2ZN8A

Crystal structure of zn2+-bound form of alg-2
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
166
structure length
166
Chain Sequence
SFLWNVFQRVDKDRSGVISDTELQQALSNGTWTPFNPVTVRSIISMFDRENKAGVNFSEFTGVWKYITDWQNVFRTYDRDNSGMIDKNELKQALSGFGYRLSDQFHDILIRKFDRQGRGQIAFDDFIQGCIVLQRLTDIFRRYDTDQDGWIQVSYEQYLSMVFSIV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Apoptosis
molecule keywords Programmed cell death protein 6
publication title Structural Basis for Ca(2+)-Dependent Formation of ALG-2/Alix Peptide Complex: Ca(2+)/EF3-Driven Arginine Switch Mechanism
pubmed doi rcsb
source organism Homo sapiens
total genus 57
structure length 166
sequence length 166
ec nomenclature
pdb deposition date 2008-04-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13202 EF-hand_5 EF hand
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2zn8A00
5HKZA 1SNLA 1AHRA 1KQMC 2O5GA 1OMVA 4I5LB 2BE6A 2VRGA 1CKKA 4A4BA 3TDIA 1B8RA 1N2DA 1PVBA 2EHBA 1QXPA 1NIWA 2LUCA 1PALA 5KU1A 1H4BA 1B7TY 2KI6D 1MF8B 4CIDA 2GGZA 1QLKA 2CCMA 2I18A 1KFXS 1FI5A 2M29A 4WQ2A 5AANA 5AEQA 4GBAA 5BPJA 1YRUB 2CT9A 1MXEA 2M1KB 4OVNF 3SG3A 4YRUA 1MWNA 3LCPC 4OV2A 2ZN9A 1KQMB 3NSKA 4USLA 4MSPA 1XFVO 1BJFA 1A75A 1ODBA 4F0ZB 2KAVA 1NYAA 3I5HC 1S26D 2TN4A 2Y5IA 2ZRTA 2MLFC 2KI4C 4A4CA 1NWDA 1TIZA 1FW4A 2JQ6A 3F45A 1SL9A 3H4SE 3WHUB 5AERA 1CLMA 4GFTA 2KFHA 1OMRA 3NSOA 1CNPA 2M1UA 2LE9B 5HLOA 3GK4X 3SG7A 2PALA 4DIRA 2ZRSA 2Q91A 4MRXA 1Y1UA 2KBMA 1TNXA 4MBEA 3RM1A 1G33A 4QJ5B 3OX5A 3SG4A 2GGMA 1YUSA 1TRFA 2OS8B 3AAJA 3D0YA 5HKYA 1A29A 1L2OC 3CZTX 1YVHA 1IQ5A 4M2PA 3I5HB 4BY5A 1IJ5A 2KGBC 5HYDA 1XFUO 1NSHA 3M0WA 2KBIA 1VRKA 3NSIA 1OQPA 1DJXA 4YI9A 1JC2A 1IG5A 1LVCD 1F71A 2ZNEA 3BXKA 4PDZA 3TS5C 1EH2A 2JWWA 1QS7A 1K9PA 1DF0A 5D7FA 3GK1A 1SL8A 2Q4UA 4I5NB 3RLZA 3BUXB 5TNCA 2JXCA 1SK6D 3EK8A 4I5JA 1ZMZA 4MVFA 4PE4A 2LVIA 2KQYA 4NDDA 4JPZB 3WXAA 4AQIA 4ZCVA 1L2OB 1Y1AA 3EVVA 1TNQA 4YBHB 3I5IB 4ORAB 1DJWA 1KFXL 5JOLA 1TN4A 1YVLA 1AVSA 5DKNA 2MAZA 3TS5B 1WDCC 3LL8B 2CNPA 1CFFA 2JT8A 3EK4A 2ZN8A 3PLFB 4PHNA 1B8CA 3AKBA 2MA2A 1IRJA 3ZWHA 1DJZA 1UHNA 1CFDA 2BL0B 1S1EA 1K2HA 2KAXA 1UHIA 3WNXB 1JF2A 4GPLB 1Y1XA 4Q04A 4CPVA 1EG3A 1KSMA 1S5GZ 2F2OA 1A4PA 1RWYA 2Y1NA 1S6CA 2JNXA 1DF0B 2KI6C 5CPVA 1DGUA 1B4CA 2COLB 1WDCB 4YGBB 1QVIZ 1IGVA 2KDHA 1A2XA 1KSOA 5GQQC 2HF5A 2NCOA 2BECA 1B1GA 1AK8A 5I2LA 3HX4A 2KGRA 1J7QA 1S6JA 5CSFA 2JT0A 2D8NA 2M8UA 4WQ3A 4CFQA 3JTDC 2K7DA 3KEVA 2FCEA 1PSRA 1J7OA 2LP2A 4C0KA 1QX5B 4YI8A 1GQMA 1RTP1 4YGAA 1KK7Z 2QACA 1XK4C 2M97A 3SG6A 4YGCB 3SG2A 1KWOC 3I5GB 1OE9B 2I2RE 1N65A 4NQGA 5HKWA 5I2QA 1KCYA 2JTZA 3EKHA 2WNDA 3BOWA 3C1VA 2M7LA 1KK8B 2K7OA 4GGNA 3SIAA 4YGDB 3VROA 2KQ6A 4DS7A 2H61A 1NCZA 3JTDB 1IH0A 1SCVA 1CFPA 1HT9A 3DD4A 1NUBA 4QJ4B 1CFCA 3BUNB 1F8HA 2JZIA 3GK2A 3SIBA 2LAPA 3FWBA 2L4IA 1HQVA 1W7JB 1DJHA 1UHHA 2R2IA 1Y6WA 1C7VA 2RGIA 1SY9A 3O78A 2LV7A 2FJUB 1KWOB 3KF9A 1LXFC 2KYCA 1F4QA 2MHHA 1H8BA 3VRNA 1WRKA 2LUXA 3KHEA 4HREE 1B8LA 2OS8C 2L98A 3AAKA 3DVKA 1F54A 4UPGA 3LLEA 1FBVA 1BR1B 1EG4A 1SPYA 3PFVA 1QX2A 1K95A 1YX8A 2AUCA 1AJ4A 5B8IB 1OMDA 1RJVA 3I5FB 5JJGA 1MR8A 2M3WA 3DF0A 1OZSA 3PM8A 3BOWB 2O60A 2KAYA 1QLSA 2V53A 1GGWA 3VGOA 2CTNA 2K7CA 3EK7A 4GGFA 1GGZA 1NCXA 1TNWA 3BUOB 1YTZC 1S36A 1FF1A 1R6PA 2LC5A 3I5IC 3DVMA 2JNFA 1YR5A 4XYNA 1GJYA 1XFXO 1QX7A 1AP4A 5AFPA 3BUMB 4HRGA 2LMVA 5IBWA 1KFUS 1LKJA 1FI6A 2EC6B 3SJSA 3BYAA 3CS1A 1SRAA 1CDPA 2M9GA 1A75B 2P6BB 1NX1A 5G08A 1BR4B 4ORCB 1B7TZ 4MZKA 1UHKA 3EVRA 1J1EA 1OOJA 2BL0C 2WCFA 2L2EA 4E68A 2LLSA 5PALA 4MEWA 1JSAA 1CDMA 5K89A 2LHLA 5HLVA 1XYDA 4OKHA 2H2KA 1DJGA 3FS7A 1UURA 5D69A 1XFYO 2LHIA 1FPWA 2LVKA 5AXIA 2F8PA 1OSAA 3CR4X 3D0YB 1DT7B 4PHKA 2FOTA 2CXJA 4IL1A 1F4OA 1M31A 2KFFA 2B1UA 2OPOA 3A8RA 4MN0A 1CM1A 1F70A 4U8DA 2LMUA 3PATA 2I7AA 1YRTB 1WRZA 4C0JA 1XFWO 1N0YA 2K2AA 3KPXA 3PN7C 4BY4A 2K61A 2LP3A 2LLUA 1IKUA 1C07A 3OB2B 1G4YR 1BOCA 4ETOA 2PRUA 4MRYA 5ER5A 1MUXA 1BMOA 1SL7A 2LCPA 1PRWA 3I5GC 2L5XB 3JVTC 4GUKA 1DVIA 3VRQA 1M46A 1K94A 1K96A 3CR5X 3FIAA 2Y4QA 3OP0A 4N5XA 2F33A 4MZLA 1BT6A 1KK8C 4PE7A 4L9MA 5J3XA 3SG5A 3TDUA 2JTTA 1CDLA 4GAOA 3CTNA 2PMYA 3PN7B 1KFUL 2M49B 1TNPA 2F2PA 1NCYA 1K9UA 3LK0A 1M63B 2AMIA 1MQ1A 2AAOA 1S6IA 3VRPA 1AJ5A 1SR6B 1TCOB 3TUYC 2LANA 1EL4A 3JVTB 2OTGC 2FCDA 1EJ3A 1LA3A 3ICBA 1K93D 2LM5A 1SCMC 2SCPA 1ZUZA 3ZNIA 1ALVA 2JPTA 4CLNA 4P5OE 2HQWA 2Y1MA 1K9KA 1QTXA 1QIVA 5KSZA 2KFGA 2ZKMX 4NDBA 1DGVA 4N1FA 2LVVA 4DRWA 1QASA 1M45A 1Y0VH 1TCFA 4DUQA 4PHMA 4M2OA 3BUWB 3I5FC 5DKRA 2MBXA 1B9AA 2LNKA 2HQ8A 4OR9B 3TUYB 4NDCA 1SYMA 2LVJA 4ZCUA 2OTGB 3AKAA 1K8UA 5DKQA 1RECA 1B47A 1SCMB 2H61C 1BLQA 2EGDA 1CDNA 1UP5A 1JFJA 2K2FA 3BQ3A 1XVJA 1PSBA 4D1EA 1YUUA 1XFZO 3OHMB 2NZ0A 1J7PA 5KTYA 3LK1A 2G9BA 3DVEA 1SMGA 2IS9A 1QV0A 1V1FA 4AOMA 2L0PA 2EC6C 3DVJA 1XA5A 1IJ6A 2MLEC 2F3ZA 2I94A 3KO0A 1CLLA 1JWDA 1K90D 1KQVA 1JBAA 4ICBA 3O2PA 2E6WA 3O4YA 