A;  3JVT C;  3S0E A;  2QEV A;  1LKJ A;  1ODB A;  4YBH B;  2L4H A;  2KHN A;  4I5N B;  4DIR A;  1OOI X;  1D1O A;  1TUJ A;  1TRF A;  2BCX A;  1J7O A;  3LK1 A;  1OOH A;  2I7A A;  2LLT A;  2L2E A;  1DC1 A;  2H2K A;  1FBV A;  1BG1 A;  2HF5 A;  1PRW A;  4ICB A;  1S6I A;  3OB1 B;  2BNX A;  1QJT A;  1CFD A;  2V53 A;  5I94 A;  1YTZ C;  1OOJ A;  2LVJ A;  3NSL A;  2KAX A;  3CGA A;  3CZ0 A;  2MAZ A;  1A75 A;  2COL B;  1KFX S;  1X02 A;  1DJY A;  2QPT A;  3SJS A;  3NSK A;  2GGM A;  2HQW A;  3JTD B;  3B88 A;  1R6P A;  3NXA A;  1SL9 A;  3WHT B;  4N5X A;  3DVJ A;  3SG7 A;  5JOL A;  3UO9 A;  3GK4 X;  4YGD B;  1ZOT B;  4MSP A;  1NX1 A;  2LLU A;  2M3W A;  1CNP A;  3LK0 A;  2P6B B;  1P28 A;  2KFH A;  3JVT B;  4MVF A;  2WND A;  1M39 A;  3BFA A;  3L4L A;  4NDD A;  1V1F A;  1H4B A;  1SBJ A;  4PE1 A;  1DTL A;  5FI7 A;  3NHT A;  1Z4H A;  1UHK A;  2ERB A;  2JNF A;  2I2R E;  1M46 A;  3VRO A;  1G33 A;  2KQY A;  2L4I A;  5IBW A;  2F3Y A;  3TS5 C;  2KFG A;  3D74 A;  1TTX A;  3EKJ A;  1CLB A;  1B8L A;  3GK1 A;  2EHB A;  2WCJ A;  2M49 B;  2WOR A;  1Q80 A;  1H8B A;  2QAC A;  4UPG A;  2KAV A;  1KQM C;  2PAS A;  1XFR A;  1AVS A;  3D73 A;  1WLZ A;  1QLS A;  5HKW A;  1N0Y A;  4JWQ A;  5I2Q A;  2O5G A;  1MWN A;  1UHN A;  3B6X A;  1NCX A;  3CYZ A;  2F8P A;  1AJ4 A;  4HRH A;  1A2X A;  2BKI B;  2QEB A;  1TIZ A;  1YUR A;  2G9B A;  2IS9 A;  2LMT A;  4U8D A;  3SIB A;  1K96 A;  1SK6 D;  4IJ7 A;  4JKT A;  2P71 A;  4QJ5 B;  1SMG A;  3CZ1 A;  4NDB A;  2KAY A;  1GGW A;  4MZK A;  3OX6 A;  1QX7 A;  2JRF A;  2MLE C;  2KI6 D;  3RZS A;  1NUB A;  3CZ2 A;  4ZCV A;  4DCK A;  4OVN F;  1YRT B;  3IVT A;  2M29 A;  3IF7 A;  1DT7 B;  1MXL C;  3TS5 B;  3KF9 A;  4C0K A;  2GV5 A;  3LL8 B;  3S0F A;  1DEK A;  1TUZ A;  2FJU B;  1CTR A;  1NX3 A;  3O4X A;  5D7F A;  1GGZ A;  1BJF A;  3BFB A;  1TCF A;  1Y6W A;  3EK7 A;  1DF0 A;  3AKA A;  5I2L A;  1S6J A;  5PAL A;  4AQJ A;  1WY9 A;  1KQM B;  2K7C A;  1SW8 A;  5EL2 A;  1PK0 D;  2I18 A;  2ZRS A;  4OV2 A;  3TUY C;  1OOG A;  1OMV A;  1F70 A;  1TCO B;  2I94 A;  3PJI A;  3PM2 A;  1CDM A;  3DY9 A;  2NCP A;  