2ZN8A

Crystal structure of zn2+-bound form of alg-2
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
166
structure length
166
Chain Sequence
b'SFLWNVFQRVDKDRSGVISDTELQQALSNGTWTPFNPVTVRSIISMFDRENKAGVNFSEFTGVWKYITDWQNVFRTYDRDNSGMIDKNELKQALSGFGYRLSDQFHDILIRKFDRQGRGQIAFDDFIQGCIVLQRLTDIFRRYDTDQDGWIQVSYEQYLSMVFSIV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Programmed cell death protein 6
publication title Structural Basis for Ca(2+)-Dependent Formation of ALG-2/Alix Peptide Complex: Ca(2+)/EF3-Driven Arginine Switch Mechanism
pubmed doi rcsb
source organism Homo sapiens
molecule tags Apoptosis
total genus 57
structure length 166
sequence length 166
ec nomenclature
pdb deposition date 2008-04-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13202 EF-hand_5 EF hand
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2zn8A00
2Y1NA 1SYMA 3KHEA 4ORAB 1AHRA 1S26D 2KYFA 1CFCA 3BUXB 1QATA 3O2PA 2LLTA 2JPTA 2JT3A 1JUOA 2JXLA 3KPXA 1XFVO 1H8BA 1RECA 3OB1B 1NCYA 3KF9A 1RTP1 4C0JA 3O6BA 1TNPA 1NP8A 1OOJA 1YX7A 3BQ3A 3SG2A 1MXEA 1A75B 1NCZA 2NCPA 3O78A 2LMTA 4GUKA 4GGFA 3PN7C 1ALVA 5CSJA 1KWOC 2EC6B 2JRFA 1UWOA 2KAVA 1JFJA 2L4IA 1K90D 1DJGA 2H61C 1K93D 1FBVA 1KFXS 5CPVA 1DF0B 1UP5A 1V1GA 3I5IC 4MZLA 1IGVA 1SL7A 2KAXA 2MLEC 4I5JA 1H4BA 1PRWA 2JTTA 5JOLA 2KI6D 4CFQA 1RFJA 4CLNA 4HSZA 3EKHA 1OMRA 1PK0D 2FJUB 1A29A 3SG4A 1DVIA 2I2RE 3FWCA 1XK4C 1KCYA 2G2BA 2OS8B 1LVCD 1K96A 4YRUA 3CTNA 5BPJA 2MA2A 3BUWB 3CWGA 1CMGA 5I2QA 3AAKA 2KGRA 4PHKA 1IQ5A 1QV1A 2I7AA 2KFFA 1CB1A 1UHKA 1DJZA 1KK7Y 2PSRA 1EH2A 3I5HB 4P2YB 4YGEB 3TUYB 2KQ6A 4C0KA 1YRUB 2ZNDA 3SG7A 2NXQA 1TRFA 2BCBA 1FPWA 1KK7Z 4PDZA 4M2PA 1KQMC 2EGDA 2LE9B 4PHJA 1TN4A 2K0JA 3CGAA 2KBMA 3SIAA 3C1VA 1QIWA 3D0YA 4FQOA 1S1EA 1YUUA 5ER5A 1CFFA 1OE9B 1ALWA 1GGWA 2LV7A 2KFGA 4WRIA 3TS5C 2KQYA 2LVJA 4ICBA 3GK4X 4A4BA 2LLSA 2B1UA 3QRXA 1SNLA 3WHTB 1MR8A 3PN7B 1AK8A 1KWOB 2DOQA 2NZ0A 2F3YA 3JTDC 4BY4A 1IH0A 1CM4A 1M63B 3ICBA 3VRNA 4CPVA 2OTGB 2G9BA 3HX4A 2JNFA 2EC6C 2E30A 1GJYA 4TNCA 3SG6A 1SW8A 3I5IB 4QJ4B 3O4YA 1NX2A 5HLVA 5J3XA 1K9PA 1WDCC 2TN4A 2MBXA 2CXJA 1DJIA 2Q4UA 2RGIA 4DUQA 2CT9A 1MUXA 1QV0A 1B8CA 4F0ZB 1BJFA 1SMGA 2JTZA 3NXAA 1WY9A 1RROA 2LUXA 3H4SE 1KSOA 3OB2B 4CIDA 4DIRA 2KHNA 5AFPA 2K7BA 2JQ6A 4OR9B 1Y1UA 1AJ5A 2OPOA 1IG5A 2KNEA 5IBWA 2E6WA 2M7NA 5KSZA 1BG1A 1J7QA 4E68A 5I8NA 1NCXA 2BBNA 2JXCA 2LP2A 1B8RA 1J1EA 4USLA 4DRWA 1OMDA 2F33A 3LK0A 2M29A 4YI8A 3TUYC 3DF0B 1PULA 4JQ0D 4PE4A 1QJTA 1KQMB 1JWDA 1JFKA 2SCPA 2ISDA 3OX5A 2COLB 1NUBA 1XFYO 3RM1A 1NIWA 4PCWA 1OZSA 2Y4QA 3EVVA 3PSRA 1OZOA 3GK1A 4I5LB 1B8LA 1NYAA 4ZCVA 1TCOB 1QLSA 3CLNA 1EG4A 4GNKB 1NX3A 2KAYA 3I5FB 3TS5B 1XFWO 4ORCB 2ZN9A 2WCBA 1BR1B 1ZMZA 1QXPA 4UPGA 5HKWA 3DVKA 3JTDB 3RLZA 2M3WA 1L2OC 3ZNIA 1J7PA 4HRGA 4MRXA 4NDBA 2WORA 1CTRA 1E8AA 1JF2A 1S3PA 3SIBA 3IF7A 3WXAA 2JWWA 3VGOA 2OTGC 1EJ3A 1YRTB 4YBHB 1WDCB 3LLEA 1TNQA 4NQGA 3AAJA 1KFUL 2ZKMX 2BECA 1U5IA 4PE0A 1JSAA 1N65A 2BL0B 4XYNA 1AUIB 2H61A 2GGMA 1YVHA 2LAPA 2LVIA 1Q80A 4MN0A 1W7JB 2WCFA 1MF8B 2LHIA 3CR5X 1Y0VH 1QIVA 4MBEA 2MHHA 1KSMA 1BOCA 2FCEA 2K7CA 1KK8B 1F8HA 4XJKB 1N0YA 2D8NA 2LVKA 1GQMA 3TZ1A 3EVRA 3VRPA 1DJHA 3BUOB 1W7IB 2LANA 2ZRSA 1M45A 1XK4A 3EK7A 1MXLC 2MAZA 2HQ8A 1SRAA 2R2IA 2L5XB 4OKHA 3LCPC 4I5KA 1PSRA 4FTGA 1CDNA 2MRDA 3BYAA 1UHNA 1ZFSA 5HLOA 2L0PA 2KI4B 4MEWA 1SCMC 2BE4A 3PFVA 1SL8A 4YGCB 3TDIA 1D1OA 1SK6D 4ZCUA 1CLMA 3EK4A 1JC2A 1SR6B 1UHIA 1K95A 1SY9A 2PRUA 1SPYA 3I5GB 3OHMB 4I5NB 5CSIA 1TCFA 3BOWB 4GGNA 1IKUA 2L4HA 1DMOA 1S36A 2M0RA 3I5FC 1NWDA 2L2EA 2AUCA 1R6PA 4C0LA 2O5GA 1L2OB 1SL9A 1WRKA 1YTZC 1B7TY 1EL4A 1XO5A 1XFZO 5HKYA 4YI9A 1S5GY 1QTXA 3WHUB 1K9KA 1BF5A 4JWQA 2LNKA 2KDHA 1LA3A 1YX8A 4HREE 3NSLA 1IWQA 1B7TZ 1WRLA 1S5GZ 2M8UA 5D7FA 4QJ3B 1CFPA 2JT0A 3AKAA 4PALA 1A75A 5PALA 3NSKA 1CKKA 2LP3A 5AXIA 1CM1A 1G33A 1A2XA 5DKQA 1FI5A 2K2AA 3LK1A 4ETOA 1QLKA 1ZOTB 4N1FA 2BL0C 3GK2A 1BMOA 3ZWHA 2F2PA 1CLLA 2HETA 1DF0A 1CFDA 4MRYA 1DJWA 1F54A 1A4PA 2LLUA 5F6TA 5B8IB 2WOSA 1KK8C 1Y6WA 1M31A 4DS7A 5CSFA 1OMVA 2QACA 1M46A 3VROA 2LM5A 1A03A 2I94A 4A4CA 1QS7A 2EHBA 1F70A 1X02A 4OV2A 1AJ4A 1HQVA 1QVIY 1B47A 1K8UA 2BE6A 1B1GA 2JULA 1AVSA 3E3RA 2K7DA 1B9AA 2AAOA 1DJXA 1XFUO 1XVJA 2HQWA 4N1GA 1SCMB 4JPZB 2F8PA 2BCXA 1BR4B 4MZJA 1BT6A 3EKJA 3SG3A 1QX2A 1QVIZ 2JZIA 2LUCA 1RJVA 1Y1XA 5DKRA 1IRJA 1UHJA 4Q04A 2KI4C 1JF0A 2KBIA 4P5OE 4DCKA 2LHLA 2JU0A 2PASA 3FS7A 4NDDA 4R1EA 2F2OA 4U8DA 1SR6C 3I5GC 1MQ1A 4GAOA 1G8IA 1NPQA 2L51A 1YUTA 2P6BB 3SG5A 5KTYA 5AANA 3EVUA 4CFRA 2I18A 3PATA 4N5XA 3DVJA 1AP4A 1CMFA 1DT7B 1KFXL 1QX7A 3A4UB 1J7RA 2L98A 4PE7A 1OSAA 2M1UA 1DTLA 1TTXA 5I2LA 1LINA 1WLZA 1YUSA 4MVFA 5HYDA 4GGFC 5I2OA 3CR4X 2L50A 5G08A 1CNPA 3CR2A 3BXKA 1BODA 2CBLA 5KU1A 2PVBA 4GPLB 2K2FA 4MSPA 1HT9A 1L7ZA 4WQ2A 3DVMA 1N2DA 3MSEB 2VRGA 3VRRA 2SASA 1UURA 3M0WA 3NSOA 1ZACA 2ZFDA 4PHMA 5TNCA 1CDLA 1NX0A 2LVVA 1QASA 1ODBA 1VRKA 2Y1MA 2Y5IA 2M97A 1MWNA 2ZN8A 5D69A 4BY5A 2M49B 2O60A 3DVEA 2AMIA 1LXFC 1SKTA 3KO0A 1KFUS 2JC2A 3D10A 2KSPA 3NSIA 1EG3A 1YVLA 4ORBB 5DKNA 4L9MA 3HCMA 3OX6A 1Y1AA 2KOTA 2HPSA 2V53A 4MLWA 5K89A 1IJ5A 5AEQA 1NX1A 1XFXO 2K7OA 3SJSA 1LKJA 2A4JA 2M1KB 1JBAA 5GQQC 3K21A 1IQ3A 4OCIA 3DF0A 1K94A 1KQVA 1C7VA 1DGUA 4OVNF 4AQJA 5HKZA 4MZKA 3IQQA 2K8MB 2KFHA 4AQIA 1FW4A 4HRHA 1S6CA 1XA5A 1TNWA 4GBAA 1LA0A 4YGDB 4GFTA 2KYCA 1DJYA 2CTNA 2FCDA 3JVTC 1FI6A 1GGZA 4YGAA 1YR5A 3KEVA 2JOJA 2QPTA 1RK9A 2Q91A 4M2QA 1PVAA 1C07A 2CCMA 2JT8A 3FIAA 1R2UA 1K9UA 1C7WA 2M7LA 1K2HA 1F71A 1PSBA 1PALA 4WQ3A 1BLQA 1IJ6A 2BCAA 3CS1A 1CDPA 1YURA 2PALA 1J1DA 2BKIB 2KI6C 4AOMA 2K61A 1U5IB 2BBMA 2GGZA 2KGBC 2FOTA 1TNXA 1EXRA 2LC5A 5CSNA 3TDZA 1DGVA 2LMUA 1TOPA 4PHNA 2IS9A 2NCOA 3VRQA 4D1EA 1FF1A 2ZNEA 2MLFC 3GOFA 1TIZA 2BKHB 2NLNA 1J55A 5ER4X 2HF5A 1XYDA 1RWYA 4M2OA 5AERA 2PMYA 3PALA 1SCVA 1V1FA 2ZRTA 3BUMB 4XJKA 1NSHA 3OP0A 5JJGA 1F55A 3BUNB 3PLFB 1ZUZA 3CZTX 1MHOA 1CLBA 1G4YR 3PM8A 1CDMA 2M9GA 4QJ5B 4YGBB 5FYXA 3TDUA 2MJWB 1WLMA 2OS8C 2LCPA 1WRZA 1OQPA 1BU3A 4NDCA 3F45A 2JNXA 1F4QA 2H2KA 3EK8A 2GV5A 1B4CA 1S6JA 3D0YB 3DD4A 2CNPA 4IL1A 2LMVA 2WCEA 2WNDA 3I5HC 3WNXB 1SBJA 3JVTB 3AKBA 1QX5B 2WC8A 3FWBA 1UUSA 3A8RA 2F3ZA 3IQOA 3LL8B 1S6IA 1UHHA 4PE1A 3BOWA 1M39A 1PVBA 1J7OA 1F4OA