1ALWA 3A4UB 1DMOA 2WORA 1TOPA 1F55A 1CMFA 3FWCA 1CMGA 1QV1A 5I8NA 2JULA 1EXRA 2JOJA 4WRIA 2PVBA 2SASA 2WCEA 4C0LA 1S5GY 1Q80A 2HETA 1V1GA 3PSRA 4OCIA 1DJIA 3HCMA 5CSIA 4GGFC 3NXAA 2QPTA 2DOQA 2F3YA 4R1EA 1QVIY 4TNCA 5CSNA 2KOTA 5F6TA 1QIWA 2K8MB 1ZACA 1SKTA 1ZOTB 2BCAA 2JXLA 1NX3A 1PULA 1NP8A 1JF0A 1A03A 1G8IA 1E8AA 1TTXA 2KI4B 1SBJA 2G2BA 1U5IA 5ER4X 1YUTA 3DF0B 2KHNA 1NPQA 1RK9A 2K0JA 3IQOA 1RROA 5I2OA 1KK7Y 4ORBB 2JRFA 2BBMA 1R2UA 4MZJA 3O6BA 2LMTA 1UUSA 1ZFSA 4CFRA 3OX6A 2BBNA 4HSZA 1MHOA 1WLMA 2BKIB 3VRRA 1CLBA 4XJKA 2BCXA 3CGAA 3IF7A 2MRDA 2A4JA 4PALA 2WC8A 2E30A 1CM4A 1YX7A 3QRXA 2CBLA 1JFKA 1J1DA 1SW8A 2M7NA 4GNKB 2KSPA 2JC2A 2ZFDA 3D10A 2PSRA 2BE4A 1SR6C 3EKJA 3CLNA 2JU0A 1BF5A 4I5KA 3CR2A 1OZOA 3PALA 5CSJA 2M0RA 3E3RA 3MSEB 1C7WA 1W7IB 2ZNDA 1WY9A 2BKHB 2NCPA 5FYXA 2JT3A 2NLNA 4HRHA 2BCBA 4N1GA 1U5IB 1CTRA 1DJYA 1D1OA 2LLTA 1JUOA 1NX0A 4JQ0D 1J55A 1PK0D 1QJTA 1BU3A 3TZ1A 1LINA 3EVUA 4M2QA 4PE1A 1BG1A 2KYFA 2HPSA 1DTLA 2L51A 1QATA 3OB1B 2L50A 1XK4A 3IQQA 1IWQA 2ISDA 1WLZA 4P2YB 4YGEB 1BODA 3NSLA 1IQ3A 4QJ3B 1X02A 4XJKB 1LA0A 4PCWA 1L7ZA 4DCKA 1RFJA 1J7RA 3GOFA 4FTGA 1NX2A 2K7BA 1WRLA 4PE0A 2KNEA 4PHJA 1M39A 3TDZA 4MLWA 1AUIB 1YURA 2L4HA 2MJWB 2WOSA 4FQOA 4AQJA 1CB1A 1XO5A 4JWQA 1UWOA 2NXQA 2GV5A 1MXLC 3K21A 1UHJA 2PASA 3WHTB 1PVAA 3CWGA 1S3PA 2WCBA
chains in the Genus database with same CATH superfamily
5HKZA 1SNLA 4INWA 1AHRA 1KQMC 2O5GA 1OMVA 4I5LB 1DC1A 2BE6A 2VRGA 1CKKA 4A4BA 3TDIA 1B8RA 1N2DA 1PVBA 2EHBA 1QXPA 1NIWA 2LUCA 1PALA 5KU1A 3L4AA 1H4BA 1B7TY 2KI6D 1MF8B 4CIDA 1XFRA 2GGZA 1QLKA 2CCMA 2L5YA 2I18A 1KFXS 1FI5A 2M29A 4WQ2A 5AANA 5AEQA 4GBAA 5BPJA 1YRUB 2CT9A 1MXEA 2M1KB 4OVNF 3SG3A 4YRUA 1MWNA 3LCPC 4OV2A 2ZN9A 1KQMB 3NSKA 2YGUA 4USLA 4MSPA 1XFVO 1BJFA 1A75A 1ODBA 3SS5A 4F0ZB 2KAVA 1NYAA 1ORGA 3I5HC 1S26D 2TN4A 2Y5IA 2ZRTA 2MLFC 2KI4C 4A4CA 4INXA 1NWDA 1TIZA 1FW4A 2JQ6A 3F45A 1SL9A 3H4SE 2K60A 4OZDA 3WHUB 1CLMA 4GFTA 2KFHA 5AERA 1OMRA 3NSOA 1CNPA 2KLEA 2M1UA 2LE9B 5HLOA 3GK4X 3SG7A 2PALA 1TWOA 4DIRA 2WC5A 2ZRSA 2Q91A 4MRXA 1Y1UA 2KBMA 1TNXA 4MBEA 3RM1A 1G33A 4QJ5B 3OX5A 3SG4A 2GGMA 1YUSA 1TRFA 2OS8B 3IVTA 3AAJA 3D0YA 5HKYA 1A29A 1L2OC 3CZTX 1YVHA 1IQ5A 4M2PA 3I5HB 3S0DA 4BY5A 1IJ5A 2KGBC 5HYDA 1XFUO 3PJIA 1NSHA 3M0WA 2KBIA 1VRKA 3NSIA 1OQPA 1DJXA 2P71A 4YI9A 1IG5A 1LVCD 1OOHA 1JC2A 1F71A 2ZNEA 3BXKA 4PDZA 3TS5C 1EH2A 2JWWA 1QS7A 1K9PA 1DF0A 4JD9A 5D7FA 3GK1A 1SL8A 2Q4UA 4I5NB 3RLZA 3BUXB 5TNCA 2JXCA 1SK6D 3EK8A 4I5JA 1ZMZA 4MVFA 4PE4A 2LVIA 2KQYA 4NDDA 2BAPA 4JPZB 3Q8IA 3WXAA 4AQIA 4ZCVA 1L2OB 1Y1AA 3CZ0A 2WCMA 3EVVA 1TNQA 4YBHB 3I5IB 3D73A 4ORAB 1DJWA 1KFXL 5JOLA 1TN4A 1YVLA 1AVSA 3PM2A 5DKNA 2MAZA 4PT1A 3TS5B 1WDCC 2FJYA 3LL8B 3NHTA 2CNPA 1CFFA 2JT8A 3EK4A 2ZN8A 3PLFB 4PHNA 1B8CA 3AKBA 2MA2A 1IRJA 3ZWHA 1DJZA 1UHNA 1CFDA 2BL0B 1S1EA 1K2HA 2KAXA 1UHIA 3WNXB 1JF2A 4GPLB 1DELA 1Y1XA 3FE9A 4Q04A 4CPVA 1EG3A 1KSMA 1S5GZ 2F2OA 1Z2CB 3B7AA 1A4PA 1RWYA 2Y1NA 1S6CA 2JNXA 1DF0B 2KI6C 4IJ7A 1DGUA 5CPVA 1B4CA 2COLB 1WDCB 4YGBB 1QVIZ 1IGVA 2KDHA 2GTEA 1A2XA 1KSOA 5GQQC 2HF5A 2NCOA 2BECA 1B1GA 3D78A 5I2LA 1AK8A 3HX4A 3BFHA 2KGRA 1J7QA 1S6JA 5CSFA 2JT0A 2D8NA 2M8UA 4WQ3A 4CFQA 3JTDC 2K7DA 3KEVA 1DEKA 2FCEA 1PSRA 1J7OA 2LP2A 4C0KA 1QX5B 4YI8A 1GQMA 1RTP1 4YGAA 1KK7Z 2QACA 1XK4C 3DY9A 3BFBA 2M97A 3SG6A 3NGVA 4YGCB 3SG2A 1KWOC 3I5GB 1OE9B 2I2RE 1N65A 4NQGA 5HKWA 5I2QA 1KCYA 3S0FA 2JTZA 3EKHA 2WNDA 3BOWA 3C1VA 2QEHA 2M7LA 1KK8B 2K7OA 4GGNA 3SIAA 4YGDB 3VROA 2KQ6A 4DS7A 2H61A 1NCZA 2WC6A 3JTDB 1IH0A 1SCVA 1CFPA 1HT9A 3DD4A 1NUBA 4QJ4B 1CFCA 3BUNB 2BNXA 2JZIA 3GK2A 3SIBA 1F8HA 2LAPA 3FWBA 2L4IA 1HQVA 1W7JB 3D74A 1DJHA 1UHHA 2R2IA 1Y6WA 1C7VA 2RGIA 1SY9A 3O78A 2LV7A 2FJUB 1KWOB 3KF9A 1LXFC 2KYCA 1F4QA 2MHHA 1H8BA 3VRNA 1WRKA 2LUXA 3KHEA 4HREE 1B8LA 2OS8C 2L98A 3AAKA 3DVKA 1F54A 4UPGA 3LLEA 1OOFA 3UNWA 1FBVA 1BR1B 1EG4A 3B88A 1SPYA 3PFVA 1QX2A 1K95A 1YX8A 2AUCA 1AJ4A 5B8IB 1LS8A 1OMDA 1RJVA 3I5FB 5JJGA 1MR8A 2M3WA 3DF0A 1OZSA 3PM8A 1TUZA 2O60A 3BOWB 2KAYA 1QLSA 2V53A 3OBVA 1GGWA 3VGOA 2CTNA 2K7CA 3EK7A 4GGFA 1GGZA 1NCXA 1TNWA 3BUOB 1YTZC 1S36A 1FF1A 1R6PA 2LC5A 3I5IC 3DVMA 2JNFA 1YR5A 4XYNA 1GJYA 1XFXO 1QX7A 1AP4A 5AFPA 3BUMB 4HRGA 2LMVA 5IBWA 1KFUS 1LKJA 4FQTA 2EC6B 3SJSA 1FI6A 3BYAA 3CDNA 3CS1A 1SRAA 3R72A 1CDPA 2M9GA 1A75B 2P6BB 1NX1A 5G08A 1BR4B 5I94A 4ORCB 1B7TZ 4MZKA 3CYZA 1OOIX 1UHKA 1J1EA 3EVRA 1OOJA 2BL0C 2WCFA 2L2EA 4E68A 2LLSA 5PALA 4MEWA 1JSAA 1CDMA 5K89A 2LHLA 5HLVA 1XYDA 3DYEA 4OKHA 2H2KA 1T14A 1DJGA 3FS7A 1UURA 5D69A 1XFYO 2LHIA 1FPWA 2LVKA 5AXIA 2F8PA 1OSAA 3CR4X 3D0YB 3EG5B 1DT7B 1TUJA 4PHKA 2FOTA 2CXJA 4IL1A 1F4OA 1M31A 2KFFA 2B1UA 3L4LA 3S0EA 3DXLA 2OPOA 3A8RA 4MN0A 1CM1A 1F70A 4U8DA 2LMUA 3PATA 2I7AA 1YRTB 1WRZA 4C0JA 1XFWO 1N0YA 3V2LA 2K2AA 3KPXA 3PN7C 1GM0A 3SS3A 4BY4A 2K61A 2LP3A 2LLUA 1IKUA 1C07A 3OB2B 1G4YR 1Z4HA 4ETOA 1BOCA 2PRUA 4MRYA 5ER5A 1MUXA 1BMOA 1SL7A 