2F2P A;  3CR2 A;  3DF0 A;  4GPL B;  4JQ0 D;  2K2A A;  3O2P A;  4XJK A;  4YGC B;  2KYC A;  2WOS A;  2HET A;  2BCB A;  2LP3 A;  4BY4 A;  2PSR A;  1LIN A;  3PN7 C;  1QIW A;  4GGF C;  2EC6 C;  2WC8 A;  1NX0 A;  3IQQ A;  2WCL A;  1YUS A;  5HL1 A;  2LVI A;  5KSZ A;  5KTY A;  3SG2 A;  3AKB A;  1EJ3 A;  3N7H A;  4D1E A;  1RRO A;  1ZMZ A;  3F45 A;  1KK7 Y;  2BL0 C;  1KWO B;  3I5H B;  1XFX O;  2KSP A;  2PVB A;  2JPT A;  3DZT A;  1ALW A;  3KPX A;  1QX2 A;  1QS7 A;  2JWW A;  1EG3 A;  3OP0 A;  4WQ2 A;  3I5G C;  1FI6 A;  1J1E A;  2K7B A;  4MLW A;  3S0G A;  1A03 A;  1J55 A;  4WQ3 A;  4QJ4 B;  1Y1A A;  1FW4 A;  2YGU A;  3BJH A;  1OE9 B;  1SL7 A;  4FQT A;  4MRX A;  1DQE A;  4N1F A;  4PE4 A;  3BUN B;  1IQ3 A;  1PSB A;  1B4C A;  1CMF A;  1PAL A;  1CB1 A;  2ZND A;  3TUY B;  4FQO A;  2LMV A;  2L50 A;  3WNX B;  2ZN9 A;  4A4B A;  1YX7 A;  2GTE A;  2JTT A;  2KQ6 A;  2LMU A;  1EXR A;  3VB1 A;  1KSM A;  1UHH A;  5CPV A;  2F3Z A;  1B9A A;  2LNK A;  2P70 A;  3D76 A;  2KLE A;  1OMR A;  1MHO A;  3PN7 B;  1L2O C;  1QAT A;  1KSO A;  2MJW B;  3D0Y A;  4F0Z B;  2F33 A;  2EC6 B;  2E6W A;  4IL1 A;  4CFR A;  1KK7 Z;  2M97 A;  1XFV O;  4PCW A;  1HQV A;  3BUX B;  3BOW A;  3CR5 X;  1FI5 A;  1QIV A;  2WCK A;  5I2O A;  1F4Q A;  2LAP A;  3DYE A;  2BL0 B;  1QVI Z;  2JXL A;  4CPV A;  1J7R A;  2JT3 A;  4INX A;  1C7V A;  3FWB A;  3GOF A;  2K7O A;  1DMO A;  3I5G B;  3FIA A;  5D69 A;  4A4C A;  1F71 A;  1JBA A;  2KYF A;  1W7I B;  5AXI A;  2KBI A;  1XK4 A;  1MQ1 A;  4CLN A;  1LS8 A;  1SNL A;  3I5I C;  3CZT X;  3ZWH A;  1U5I A;  1NPQ A;  4HSZ A;  3GK2 A;  4PE0 A;  1BOC A;  1FF1 A;  5ER5 A;  1SCV A;  1ORG A;  1NYA A;  4ZCU A;  1SPY A;  1IKU A;  3EKH A;  1CM4 A;  2E30 A;  5FYX A;  4AOM A;  1Z2C B;  2JT0 A;  1VRK A;  1WRZ A;  4KYN A;  1JF2 A;  2JUL A;  1QTX A;  3EK4 A;  3EVR A;  4PHJ A;  2Y5I A;  1J7Q A;  4F7F A;  2LUX A;  2WC6 A;  1TNP A;  2F2O A;  1AUI B;  4CID A;  1L2O B;  2BEC A;  1CFF A;  1DGV A;  2WCB A;  3EG5 B;  3O78 A;  4MEW A;  5J3X A;  5AFP A;  5DKN A;  1IIO A;  1S3P A;  2KBM A;  2Q4U A;  1DJZ A;  2LP2 A;  2L5Y A;  1SCM