chains in the Genus database with same CATH superfamily
2Y1NA 1Z4HA 3S0DA 1SYMA 3KHEA 4ORAB 1AHRA 1S26D 2KYFA 1CFCA 3BUXB 3D73A 1QATA 3O2PA 2LLTA 2JPTA 2JT3A 1JUOA 2JXLA 3KPXA 1XFVO 1H8BA 1RECA 3OB1B 1NCYA 3KF9A 1RTP1 4C0JA 3O6BA 1TNPA 1NP8A 1OOJA 1YX7A 3BQ3A 3SG2A 3SS3A 1MXEA 1A75B 1NCZA 2NCPA 3O78A 2LMTA 4GUKA 4GGFA 3PN7C 1ALVA 5CSJA 1KWOC 3S0BA 1W9ZA 2EC6B 1UWOA 2JRFA 2KAVA 3DXLA 1JFJA 2L4IA 1K90D 3UNWA 1DJGA 2H61C 1K93D 1FBVA 1KFXS 3B6XA 5CPVA 1DF0B 1DQEA 1UP5A 1V1GA 3I5IC 4MZLA 1IGVA 1SL7A 2KAXA 2MLEC 4I5JA 1H4BA 2PQLA 1PRWA 2JTTA 5JOLA 2KI6D 4CFQA 1RFJA 4CLNA 4HSZA 3FE9A 3EKHA 1OMRA 1PK0D 3BFAA 2FJUB 1A29A 3SG4A 1DVIA 2I2RE 3FWCA 1XK4C 3VB1A 1KCYA 2G2BA 2OS8B 1LVCD 1K96A 3DY9A 4YRUA 3CTNA 5BPJA 2MA2A 2FJYA 3BUWB 3CWGA 5D3OA 1CMGA 5I2QA 3AAKA 1IIOA 2KGRA 4PHKA 1IQ5A 1QV1A 2I7AA 2KFFA 1CB1A 1UHKA 1DJZA 1KK7Y 2PSRA 3D76A 1EH2A 3I5HB 4P2YB 4YGEB 3TUYB 2KQ6A 4C0KA 3Q8IA 1YRUB 2ZNDA 2WCHA 3SG7A 2NXQA 1OW4A 1TRFA 2BCBA 1FPWA 1KK7Z 4PDZA 4M2PA 1KQMC 2EGDA 2LE9B 3BFHA 4PHJA 1TN4A 2K0JA 3CGAA 2KBMA 3SIAA 3C1VA 1QIWA 4KYNA 3S0AA 3D0YA 4FQOA 1S1EA 2WCMA 1YUUA 5ER5A 1CFFA 1OE9B 5I94A 1ALWA 1GGWA 2LV7A 2KFGA 1QWVA 4WRIA 3TS5C 2KQYA 2LVJA 4ICBA 3GK4X 4A4BA 2LLSA 2B1UA 3BFBA 1SNLA 2KLDA 1MR8A 3QRXA 3PN7B 3WHTB 1AK8A 1KWOB 2DOQA 2NZ0A 2F3YA 3JTDC 2QEVA 4BY4A 1IH0A 4PT1A 1CM4A 1M63B 3ICBA 3D78A 3VRNA 4CPVA 2OTGB 1TUJA 2G9BA 1TWOA 3HX4A 2JNFA 2EC6C 2E30A 1GJYA 4TNCA 3SG6A 1SW8A 3I5IB 4QJ4B 3O4YA 1NX2A 5HLVA 5J3XA 4FQTA 1K9PA 1WDCC 2TN4A 2MBXA 3D75A 2CXJA 1DJIA 2WCJA 2Q4UA 2RGIA 4DUQA 2CT9A 1MUXA 1QV0A 1B8CA 4F0ZB 1BJFA 1SMGA 2JTZA 3D74A 3NXAA 1WY9A 1RROA 2LUXA 3H4SE 1KSOA 3IVTA 2L2CA 3OB2B 4CIDA 4DIRA 2KHNA 5AFPA 2K7BA 2JQ6A 4OR9B 1Y1UA 1AJ5A 2OPOA 1IG5A 2KNEA 5IBWA 2E6WA 2M7NA 5KSZA 2GTEA 1BG1A 4E68A 1J7QA 5I8NA 1NCXA 2BBNA 2JXCA 2LP2A 1B8RA 1J1EA 4USLA 4DRWA 1OMDA 2F33A 3LK0A 3OBVA 2M29A 4YI8A 3BJHA 3DF0B 1PULA 4JQ0D 3TUYC 4PE4A 1QJTA 1KQMB 1JWDA 1JFKA 2SCPA 2ISDA 3OX5A 2COLB 1NUBA 1XFYO 3RM1A 3CZ2A 1NIWA 4PCWA 1OZSA 2Y4QA 3EVVA 3PSRA 1OZOA 3GK1A 4I5LB 1B8LA 1NYAA 4ZCVA 1TCOB 1QLSA 3CLNA 1EG4A 4GNKB 1Z2CB 1NX3A 2KAYA 3I5FB 3TS5B 3S0GA 1DEKA 1XFWO 3L47A 4ORCB 2ZN9A 2WCBA 1BR1B 1ZMZA 1OOFA 1QXPA 4UPGA 5HKWA 2PYQA 3DVKA 3JTDB 3RLZA 2M3WA 3QMEA 1L2OC 2QEBA 3ZNIA 1J7PA 4HRGA 3SS4A 4MRXA 4NDBA 2WORA 1CTRA 1E8AA 1JF2A 1S3PA 3SIBA 3IF7A 3WXAA 2JWWA 2KLEA 3VGOA 2OTGC 1EJ3A 1YRTB 1C3ZA 4YBHB 1WDCB 3LLEA 1TNQA 4NQGA 3AAJA 1KFUL 2ZKMX 2BECA 1U5IA 4PE0A 1JSAA 1N65A 2BL0B 4XYNA 1AUIB 2H61A 2GGMA 1YVHA 2LAPA 2LVIA 1Q80A 4MN0A 1W7JB 2WCFA 1MF8B 2LHIA 3FE8A 3CR5X 1Y0VH 1QIVA 4MBEA 2MHHA 3OGNA 1KSMA 1BOCA 2FCEA 2K7CA 1KK8B 1F8HA 4XJKB 1N0YA 1XFRA 2D8NA 2LVKA 1GQMA 3TZ1A 3EVRA 3VRPA 1DJHA 3BUOB 1W7IB 3B7AA 5DICA 2LANA 2ZRSA 3FE6A 1M45A 1XK4A 3EK7A 1MXLC 2MAZA 2HQ8A 1SRAA 2R2IA 2L5XB 4OKHA 3LCPC 4I5KA 1PSRA 4FTGA 5K89A 1CDNA 2MRDA 3BYAA 1UHNA 1ZFSA 2YGUA 5HLOA 1LS8A 2KI4B 2L0PA 4MEWA 1SCMC 3S0EA 3RZSA 1ORGA 2BE4A 3PFVA 1SL8A 3B86A 4YGCB 3TDIA 1D1OA 1SK6D 4ZCUA 1CLMA 3EK4A 1JC2A 1SR6B 1UHIA 1K95A 1SY9A 2PRUA 1SPYA 2QEHA 2QEOA 3I5GB 3OHMB 1TCFA 3BOWB 4I5NB 4GGNA 1IKUA 2L4HA 4INWA 1DMOA 1S36A 2M0RA 3I5FC 3CZ0A 1NWDA 2L2EA 2AUCA 1R6PA 3L4LA 2O5GA 4C0LA 4OZDA 1L2OB 1SL9A 1DC1A 3L4AA 1WRKA 1YTZC 1B7TY 1EL4A 1XO5A 1XFZO 3CYZA 1OOHA 5HKYA 3S0FA 4YI9A 1S5GY 1QTXA 3WHUB 1K9KA 1BF5A 4JWQA 2LNKA 2KDHA 1LA3A 1YX8A 4HREE 3NSLA 1IWQA 1B7TZ 1WRLA 1S5GZ 2M8UA 5D7FA 4QJ3B 1CFPA 2JT0A 3AKAA 2WC6A 4PALA 1A75A 5PALA 3NSKA 1CKKA 1DELA 2LP3A 5AXIA 1CM1A 1G33A 1A2XA 2K60A 5DKQA 5FI7A 5HL1A 2K2AA 3LK1A 4ETOA 1QLKA 1ZOTB 4N1FA 2BL0C 3GK2A 1BMOA 4JD9A 3ZWHA 2F2PA 1CLLA 2HETA 1DF0A 1CFDA 4MRYA 1DJWA 1F54A 1A4PA 2LLUA 5F6TA 5B8IB 2WOSA 1KK8C 1Y6WA 1M31A 4DS7A 5CSFA 1OMVA 2QACA 1M46A 1OOGA 3R1OA 3VROA 2LM5A 1A03A 2I94A 4A4CA 1QS7A 2EHBA 1F70A 1X02A 3EG5B 4OV2A 5FI6A 1AJ4A 1HQVA 1QVIY 1B47A 1K8UA 2BE6A 1B1GA 2JULA 1AVSA 3CZ1A 3E3RA 2K7DA 1B9AA 3UO9A 2AAOA 1DJXA 1XFUO 1XVJA 2HQWA 4N1GA 1SCMB 4JPZB 2F8PA 2BCXA 1BR4B 4MZJA 1BT6A 3EKJA 3B87A 1QX2A 3SG3A 1QVIZ 2JZIA 2LUCA 1RJVA 1Y1XA 5DKRA 1IRJA 1UHJA 4Q04A 2KI4C 1JF0A 2KBIA 4P5OE 4DCKA 2LHLA 2WC5A 2JU0A 2PASA 3FS7A 4NDDA 4R1EA 2F2OA 4U8DA 1SR6C 3I5GC 1MQ1A 3DZTA 4GAOA 1G8IA 1NPQA 2L51A 1YUTA 2P6BB 3SG5A 5KTYA 5AANA 3EVUA 4CFRA 3V2LA 2I18A 2BAPA 3PATA 1OOIX 4N5XA 3DVJA 1AP4A 1CMFA 1DT7B 1KFXL 3NHIA 1QX7A 3A4UB 1J7RA 2L98A 4PE7A 1OSAA 2M1UA 1DTLA 1TTXA 5I2LA 1LINA 1WLZA 1YUSA 4MVFA 5HYDA 4GGFC 5I2OA 3CR4X 2L50A 5G08A 1CNPA 3CR2A 3BXKA 4JKTA 2CBLA 1BODA 5KU1A 2P71A 2PVBA 4GPLB 2K2FA 4MSPA 2H8VA 2ERBA 1HT9A 2WCKA 1L7ZA 4WQ2A 3DVMA 3R1VA 1N2DA 3MSEB 