2LCPA 1PRWA 3I5GC 2L5XB 2WCHA 3JVTC 5FI6A 2QEOA 1DVIA 4GUKA 3VRQA 1M46A 1K94A 1K96A 3CR5X 3FIAA 2Y4QA 3OP0A 4N5XA 2F33A 2KPHA 4MZLA 1BT6A 1KK8C 4PE7A 4L9MA 5J3XA 1W9ZA 3SG5A 3TDUA 2ERBA 2JTTA 1IIOA 1CDLA 4GAOA 3CTNA 3B6XA 2PMYA 3PN7B 1KFUL 2M49B 1P28A 1TNPA 2F2PA 1NCYA 1K9UA 3LK0A 3BJHA 1M63B 2AMIA 1MQ1A 2AAOA 1S6IA 3VRPA 1AJ5A 1SR6B 3D77A 1TCOB 3SS4A 3TUYC 2LANA 1EL4A 3JVTB 2OTGC 2FCDA 1EJ3A 3K1EA 1LA3A 3ICBA 1K93D 2LM5A 1SCMC 2SCPA 1ZUZA 3ZNIA 3S0BA 1ALVA 2JPTA 4CLNA 4P5OE 2HQWA 2Y1MA 3FE8A 1K9KA 1QTXA 1QWVA 2QDIA 1QIVA 5KSZA 2KFGA 2ZKMX 4NDBA 1DGVA 3CZ2A 4N1FA 2LVVA 4DRWA 1QASA 1M45A 1Y0VH 1TCFA 3B86A 4DUQA 2KLDA 4PHMA 5FI2A 4M2OA 3R1PA 2PQLA 5HL1A 2WCJA 3BUWB 3I5FC 5DKRA 2MBXA 3VB1A 1B9AA 2LNKA 2HQ8A 4OR9B 4F7FA 3TUYB 4NDCA 1SYMA 2LVJA 3D75A 4ZCUA 2OTGB 3AKAA 1K8UA 5DKQA 2JPOA 1RECA 1B47A 1SCMB 2H61C 1BLQA 2EGDA 1CDNA 1UP5A 1JFJA 2K2FA 3BQ3A 1XVJA 2WCLA 1PSBA 3OGNA 4D1EA 1YUUA 1XFZO 3OHMB 2NZ0A 1J7PA 5KTYA 3LK1A 2G9BA 3DVEA 1SMGA 2IS9A 3R1OA 2P70A 1QV0A 1V1FA 4AOMA 2L0PA 2EC6C 3DVJA 1XA5A 1IJ6A 2MLEC 2F3ZA 2I94A 3KO0A 1CLLA 5D3OA 1K90D 1JWDA 1KQVA 1JBAA 4ICBA 3O2PA 2E6WA 3O4YA 1ALWA 3A4UB 5EL2A 1DMOA 2WORA 1TOPA 1F55A 1CMFA 4KYNA 3FWCA 1CMGA 1QV1A 5I8NA 2JULA 1EXRA 2JOJA 4WRIA 3CZ1A 3D76A 2PVBA 2SASA 2WCEA 4C0LA 1S5GY 1Q80A 2HETA 1V1GA 3PSRA 4OCIA 1DJIA 3HCMA 5CSIA 4GGFC 3NXAA 2QPTA 2DOQA 2F3YA 4R1EA 1QVIY 2H8VA 4TNCA 5CSNA 2KOTA 3DZTA 5F6TA 1QIWA 2K8MB 1ZACA 1OW4A 2WCKA 1SKTA 1ZOTB 2BCAA 2JXLA 1NX3A 1PULA 1NP8A 1JF0A 1A03A 1G8IA 1E8AA 1TTXA 2KI4B 1SBJA 2G2BA 1U5IA 5ER4X 3S0GA 1YUTA 3DF0B 2KHNA 1NPQA 1RK9A 2K0JA 3IQOA 1RROA 5I2OA 1KK7Y 4ORBB 2JRFA 2BBMA 1R2UA 3FE6A 4MZJA 3O6BA 2LMTA 2QEBA 2L2CA 1UUSA 1ZFSA 4CFRA 3OX6A 2BBNA 4HSZA 1MHOA 1WLMA 2BKIB 5FI7A 3VRRA 1CLBA 4XJKA 5DICA 2BCXA 3CGAA 3IF7A 2MRDA 2A4JA 4PALA 2WC8A 4JKTA 3UO9A 2E30A 1CM4A 1YX7A 3QRXA 2CBLA 1JFKA 1J1DA 1SW8A 2M7NA 4GNKB 2KSPA 2JC2A 2ZFDA 3D10A 2PSRA 2BE4A 1SR6C 3EKJA 3CLNA 2JU0A 1BF5A 4I5KA 3CR2A 1OZOA 3PALA 5CSJA 2M0RA 3E3RA 3MSEB 1C7WA 1W7IB 3R1VA 3QMEA 2ZNDA 1WY9A 2BKHB 2NCPA 5FYXA 2JT3A 2NLNA 1C3ZA 3B87A 2BCBA 4HRHA 4N1GA 1U5IB 1C3YA 1CTRA 1DJYA 3S0AA 1D1OA 2LLTA 1JUOA 1NX0A 4JQ0D 1J55A 1PK0D 1QJTA 1BU3A 3TZ1A 1LINA 3EVUA 4M2QA 4PE1A 1BG1A 2KYFA 2HPSA 3NHIA 1DTLA 1SSEB 2L51A 2PYQA 1QATA 3CABA 3OB1B 2L50A 1XK4A 3IQQA 1IWQA 2QEVA 3BFAA 2ISDA 1WLZA 4P2YB 4YGEB 1BODA 3NSLA 1DQEA 4QJ3B 1X02A 4XJKB 1IQ3A 1LA0A 4PCWA 1L7ZA 4DCKA 1RFJA 3RZSA 1J7RA 3GOFA 4FTGA 1NX2A 2K7BA 1WRLA 3O4XA 4PE0A 2KNEA 4PHJA 1M39A 3TDZA 4MLWA 1AUIB 1YURA 2L4HA 2MJWB 2WOSA 4FQOA 4AQJA 3N7HA 1CB1A 1XO5A 4JWQA 1UWOA 2NXQA 2GV5A 1MXLC 1OOGA 1UHJA 2PASA 3K21A 1PVAA 3WHTB 3CWGA 1S3PA 2WCBA 3L47A
chains in the Genus database with same CATH topology
5HKZA 1SNLA 1AHRA 1KQMC 2O5GA 1OMVA 4I5LB 2BE6A 2VRGA 1CKKA 4A4BA 3TDIA 1B8RA 1N2DA 1PVBA 2EHBA 1QXPA 1NIWA 2LUCA 1PALA 5KU1A 1H4BA 1B7TY 2KI6D 1MF8B 4CIDA 2GGZA 1QLKA 2CCMA 2I18A 1KFXS 1FI5A 2M29A 4WQ2A 5AANA 5AEQA 4GBAA 5BPJA 1YRUB 2CT9A 1MXEA 2M1KB 4OVNF 3SG3A 4YRUA 1MWNA 3LCPC 4OV2A 2ZN9A 1KQMB 3NSKA 4USLA 4MSPA 1XFVO 1BJFA 1A75A 1ODBA 4F0ZB 2KAVA 1NYAA 3I5HC 1S26D 2TN4A 2Y5IA 2ZRTA 2MLFC 2KI4C 4A4CA 1NWDA 1TIZA 1FW4A 2JQ6A 3F45A 1SL9A 3H4SE 3WHUB 5AERA 1CLMA 4GFTA 2KFHA 1OMRA 3NSOA 1CNPA 2M1UA 2LE9B 5HLOA 3GK4X 3SG7A 2PALA 4DIRA 2ZRSA 2Q91A 4MRXA 1Y1UA 2KBMA 1TNXA 4MBEA 3RM1A 1G33A 4QJ5B 3OX5A 3SG4A 2GGMA 1YUSA 1TRFA 2OS8B 3AAJA 3D0YA 5HKYA 1A29A 1L2OC 3CZTX 1YVHA 1IQ5A 4M2PA 3I5HB 4BY5A 1IJ5A 2KGBC 5HYDA 1XFUO 1NSHA 3M0WA 2KBIA 1VRKA 3NSIA 1OQPA 1DJXA 4YI9A 1JC2A 1IG5A 1LVCD 1F71A 2ZNEA 3BXKA 4PDZA 3TS5C 1EH2A 2JWWA 1QS7A 1K9PA 1DF0A 5D7FA 3GK1A 1SL8A 2Q4UA 4I5NB 3RLZA 3BUXB 5TNCA 2JXCA 1SK6D 3EK8A 4I5JA 1ZMZA 4MVFA 4PE4A 2LVIA 2KQYA 4NDDA 4JPZB 3WXAA 4AQIA 4ZCVA 1L2OB 1Y1AA 3EVVA 1TNQA 4YBHB 3I5IB 4ORAB 1DJWA 1KFXL 5JOLA 1TN4A 1YVLA 1AVSA 5DKNA 2MAZA 3TS5B 1WDCC 3LL8B 2CNPA 1CFFA 2JT8A 3EK4A 2ZN8A 3PLFB 4PHNA 1B8CA 3AKBA 2MA2A 1IRJA 3ZWHA 1DJZA 1UHNA 1CFDA 2BL0B 1S1EA 1K2HA 2KAXA 1UHIA 3WNXB 1JF2A 4GPLB 1Y1XA 4Q04A 4CPVA 1EG3A 1KSMA 1S5GZ 2F2OA 1A4PA 1RWYA 2Y1NA 1S6CA 2JNXA 1DF0B 2KI6C 5CPVA 1DGUA 1B4CA 2COLB 1WDCB 4YGBB 1QVIZ 1IGVA 2KDHA 1A2XA 1KSOA 5GQQC 2HF5A 2NCOA 2BECA 1B1GA 1AK8A 5I2LA 3HX4A 2KGRA 1J7QA 1S6JA 5CSFA 2JT0A 2D8NA 2M8UA 4WQ3A 4CFQA 3JTDC 2K7DA 3KEVA 2FCEA 1PSRA 1J7OA 2LP2A 4C0KA 1QX5B 4YI8A 1GQMA 1RTP1 4YGAA 1KK7Z 2QACA 1XK4C 2M97A 3SG6A 4YGCB 3SG2A 1KWOC 3I5GB 1OE9B 2I2RE 1N65A 4NQGA 5HKWA 5I2QA 1KCYA 2JTZA 3EKHA 2WNDA 3BOWA 3C1VA 2M7LA 1KK8B 2K7OA 4GGNA 3SIAA 4YGDB 3VROA 2KQ6A 4DS7A 2H61A 1NCZA 3JTDB 1IH0A 1SCVA 1CFPA 1HT9A 3DD4A 1NUBA 4QJ4B 1CFCA 3BUNB 1F8HA 2JZIA 3GK2A 3SIBA 2LAPA 3FWBA 2L4IA 1HQVA 1W7JB 1DJHA 1UHHA 2R2IA 1Y6WA 1C7VA 2RGIA 1SY9A 3O78A 2LV7A 2FJUB 1KWOB 3KF9A 1LXFC 2KYCA 1F4QA 2MHHA 1H8BA 3VRNA 1WRKA 2LUXA 3KHEA 4HREE 1B8LA 2OS8C 2L98A 3AAKA 3DVKA 1F54A 