C;  2L51 A;  5CSN A;  2ZKM X;  1F4O A;  1ZAC A;  1NP8 A;  4QJ3 B;  2CTN A;  1NIW A;  1GJY A;  2LM5 A;  2M7N A;  3ZNI A;  2B1U A;  2WCH A;  1TNX A;  2LCP A;  3KO0 A;  3FE8 A;  1A29 A;  1K93 D;  4I5K A;  3CDN A;  3PLF B;  2TN4 A;  4GAO A;  1C07 A;  3R1O A;  1Y1U A;  1DJW A;  3D78 A;  3HCM A;  5AER A;  1CDN A;  5CSJ A;  1QV0 A;  1IG5 A;  1M63 B;  3FS7 A;  4HRE E;  1K2H A;  3BUW B;  2FJY A;  1ALV A;  1K95 A;  2FCD A;  2MA2 A;  2QEO A;  1CKK A;  1S6C A;  4USL A;  2KGB C;  1F8H A;  1N65 A;  1MUX A;  4PDZ A;  2OS8 C;  5JJG A;  1YRU B;  1Y0V H;  1G8I A;  1GM0 A;  1NCY A;  1YUU A;  3B86 A;  3TDZ A;  1IWQ A;  5B8I B;  2KI4 C;  2H61 A;  1WLM A;  3BXK A;  3DF0 B;  3TZ1 A;  2LHL A;  4ORC B;  2R2I A;  3K21 A;  1SCM B;  1S26 D;  4MN0 A;  1YR5 A;  4YGE B;  3BQ3 A;  1MF8 B;  2CBL A;  3E3R A;  3NSO A;  1IRJ A;  1CM1 A;  3CTN A;  3D75 A;  5HLO A;  1JC2 A;  1J1D A;  3AAJ A;  3DD4 A;  5GQQ C;  2M8U A;  2HQ8 A;  2EGD A;  3CLN A;  4ORB B;  1UUR A;  1KFU S;  3S0A A;  2JQ6 A;  1ZUZ A;  4MZJ A;  1XYD A;  3LCP C;  2KDH A;  3S0B A;  3MSE B;  2KLD A;  2LHI A;  2MRD A;  2LVV A;  2OTG C;  3K1E A;  1BT6 A;  2M1K B;  3DVK A;  1ZFS A;  2O60 A;  2SCP A;  1BF5 A;  1A4P A;  1YVH A;  3C1V A;  5DKR A;  5CSF A;  3VRP A;  1PUL A;  2WCM A;  2OS8 B;  1SSE B;  1DJI A;  3L4A A;  2D8N A;  1K9U A;  1BLQ A;  1UP5 A;  3B7A A;  3VRR A;  3OHM B;  2PMY A;  2JC2 A;  2KI4 B;  2VRG A;  1G4Y R;  2QDI A;  1XFU O;  4YRU A;  1BU3 A;  1JUO A;  1K8U A;  3O6B A;  4INW A;  2L0P A;  3BUM B;  1JFJ A;  1K9P A;  1L7Z A;  4I5L B;  1CLL A;  2Y1N A;  1QX5 B;  1SKT A;  1W7J B;  3KHE A;  1NWD A;  1B7T Y;  5D3O A;  3A8R A;  4PT1 A;  2Q91 A;  1A75 B;  1E8A A;  1WRL A;  5CSI A;  2WCE A;  1F54 A;  2PQL A;  1XO5 A;  3SS4 A;  1TOP A;  5HKY A;  1IJ6 A;  4WRI A;  3EVU A;  3TDI A;  2OTG B;  2L98 A;  2LE9 B;  2RGI A;  3D77 A;  1AP4 A;  3PAL A;  1BR1 B;  1OZS A;  3FE6 A;  1CDP A;  1KQV A;  3VRQ A;  3SS3 A;  1LA0 A;  1RWY A;  3CWG A;  3TDU A;  2WC5 A;  1RJV A;  1NSH A;  4M2O A;  2ISD A;  1JWD A;  1PSR A;  1KFU L;  4R1E A;  4MZL A;  4NDC A;  3SG3 A;  1SR6 C;  3RLZ A;  4E68 A;  1S5G Y;  2CXJ A;  1QV1 A;  2AUC A;  5I8N A;  2OPO A;  4C0L A;  4GUK A;  1RTP 1;  4PHN A;  1KK8 C;  2KOT A;  1B7T Z;  5HYD A;  1UHI A;  1WRK A;  2H61 C;  1C3Z A;  2Y1M A;  4PAL A;  1B1G A;  5DKQ A;  1MR8 A;  3NSI A;  1V1G A;  2DOQ A;  1BR4 B;  3DVE A;  1AK8 A;  2K60 A;  1Y1X A; 