2VRGA 3VRRA 2SASA 1UURA 3M0WA 3NSOA 1ZACA 2ZFDA 4PHMA 5TNCA 1CDLA 1NX0A 2LVVA 1QASA 3NHTA 1ODBA 1VRKA 2Y1MA 2Y5IA 2M97A 1MWNA 2ZN8A 5D69A 4BY5A 2M49B 2O60A 3DVEA 2AMIA 1SSEB 1LXFC 1TUZA 1SKTA 3KO0A 1KFUS 2JC2A 3D10A 2KSPA 3NSIA 1EG3A 1YVLA 1C3YA 1T14A 2L5YA 4ORBB 5DKNA 4L9MA 3HCMA 3OX6A 1Y1AA 3SS5A 2KOTA 2HPSA 2QDIA 2V53A 3DYEA 1IJ5A 4MLWA 1NX1A 1XFXO 5AEQA 2K7OA 3SJSA 1LKJA 2A4JA 2M1KB 3CDNA 1JBAA 5GQQC 3K21A 1IQ3A 4OCIA 3DF0A 1K94A 1KQVA 1C7VA 1DGUA 3B88A 4OVNF 4AQJA 5HKZA 4MZKA 3IQQA 5EL2A 2K8MB 2KFHA 4AQIA 1FW4A 4HRHA 1S6CA 1XA5A 1TNWA 4GBAA 1LA0A 4YGDB 4GFTA 2KYCA 2KPHA 1DJYA 2CTNA 2FCDA 3JVTC 3D77A 1FI6A 1GGZA 4YGAA 1YR5A 3KEVA 2JOJA 2QPTA 1RK9A 2Q91A 3CABA 4M2QA 1PVAA 1C07A 2CCMA 2JT8A 3FIAA 1R2UA 3R1PA 1K9UA 4IJ7A 1C7WA 2M7LA 1K2HA 1F71A 5FI2A 1PSBA 4INXA 1PALA 4WQ3A 1BLQA 1IJ6A 1P28A 2BCAA 3CS1A 1CDPA 1YURA 3K1EA 2PALA 3NGVA 3PJIA 1J1DA 2BKIB 2KI6C 4AOMA 2K61A 1U5IB 2BBMA 2GGZA 3O4XA 2KGBC 2FOTA 1TNXA 1EXRA 2LC5A 5CSNA 3TDZA 1DGVA 2LMUA 1TOPA 4PHNA 2IS9A 2NCOA 3VRQA 4D1EA 1FF1A 2ZNEA 5CSIA 2MLFC 3GOFA 1TIZA 2BKHB 2JPOA 2NLNA 1J55A 5ER4X 2HF5A 1XYDA 2BNXA 1RWYA 4M2OA 2WCLA 5AERA 2PMYA 3PALA 1SCVA 3PM2A 1V1FA 1FI5A 2ZRTA 3BUMB 3R72A 4XJKA 4F7FA 1NSHA 3OP0A 5JJGA 1F55A 3BUNB 3PLFB 1ZUZA 3CZTX 1MHOA 1GM0A 1CLBA 1G4YR 3PM8A 1CDMA 2M9GA 4QJ5B 4YGBB 5FYXA 3TDUA 2MJWB 1WLMA 2OS8C 2LCPA 1WRZA 1OQPA 1BU3A 4NDCA 3F45A 2JNXA 1F4QA 2H2KA 3EK8A 2P70A 3N7HA 2GV5A 1B4CA 1S6JA 3D0YB 3DD4A 2CNPA 4IL1A 2LMVA 2WCEA 2WNDA 3I5HC 3WNXB 1SBJA 3JVTB 3AKBA 1QX5B 2WC8A 3FWBA 1UUSA 3A8RA 2F3ZA 3IQOA 3LL8B 1S6IA 1UHHA 4PE1A 3BOWA 1M39A 1PVBA 1J7OA 1F4OA
chains in the Genus database with same CATH topology
2Y1NA 1SYMA 3KHEA 4ORAB 1AHRA 1S26D 2KYFA 1CFCA 3BUXB 1QATA 3O2PA 2LLTA 2JPTA 2JT3A 1JUOA 2JXLA 3KPXA 1XFVO 1H8BA 1RECA 3OB1B 1NCYA 3KF9A 1RTP1 4C0JA 3O6BA 1TNPA 1NP8A 1OOJA 1YX7A 3BQ3A 3SG2A 1MXEA 1A75B 1NCZA 2NCPA 3O78A 2LMTA 4GUKA 4GGFA 3PN7C 1ALVA 5CSJA 1KWOC 2EC6B 2JRFA 1UWOA 2KAVA 1JFJA 2L4IA 1K90D 1DJGA 2H61C 1K93D 1FBVA 1KFXS 5CPVA 1DF0B 1UP5A 1V1GA 3I5IC 4MZLA 1IGVA 1SL7A 2KAXA 2MLEC 4I5JA 1H4BA 1PRWA 2JTTA 5JOLA 2KI6D 4CFQA 1RFJA 4CLNA 4HSZA 3EKHA 1OMRA 1PK0D 2FJUB 1A29A 3SG4A 1DVIA 2I2RE 3FWCA 1XK4C 1KCYA 2G2BA 2OS8B 1LVCD 1K96A 4YRUA 3CTNA 5BPJA 2MA2A 3BUWB 3CWGA 1CMGA 5I2QA 3AAKA 2KGRA 4PHKA 1IQ5A 1QV1A 2I7AA 2KFFA 1CB1A 1UHKA 1DJZA 1KK7Y 2PSRA 1EH2A 3I5HB 4P2YB 4YGEB 3TUYB 2KQ6A 4C0KA 1YRUB 2ZNDA 3SG7A 2NXQA 1TRFA 2BCBA 1FPWA 1KK7Z 4PDZA 4M2PA 1KQMC 2EGDA 2LE9B 4PHJA 1TN4A 2K0JA 3CGAA 2KBMA 3SIAA 3C1VA 1QIWA 3D0YA 4FQOA 1S1EA 1YUUA 5ER5A 1CFFA 1OE9B 1ALWA 1GGWA 2LV7A 2KFGA 4WRIA 3TS5C 2KQYA 2LVJA 4ICBA 3GK4X 4A4BA 2LLSA 2B1UA 3QRXA 1SNLA 3WHTB 1MR8A 3PN7B 1AK8A 1KWOB 2DOQA 2NZ0A 2F3YA 3JTDC 4BY4A 1IH0A 1CM4A 1M63B 3ICBA 3VRNA 4CPVA 2OTGB 2G9BA 3HX4A 2JNFA 2EC6C 2E30A 1GJYA 4TNCA 3SG6A 1SW8A 3I5IB 4QJ4B 3O4YA 1NX2A 5HLVA 5J3XA 1K9PA 1WDCC 2TN4A 2MBXA 2CXJA 1DJIA 2Q4UA 2RGIA 4DUQA 2CT9A 1MUXA 1QV0A 1B8CA 4F0ZB 1BJFA 1SMGA 2JTZA 3NXAA 1WY9A 1RROA 2LUXA 3H4SE 1KSOA 3OB2B 4CIDA 4DIRA 2KHNA 5AFPA 2K7BA 2JQ6A 4OR9B 1Y1UA 1AJ5A 2OPOA 1IG5A 2KNEA 5IBWA 2E6WA 2M7NA 5KSZA 1BG1A 1J7QA 4E68A 5I8NA 1NCXA 2BBNA 2JXCA 2LP2A 1B8RA 1J1EA 4USLA 4DRWA 1OMDA 2F33A 3LK0A 2M29A 4YI8A 3TUYC 3DF0B 1PULA 4JQ0D 4PE4A 1QJTA 1KQMB 1JWDA 1JFKA 2SCPA 2ISDA 3OX5A 2COLB 1NUBA 1XFYO 3RM1A 1NIWA 4PCWA 1OZSA 2Y4QA 3EVVA 3PSRA 1OZOA 3GK1A 4I5LB 1B8LA 1NYAA 4ZCVA 1TCOB 1QLSA 3CLNA 1EG4A 4GNKB 1NX3A 2KAYA 3I5FB 3TS5B 1XFWO 4ORCB 2ZN9A 2WCBA 1BR1B 1ZMZA 1QXPA 4UPGA 5HKWA 3DVKA 3JTDB 3RLZA 2M3WA 1L2OC 3ZNIA 1J7PA 4HRGA 4MRXA 4NDBA 2WORA 1CTRA 1E8AA 1JF2A 1S3PA 3SIBA 3IF7A 3WXAA 2JWWA 3VGOA 2OTGC 1EJ3A 1YRTB 4YBHB 1WDCB 3LLEA 1TNQA 4NQGA 3AAJA 1KFUL 2ZKMX 2BECA 1U5IA 4PE0A 1JSAA 1N65A 2BL0B 4XYNA 1AUIB 2H61A 2GGMA 1YVHA 2LAPA 2LVIA 1Q80A 4MN0A 1W7JB 2WCFA 1MF8B 2LHIA 3CR5X 1Y0VH 1QIVA 4MBEA 2MHHA 1KSMA 1BOCA 2FCEA 2K7CA 1KK8B 1F8HA 4XJKB 1N0YA 2D8NA 2LVKA 1GQMA 3TZ1A 3EVRA 3VRPA 1DJHA 3BUOB 1W7IB 2LANA 2ZRSA 1M45A 1XK4A 3EK7A 1MXLC 2MAZA 2HQ8A 1SRAA 2R2IA 2L5XB 4OKHA 3LCPC 4I5KA 1PSRA 4FTGA 1CDNA 2MRDA 3BYAA 1UHNA 1ZFSA 5HLOA 2L0PA 2KI4B 4MEWA 1SCMC 2BE4A 3PFVA 1SL8A 4YGCB 3TDIA 1D1OA 1SK6D 4ZCUA 1CLMA 3EK4A 1JC2A 1SR6B 1UHIA 1K95A 1SY9A 2PRUA 1SPYA 3I5GB 3OHMB 4I5NB 5CSIA 1TCFA 3BOWB 4GGNA 1IKUA 2L4HA 1DMOA 1S36A 2M0RA 3I5FC 1NWDA 2L2EA 2AUCA 1R6PA 4C0LA 2O5GA 1L2OB 1SL9A 1WRKA 1YTZC 1B7TY 1EL4A 1XO5A 1XFZO 5HKYA 4YI9A 1S5GY 1QTXA 3WHUB 1K9KA 1BF5A 4JWQA 2LNKA 2KDHA 1LA3A 1YX8A 4HREE 3NSLA 1IWQA 1B7TZ 1WRLA 1S5GZ 2M8UA 5D7FA 4QJ3B 1CFPA 2JT0A 3AKAA 4PALA 1A75A 5PALA 3NSKA 1CKKA 2LP3A 5AXIA 1CM1A 1G33A 1A2XA 5DKQA 1FI5A 2K2AA 3LK1A 4ETOA 1QLKA 1ZOTB 4N1FA 2BL0C 3GK2A 1BMOA 3ZWHA 2F2PA 1CLLA 2HETA 1DF0A 1CFDA 4MRYA 1DJWA 1F54A 1A4PA 2LLUA 5F6TA 5B8IB 2WOSA 1KK8C 1Y6WA 1M31A 4DS7A 5CSFA 1OMVA 2QACA 1M46A 3VROA 2LM5A 1A03A 2I94A 4A4CA 1QS7A 2EHBA 1F70A 1X02A 4OV2A 1AJ4A 1HQVA 1QVIY 1B47A 1K8UA 2BE6A 1B1GA 2JULA 1AVSA 3E3RA 2K7DA 1B9AA 2AAOA 1DJXA 1XFUO 1XVJA 2HQWA 4N1GA 1SCMB 4JPZB 2F8PA 2BCXA 1BR4B 4MZJA 1BT6A 3EKJA 3SG3A 1QX2A 1QVIZ 2JZIA 2LUCA 1RJVA 1Y1XA 5DKRA 1IRJA 1UHJA 4Q04A 2KI4C 1JF0A 2KBIA 4P5OE 4DCKA 2LHLA 2JU0A 2PASA 3FS7A 4NDDA 4R1EA 2F2OA 4U8DA 1SR6C 3I5GC 1MQ1A 4GAOA 1G8IA 1NPQA 2L51A 1YUTA 2P6BB 3SG5A 5KTYA 5AANA 3EVUA 4CFRA 2I18A 3PATA 4N5XA 3DVJA 1AP4A 1CMFA 1DT7B 1KFXL 1QX7A 3A4UB 1J7RA 2L98A 4PE7A 1OSAA 2M1UA 1DTLA 