4UPGA 3LLEA 1FBVA 1BR1B 1EG4A 1SPYA 3PFVA 1QX2A 1K95A 1YX8A 2AUCA 1AJ4A 5B8IB 1OMDA 1RJVA 3I5FB 5JJGA 1MR8A 2M3WA 3DF0A 1OZSA 3PM8A 3BOWB 2O60A 2KAYA 1QLSA 2V53A 1GGWA 3VGOA 2CTNA 2K7CA 3EK7A 4GGFA 1GGZA 1NCXA 1TNWA 3BUOB 1YTZC 1S36A 1FF1A 1R6PA 2LC5A 3I5IC 3DVMA 2JNFA 1YR5A 4XYNA 1GJYA 1XFXO 1QX7A 1AP4A 5AFPA 3BUMB 4HRGA 2LMVA 5IBWA 1KFUS 1LKJA 1FI6A 2EC6B 3SJSA 3BYAA 3CS1A 1SRAA 1CDPA 2M9GA 1A75B 2P6BB 1NX1A 5G08A 1BR4B 4ORCB 1B7TZ 4MZKA 1UHKA 3EVRA 1J1EA 1OOJA 2BL0C 2WCFA 2L2EA 4E68A 2LLSA 5PALA 4MEWA 1JSAA 1CDMA 5K89A 2LHLA 5HLVA 1XYDA 4OKHA 2H2KA 1DJGA 3FS7A 1UURA 5D69A 1XFYO 2LHIA 1FPWA 2LVKA 5AXIA 2F8PA 1OSAA 3CR4X 3D0YB 1DT7B 4PHKA 2FOTA 2CXJA 4IL1A 1F4OA 1M31A 2KFFA 2B1UA 2OPOA 3A8RA 4MN0A 1CM1A 1F70A 4U8DA 2LMUA 3PATA 2I7AA 1YRTB 1WRZA 4C0JA 1XFWO 1N0YA 2K2AA 3KPXA 3PN7C 4BY4A 2K61A 2LP3A 2LLUA 1IKUA 1C07A 3OB2B 1G4YR 1BOCA 4ETOA 2PRUA 4MRYA 5ER5A 1MUXA 1BMOA 1SL7A 2LCPA 1PRWA 3I5GC 2L5XB 3JVTC 4GUKA 1DVIA 3VRQA 1M46A 1K94A 1K96A 3CR5X 3FIAA 2Y4QA 3OP0A 4N5XA 2F33A 4MZLA 1BT6A 1KK8C 4PE7A 4L9MA 5J3XA 3SG5A 3TDUA 2JTTA 1CDLA 4GAOA 3CTNA 2PMYA 3PN7B 1KFUL 2M49B 1TNPA 2F2PA 1NCYA 1K9UA 3LK0A 1M63B 2AMIA 1MQ1A 2AAOA 1S6IA 3VRPA 1AJ5A 1SR6B 1TCOB 3TUYC 2LANA 1EL4A 3JVTB 2OTGC 2FCDA 1EJ3A 1LA3A 3ICBA 1K93D 2LM5A 1SCMC 2SCPA 1ZUZA 3ZNIA 1ALVA 2JPTA 4CLNA 4P5OE 2HQWA 2Y1MA 1K9KA 1QTXA 1QIVA 5KSZA 2KFGA 2ZKMX 4NDBA 1DGVA 4N1FA 2LVVA 4DRWA 1QASA 1M45A 1Y0VH 1TCFA 4DUQA 4PHMA 4M2OA 3BUWB 3I5FC 5DKRA 2MBXA 1B9AA 2LNKA 2HQ8A 4OR9B 3TUYB 4NDCA 1SYMA 2LVJA 4ZCUA 2OTGB 3AKAA 1K8UA 5DKQA 1RECA 1B47A 1SCMB 2H61C 1BLQA 2EGDA 1CDNA 1UP5A 1JFJA 2K2FA 3BQ3A 1XVJA 1PSBA 4D1EA 1YUUA 1XFZO 3OHMB 2NZ0A 1J7PA 5KTYA 3LK1A 2G9BA 3DVEA 1SMGA 2IS9A 1QV0A 1V1FA 4AOMA 2L0PA 2EC6C 3DVJA 1XA5A 1IJ6A 2MLEC 2F3ZA 2I94A 3KO0A 1CLLA 1JWDA 1K90D 1KQVA 1JBAA 4ICBA 3O2PA 2E6WA 3O4YA 1ALWA 3A4UB 1DMOA 2WORA 1TOPA 1F55A 1CMFA 3FWCA 1CMGA 1QV1A 5I8NA 2JULA 1EXRA 2JOJA 4WRIA 2PVBA 2SASA 2WCEA 4C0LA 1S5GY 1Q80A 2HETA 1V1GA 3PSRA 4OCIA 1DJIA 3HCMA 5CSIA 4GGFC 3NXAA 2QPTA 2DOQA 2F3YA 4R1EA 1QVIY 4TNCA 5CSNA 2KOTA 5F6TA 1QIWA 2K8MB 1ZACA 1SKTA 1ZOTB 2BCAA 2JXLA 1NX3A 1PULA 1NP8A 1JF0A 1A03A 1G8IA 1E8AA 1TTXA 2KI4B 1SBJA 2G2BA 1U5IA 5ER4X 1YUTA 3DF0B 2KHNA 1NPQA 1RK9A 2K0JA 3IQOA 1RROA 5I2OA 1KK7Y 4ORBB 2JRFA 2BBMA 1R2UA 4MZJA 3O6BA 2LMTA 1UUSA 1ZFSA 4CFRA 3OX6A 2BBNA 4HSZA 1MHOA 1WLMA 2BKIB 3VRRA 1CLBA 4XJKA 2BCXA 3CGAA 3IF7A 2MRDA 2A4JA 4PALA 2WC8A 2E30A 1CM4A 1YX7A 3QRXA 2CBLA 1JFKA 1J1DA 1SW8A 2M7NA 4GNKB 2KSPA 2JC2A 2ZFDA 3D10A 2PSRA 2BE4A 1SR6C 3EKJA 3CLNA 2JU0A 1BF5A 4I5KA 3CR2A 1OZOA 3PALA 5CSJA 2M0RA 3E3RA 3MSEB 1C7WA 1W7IB 2ZNDA 1WY9A 2BKHB 2NCPA 5FYXA 2JT3A 2NLNA 4HRHA 2BCBA 4N1GA 1U5IB 1CTRA 1DJYA 1D1OA 2LLTA 1JUOA 1NX0A 4JQ0D 1J55A 1PK0D 1QJTA 1BU3A 3TZ1A 1LINA 3EVUA 4M2QA 4PE1A 1BG1A 2KYFA 2HPSA 1DTLA 2L51A 1QATA 3OB1B 2L50A 1XK4A 3IQQA 1IWQA 2ISDA 1WLZA 4P2YB 4YGEB 1BODA 3NSLA 1IQ3A 4QJ3B 1X02A 4XJKB 1LA0A 4PCWA 1L7ZA 4DCKA 1RFJA 1J7RA 3GOFA 4FTGA 1NX2A 2K7BA 1WRLA 4PE0A 2KNEA 4PHJA 1M39A 3TDZA 4MLWA 1AUIB 1YURA 2L4HA 2MJWB 2WOSA 4FQOA 4AQJA 1CB1A 1XO5A 4JWQA 1UWOA 2NXQA 2GV5A 1MXLC 3K21A 1UHJA 2PASA 3WHTB 1PVAA 3CWGA 1S3PA 2WCBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HKZ A;  1SNL A;  1AHR A;  1KQM C;  2O5G A;  1OMV A;  4I5L B;  2BE6 A;  2VRG A;  1CKK A;  4A4B A;  3TDI A;  1B8R A;  1N2D A;  1PVB A;  2EHB A;  1QXP A;  1NIW A;  2LUC A;  1PAL A;  5KU1 A;  1H4B A;  1B7T Y;  2KI6 D;  1MF8 B;  4CID A;  2GGZ A;  1QLK A;  2CCM A;  2I18 A;  1KFX S;  1FI5 A;  2M29 A;  4WQ2 A;  5AAN A;  5AEQ A;  4GBA A;  5BPJ A;  1YRU B;  2CT9 A;  1MXE A;  2M1K B;  4OVN F;  3SG3 A;  4YRU A;  1MWN A;  3LCP C;  4OV2 A;  2ZN9 A;  1KQM B;  3NSK A;  4USL A;  4MSP A;  1XFV O;  1BJF A;  1A75 A;  1ODB A;  4F0Z B;  2KAV A;  1NYA A;  3I5H C;  1S26 D;  2TN4 A;  2Y5I A;  2ZRT A;  2MLF C;  2KI4 C;  4A4C A;  1NWD A;  1TIZ A;  1FW4 A;  2JQ6 A;  3F45 A;  1SL9 A;  3H4S E;  3WHU B;  5AER A;  1CLM A;  4GFT A;  2KFH A;  1OMR A;  3NSO A;  1CNP A;  2M1U A;  2LE9 B;  5HLO A;  3GK4 X;  3SG7 A;  2PAL A;  4DIR A;  2ZRS A;  2Q91 A;  4MRX A;  1Y1U A;  2KBM A;  1TNX A;  4MBE A;  3RM1 A;  1G33 A;  4QJ5 B;  3OX5 A;  3SG4 A;  2GGM A;  1YUS A;  1TRF A;  2OS8 B;  3AAJ A;  3D0Y A;  5HKY A;  1A29 A;  1L2O C;  3CZT X;  1YVH A;  1IQ5 A;  4M2P A;  3I5H B;  4BY5 A;  1IJ5 A;  2KGB C;  5HYD A;  1XFU O;  1NSH A;  3M0W A;  2KBI A;  1VRK A;  3NSI A;  1OQP A;  1DJX A;  4YI9 A;  1JC2 A;  1IG5 A;  1LVC D;  1F71 A;  2ZNE A;  3BXK A;  4PDZ A;  3TS5 C;  1EH2 A;  2JWW A;  1QS7 A;  1K9P A;  1DF0 A;  5D7F A;  3GK1 A;  1SL8 A;  2Q4U A;  4I5N B;  3RLZ A;  3BUX B;  5TNC A;  2JXC A;  1SK6 D;  3EK8 A;  4I5J A;  1ZMZ A;  4MVF A;  4PE4 A;  2LVI A;  2KQY A;  4NDD A;  4JPZ B;  3WXA A;  4AQI A;  4ZCV A;  1L2O B;  1Y1A A;  3EVV A;  1TNQ A;  4YBH B;  3I5I B;  4ORA B;  1DJW A;  1KFX L;  