#chains in the Genus database with same CATH homology
 4OR9 B;  3PM8 A;  1DVI A;  4FTG A;  4OCI A;  4GNK B;  5HKZ A;  2PAL A;  4GGN A;  5BPJ A;  5TNC A;  3WHU B;  2K0J A;  2MHH A;  2GGZ A;  2LVK A;  2LLS A;  3FWC A;  1N2D A;  4PHK A;  1S5G Z;  4GGF A;  3DVM A;  4GFT A;  2BBN A;  1UWO A;  1SR6 B;  3OX5 A;  5AAN A;  2LV7 A;  4P2Y B;  3QRX A;  1DGU A;  5G08 A;  4DUQ A;  4C0J A;  2HPS A;  2KGR A;  3I5F C;  2WCF A;  4M2P A;  4N1G A;  1TNW A;  3O4Y A;  1KK8 B;  3I5I B;  2K7D A;  2JXC A;  2JTZ A;  1B8C A;  1K90 D;  3AAK A;  2JT8 A;  4YI8 A;  1LVC D;  4ETO A;  1F55 A;  4DRW A;  4OKH A;  2Y4Q A;  4MRY A;  2MLF C;  1DF0 B;  2LAN A;  1LXF C;  1DJH A;  3BYA A;  3M0W A;  3PAT A;  3PFV A;  2LUC A;  2M0R A;  1DJG A;  1TN4 A;  1XA5 A;  2M1U A;  3EVV A;  1WDC C;  2KI6 C;  2NXQ A;  1IGV A;  1TNQ A;  1YVL A;  2KNE A;  4GBA A;  2JNX A;  1XVJ A;  4MBE A;  2MBX A;  1AHR A;  4YGA A;  1OMD A;  1NX2 A;  1RFJ A;  3D10 A;  4XJK B;  1HT9 A;  5F6T A;  1KCY A;  3CR4 X;  1QXP A;  3WXA A;  1R2U A;  1JFK A;  3VRN A;  2CNP A;  2BE4 A;  1MXE A;  2BKH B;  1AJ5 A;  4PE7 A;  3BUO B;  1XFY O;  2K8M B;  3H4S E;  1CNP A;  4P5O E;  2CCM A;  1SY9 A;  4HRG A;  1YX8 A;  3I5F B;  1DJX A;  1GQM A;  1KFX L;  1JF0 A;  2BBM A;  4PHM A;  1NCZ A;  1IJ5 A;  1UUS A;  2AMI A;  2CT9 A;  1CLM A;  5K89 A;  3EK8 A;  1KWO C;  3I5H C;  4CFQ A;  3SG6 A;  1XK4 C;  3LLE A;  2ZNE A;  1BOD A;  1K9K A;  1S36 A;  1SRA A;  2NCO A;  1QAS A;  2JOJ A;  2M7L A;  2G2B A;  2L5X B;  1IQ5 A;  2SAS A;  2BCA A;  1UHJ A;  4ORA B;  4YGB B;  2M9G A;  1WDC B;  4AQI A;  4M2Q A;  1LA3 A;  4Q04 A;  5AEQ A;  1OSA A;  2FCE A;  4L9M A;  1SL8 A;  3CS1 A;  2JZI A;  1CMG A;  1K94 A;  4I5J A;  2ZFD A;  4YI9 A;  2A4J A;  1B47 A;  3D0Y B;  3VGO A;  2NZ0 A;  2BE6 A;  1CDL A;  1M31 A;  1YUT A;  2AAO A;  3ICB A;  3IQO A;  2K2F A;  3OB2 B;  3HX4 A;  3RM1 A;  3BOW B;  3PSR A;  1XFW O;  4DS7 A;  1B8R A;  1EL4 A;  1OZO A;  1OQP A;  3SIA A;  1FPW A;  2ZN8 A;  2PRU A;  1CFP A;  1PVA A;  1EG4 A;  1EH2 A;  1PVB A;  1RK9 A;  4NQG A;  1CFC A;  3A4U B;  5HLV A;  1C7W A;  1U5I B;  4JPZ B;  5ER4 X;  2LC5 A;  1BMO A;  2FOT A;  1QVI Y;  3JTD C;  1J7P A;  1S1E A;  2JU0 A;  2NLN A;  4XYN A;  4BY5 A;  4TNC A;  5KU1 A;  3KEV A;  1XFZ O;  2K61 A;  1IH0 A;  1M45 A;  1QLK A;  1REC A;  2KFF A;  1SYM A;  2ZRT A;  3SG4 A;  3SG5 A;  3JVT C;  1LKJ A;  1ODB A;  4YBH B;  2L4H A;  2KHN A;  4I5N B;  4DIR A;  1D1O A;  1TRF A;  2BCX A;  1J7O A;  3LK1 A;  2I7A A;  2LLT A;  2L2E A;  2H2K A;  1FBV A;  1BG1 A;  2HF5 A;  1PRW A;  4ICB A;  1S6I A;  3OB1 B;  1QJT A;  1CFD A;  2V53 A;  1YTZ C;  1OOJ A;  2LVJ A;  3NSL A;  2KAX A;  3CGA A;  2MAZ A;  1A75 A;  2COL B;  1KFX S;  1X02 A;  1DJY A;  2QPT A;  3SJS A;  3NSK A;  2GGM A;  2HQW A;  3JTD B;  1R6P A;  3NXA A;  1SL9 A;  3WHT B;  4N5X A;  3DVJ A;  3SG7 A;  5JOL A;  3GK4 X;  4YGD B;  1ZOT B;  4MSP A;  1NX1 A;  2LLU A;  2M3W A;  3LK0 A;  2P6B B;  2KFH A;  3JVT B;  4MVF A;  2WND A;  1M39 A;  4NDD A;  1V1F A;  1H4B A;  1SBJ A;  4PE1 A;  1DTL A;  1UHK A;  2JNF A;  2I2R E;  1M46 A;  3VRO A;  1G33 A;  2KQY A;  2L4I A;  5IBW A;  2F3Y A;  3TS5 C;  2KFG A;  1TTX A;  3EKJ A;  1CLB A;  1B8L A;  3GK1 A;  2EHB A;  2M49 B;  2WOR A;  1Q80 A;  1H8B A;  2QAC A;  4UPG A;  2KAV A;  1KQM C;  2PAS A;  1AVS A;  1WLZ A;  1QLS A;  5HKW A;  1N0Y A;  4JWQ A;  5I2Q A;  2O5G A;  1MWN A;  1UHN A;  1NCX A;  2F8P A;  1AJ4 A;  4HRH A;  1A2X A;  2BKI B;  4U8D A;  1TIZ A;  1YUR A;  2G9B A;  2IS9 A;  2LMT A;  3SIB A;  1JSA A;  1K96 A;  1SK6 D;  4QJ5 B;  1SMG A;  4NDB A;  1GGW A;  2KAY A;  4MZK A;  3OX6 A;  1QX7 A;  2JRF A;  2MLE C;  2KI6 D;  1NUB A;  4ZCV A;  4DCK A;  4OVN F;  1YRT B;  2M29 A;  3IF7 A;  1DT7 B;  1MXL C;  3TS5 B;  3KF9 A;  4C0K A;  2GV5 A;  3LL8 B;  2FJU B;  1CTR A;  1NX3 A;  5D7F A;  1GGZ A;  1BJF A;  1TCF A;  1Y6W A;  3EK7 A;  1DF0 A;  3AKA A;  5I2L A;  1S6J