1TTXA 5I2LA 1LINA 1WLZA 1YUSA 4MVFA 5HYDA 4GGFC 5I2OA 3CR4X 2L50A 5G08A 1CNPA 3CR2A 3BXKA 1BODA 2CBLA 5KU1A 2PVBA 4GPLB 2K2FA 4MSPA 1HT9A 1L7ZA 4WQ2A 3DVMA 1N2DA 3MSEB 2VRGA 3VRRA 2SASA 1UURA 3M0WA 3NSOA 1ZACA 2ZFDA 4PHMA 5TNCA 1CDLA 1NX0A 2LVVA 1QASA 1ODBA 1VRKA 2Y1MA 2Y5IA 2M97A 1MWNA 2ZN8A 5D69A 4BY5A 2M49B 2O60A 3DVEA 2AMIA 1LXFC 1SKTA 3KO0A 1KFUS 2JC2A 3D10A 2KSPA 3NSIA 1EG3A 1YVLA 4ORBB 5DKNA 4L9MA 3HCMA 3OX6A 1Y1AA 2KOTA 2HPSA 2V53A 4MLWA 5K89A 1IJ5A 5AEQA 1NX1A 1XFXO 2K7OA 3SJSA 1LKJA 2A4JA 2M1KB 1JBAA 5GQQC 3K21A 1IQ3A 4OCIA 3DF0A 1K94A 1KQVA 1C7VA 1DGUA 4OVNF 4AQJA 5HKZA 4MZKA 3IQQA 2K8MB 2KFHA 4AQIA 1FW4A 4HRHA 1S6CA 1XA5A 1TNWA 4GBAA 1LA0A 4YGDB 4GFTA 2KYCA 1DJYA 2CTNA 2FCDA 3JVTC 1FI6A 1GGZA 4YGAA 1YR5A 3KEVA 2JOJA 2QPTA 1RK9A 2Q91A 4M2QA 1PVAA 1C07A 2CCMA 2JT8A 3FIAA 1R2UA 1K9UA 1C7WA 2M7LA 1K2HA 1F71A 1PSBA 1PALA 4WQ3A 1BLQA 1IJ6A 2BCAA 3CS1A 1CDPA 1YURA 2PALA 1J1DA 2BKIB 2KI6C 4AOMA 2K61A 1U5IB 2BBMA 2GGZA 2KGBC 2FOTA 1TNXA 1EXRA 2LC5A 5CSNA 3TDZA 1DGVA 2LMUA 1TOPA 4PHNA 2IS9A 2NCOA 3VRQA 4D1EA 1FF1A 2ZNEA 2MLFC 3GOFA 1TIZA 2BKHB 2NLNA 1J55A 5ER4X 2HF5A 1XYDA 1RWYA 4M2OA 5AERA 2PMYA 3PALA 1SCVA 1V1FA 2ZRTA 3BUMB 4XJKA 1NSHA 3OP0A 5JJGA 1F55A 3BUNB 3PLFB 1ZUZA 3CZTX 1MHOA 1CLBA 1G4YR 3PM8A 1CDMA 2M9GA 4QJ5B 4YGBB 5FYXA 3TDUA 2MJWB 1WLMA 2OS8C 2LCPA 1WRZA 1OQPA 1BU3A 4NDCA 3F45A 2JNXA 1F4QA 2H2KA 3EK8A 2GV5A 1B4CA 1S6JA 3D0YB 3DD4A 2CNPA 4IL1A 2LMVA 2WCEA 2WNDA 3I5HC 3WNXB 1SBJA 3JVTB 3AKBA 1QX5B 2WC8A 3FWBA 1UUSA 3A8RA 2F3ZA 3IQOA 3LL8B 1S6IA 1UHHA 4PE1A 3BOWA 1M39A 1PVBA 1J7OA 1F4OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Y1N A;  1SYM A;  3KHE A;  4ORA B;  1AHR A;  1S26 D;  2KYF A;  1CFC A;  3BUX B;  1QAT A;  3O2P A;  2LLT A;  2JPT A;  2JT3 A;  1JUO A;  2JXL A;  3KPX A;  1XFV O;  1H8B A;  1REC A;  3OB1 B;  1NCY A;  3KF9 A;  1RTP 1;  4C0J A;  3O6B A;  1TNP A;  1NP8 A;  1OOJ A;  1YX7 A;  3BQ3 A;  3SG2 A;  1MXE A;  1A75 B;  1NCZ A;  2NCP A;  3O78 A;  2LMT A;  4GUK A;  4GGF A;  3PN7 C;  1ALV A;  5CSJ A;  1KWO C;  2EC6 B;  2JRF A;  1UWO A;  2KAV A;  1JFJ A;  2L4I A;  1K90 D;  1DJG A;  2H61 C;  1K93 D;  1FBV A;  1KFX S;  5CPV A;  1DF0 B;  1UP5 A;  1V1G A;  3I5I C;  4MZL A;  1IGV A;  1SL7 A;  2KAX A;  2MLE C;  4I5J A;  1H4B A;  1PRW A;  2JTT A;  5JOL A;  2KI6 D;  4CFQ A;  1RFJ A;  4CLN A;  4HSZ A;  3EKH A;  1OMR A;  1PK0 D;  2FJU B;  1A29 A;  3SG4 A;  1DVI A;  2I2R E;  3FWC A;  1XK4 C;  1KCY A;  2G2B A;  2OS8 B;  1LVC D;  1K96 A;  4YRU A;  3CTN A;  5BPJ A;  2MA2 A;  3BUW B;  3CWG A;  1CMG A;  5I2Q A;  3AAK A;  2KGR A;  4PHK A;  1IQ5 A;  1QV1 A;  2I7A A;  2KFF A;  1CB1 A;  1UHK A;  1DJZ A;  1KK7 Y;  2PSR A;  1EH2 A;  3I5H B;  4P2Y B;  4YGE B;  3TUY B;  2KQ6 A;  4C0K A;  1YRU B;  2ZND A;  3SG7 A;  2NXQ A;  1TRF A;  2BCB A;  1FPW A;  1KK7 Z;  4PDZ A;  4M2P A;  1KQM C;  2EGD A;  2LE9 B;  4PHJ A;  1TN4 A;  2K0J A;  3CGA A;  2KBM A;  3SIA A;  3C1V A;  1QIW A;  3D0Y A;  4FQO A;  1S1E A;  1YUU A;  5ER5 A;  1CFF A;  1OE9 B;  1ALW A;  1GGW A;  2LV7 A;  2KFG A;  4WRI A;  3TS5 C;  2KQY A;  2LVJ A;  4ICB A;  3GK4 X;  4A4B A;  2LLS A;  2B1U A;  3QRX A;  1SNL A;  3WHT B;  1MR8 A;  3PN7 B;  1AK8 A;  1KWO B;  2DOQ A;  2NZ0 A;  2F3Y A;  3JTD C;  4BY4 A;  1IH0 A;  1CM4 A;  1M63 B;  3ICB A;  3VRN A;  4CPV A;  2OTG B;  2G9B A;  3HX4 A;  2JNF A;  2EC6 C;  2E30 A;  1GJY A;  4TNC A;  3SG6 A;  1SW8 A;  3I5I B;  4QJ4 B;  3O4Y A;  1NX2 A;  5HLV A;  5J3X A;  1K9P A;  1WDC C;  2TN4 A;  2MBX A;  2CXJ A;  1DJI A;  2Q4U A;  2RGI A;  4DUQ A;  2CT9 A;  1MUX A;  1QV0 A;  1B8C A;  4F0Z B;  1BJF A;  1SMG A;  2JTZ A;  3NXA A;  1WY9 A;  1RRO A;  2LUX A;  3H4S E;  1KSO A;  3OB2 B;  4CID A;  4DIR A;  2KHN A;  5AFP A;  2K7B A;  2JQ6 A;  4OR9 B;  1Y1U A;  1AJ5 A;  2OPO A;  1IG5 A;  2KNE A;  5IBW A;  2E6W A;  2M7N A;  5KSZ A;  1BG1 A;  1J7Q A;  4E68 A;  5I8N A;  1NCX A;  2BBN A;  2JXC A;  2LP2 A;  1B8R A;  1J1E A;  4USL A;  4DRW A;  1OMD A;  2F33 A;  3LK0 A;  2M29 A;  4YI8 A;  3TUY C;  3DF0 B;  1PUL A;  4JQ0 D;  4PE4 A;  1QJT A;  1KQM B;  1JWD A;  1JFK A;  2SCP A;  2ISD A;  3OX5 A;  2COL B;  1NUB A;  1XFY O;  3RM1 A;  1NIW A;  4PCW A;  1OZS A;  2Y4Q A;  3EVV A;  3PSR A;  1OZO A;  3GK1 A;  4I5L B;  1B8L A;  1NYA A;  4ZCV A;  1TCO B;  1QLS A;  3CLN A;  1EG4 A;  4GNK B;  1NX3 A;  2KAY A;  3I5F B;  3TS5 B;  1XFW O;  4ORC B;  2ZN9 A;  2WCB A;  1BR1 B;  1ZMZ A;  1QXP A;  4UPG A;  5HKW A;  3DVK A;  3JTD B;  3RLZ A;  2M3W A;  1L2O C;  3ZNI A;  1J7P A;  4HRG A;  4MRX A;  4NDB A;  2WOR A;  1CTR A;  1E8A A;  1JF2 A;  1S3P A;  3SIB A;  3IF7 A;  3WXA A;  2JWW A;  3VGO A;  2OTG C;  1EJ3 A;  1YRT B;  4YBH B;  1WDC B;  3LLE A;  1TNQ A;  4NQG A;  3AAJ A;  1KFU L;  2ZKM X;  2BEC A;  1U5I A;  4PE0 A;  1JSA A;  1N65 A;  2BL0 B;  4XYN A;  1AUI B;  2H61 A;  2GGM A;  1YVH A;  2LAP A;  2LVI A;  1Q80 A;  4MN0 A;  1W7J B;  2WCF A;  1MF8 B;  2LHI A;  3CR5 X;  1Y0V H;  1QIV A;  4MBE A;  2MHH A;  1KSM A;  1BOC A;  2FCE A;  2K7C A;  1KK8 B;  1F8H A;  4XJK B;  1N0Y A;  2D8N A;  2LVK A;  1GQM A;  3TZ1 A;  3EVR A;  3VRP A;  1DJH A;  3BUO B;  1W7I B;  2LAN A;  2ZRS A;  1M45 A;  1XK4 A;  3EK7 A;  1MXL C;  2MAZ A;  2HQ8 A;  1SRA A;  2R2I A;  2L5X B;  4OKH A;  3LCP C;  4I5K A;  1PSR A;  4FTG A;  1CDN A;  2MRD A;  3BYA A;  1UHN A;  1ZFS A;  5HLO A;  2L0P A;  2KI4 B;  4MEW A;  1SCM C;  2BE4 A;  3PFV A;  1SL8 A;  4YGC B;  3TDI A;  1D1O A;  1SK6 