5JOL A;  1TN4 A;  1YVL A;  1AVS A;  5DKN A;  2MAZ A;  3TS5 B;  1WDC C;  3LL8 B;  2CNP A;  1CFF A;  2JT8 A;  3EK4 A;  2ZN8 A;  3PLF B;  4PHN A;  1B8C A;  3AKB A;  2MA2 A;  1IRJ A;  3ZWH A;  1DJZ A;  1UHN A;  1CFD A;  2BL0 B;  1S1E A;  1K2H A;  2KAX A;  1UHI A;  3WNX B;  1JF2 A;  4GPL B;  1Y1X A;  4Q04 A;  4CPV A;  1EG3 A;  1KSM A;  1S5G Z;  2F2O A;  1A4P A;  1RWY A;  2Y1N A;  1S6C A;  2JNX A;  1DF0 B;  2KI6 C;  5CPV A;  1DGU A;  1B4C A;  2COL B;  1WDC B;  4YGB B;  1QVI Z;  1IGV A;  2KDH A;  1A2X A;  1KSO A;  5GQQ C;  2HF5 A;  2NCO A;  2BEC A;  1B1G A;  1AK8 A;  5I2L A;  3HX4 A;  2KGR A;  1J7Q A;  1S6J A;  5CSF A;  2JT0 A;  2D8N A;  2M8U A;  4WQ3 A;  4CFQ A;  3JTD C;  2K7D A;  3KEV A;  2FCE A;  1PSR A;  1J7O A;  2LP2 A;  4C0K A;  1QX5 B;  4YI8 A;  1GQM A;  1RTP 1;  4YGA A;  1KK7 Z;  2QAC A;  1XK4 C;  2M97 A;  3SG6 A;  4YGC B;  3SG2 A;  1KWO C;  3I5G B;  1OE9 B;  2I2R E;  1N65 A;  4NQG A;  5HKW A;  5I2Q A;  1KCY A;  2JTZ A;  3EKH A;  2WND A;  3BOW A;  3C1V A;  2M7L A;  1KK8 B;  2K7O A;  4GGN A;  3SIA A;  4YGD B;  3VRO A;  2KQ6 A;  4DS7 A;  2H61 A;  1NCZ A;  3JTD B;  1IH0 A;  1SCV A;  1CFP A;  1HT9 A;  3DD4 A;  1NUB A;  4QJ4 B;  1CFC A;  3BUN B;  1F8H A;  2JZI A;  3GK2 A;  3SIB A;  2LAP A;  3FWB A;  2L4I A;  1HQV A;  1W7J B;  1DJH A;  1UHH A;  2R2I A;  1Y6W A;  1C7V A;  2RGI A;  1SY9 A;  3O78 A;  2LV7 A;  2FJU B;  1KWO B;  3KF9 A;  1LXF C;  2KYC A;  1F4Q A;  2MHH A;  1H8B A;  3VRN A;  1WRK A;  2LUX A;  3KHE A;  4HRE E;  1B8L A;  2OS8 C;  2L98 A;  3AAK A;  3DVK A;  1F54 A;  4UPG A;  3LLE A;  1FBV A;  1BR1 B;  1EG4 A;  1SPY A;  3PFV A;  1QX2 A;  1K95 A;  1YX8 A;  2AUC A;  1AJ4 A;  5B8I B;  1OMD A;  1RJV A;  3I5F B;  5JJG A;  1MR8 A;  2M3W A;  3DF0 A;  1OZS A;  3PM8 A;  3BOW B;  2O60 A;  2KAY A;  1QLS A;  2V53 A;  1GGW A;  3VGO A;  2CTN A;  2K7C A;  3EK7 A;  4GGF A;  1GGZ A;  1NCX A;  1TNW A;  3BUO B;  1YTZ C;  1S36 A;  1FF1 A;  1R6P A;  2LC5 A;  3I5I C;  3DVM A;  2JNF A;  1YR5 A;  4XYN A;  1GJY A;  1XFX O;  1QX7 A;  1AP4 A;  5AFP A;  3BUM B;  4HRG A;  2LMV A;  5IBW A;  1KFU S;  1LKJ A;  1FI6 A;  2EC6 B;  3SJS A;  3BYA A;  3CS1 A;  1SRA A;  1CDP A;  2M9G A;  1A75 B;  2P6B B;  1NX1 A;  5G08 A;  1BR4 B;  4ORC B;  1B7T Z;  4MZK A;  1UHK A;  3EVR A;  1J1E A;  1OOJ A;  2BL0 C;  2WCF A;  2L2E A;  4E68 A;  2LLS A;  5PAL A;  4MEW A;  1JSA A;  1CDM A;  5K89 A;  2LHL A;  5HLV A;  1XYD A;  4OKH A;  2H2K A;  1DJG A;  3FS7 A;  1UUR A;  5D69 A;  1XFY O;  2LHI A;  1FPW A;  2LVK A;  5AXI A;  2F8P A;  1OSA A;  3CR4 X;  3D0Y B;  1DT7 B;  4PHK A;  2FOT A;  2CXJ A;  4IL1 A;  1F4O A;  1M31 A;  2KFF A;  2B1U A;  2OPO A;  3A8R A;  4MN0 A;  1CM1 A;  1F70 A;  4U8D A;  2LMU A;  3PAT A;  2I7A A;  1YRT B;  1WRZ A;  4C0J A;  1XFW O;  1N0Y A;  2K2A A;  3KPX A;  3PN7 C;  4BY4 A;  2K61 A;  2LP3 A;  2LLU A;  1IKU A;  1C07 A;  3OB2 B;  1G4Y R;  1BOC A;  4ETO A;  2PRU A;  4MRY A;  5ER5 A;  1MUX A;  1BMO A;  1SL7 A;  2LCP A;  1PRW A;  3I5G C;  2L5X B;  3JVT C;  4GUK A;  1DVI A;  3VRQ A;  1M46 A;  1K94 A;  1K96 A;  3CR5 X;  3FIA A;  2Y4Q A;  3OP0 A;  4N5X A;  2F33 A;  4MZL A;  1BT6 A;  1KK8 C;  4PE7 A;  4L9M A;  5J3X A;  3SG5 A;  3TDU A;  2JTT A;  1CDL A;  4GAO A;  3CTN A;  2PMY A;  3PN7 B;  1KFU L;  2M49 B;  1TNP A;  2F2P A;  1NCY A;  1K9U A;  3LK0 A;  1M63 B;  2AMI A;  1MQ1 A;  2AAO A;  1S6I A;  3VRP A;  1AJ5 A;  1SR6 B;  1TCO B;  3TUY C;  2LAN A;  1EL4 A;  3JVT B;  2OTG C;  2FCD A;  1EJ3 A;  1LA3 A;  3ICB A;  1K93 D;  2LM5 A;  1SCM C;  2SCP A;  1ZUZ A;  3ZNI A;  1ALV A;  2JPT A;  4CLN A;  4P5O E;  2HQW A;  2Y1M A;  1K9K A;  1QTX A;  1QIV A;  5KSZ A;  2KFG A;  2ZKM X;  4NDB A;  1DGV A;  4N1F A;  2LVV A;  4DRW A;  1QAS A;  1M45 A;  1Y0V H;  1TCF A;  4DUQ A;  4PHM A;  4M2O A;  3BUW B;  3I5F C;  5DKR A;  2MBX A;  1B9A A;  2LNK A;  2HQ8 A;  4OR9 B;  3TUY B;  4NDC A;  1SYM A;  2LVJ A;  4ZCU A;  2OTG B;  3AKA A;  1K8U A;  5DKQ A;  1REC A;  1B47 A;  1SCM B;  2H61 C;  1BLQ A;  2EGD A;  1CDN A;  1UP5 A;  1JFJ A;  2K2F A;  3BQ3 A;  1XVJ A;  1PSB A;  4D1E A;  1YUU A;  1XFZ O;  3OHM B;  2NZ0 A;  1J7P A;  5KTY A;  3LK1 A;  2G9B A;  3DVE A;  1SMG A;  2IS9 A;  1QV0 A;  1V1F A;  4AOM A;  2L0P A;  2EC6 C;  3DVJ A;  1XA5 A;  1IJ6 A;  2MLE C;  2F3Z A;  2I94 A;  3KO0 A;  1CLL A;  1JWD A;  1K90 D;  1KQV A;  1JBA A;  4ICB A;  3O2P A;  2E6W A;  3O4Y A;  1ALW A;  3A4U B;  1DMO A;  2WOR A;  1TOP A;  1F55 A;  1CMF A;  3FWC A;  1CMG A;  1QV1 A;  5I8N A;  2JUL A;  1EXR A;  2JOJ A;  4WRI A;  2PVB A;  2SAS A;  2WCE A;  4C0L A;  1S5G Y;  1Q80 A;  2HET A;  1V1G A;  3PSR A;  4OCI A;  1DJI A;  3HCM A;  5CSI A;  4GGF C;  3NXA A;  2QPT A;  2DOQ A;  2F3Y A;  4R1E A;  1QVI Y;  4TNC A;  5CSN A;  2KOT A;  5F6T A;  1QIW A;  2K8M B;  1ZAC A;  1SKT A;  1ZOT B;  2BCA A;  2JXL A;  1NX3 A;  1PUL A;  1NP8 A;  1JF0 A;  1A03 A;  1G8I A;  1E8A A;  1TTX A;  2KI4 B;  1SBJ A;  2G2B A;  1U5I A;  5ER4 X;  1YUT A;  3DF0 B;  2KHN A;  1NPQ A;  1RK9 A;  2K0J A;  3IQO A;  1RRO A;  5I2O A;  1KK7 Y;  4ORB B;  2JRF A;  2BBM A;  1R2U A;  4MZJ A;  3O6B A;  2LMT A;  1UUS A;  1ZFS A;  4CFR A;  3OX6 A;  2BBN A;  4HSZ A;  1MHO A;  1WLM A;  2BKI B;  3VRR A;  1CLB A;  4XJK A;  2BCX A;  3CGA A;  3IF7 A;  2MRD A;  2A4J A;  4PAL A;  2WC8 A;  2E30 A;  1CM4 A;  1YX7 A;  3QRX A;  2CBL A;  1JFK A;  1J1D A;  1SW8 A;  2M7N A;  4GNK B;  2KSP A;  2JC2 A;  2ZFD A;  3D10 A;  2PSR A;  2BE4 A;  1SR6 C;  3EKJ A;  3CLN A;  2JU0 A;  1BF5 A;  4I5K A;  3CR2 A;  1OZO A;  3PAL A;  5CSJ A;  2M0R A;  3E3R A;  3MSE B;  1C7W A;  1W7I B;  2ZND A;  1WY9 A;  2BKH B;  2NCP A;  5FYX A;  2JT3 A;  2NLN A;  4HRH A;  2BCB A;  4N1G A;  1U5I B;  1CTR A;  1DJY A;  1D1O A;  2LLT A;  1JUO A;  1NX0 A;  4JQ0 D;  1J55 A;  1PK0 D;  1QJT A;  1BU3 A;  3TZ1 A;  1LIN A;  3EVU A;  4M2Q A;  4PE1 A;  1BG1 A;  2KYF A;  2HPS A;  1DTL A;  2L51 A;  1QAT A;  3OB1 B;  2L50 A;  1XK4 A;  3IQQ A;  1IWQ A;  2ISD A;  1WLZ A;  4P2Y B;  4YGE B;  1BOD A;  3NSL A;  1IQ3 A;  4QJ3 B;  1X02 A;  4XJK B;  1LA0 A;  4PCW A;  1L7Z A;  4DCK A;  1RFJ A;  1J7R A;  3GOF A;  4FTG A;  1NX2 A;  2K7B A;  1WRL A;  4PE0 A;  2KNE A;  4PHJ A;  1M39 A;  3TDZ A;  4MLW A;  1AUI B;  1YUR A;  2L4H A;  2MJW B;  2WOS A;  4FQO A;  4AQJ A;  1CB1 A;  1XO5 A;  4JWQ A;  1UWO A;  2NXQ A;  2GV5 A;  1MXL C;  3K21 A;  1UHJ A;  2PAS A;  3WHT B;  1PVA A;  3CWG A;  1S3P A;  2WCB A; 
#chains in the Genus database with same CATH topology
 5HKZ A;  1SNL A;  4INW A;  1AHR A;  1KQM C;  2O5G A;  1OMV A;  4I5L B;  1DC1 A;  2BE6 A;  2VRG A;  1CKK A;  4A4B A;  3TDI A;  1B8R A;  1N2D A;  1PVB A;  2EHB A;  1QXP A;  1NIW A;  2LUC A;  1PAL A;  5KU1 A;  3L4A A;  1H4B A;  1B7T Y;  2KI6 D;  1MF8 B;  4CID A;  1XFR A;  2GGZ A;  1QLK A;  2CCM A;  2L5Y A;  2I18 A;  1KFX S;  1FI5 A;  2M29 A;  4WQ2 A;  5AAN A;  5AEQ A;  4GBA A;  5BPJ A;  1YRU B;  2CT9 A;  1MXE A;  2M1K B;  4OVN F;  3SG3 A;  4YRU A;  1MWN A;  3LCP C;  4OV2 A;  2ZN9 A;  1KQM B;  3NSK A;  2YGU A;  4USL A;  4MSP A;  1XFV O;  1BJF A;  1A75 A;  1ODB A;  3SS5 A;  4F0Z B;  2KAV A;  1NYA A;  1ORG A;  3I5H C;  1S26 D;  2TN4 A;  2Y5I A;  2ZRT A;  2MLF C;  2KI4 C;  4A4C A;  4INX A;  1NWD A;  1TIZ A;  1FW4 A;  2JQ6 A;  3F45 A;  1SL9 A;  3H4S E;  2K60 A;  4OZD A;  3WHU B;  1CLM A;  4GFT A;  2KFH A;  5AER A;  1OMR A;  3NSO A;  1CNP A;  2KLE A;  2M1U A;  2LE9 B;  5HLO A;  3GK4 X;  3SG7 A;  2PAL A;  1TWO A;  4DIR A;  2WC5 A;  2ZRS A;  2Q91 A;  4MRX A;  1Y1U A;  2KBM A;  1TNX A;  4MBE A;  3RM1 A;  1G33 A;  4QJ5 B;  3OX5 A;  3SG4 A;  2GGM A;  1YUS A;  1TRF A;  2OS8 B;  3IVT A;  3AAJ A;  3D0Y A;  5HKY A;  1A29 A;  1L2O C;  3CZT X;  1YVH A;  1IQ5 A;  4M2P A;  3I5H B;  3S0D A;  4BY5 A;  1IJ5 A;  2KGB C;  5HYD A;  1XFU O;  3PJI A;  1NSH A;  3M0W A;  2KBI A;  1VRK A;  3NSI A;  1OQP A;  1DJX A;  2P71 A;  4YI9 A;  1IG5 A;  1LVC D;  1OOH A;  1JC2 A;  1F71 A;  2ZNE A;  3BXK A;  4PDZ A;  3TS5 C;  1EH2 A;  2JWW A;  1QS7 A;  1K9P A;  1DF0 A;  4JD9 A;  5D7F A;  3GK1 A;  1SL8 A;  2Q4U A;  4I5N B;  3RLZ A;  3BUX B;  5TNC A;  2JXC A;  1SK6 D;  3EK8 A;  4I5J A;  1ZMZ A;  4MVF A;  4PE4 A;  2LVI A;  2KQY A;  4NDD A;  2BAP A;  4JPZ B;  3Q8I A;  3WXA A;  4AQI A;  4ZCV A;  1L2O B;  1Y1A A;  3CZ0 A;  2WCM A;  3EVV A;  1TNQ A;  4YBH B;  3I5I B;  3D73 A;  4ORA B;  1DJW A;  1KFX L;  5JOL A;  1TN4 A;  1YVL A;  1AVS A;  3PM2 A;  5DKN A;  2MAZ A;  4PT1 A;  3TS5 B;  1WDC C;  2FJY A;  3LL8 B;  3NHT A;  2CNP A;  1CFF A;  2JT8 A;  3EK4 A;  2ZN8 A;  3PLF B;  4PHN A;  1B8C A;  3AKB A;  2MA2 A;  1IRJ A;  3ZWH A;  1DJZ A;  1UHN A;  1CFD A;  2BL0 B;  1S1E A;  1K2H A;  2KAX A;  1UHI A;  3WNX B;  1JF2 A;  4GPL B;  1DEL A;  1Y1X A;  3FE9 A;  4Q04 A;  4CPV A;  1EG3 A;  1KSM A;  1S5G Z;  2F2O A;  1Z2C B;  3B7A A;  1A4P A;  1RWY A;  2Y1N A;  1S6C A;  2JNX A;  1DF0 B;  2KI6 C;  4IJ7 A;  1DGU A;  5CPV A;  1B4C A;  2COL B;  1WDC B;  4YGB B;  1QVI Z;  1IGV A;  2KDH A;  2GTE A;  1A2X A;  1KSO A;  5GQQ C;  2HF5 A;  2NCO A;  2BEC A;  1B1G A;  3D78 A;  5I2L A;  1AK8 A;  3HX4 A;  3BFH A;  2KGR A;  1J7Q A;  1S6J A;  5CSF A;  2JT0 A;  2D8N A;  2M8U A;  4WQ3 A;  4CFQ A;  3JTD C;  2K7D A;  3KEV A;  1DEK A;  2FCE A;  1PSR A;  1J7O A;  2LP2 A;  4C0K A;  1QX5 B;  4YI8 A;  1GQM A;  1RTP 1;  4YGA A;  1KK7 Z;  2QAC A;  1XK4 C;  3DY9 A;  3BFB A;  2M97 A;  3SG6 A;  3NGV A;  4YGC B;  3SG2 A;  1KWO C;  3I5G B;  1OE9 B;  2I2R E;  1N65 A;  4NQG A;  5HKW A;  5I2Q A;  1KCY A;  3S0F A;  2JTZ A;  3EKH A;  2WND A;  3BOW A;  3C1V A;  2QEH A;  2M7L A;  1KK8 B;  2K7O A;  4GGN A;  3SIA A;  4YGD B;  3VRO A;  2KQ6 A;  4DS7 A;  2H61 A;  1NCZ A;  2WC6 A;  3JTD B;  1IH0 A;  1SCV A;  1CFP A;  1HT9 A;  3DD4 A;  1NUB A;  4QJ4 B;  1CFC A;  3BUN B;  2BNX A;  2JZI A;  3GK2 A;  3SIB A;  1F8H A;  2LAP A;  3FWB A;  2L4I A;  1HQV A;  