A;  5PAL A;  4AQJ A;  1WY9 A;  1KQM B;  2K7C A;  1SW8 A;  1PK0 D;  2I18 A;  2ZRS A;  4OV2 A;  3TUY C;  1OMV A;  1F70 A;  1TCO B;  2I94 A;  1CDM A;  4GPL B;  2NCP A;  2F2P A;  3CR2 A;  3DF0 A;  4JQ0 D;  4YGC B;  2K2A A;  3O2P A;  4XJK A;  2KYC A;  2WOS A;  2HET A;  2BCB A;  2LP3 A;  4BY4 A;  2PSR A;  1LIN A;  3PN7 C;  1QIW A;  4GGF C;  2EC6 C;  2WC8 A;  1NX0 A;  3IQQ A;  1YUS A;  2LVI A;  5KSZ A;  5KTY A;  3SG2 A;  3AKB A;  1EJ3 A;  4D1E A;  1RRO A;  1ZMZ A;  3F45 A;  1KK7 Y;  2BL0 C;  1KWO B;  3I5H B;  1XFX O;  2KSP A;  2PVB A;  2JPT A;  3KPX A;  1ALW A;  3OP0 A;  1QX2 A;  1QS7 A;  2JWW A;  1EG3 A;  4WQ2 A;  1FI6 A;  3I5G C;  1J1E A;  2K7B A;  4MLW A;  1A03 A;  1J55 A;  4WQ3 A;  4QJ4 B;  1Y1A A;  1FW4 A;  1OE9 B;  1SL7 A;  1IQ3 A;  4MRX A;  4N1F A;  4PE4 A;  3BUN B;  1B4C A;  1PSB A;  1CMF A;  1PAL A;  1CB1 A;  2ZND A;  3TUY B;  4FQO A;  2LMV A;  2L50 A;  3WNX B;  2ZN9 A;  4A4B A;  1YX7 A;  2JTT A;  2KQ6 A;  2LMU A;  1EXR A;  1KSM A;  1UHH A;  5CPV A;  2F3Z A;  1B9A A;  2LNK A;  1OMR A;  1MHO A;  3PN7 B;  1L2O C;  1QAT A;  1KSO A;  2MJW B;  3D0Y A;  4F0Z B;  2F33 A;  2EC6 B;  2E6W A;  4IL1 A;  4CFR A;  1KK7 Z;  2M97 A;  1XFV O;  4PCW A;  1HQV A;  3BUX B;  3BOW A;  3CR5 X;  1FI5 A;  1QIV A;  5I2O A;  1F4Q A;  2LAP A;  2BL0 B;  1QVI Z;  2JXL A;  4CPV A;  1J7R A;  2JT3 A;  1C7V A;  3FWB A;  3GOF A;  2K7O A;  1DMO A;  3I5G B;  3FIA A;  5D69 A;  4A4C A;  1F71 A;  1JBA A;  2KYF A;  1W7I B;  5AXI A;  2KBI A;  1XK4 A;  1MQ1 A;  4CLN A;  1SNL A;  3I5I C;  3CZT X;  3ZWH A;  1U5I A;  1NPQ A;  4HSZ A;  3GK2 A;  4PE0 A;  1BOC A;  1FF1 A;  5ER5 A;  1SCV A;  1NYA A;  4ZCU A;  1SPY A;  1IKU A;  3EKH A;  1CM4 A;  2E30 A;  5FYX A;  4AOM A;  2JT0 A;  1VRK A;  1WRZ A;  1JF2 A;  2JUL A;  1QTX A;  3EK4 A;  3EVR A;  4PHJ A;  2Y5I A;  1J7Q A;  2LUX A;  1TNP A;  2F2O A;  1AUI B;  4CID A;  1L2O B;  2BEC A;  1CFF A;  1DGV A;  2WCB A;  5AFP A;  3O78 A;  4MEW A;  5J3X A;  5DKN A;  1S3P A;  2KBM A;  2Q4U A;  1DJZ A;  2LP2 A;  1SCM C;  2L51 A;  5CSN A;  2ZKM X;  1F4O A;  1ZAC A;  1NP8 A;  4QJ3 B;  2CTN A;  