D;  4ZCU A;  1CLM A;  3EK4 A;  1JC2 A;  1SR6 B;  1UHI A;  1K95 A;  1SY9 A;  2PRU A;  1SPY A;  3I5G B;  3OHM B;  4I5N B;  5CSI A;  1TCF A;  3BOW B;  4GGN A;  1IKU A;  2L4H A;  1DMO A;  1S36 A;  2M0R A;  3I5F C;  1NWD A;  2L2E A;  2AUC A;  1R6P A;  4C0L A;  2O5G A;  1L2O B;  1SL9 A;  1WRK A;  1YTZ C;  1B7T Y;  1EL4 A;  1XO5 A;  1XFZ O;  5HKY A;  4YI9 A;  1S5G Y;  1QTX A;  3WHU B;  1K9K A;  1BF5 A;  4JWQ A;  2LNK A;  2KDH A;  1LA3 A;  1YX8 A;  4HRE E;  3NSL A;  1IWQ A;  1B7T Z;  1WRL A;  1S5G Z;  2M8U A;  5D7F A;  4QJ3 B;  1CFP A;  2JT0 A;  3AKA A;  4PAL A;  1A75 A;  5PAL A;  3NSK A;  1CKK A;  2LP3 A;  5AXI A;  1CM1 A;  1G33 A;  1A2X A;  5DKQ A;  1FI5 A;  2K2A A;  3LK1 A;  4ETO A;  1QLK A;  1ZOT B;  4N1F A;  2BL0 C;  3GK2 A;  1BMO A;  3ZWH A;  2F2P A;  1CLL A;  2HET A;  1DF0 A;  1CFD A;  4MRY A;  1DJW A;  1F54 A;  1A4P A;  2LLU A;  5F6T A;  5B8I B;  2WOS A;  1KK8 C;  1Y6W A;  1M31 A;  4DS7 A;  5CSF A;  1OMV A;  2QAC A;  1M46 A;  3VRO A;  2LM5 A;  1A03 A;  2I94 A;  4A4C A;  1QS7 A;  2EHB A;  1F70 A;  1X02 A;  4OV2 A;  1AJ4 A;  1HQV A;  1QVI Y;  1B47 A;  1K8U A;  2BE6 A;  1B1G A;  2JUL A;  1AVS A;  3E3R A;  2K7D A;  1B9A A;  2AAO A;  1DJX A;  1XFU O;  1XVJ A;  2HQW A;  4N1G A;  1SCM B;  4JPZ B;  2F8P A;  2BCX A;  1BR4 B;  4MZJ A;  1BT6 A;  3EKJ A;  3SG3 A;  1QX2 A;  1QVI Z;  2JZI A;  2LUC A;  1RJV A;  1Y1X A;  5DKR A;  1IRJ A;  1UHJ A;  4Q04 A;  2KI4 C;  1JF0 A;  2KBI A;  4P5O E;  4DCK A;  2LHL A;  2JU0 A;  2PAS A;  3FS7 A;  4NDD A;  4R1E A;  2F2O A;  4U8D A;  1SR6 C;  3I5G C;  1MQ1 A;  4GAO A;  1G8I A;  1NPQ A;  2L51 A;  1YUT A;  2P6B B;  3SG5 A;  5KTY A;  5AAN A;  3EVU A;  4CFR A;  2I18 A;  3PAT A;  4N5X A;  3DVJ A;  1AP4 A;  1CMF A;  1DT7 B;  1KFX L;  1QX7 A;  3A4U B;  1J7R A;  2L98 A;  4PE7 A;  1OSA A;  2M1U A;  1DTL A;  1TTX A;  5I2L A;  1LIN A;  1WLZ A;  1YUS A;  4MVF A;  5HYD A;  4GGF C;  5I2O A;  3CR4 X;  2L50 A;  5G08 A;  1CNP A;  3CR2 A;  3BXK A;  1BOD A;  2CBL A;  5KU1 A;  2PVB A;  4GPL B;  2K2F A;  4MSP A;  1HT9 A;  1L7Z A;  4WQ2 A;  3DVM A;  1N2D A;  3MSE B;  2VRG A;  3VRR A;  2SAS A;  1UUR A;  3M0W A;  3NSO A;  1ZAC A;  2ZFD A;  4PHM A;  5TNC A;  1CDL A;  1NX0 A;  2LVV A;  1QAS A;  1ODB A;  1VRK A;  2Y1M A;  2Y5I A;  2M97 A;  1MWN A;  2ZN8 A;  5D69 A;  4BY5 A;  2M49 B;  2O60 A;  3DVE A;  2AMI A;  1LXF C;  1SKT A;  3KO0 A;  1KFU S;  2JC2 A;  3D10 A;  2KSP A;  3NSI A;  1EG3 A;  1YVL A;  4ORB B;  5DKN A;  4L9M A;  3HCM A;  3OX6 A;  1Y1A A;  2KOT A;  2HPS A;  2V53 A;  4MLW A;  5K89 A;  1IJ5 A;  5AEQ A;  1NX1 A;  1XFX O;  2K7O A;  3SJS A;  1LKJ A;  2A4J A;  2M1K B;  1JBA A;  5GQQ C;  3K21 A;  1IQ3 A;  4OCI A;  3DF0 A;  1K94 A;  1KQV A;  1C7V A;  1DGU A;  4OVN F;  4AQJ A;  5HKZ A;  4MZK A;  3IQQ A;  2K8M B;  2KFH A;  4AQI A;  1FW4 A;  4HRH A;  1S6C A;  1XA5 A;  1TNW A;  4GBA A;  1LA0 A;  4YGD B;  4GFT A;  2KYC A;  1DJY A;  2CTN A;  2FCD A;  3JVT C;  1FI6 A;  1GGZ A;  4YGA A;  1YR5 A;  3KEV A;  2JOJ A;  2QPT A;  1RK9 A;  2Q91 A;  4M2Q A;  1PVA A;  1C07 A;  2CCM A;  2JT8 A;  3FIA A;  1R2U A;  1K9U A;  1C7W A;  2M7L A;  1K2H A;  1F71 A;  1PSB A;  1PAL A;  4WQ3 A;  1BLQ A;  1IJ6 A;  2BCA A;  3CS1 A;  1CDP A;  1YUR A;  2PAL A;  1J1D A;  2BKI B;  2KI6 C;  4AOM A;  2K61 A;  1U5I B;  2BBM A;  2GGZ A;  2KGB C;  2FOT A;  1TNX A;  1EXR A;  2LC5 A;  5CSN A;  3TDZ A;  1DGV A;  2LMU A;  1TOP A;  4PHN A;  2IS9 A;  2NCO A;  3VRQ A;  4D1E A;  1FF1 A;  2ZNE A;  2MLF C;  3GOF A;  1TIZ A;  2BKH B;  2NLN A;  1J55 A;  5ER4 X;  2HF5 A;  1XYD A;  1RWY A;  4M2O A;  5AER A;  2PMY A;  3PAL A;  1SCV A;  1V1F A;  2ZRT A;  3BUM B;  4XJK A;  1NSH A;  3OP0 A;  5JJG A;  1F55 A;  3BUN B;  3PLF B;  1ZUZ A;  3CZT X;  1MHO A;  1CLB A;  1G4Y R;  3PM8 A;  1CDM A;  2M9G A;  4QJ5 B;  4YGB B;  5FYX A;  3TDU A;  2MJW B;  1WLM A;  2OS8 C;  2LCP A;  1WRZ A;  1OQP A;  1BU3 A;  4NDC A;  3F45 A;  2JNX A;  1F4Q A;  2H2K A;  3EK8 A;  2GV5 A;  1B4C A;  1S6J A;  3D0Y B;  3DD4 A;  2CNP A;  4IL1 A;  2LMV A;  2WCE A;  2WND A;  3I5H C;  3WNX B;  1SBJ A;  3JVT B;  3AKB A;  1QX5 B;  2WC8 A;  3FWB A;  1UUS A;  3A8R A;  2F3Z A;  3IQO A;  3LL8 B;  1S6I A;  1UHH A;  4PE1 A;  3BOW A;  1M39 A;  1PVB A;  1J7O A;  1F4O A; 
#chains in the Genus database with same CATH topology
 2Y1N A;  1Z4H A;  3S0D A;  1SYM A;  3KHE A;  4ORA B;  1AHR A;  1S26 D;  2KYF A;  1CFC A;  3BUX B;  3D73 A;  1QAT A;  3O2P A;  2LLT A;  2JPT A;  2JT3 A;  1JUO A;  2JXL A;  3KPX A;  1XFV O;  1H8B A;  1REC A;  3OB1 B;  1NCY A;  3KF9 A;  1RTP 1;  4C0J A;  3O6B A;  1TNP A;  1NP8 A;  1OOJ A;  1YX7 A;  3BQ3 A;  3SG2 A;  3SS3 A;  1MXE A;  1A75 B;  1NCZ A;  2NCP A;  3O78 A;  2LMT A;  4GUK A;  4GGF A;  3PN7 C;  1ALV A;  5CSJ A;  1KWO C;  3S0B A;  1W9Z A;  2EC6 B;  1UWO A;  2JRF A;  2KAV A;  3DXL A;  1JFJ A;  2L4I A;  1K90 D;  3UNW A;  1DJG A;  2H61 C;  1K93 D;  1FBV A;  1KFX S;  3B6X A;  5CPV A;  1DF0 B;  1DQE A;  1UP5 A;  1V1G A;  3I5I C;  4MZL A;  1IGV A;  1SL7 A;  2KAX A;  2MLE C;  4I5J A;  1H4B A;  2PQL A;  1PRW A;  2JTT A;  5JOL A;  2KI6 D;  4CFQ A;  1RFJ A;  4CLN A;  4HSZ A;  3FE9 A;  3EKH A;  1OMR A;  1PK0 D;  3BFA A;  2FJU B;  1A29 A;  3SG4 A;  1DVI A;  2I2R E;  3FWC A;  1XK4 C;  3VB1 A;  1KCY A;  2G2B A;  2OS8 B;  1LVC D;  1K96 A;  3DY9 A;  4YRU A;  3CTN A;  5BPJ A;  2MA2 A;  2FJY A;  3BUW B;  3CWG A;  5D3O A;  1CMG A;  5I2Q A;  3AAK A;  1IIO A;  2KGR A;  4PHK A;  1IQ5 