1W7J B;  3D74 A;  1DJH A;  1UHH A;  2R2I A;  1Y6W A;  1C7V A;  2RGI A;  1SY9 A;  3O78 A;  2LV7 A;  2FJU B;  1KWO B;  3KF9 A;  1LXF C;  2KYC A;  1F4Q A;  2MHH A;  1H8B A;  3VRN A;  1WRK A;  2LUX A;  3KHE A;  4HRE E;  1B8L A;  2OS8 C;  2L98 A;  3AAK A;  3DVK A;  1F54 A;  4UPG A;  3LLE A;  1OOF A;  3UNW A;  1FBV A;  1BR1 B;  1EG4 A;  3B88 A;  1SPY A;  3PFV A;  1QX2 A;  1K95 A;  1YX8 A;  2AUC A;  1AJ4 A;  5B8I B;  1LS8 A;  1OMD A;  1RJV A;  3I5F B;  5JJG A;  1MR8 A;  2M3W A;  3DF0 A;  1OZS A;  3PM8 A;  1TUZ A;  2O60 A;  3BOW B;  2KAY A;  1QLS A;  2V53 A;  3OBV A;  1GGW A;  3VGO A;  2CTN A;  2K7C A;  3EK7 A;  4GGF A;  1GGZ A;  1NCX A;  1TNW A;  3BUO B;  1YTZ C;  1S36 A;  1FF1 A;  1R6P A;  2LC5 A;  3I5I C;  3DVM A;  2JNF A;  1YR5 A;  4XYN A;  1GJY A;  1XFX O;  1QX7 A;  1AP4 A;  5AFP A;  3BUM B;  4HRG A;  2LMV A;  5IBW A;  1KFU S;  1LKJ A;  4FQT A;  2EC6 B;  3SJS A;  1FI6 A;  3BYA A;  3CDN A;  3CS1 A;  1SRA A;  3R72 A;  1CDP A;  2M9G A;  1A75 B;  2P6B B;  1NX1 A;  5G08 A;  1BR4 B;  5I94 A;  4ORC B;  1B7T Z;  4MZK A;  3CYZ A;  1OOI X;  1UHK A;  1J1E A;  3EVR A;  1OOJ A;  2BL0 C;  2WCF A;  2L2E A;  4E68 A;  2LLS A;  5PAL A;  4MEW A;  1JSA A;  1CDM A;  5K89 A;  2LHL A;  5HLV A;  1XYD A;  3DYE A;  4OKH A;  2H2K A;  1T14 A;  1DJG A;  3FS7 A;  1UUR A;  5D69 A;  1XFY O;  2LHI A;  1FPW A;  2LVK A;  5AXI A;  2F8P A;  1OSA A;  3CR4 X;  3D0Y B;  3EG5 B;  1DT7 B;  1TUJ A;  4PHK A;  2FOT A;  2CXJ A;  4IL1 A;  1F4O A;  1M31 A;  2KFF A;  2B1U A;  3L4L A;  3S0E A;  3DXL A;  2OPO A;  3A8R A;  4MN0 A;  1CM1 A;  1F70 A;  4U8D A;  2LMU A;  3PAT A;  2I7A A;  1YRT B;  1WRZ A;  4C0J A;  1XFW O;  1N0Y A;  3V2L A;  2K2A A;  3KPX A;  3PN7 C;  1GM0 A;  3SS3 A;  4BY4 A;  2K61 A;  2LP3 A;  2LLU A;  1IKU A;  1C07 A;  3OB2 B;  1G4Y R;  1Z4H A;  4ETO A;  1BOC A;  2PRU A;  4MRY A;  5ER5 A;  1MUX A;  1BMO A;  1SL7 A;  2LCP A;  1PRW A;  3I5G C;  2L5X B;  2WCH A;  3JVT C;  5FI6 A;  2QEO A;  1DVI A;  4GUK A;  3VRQ A;  1M46 A;  1K94 A;  1K96 A;  3CR5 X;  3FIA A;  2Y4Q A;  3OP0 A;  4N5X A;  2F33 A;  2KPH A;  4MZL A;  1BT6 A;  1KK8 C;  4PE7 A;  4L9M A;  5J3X A;  1W9Z A;  3SG5 A;  3TDU A;  2ERB A;  2JTT A;  1IIO A;  1CDL A;  4GAO A;  3CTN A;  3B6X A;  2PMY A;  3PN7 B;  1KFU L;  2M49 B;  1P28 A;  1TNP A;  2F2P A;  1NCY A;  1K9U A;  3LK0 A;  3BJH A;  1M63 B;  2AMI A;  1MQ1 A;  2AAO A;  1S6I A;  3VRP A;  1AJ5 A;  1SR6 B;  3D77 A;  1TCO B;  3SS4 A;  3TUY C;  2LAN A;  1EL4 A;  3JVT B;  2OTG C;  2FCD A;  1EJ3 A;  3K1E A;  1LA3 A;  3ICB A;  1K93 D;  2LM5 A;  1SCM C;  2SCP A;  1ZUZ A;  3ZNI A;  3S0B A;  1ALV A;  2JPT A;  4CLN A;  4P5O E;  2HQW A;  2Y1M A;  3FE8 A;  1K9K A;  1QTX A;  1QWV A;  2QDI A;  1QIV A;  5KSZ A;  2KFG A;  2ZKM X;  4NDB A;  1DGV A;  3CZ2 A;  4N1F A;  2LVV A;  4DRW A;  1QAS A;  1M45 A;  1Y0V H;  1TCF A;  3B86 A;  4DUQ A;  2KLD A;  4PHM A;  5FI2 A;  4M2O A;  3R1P A;  2PQL A;  5HL1 A;  2WCJ A;  3BUW B;  3I5F C;  5DKR A;  2MBX A;  3VB1 A;  1B9A A;  2LNK A;  2HQ8 A;  4OR9 B;  4F7F A;  3TUY B;  4NDC A;  1SYM A;  2LVJ A;  3D75 A;  4ZCU A;  2OTG B;  3AKA A;  1K8U A;  5DKQ A;  2JPO A;  1REC A;  1B47 A;  1SCM B;  2H61 C;  1BLQ A;  2EGD A;  1CDN A;  1UP5 A;  1JFJ A;  2K2F A;  3BQ3 A;  1XVJ A;  2WCL A;  1PSB A;  3OGN A;  4D1E A;  1YUU A;  1XFZ O;  3OHM B;  2NZ0 A;  1J7P A;  5KTY A;  3LK1 A;  2G9B A;  3DVE A;  1SMG A;  2IS9 A;  3R1O A;  2P70 A;  1QV0 A;  1V1F A;  4AOM A;  2L0P A;  2EC6 C;  3DVJ A;  1XA5 A;  1IJ6 A;  2MLE C;  2F3Z A;  2I94 A;  3KO0 A;  1CLL A;  5D3O A;  1K90 D;  1JWD A;  1KQV A;  1JBA A;  4ICB A;  3O2P A;  2E6W A;  3O4Y A;  1ALW A;  3A4U B;  5EL2 A;  1DMO A;  2WOR A;  1TOP A;  1F55 A;  1CMF A;  4KYN A;  3FWC A;  1CMG A;  1QV1 A;  5I8N A;  2JUL A;  1EXR A;  2JOJ A;  4WRI A;  3CZ1 A;  3D76 A;  2PVB A;  2SAS A;  2WCE A;  4C0L A;  1S5G Y;  1Q80 A;  2HET A;  1V1G A;  3PSR A;  4OCI A;  1DJI A;  3HCM A;  5CSI A;  4GGF C;  3NXA A;  2QPT A;  2DOQ A;  2F3Y A;  4R1E A;  1QVI Y;  2H8V A;  4TNC A;  5CSN A;  2KOT A;  3DZT A;  5F6T A;  1QIW A;  2K8M B;  1ZAC A;  1OW4 A;  2WCK A;  1SKT A;  1ZOT B;  2BCA A;  2JXL A;  1NX3 A;  1PUL A;  1NP8 A;  1JF0 A;  1A03 A;  1G8I A;  1E8A A;  1TTX A;  2KI4 B;  1SBJ A;  2G2B A;  1U5I A;  5ER4 X;  3S0G A;  1YUT A;  3DF0 B;  2KHN A;  1NPQ A;  1RK9 A;  2K0J A;  3IQO A;  1RRO A;  5I2O A;  1KK7 Y;  4ORB B;  2JRF A;  2BBM A;  1R2U A;  3FE6 A;  4MZJ A;  3O6B A;  2LMT A;  2QEB A;  2L2C A;  1UUS A;  1ZFS A;  4CFR A;  3OX6 A;  2BBN A;  4HSZ A;  1MHO A;  1WLM A;  2BKI B;  5FI7 A;  3VRR A;  1CLB A;  4XJK A;  5DIC A;  2BCX A;  3CGA A;  3IF7 A;  2MRD A;  2A4J A;  4PAL A;  2WC8 A;  4JKT A;  3UO9 A;  2E30 A;  1CM4 A;  1YX7 A;  3QRX A;  2CBL A;  1JFK A;  1J1D A;  1SW8 A;  2M7N A;  4GNK B;  2KSP A;  2JC2 A;  2ZFD A;  3D10 A;  2PSR A;  2BE4 A;  1SR6 C;  3EKJ A;  3CLN A;  2JU0 A;  1BF5 A;  4I5K A;  3CR2 A;  1OZO