1NIW A;  1GJY A;  2LM5 A;  2M7N A;  3ZNI A;  2B1U A;  1TNX A;  2LCP A;  3KO0 A;  4I5K A;  1A29 A;  1K93 D;  3PLF B;  2TN4 A;  4GAO A;  1C07 A;  1Y1U A;  1DJW A;  3HCM A;  5AER A;  1CDN A;  5CSJ A;  1QV0 A;  1IG5 A;  1M63 B;  3FS7 A;  4HRE E;  1K2H A;  3BUW B;  1ALV A;  1K95 A;  2FCD A;  2MA2 A;  1CKK A;  1S6C A;  4USL A;  2KGB C;  1F8H A;  1N65 A;  1MUX A;  4PDZ A;  2OS8 C;  5JJG A;  1YRU B;  1Y0V H;  1G8I A;  1NCY A;  1YUU A;  3TDZ A;  1IWQ A;  5B8I B;  2KI4 C;  2H61 A;  1WLM A;  3BXK A;  3DF0 B;  3TZ1 A;  2LHL A;  4ORC B;  2R2I A;  3K21 A;  1SCM B;  1S26 D;  4MN0 A;  1YR5 A;  4YGE B;  3BQ3 A;  1MF8 B;  2CBL A;  3E3R A;  3NSO A;  1IRJ A;  1CM1 A;  3CTN A;  5HLO A;  1JC2 A;  1J1D A;  3AAJ A;  3DD4 A;  5GQQ C;  2M8U A;  2HQ8 A;  2EGD A;  3CLN A;  4ORB B;  1UUR A;  1KFU S;  2JQ6 A;  1ZUZ A;  4MZJ A;  1XYD A;  3LCP C;  2KDH A;  3MSE B;  2LHI A;  2MRD A;  2LVV A;  2OTG C;  1BT6 A;  2M1K B;  3DVK A;  1ZFS A;  2O60 A;  2SCP A;  1BF5 A;  1A4P A;  1YVH A;  3C1V A;  5DKR A;  5CSF A;  3VRP A;  1PUL A;  2OS8 B;  1DJI A;  2D8N A;  1K9U A;  1BLQ A;  1UP5 A;  3VRR A;  3OHM B;  2PMY A;  2JC2 A;  2KI4 B;  2VRG A;  1G4Y R;  1XFU O;  4YRU A;  1BU3 A;  1JUO A;  1K8U A;  3O6B A;  2L0P A;  3BUM B;  1JFJ A;  1K9P A;  1L7Z A;  4I5L B;  1CLL A;  2Y1N A;  1QX5 B;  1SKT A;  1W7J B;  3KHE A;  1NWD A;  1B7T Y;  3A8R A;  2Q91 A;  1A75 B;  1E8A A;  1WRL A;  5CSI A;  2WCE A;  1F54 A;  1XO5 A;  1TOP A;  5HKY A;  1IJ6 A;  4WRI A;  3EVU A;  3TDI A;  2OTG B;  2L98 A;  2LE9 B;  2RGI A;  1AP4 A;  3PAL A;  1BR1 B;  1OZS A;  1CDP A;  1KQV A;  3VRQ A;  1LA0 A;  1RWY A;  3CWG A;  3TDU A;  4M2O A;  1RJV A;  1NSH A;  1JWD A;  2ISD A;  1PSR A;  1KFU L;  4R1E A;  4MZL A;  4NDC A;  3SG3 A;  1SR6 C;  3RLZ A;  4E68 A;  1S5G Y;  2CXJ A;  1QV1 A;  2AUC A;  5I8N A;  2OPO A;  4C0L A;  4GUK A;  1RTP 1;  4PHN A;  1KK8 C;  2KOT A;  1B7T Z;  5HYD A;  1UHI A;  1WRK A;  2H61 C;  2Y1M A;  4PAL A;  1B1G A;  5DKQ A;  1MR8 A;  3NSI A;  1V1G A;  2DOQ A;  1BR4 B;  3DVE A;  1AK8 A;  1Y1X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...