A;  1QV1 A;  2I7A A;  2KFF A;  1CB1 A;  1UHK A;  1DJZ A;  1KK7 Y;  2PSR A;  3D76 A;  1EH2 A;  3I5H B;  4P2Y B;  4YGE B;  3TUY B;  2KQ6 A;  4C0K A;  3Q8I A;  1YRU B;  2ZND A;  2WCH A;  3SG7 A;  2NXQ A;  1OW4 A;  1TRF A;  2BCB A;  1FPW A;  1KK7 Z;  4PDZ A;  4M2P A;  1KQM C;  2EGD A;  2LE9 B;  3BFH A;  4PHJ A;  1TN4 A;  2K0J A;  3CGA A;  2KBM A;  3SIA A;  3C1V A;  1QIW A;  4KYN A;  3S0A A;  3D0Y A;  4FQO A;  1S1E A;  2WCM A;  1YUU A;  5ER5 A;  1CFF A;  1OE9 B;  5I94 A;  1ALW A;  1GGW A;  2LV7 A;  2KFG A;  1QWV A;  4WRI A;  3TS5 C;  2KQY A;  2LVJ A;  4ICB A;  3GK4 X;  4A4B A;  2LLS A;  2B1U A;  3BFB A;  1SNL A;  2KLD A;  1MR8 A;  3QRX A;  3PN7 B;  3WHT B;  1AK8 A;  1KWO B;  2DOQ A;  2NZ0 A;  2F3Y A;  3JTD C;  2QEV A;  4BY4 A;  1IH0 A;  4PT1 A;  1CM4 A;  1M63 B;  3ICB A;  3D78 A;  3VRN A;  4CPV A;  2OTG B;  1TUJ A;  2G9B A;  1TWO A;  3HX4 A;  2JNF A;  2EC6 C;  2E30 A;  1GJY A;  4TNC A;  3SG6 A;  1SW8 A;  3I5I B;  4QJ4 B;  3O4Y A;  1NX2 A;  5HLV A;  5J3X A;  4FQT A;  1K9P A;  1WDC C;  2TN4 A;  2MBX A;  3D75 A;  2CXJ A;  1DJI A;  2WCJ A;  2Q4U A;  2RGI A;  4DUQ A;  2CT9 A;  1MUX A;  1QV0 A;  1B8C A;  4F0Z B;  1BJF A;  1SMG A;  2JTZ A;  3D74 A;  3NXA A;  1WY9 A;  1RRO A;  2LUX A;  3H4S E;  1KSO A;  3IVT A;  2L2C A;  3OB2 B;  4CID A;  4DIR A;  2KHN A;  5AFP A;  2K7B A;  2JQ6 A;  4OR9 B;  1Y1U A;  1AJ5 A;  2OPO A;  1IG5 A;  2KNE A;  5IBW A;  2E6W A;  2M7N A;  5KSZ A;  2GTE A;  1BG1 A;  4E68 A;  1J7Q A;  5I8N A;  1NCX A;  2BBN A;  2JXC A;  2LP2 A;  1B8R A;  1J1E A;  4USL A;  4DRW A;  1OMD A;  2F33 A;  3LK0 A;  3OBV A;  2M29 A;  4YI8 A;  3BJH A;  3DF0 B;  1PUL A;  4JQ0 D;  3TUY C;  4PE4 A;  1QJT A;  1KQM B;  1JWD A;  1JFK A;  2SCP A;  2ISD A;  3OX5 A;  2COL B;  1NUB A;  1XFY O;  3RM1 A;  3CZ2 A;  1NIW A;  4PCW A;  1OZS A;  2Y4Q A;  3EVV A;  3PSR A;  1OZO A;  3GK1 A;  4I5L B;  1B8L A;  1NYA A;  4ZCV A;  1TCO B;  1QLS A;  3CLN A;  1EG4 A;  4GNK B;  1Z2C B;  1NX3 A;  2KAY A;  3I5F B;  3TS5 B;  3S0G A;  1DEK A;  1XFW O;  3L47 A;  4ORC B;  2ZN9 A;  2WCB A;  1BR1 B;  1ZMZ A;  1OOF A;  1QXP A;  4UPG A;  5HKW A;  2PYQ A;  3DVK A;  3JTD B;  3RLZ A;  2M3W A;  3QME A;  1L2O C;  2QEB A;  3ZNI A;  1J7P A;  4HRG A;  3SS4 A;  4MRX A;  4NDB A;  2WOR A;  1CTR A;  1E8A A;  1JF2 A;  1S3P A;  3SIB A;  3IF7 A;  3WXA A;  2JWW A;  2KLE A;  3VGO A;  2OTG C;  1EJ3 A;  1YRT B;  1C3Z A;  4YBH B;  1WDC B;  3LLE A;  1TNQ A;  4NQG A;  3AAJ A;  1KFU L;  2ZKM X;  2BEC A;  1U5I A;  4PE0 A;  1JSA A;  1N65 A;  2BL0 B;  4XYN A;  1AUI B;  2H61 A;  2GGM A;  1YVH A;  2LAP A;  2LVI A;  1Q80 A;  4MN0 A;  1W7J B;  2WCF A;  1MF8 B;  2LHI A;  3FE8 A;  3CR5 X;  1Y0V H;  1QIV A;  4MBE A;  2MHH A;  3OGN A;  1KSM A;  1BOC A;  2FCE A;  2K7C A;  1KK8 B;  1F8H A;  4XJK B;  1N0Y A;  1XFR A;  2D8N A;  2LVK A;  1GQM A;  3TZ1 A;  3EVR A;  3VRP A;  1DJH A;  3BUO B;  1W7I B;  3B7A A;  5DIC A;  2LAN A;  2ZRS A;  3FE6 A;  1M45 A;  1XK4 A;  3EK7 A;  1MXL C;  2MAZ A;  2HQ8 A;  1SRA A;  2R2I A;  2L5X B;  4OKH A;  3LCP C;  4I5K A;  1PSR A;  4FTG A;  5K89 A;  1CDN A;  2MRD A;  3BYA A;  1UHN A;  1ZFS A;  2YGU A;  5HLO A;  1LS8 A;  2KI4 B;  2L0P A;  4MEW A;  1SCM C;  3S0E A;  3RZS A;  1ORG A;  2BE4 A;  3PFV A;  1SL8 A;  3B86 A;  4YGC B;  3TDI A;  1D1O A;  1SK6 D;  4ZCU A;  1CLM A;  3EK4 A;  1JC2 A;  1SR6 B;  1UHI A;  1K95 A;  1SY9 A;  2PRU A;  1SPY A;  2QEH A;  2QEO A;  3I5G B;  3OHM B;  1TCF A;  3BOW B;  4I5N B;  4GGN A;  1IKU A;  2L4H A;  4INW A;  1DMO A;  1S36 A;  2M0R A;  3I5F C;  3CZ0 A;  1NWD A;  2L2E A;  2AUC A;  1R6P A;  3L4L A;  2O5G A;  4C0L A;  4OZD A;  1L2O B;  1SL9 A;  1DC1 A;  3L4A A;  1WRK A;  1YTZ C;  1B7T Y;  1EL4 A;  1XO5 A;  1XFZ O;  3CYZ A;  1OOH A;  5HKY A;  3S0F A;  4YI9 A;  1S5G Y;  1QTX A;  3WHU B;  1K9K A;  1BF5 A;  4JWQ A;  2LNK A;  2KDH A;  1LA3 A;  1YX8 A;  4HRE E;  3NSL A;  1IWQ A;  1B7T Z;  1WRL A;  1S5G Z;  2M8U A;  5D7F A;  4QJ3 B;  1CFP A;  2JT0 A;  3AKA A;  2WC6 A;  4PAL A;  1A75 A;  5PAL A;  3NSK A;  1CKK A;  1DEL A;  2LP3 A;  5AXI A;  1CM1 A;  1G33 A;  1A2X A;  2K60 A;  5DKQ A;  5FI7 A;  5HL1 A;  2K2A A;  3LK1 A;  4ETO A;  1QLK A;  1ZOT B;  4N1F A;  2BL0 C;  3GK2 A;  1BMO A;  4JD9 A;  3ZWH A;  2F2P A;  1CLL A;  2HET A;  1DF0 A;  1CFD A;  4MRY A;  1DJW A;  1F54 A;  1A4P A;  2LLU A;  5F6T A;  5B8I B;  2WOS A;  1KK8 C;  1Y6W A;  1M31 A;  4DS7 A;  5CSF A;  1OMV A;  2QAC A;  1M46 A;  1OOG A;  3R1O A;  3VRO A;  2LM5 A;  1A03 A;  2I94 A;  4A4C A;  1QS7 A;  2EHB A;  1F70 A;  1X02 A;  3EG5 B;  4OV2 A;  5FI6 A;  1AJ4 A;  1HQV A;  1QVI Y;  1B47 A;  1K8U A;  2BE6 A;  1B1G A;  2JUL A;  1AVS A;  3CZ1 A;  3E3R A;  2K7D A;  1B9A A;  3UO9 A;  2AAO A;  1DJX A;  1XFU O;  1XVJ A;  2HQW A;  4N1G A;  1SCM B;  4JPZ B;  2F8P A;  2BCX A;  1BR4 B;  4MZJ A;  1BT6 A;  3EKJ A;  3B87 A;  1QX2 A;  3SG3 A;  1QVI Z;  2JZI A;  2LUC A;  1RJV A;  1Y1X A;  5DKR A;  1IRJ A;  1UHJ A;  4Q04 A;  2KI4 C;  1JF0 A;  2KBI A;  4P5O E;  4DCK A;  2LHL A;  2WC5 A;  2JU0 A;  2PAS A;  3FS7 A;  4NDD A;  4R1E A;  2F2O A;  4U8D A;  1SR6 C;  3I5G C;  1MQ1 A;  3DZT A;  4GAO A;  1G8I A;  1NPQ A;  2L51 A;  1YUT A;  2P6B B;  3SG5 A;  5KTY A;  5AAN A;  3EVU A;  4CFR A;  3V2L A;  2I18 A;  2BAP A;  3PAT A;  1OOI X;  4N5X A;  3DVJ A;  1AP4 A;  1CMF A;  1DT7 B;  1KFX L;  3NHI A;  1QX7 A;  3A4U B;  1J7R A;  2L98 A;  4PE7 A;  1OSA A;  2M1U A;  1DTL A;  1TTX A;  5I2L A;  1LIN A;  1WLZ A;  1YUS A;  4MVF A;  5HYD A;  4GGF C;  5I2O A;  3CR4 X;  2L50 A;  5G08 A;  1CNP A;  3CR2 A;  3BXK A;  4JKT A;  2CBL A;  1BOD A;  5KU1 A;  2P71 A;  2PVB A;  4GPL B;  2K2F A;  4MSP A;  2H8V A;  2ERB A;  1HT9 A;  2WCK A;  1L7Z A;  4WQ2 A;  3DVM A;  3R1V A;  1N2D A;  3MSE B;  2VRG A;  3VRR A;  2SAS A;  1UUR A;  3M0W A;  3NSO A;  1ZAC A;  2ZFD A;  4PHM A;  5TNC A;  1CDL A;  1NX0 A;  2LVV A;  1QAS A;  3NHT A;  1ODB A;  1VRK A;  2Y1M A;  2Y5I A;  2M97 A;  1MWN A;  2ZN8 A;  5D69 A;  4BY5 A;  2M49 B;  2O60 A;  3DVE A;  2AMI A;  1SSE B;  1LXF C;  1TUZ A;  1SKT A;  3KO0 A;  1KFU S;  2JC2 A;  3D10 A;  2KSP A;  3NSI A;  1EG3 A;  1YVL A;  1C3Y A;  1T14 A;  2L5Y A;  4ORB B;  5DKN A;  4L9M A;  3HCM A;  3OX6 A;  1Y1A A;  3SS5 A;  2KOT A;  2HPS A;  2QDI A;  2V53 A;  3DYE A;  1IJ5 A;  4MLW A;  1NX1 A;  1XFX O;  5AEQ A;  2K7O A;  3SJS A;  1LKJ A;  2A4J A;  2M1K B;  3CDN A;  1JBA A;  5GQQ C;  3K21 A;  1IQ3 A;  4OCI A;  3DF0 A;  1K94 A;  1KQV A;  1C7V A;  1DGU A;  3B88 A;  4OVN F;  4AQJ A;  5HKZ A;  4MZK A;  3IQQ A;  5EL2 A;  2K8M B;  2KFH A;  4AQI A;  1FW4 A;  4HRH A;  1S6C A;  1XA5 A;  1TNW A;  4GBA A;  1LA0 A;  4YGD B;  4GFT A;  2KYC A;  2KPH A;  1DJY A;  2CTN A;  2FCD A;  3JVT C;  3D77 A;  1FI6 A;  1GGZ A;  4YGA A;  1YR5 A;  3KEV A;  2JOJ A;  2QPT A;  1RK9 A;  2Q91 A;  3CAB A;  4M2Q A;  1PVA A;  1C07 A;  2CCM A;  2JT8 A;  3FIA A;  1R2U A;  3R1P A;  1K9U A;  4IJ7 A;  1C7W A;  2M7L A;  1K2H A;  1F71 A;  5FI2 A;  1PSB A;  4INX A;  1PAL A;  4WQ3 A;  1BLQ A;  1IJ6 A;  1P28 A;  2BCA A;  3CS1 A;  1CDP A;  1YUR A;  3K1E A;  2PAL A;  3NGV A;  3PJI A;  1J1D A;  2BKI B;  2KI6 C;  4AOM A;  2K61 A;  1U5I B;  2BBM A;  2GGZ A;  3O4X A;  2KGB C;  2FOT A;  1TNX A;  1EXR A;  2LC5 A;  5CSN A;  3TDZ A;  1DGV A;  2LMU A;  1TOP A;  4PHN A;  2IS9 A;  2NCO A;  3VRQ A;  4D1E A;  1FF1 A;  2ZNE A;  5CSI A;  2MLF C;  3GOF A;  1TIZ A;  2BKH B;  2JPO A;  2NLN A;  1J55 A;  5ER4 X;  2HF5 A;  1XYD A;  2BNX A;  1RWY A;  4M2O A;  2WCL A;  5AER A;  2PMY A;  3PAL A;  1SCV A;  3PM2 A;  1V1F A;  1FI5 A;  2ZRT A;  3BUM B;  3R72 A;  4XJK A;  4F7F A;  1NSH A;  3OP0 A;  5JJG A;  1F55 A;  3BUN B;  3PLF B;  1ZUZ A;  3CZT X;  1MHO A;  1GM0 A;  1CLB A;  1G4Y R;  3PM8 A;  1CDM A;  2M9G A;  4QJ5 B;  4YGB B;  5FYX A;  3TDU A;  2MJW B;  1WLM A;  2OS8 C;  2LCP A;  1WRZ A;  1OQP A;  1BU3 A;  4NDC A;  3F45 A;  2JNX A;  1F4Q A;  2H2K A;  3EK8 A;  2P70 A;  3N7H A;  2GV5 A;  1B4C A;  1S6J A;  3D0Y B;  3DD4 A;  2CNP A;  4IL1 A;  2LMV A;  2WCE A;  2WND A;  3I5H C;  3WNX B;  1SBJ A;  3JVT B;  3AKB A;  1QX5 B;  2WC8 A;  3FWB A;  1UUS A;  3A8R A;  2F3Z A;  3IQO A;  3LL8 B;  1S6I A;  1UHH A;  4PE1 A;  3BOW A;  1M39 A;  1PVB A;  1J7O A;  1F4O A; 
#chains in the Genus database with same CATH homology
 2Y1N A;  1SYM A;  3KHE A;  4ORA B;  1AHR A;  1S26 D;  2KYF A;  1CFC A;  3BUX B;  1QAT A;  3O2P A;  2LLT A;  2JPT A;  2JT3 A;  1JUO A;  2JXL A;  3KPX A;  1XFV O;  1H8B A;  1REC A;  3OB1 B;  1NCY A;  3KF9 A;  1RTP 1;  4C0J A;  3O6B A;  1TNP A;  1NP8 A;  1OOJ A;  1YX7 A;  3BQ3 A;  3SG2 A;  1MXE A;  1A75 B;  1NCZ A;  2NCP A;  3O78 A;  2LMT A;  4GUK A;  4GGF A;  3PN7 C;  1ALV A;  5CSJ A;  1KWO C;  2EC6 B;  2JRF A;  1UWO A;  2KAV A;  1JFJ A;  2L4I A;  1K90 D;  1DJG A;  2H61 C;  1K93 D;  1FBV A;  1KFX S;  5CPV A;  1DF0 B;  1UP5 A;  1V1G A;  3I5I C;  4MZL A;  1IGV A;  1SL7 A;  2KAX A;  2MLE C;  4I5J A;  1H4B A;  1PRW A;  2JTT A;  5JOL A;  2KI6 D;  4CFQ A;  1RFJ A;  4CLN A;  4HSZ A;  3EKH A;  1OMR A;  1PK0 D;  2FJU B;  1A29 A;  3SG4 A;  1DVI A;  2I2R E;  3FWC A;  1XK4 C;  1KCY A;  2G2B A;  2OS8 B;  1LVC D;  1K96 A;  4YRU A;  3CTN A;  5BPJ A;  2MA2 A;  3BUW B;  3CWG A;  1CMG A;  5I2Q A;  3AAK A;  2KGR A;  4PHK A;  1IQ5 A;  1QV1 A;  2I7A A;  2KFF A;  1CB1 A;  1UHK A;  1DJZ A;  1KK7 Y;  2PSR A;  1EH2 A;  3I5H B;  4P2Y B;  4YGE B;  3TUY B;  2KQ6 A;  4C0K A;  1YRU B;  2ZND A;  3SG7 A;  2NXQ A;  1TRF A;  2BCB A;  1FPW A;  1KK7 Z;  4PDZ A;  4M2P A;  1KQM C;  2EGD A;  2LE9 B;  4PHJ A;  1TN4 A;  2K0J A;  3CGA A;  2KBM A;  3SIA A;  3C1V A;  1QIW A;  3D0Y A;  4FQO A;  1S1E A;  1YUU A;  5ER5 A;  1CFF A;  1OE9 B;  1ALW A;  1GGW A;  2LV7 A;  2KFG A;  4WRI A;  3TS5 C;  2KQY A;  2LVJ A;  4ICB A;  3GK4 X;  4A4B A;  2LLS A;  2B1U A;  3QRX A;  1SNL A;  3WHT B;  1MR8 A;  3PN7 B;  1AK8 A;  1KWO B;  2DOQ A;  2NZ0 A;  2F3Y A;  3JTD C;  4BY4 A;  1IH0 A;  1CM4 A;  1M63 B;  3ICB A;  3VRN A;  4CPV A;  2OTG B;  2G9B A;  3HX4 A;  2JNF A;  2EC6 C;  2E30 A;  1GJY A;  4TNC A;  3SG6 A;  1SW8 A;  3I5I B;  4QJ4 B;  3O4Y A;  1NX2 A;  5HLV A;  5J3X A;  1K9P A;  1WDC C;  2TN4 A;  2MBX A;  2CXJ A;  1DJI A;  2Q4U A;  2RGI A;  4DUQ A;  2CT9 A;  1MUX A;  1QV0 A;  1B8C A;  4F0Z B;  1BJF A;  1SMG A;  2JTZ A;  3NXA A;  1WY9 A;  1RRO A;  2LUX A;  3H4S E;  1KSO A;  3OB2 B;  4CID A;  4DIR A;  2KHN A;  5AFP A;  2K7B A;  2JQ6 A;  4OR9 B;  1Y1U A;  1AJ5 A;  2OPO A;  1IG5 A;  2KNE A;  5IBW A;  2E6W A;  2M7N A;  5KSZ A;  1BG1 A;  1J7Q A;  4E68 A;  5I8N A;  1NCX A;  2BBN A;  2JXC A;  2LP2 A;  1B8R A;  1J1E A;  4USL A;  4DRW A;  1OMD A;  2F33 A;  3LK0 A;  2M29 A;  4YI8 A;  3TUY C;  3DF0 B;  1PUL A;  4JQ0 D;  4PE4 A;  1QJT A;  1KQM B;  1JWD A;  1JFK A;  2SCP A;  2ISD A;  3OX5 A;  2COL B;  1NUB A;  1XFY O;  3RM1 A;  1NIW A;  4PCW A;  1OZS A;  2Y4Q A;  3EVV A;  3PSR A;  1OZO A;  3GK1 A;  4I5L B;  1B8L A;  1NYA A;  4ZCV A;  1TCO B;  1QLS A;  3CLN A;  1EG4 A;  4GNK B;  1NX3 A;  2KAY A;  3I5F B;  3TS5 B;  1XFW O;  4ORC B;  2ZN9 A;  2WCB A;  1BR1 B;  1ZMZ A;  1QXP A;  4UPG A;  5HKW A;  3DVK A;  3JTD B;  3RLZ A;  2M3W A;  1L2O C;  3ZNI A;  1J7P A;  4HRG A;  4MRX A;  4NDB A;  2WOR A;  1CTR A;  1E8A A;  1JF2 A;  1S3P A;  3SIB A;  3IF7 A;  3WXA A;  2JWW A;  3VGO A;  2OTG C;  1EJ3 A;  1YRT B;  4YBH B;  1WDC B;  3LLE A;  1TNQ A;  4NQG A;  3AAJ A;  1KFU L;  2ZKM X;  2BEC A;  1U5I A;  4PE0 A;  1JSA A;  1N65 A;  2BL0 B;  4XYN A;  1AUI B;  2H61 A;  2GGM A;  1YVH A;  2LAP A;  2LVI A;  1Q80 A;  4MN0 A;  1W7J B;  2WCF A;  1MF8 B;  2LHI A;  3CR5 X;  1Y0V H;  1QIV A;  4MBE A;  2MHH A;  1KSM A;  1BOC A;  2FCE A;  2K7C A;  1KK8 B;  1F8H A;  4XJK B;  1N0Y A;  2D8N A;  2LVK A;  1GQM A;  3TZ1 A;  3EVR A;  3VRP A;  1DJH A;  3BUO B;  1W7I B;  2LAN A;  2ZRS A;  1M45 A;  1XK4 A;  3EK7 A;  1MXL C;  2MAZ A;  2HQ8 A;  1SRA A;  2R2I A;  2L5X B;  4OKH A;  3LCP C;  4I5K A;  1PSR A;  4FTG A;  1CDN A;  2MRD A;  3BYA A;  1UHN A;  1ZFS A;  5HLO A;  2L0P A;  2KI4 B;  4MEW A;  1SCM C;  2BE4 A;  3PFV A;  1SL8 A;  4YGC B;  3TDI A;  1D1O A;  1SK6 D;  4ZCU A;  1CLM A;  3EK4 A;  1JC2 A;  1SR6 B;  1UHI A;  1K95 A;  1SY9 A;  2PRU A;  1SPY A;  3I5G B;  3OHM B;  4I5N B;  5CSI A;  1TCF A;  3BOW B;  4GGN A;  1IKU A;  2L4H A;  1DMO A;  1S36 A;  2M0R A;  3I5F C;  1NWD A;  2L2E A;  2AUC A;  1R6P A;  4C0L A;  2O5G A;  1L2O B;  1SL9 A;  1WRK A;  1YTZ C;  1B7T Y;  1EL4 A;  1XO5 A;  1XFZ O;  5HKY A;  4YI9 A;  1S5G Y;  1QTX A;  3WHU B;  1K9K A;  1BF5 A;  4JWQ A;  2LNK A;  2KDH A;  1LA3 A;  1YX8 A;  4HRE E;  3NSL A;  1IWQ A;  1B7T Z;  1WRL A;  1S5G Z;  2M8U A;  5D7F A;  4QJ3 B;  1CFP A;  2JT0 A;  3AKA A;  4PAL A;  1A75 A;  5PAL A;  3NSK A;  1CKK A;  2LP3 A;  5AXI A;  1CM1 A;  1G33 A;  1A2X A;  5DKQ A;  1FI5 A;  2K2A A;  3LK1 A;  4ETO A;  1QLK A;  1ZOT B;  4N1F A;  2BL0 C;  3GK2 A;  1BMO A;  3ZWH A;  2F2P A;  1CLL A;  2HET A;  1DF0 A;  1CFD A;  4MRY A;  1DJW A;  1F54 A;  1A4P A;  2LLU A;  5F6T A;  5B8I B;  2WOS A;  1KK8 C;  1Y6W A;  1M31 A;  4DS7 A;  5CSF A;  1OMV A;  2QAC A;  1M46 A;  3VRO A;  2LM5 A;  1A03 A;  2I94 A;  4A4C A;  1QS7 A;  2EHB A;  1F70 A;  1X02 A;  4OV2 A;  1AJ4 A;  1HQV A;  1QVI Y;  1B47 A;  1K8U A;  2BE6 A;  1B1G A;  2JUL A;  1AVS A;  3E3R A;  2K7D A;  1B9A A;  2AAO A;  1DJX A;  1XFU O;  1XVJ A;  2HQW A;  4N1G A;  1SCM B;  4JPZ B;  2F8P A;  2BCX A;  1BR4 B;  4MZJ A;  1BT6 A;  3EKJ A;  3SG3 A;  1QX2 A;  1QVI Z;  2JZI A;  2LUC A;  1RJV A;  1Y1X A;  5DKR A;  1IRJ A;  1UHJ A;  4Q04 A;  2KI4 C;  1JF0 A;  2KBI A;  4P5O E;  4DCK A;  2LHL A;  2JU0 A;  2PAS A;  3FS7 A;  4NDD A;  4R1E A;  2F2O A;  4U8D A;  1SR6 C;  3I5G C;  1MQ1 A;  4GAO A;  1G8I A;  1NPQ A;  2L51 A;  1YUT A;  2P6B B;  3SG5 A;  5KTY A;  5AAN A;  3EVU A;  4CFR A;  2I18 A;  3PAT A;  4N5X A;  3DVJ A;  1AP4 A;  1CMF A;  1DT7 B;  1KFX L;  1QX7 A;  3A4U B;  1J7R A;  2L98 A;  4PE7 A;  1OSA A;  2M1U A;  1DTL A;  1TTX A;  5I2L A;  1LIN A;  1WLZ A;  1YUS A;  4MVF A;  5HYD A;  4GGF C;  5I2O A;  3CR4 X;  2L50 A;  5G08 A;  1CNP A;  3CR2 A;  3BXK A;  1BOD A;  2CBL A;  5KU1 A;  2PVB A;  4GPL B;  2K2F A;  4MSP A;  1HT9 A;  1L7Z A;  4WQ2 A;  3DVM A;  1N2D A;  3MSE B;  2VRG A;  3VRR A;  2SAS A;  1UUR A;  3M0W A;  3NSO A;  1ZAC A;  2ZFD A;  4PHM A;  5TNC A;  1CDL A;  1NX0 A;  2LVV A;  1QAS A;  1ODB A;  1VRK A;  2Y1M A;  2Y5I A;  2M97 A;  1MWN A;  2ZN8 A;  5D69 A;  4BY5 A;  2M49 B;  2O60 A;  3DVE A;  2AMI A;  1LXF C;  1SKT A;  3KO0 A;  1KFU S;  2JC2 A;  3D10 A;  2KSP A;  3NSI A;  1EG3 A;  1YVL A;  4ORB B;  5DKN A;  4L9M A;  3HCM A;  3OX6 A;  1Y1A A;  2KOT A;  2HPS A;  2V53 A;  4MLW A;  5K89 A;  1IJ5 A;  5AEQ A;  1NX1 A;  1XFX O;  2K7O A;  3SJS A;  1LKJ A;  2A4J A;  2M1K B;  1JBA A;  5GQQ C;  3K21 A;  1IQ3 A;  4OCI A;  3DF0 A;  1K94 A;  1KQV A;  1C7V A;  1DGU A;  4OVN F;  4AQJ A;  5HKZ A;  4MZK A;  3IQQ A;  2K8M B;  2KFH A;  4AQI A;  1FW4 A;  4HRH A;  1S6C A;  1XA5 A;  1TNW A;  4GBA A;  1LA0 A;  4YGD B;  4GFT A;  2KYC A;  1DJY A;  2CTN A;  2FCD A;  3JVT C;  1FI6 A;  1GGZ A;  4YGA A;  1YR5 A;  3KEV A;  2JOJ A;  2QPT A;  1RK9 A;  2Q91 A;  4M2Q A;  1PVA A;  1C07 A;  2CCM A;  2JT8 A;  3FIA A;  1R2U A;  1K9U A;  1C7W A;  2M7L A;  1K2H A;  1F71 A;  1PSB A;  1PAL A;  4WQ3 A;  1BLQ A;  1IJ6 A;  2BCA A;  3CS1 A;  1CDP A;  1YUR A;  2PAL A;  1J1D A;  2BKI B;  2KI6 C;  4AOM A;  2K61 A;  1U5I B;  2BBM A;  2GGZ A;  2KGB C;  2FOT A;  1TNX A;  1EXR A;  2LC5 A;  5CSN A;  3TDZ A;  1DGV A;  2LMU A;  1TOP A;  4PHN A;  2IS9 A;  2NCO A;  3VRQ A;  4D1E A;  1FF1 A;  2ZNE A;  2MLF C;  3GOF A;  1TIZ A;  2BKH B;  2NLN A;  1J55 A;  5ER4 X;  2HF5 A;  1XYD A;  1RWY A;  4M2O A;  5AER A;  2PMY A;  3PAL A;  1SCV A;  1V1F A;  2ZRT A;  3BUM B;  4XJK A;  1NSH A;  3OP0 A;  5JJG A;  1F55 A;  3BUN B;  3PLF B;  1ZUZ A;  3CZT X;  1MHO A;  1CLB A;  1G4Y R;  3PM8 A;  1CDM A;  2M9G A;  4QJ5 B;  4YGB B;  5FYX A;  3TDU A;  2MJW B;  1WLM A;  2OS8 C;  2LCP A;  1WRZ A;  1OQP A;  1BU3 A;  4NDC A;  3F45 A;  2JNX A;  1F4Q A;  2H2K A;  3EK8 A;  2GV5 A;  1B4C A;  1S6J A;  3D0Y B;  3DD4 A;  2CNP A;  4IL1 A;  2LMV A;  2WCE A;  2WND A;  3I5H C;  3WNX B;  1SBJ A;  3JVT B;  3AKB A;  1QX5 B;  2WC8 A;  3FWB A;  1UUS A;  3A8R A;  2F3Z A;  3IQO A;  3LL8 B;  1S6I A;  1UHH A;  4PE1 A;  3BOW A;  1M39 A;  1PVB A;  1J7O A;  1F4O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...