A;  3PAL A;  5CSJ A;  2M0R A;  3E3R A;  3MSE B;  1C7W A;  1W7I B;  3R1V A;  3QME A;  2ZND A;  1WY9 A;  2BKH B;  2NCP A;  5FYX A;  2JT3 A;  2NLN A;  1C3Z A;  3B87 A;  2BCB A;  4HRH A;  4N1G A;  1U5I B;  1C3Y A;  1CTR A;  1DJY A;  3S0A A;  1D1O A;  2LLT A;  1JUO A;  1NX0 A;  4JQ0 D;  1J55 A;  1PK0 D;  1QJT A;  1BU3 A;  3TZ1 A;  1LIN A;  3EVU A;  4M2Q A;  4PE1 A;  1BG1 A;  2KYF A;  2HPS A;  3NHI A;  1DTL A;  1SSE B;  2L51 A;  2PYQ A;  1QAT A;  3CAB A;  3OB1 B;  2L50 A;  1XK4 A;  3IQQ A;  1IWQ A;  2QEV A;  3BFA A;  2ISD A;  1WLZ A;  4P2Y B;  4YGE B;  1BOD A;  3NSL A;  1DQE A;  4QJ3 B;  1X02 A;  4XJK B;  1IQ3 A;  1LA0 A;  4PCW A;  1L7Z A;  4DCK A;  1RFJ A;  3RZS A;  1J7R A;  3GOF A;  4FTG A;  1NX2 A;  2K7B A;  1WRL A;  3O4X A;  4PE0 A;  2KNE A;  4PHJ A;  1M39 A;  3TDZ A;  4MLW A;  1AUI B;  1YUR A;  2L4H A;  2MJW B;  2WOS A;  4FQO A;  4AQJ A;  3N7H A;  1CB1 A;  1XO5 A;  4JWQ A;  1UWO A;  2NXQ A;  2GV5 A;  1MXL C;  1OOG A;  1UHJ A;  2PAS A;  3K21 A;  1PVA A;  3WHT B;  3CWG A;  1S3P A;  2WCB A;  3L47 A; 
#chains in the Genus database with same CATH homology
 5HKZ A;  1SNL A;  1AHR A;  1KQM C;  2O5G A;  1OMV A;  4I5L B;  2BE6 A;  2VRG A;  1CKK A;  4A4B A;  3TDI A;  1B8R A;  1N2D A;  1PVB A;  2EHB A;  1QXP A;  1NIW A;  2LUC A;  1PAL A;  5KU1 A;  1H4B A;  1B7T Y;  2KI6 D;  1MF8 B;  4CID A;  2GGZ A;  1QLK A;  2CCM A;  2I18 A;  1KFX S;  1FI5 A;  2M29 A;  4WQ2 A;  5AAN A;  5AEQ A;  4GBA A;  5BPJ A;  1YRU B;  2CT9 A;  1MXE A;  2M1K B;  4OVN F;  3SG3 A;  4YRU A;  1MWN A;  3LCP C;  4OV2 A;  2ZN9 A;  1KQM B;  3NSK A;  4USL A;  4MSP A;  1XFV O;  1BJF A;  1A75 A;  1ODB A;  4F0Z B;  2KAV A;  1NYA A;  3I5H C;  1S26 D;  2TN4 A;  2Y5I A;  2ZRT A;  2MLF C;  2KI4 C;  4A4C A;  1NWD A;  1TIZ A;  1FW4 A;  2JQ6 A;  3F45 A;  1SL9 A;  3H4S E;  3WHU B;  5AER A;  1CLM A;  4GFT A;  2KFH A;  1OMR A;  3NSO A;  1CNP A;  2M1U A;  2LE9 B;  5HLO A;  3GK4 X;  3SG7 A;  2PAL A;  4DIR A;  2ZRS A;  2Q91 A;  4MRX A;  1Y1U A;  2KBM A;  1TNX A;  4MBE A;  3RM1 A;  1G33 A;  4QJ5 B;  3OX5 A;  3SG4 A;  2GGM A;  1YUS A;  1TRF A;  2OS8 B;  3AAJ A;  3D0Y A;  5HKY A;  1A29 A;  1L2O C;  3CZT X;  1YVH A;  1IQ5 A;  4M2P A;  3I5H B;  4BY5 A;  1IJ5 A;  2KGB C;  5HYD A;  1XFU O;  1NSH A;  3M0W A;  2KBI A;  1VRK A;  3NSI A;  1OQP A;  1DJX A;  4YI9 A;  1JC2 A;  1IG5 A;  1LVC D;  1F71 A;  2ZNE A;  3BXK A;  4PDZ A;  3TS5 C;  1EH2 A;  2JWW A;  1QS7 A;  1K9P A;  1DF0 A;  5D7F A;  3GK1 A;  1SL8 A;  2Q4U A;  4I5N B;  3RLZ A;  3BUX B;  5TNC A;  2JXC A;  1SK6 D;  3EK8 A;  4I5J A;  1ZMZ A;  4MVF A;  4PE4 A;  2LVI A;  2KQY A;  4NDD A;  4JPZ B;  3WXA A;  4AQI A;  4ZCV A;  1L2O B;  1Y1A A;  3EVV A;  1TNQ A;  4YBH B;  3I5I B;  4ORA B;  1DJW A;  1KFX L;  5JOL A;  1TN4 A;  1YVL A;  1AVS A;  5DKN A;  2MAZ A;  3TS5 B;  1WDC C;  3LL8 B;  2CNP A;  1CFF A;  2JT8 A;  3EK4 A;  2ZN8 A;  3PLF B;  4PHN A;  1B8C A;  3AKB A;  2MA2 A;  1IRJ A;  3ZWH A;  1DJZ A;  1UHN A;  1CFD A;  2BL0 B;  1S1E A;  1K2H A;  2KAX A;  1UHI A;  3WNX B;  1JF2 A;  4GPL B;  1Y1X A;  4Q04 A;  4CPV A;  1EG3 A;  1KSM A;  1S5G Z;  2F2O A;  1A4P A;  1RWY A;  2Y1N A;  1S6C A;  2JNX A;  1DF0 B;  2KI6 C;  5CPV A;  1DGU A;  1B4C A;  2COL B;  1WDC B;  4YGB B;  1QVI Z;  1IGV A;  2KDH A;  1A2X A;  1KSO A;  5GQQ C;  2HF5 A;  2NCO A;  2BEC A;  1B1G A;  1AK8 A;  5I2L A;  3HX4 A;  2KGR A;  1J7Q A;  1S6J A;  5CSF A;  2JT0 A;  2D8N A;  2M8U A;  4WQ3 A;  4CFQ A;  3JTD C;  2K7D A;  3KEV A;  2FCE A;  1PSR A;  1J7O A;  2LP2 A;  4C0K A;  1QX5 B;  4YI8 A;  1GQM A;  1RTP 1;  4YGA A;  1KK7 Z;  2QAC A;  1XK4 C;  2M97 A;  3SG6 A;  4YGC B;  3SG2 A;  1KWO C;  3I5G B;  1OE9 B;  2I2R E;  1N65 A;  4NQG A;  5HKW A;  5I2Q A;  1KCY A;  2JTZ A;  3EKH A;  2WND A;  3BOW A;  3C1V A;  2M7L A;  1KK8 B;  2K7O A;  4GGN A;  3SIA A;  4YGD B;  3VRO A;  2KQ6 A;  4DS7 A;  2H61 A;  1NCZ A;  3JTD B;  1IH0 A;  1SCV A;  1CFP A;  1HT9 A;  3DD4 A;  1NUB A;  4QJ4 B;  1CFC A;  3BUN B;  1F8H A;  2JZI A;  3GK2 A;  3SIB A;  2LAP A;  3FWB A;  2L4I A;  1HQV A;  1W7J B;  1DJH A;  1UHH A;  2R2I A;  1Y6W A;  1C7V A;  2RGI A;  1SY9 A;  3O78 A;  2LV7 A;  2FJU B;  1KWO B;  3KF9 A;  1LXF C;  2KYC A;  1F4Q A;  2MHH A;  1H8B A;  3VRN A;  1WRK A;  2LUX A;  3KHE A;  4HRE E;  1B8L A;  2OS8 C;  2L98 A;  3AAK A;  3DVK A;  1F54 A;  4UPG A;  3LLE A;  1FBV A;  1BR1 B;  1EG4 A;  1SPY A;  3PFV A;  1QX2 A;  1K95 A;  1YX8 A;  2AUC A;  1AJ4 A;  5B8I B;  1OMD A;  1RJV A;  3I5F B;  5JJG A;  1MR8 A;  2M3W A;  3DF0 A;  1OZS A;  3PM8 A;  3BOW B;  2O60 A;  2KAY A;  1QLS A;  2V53 A;  1GGW A;  3VGO A;  2CTN A;  2K7C A;  3EK7 A;  4GGF A;  1GGZ A;  1NCX A;  1TNW A;  3BUO B;  1YTZ C;  1S36 A;  1FF1 A;  1R6P A;  2LC5 A;  3I5I C;  3DVM A;  2JNF A;  1YR5 A;  4XYN A;  1GJY A;  1XFX O;  1QX7 A;  1AP4 A;  5AFP A;  3BUM B;  4HRG A;  2LMV A;  5IBW A;  1KFU S;  1LKJ A;  1FI6 A;  2EC6 B;  3SJS A;  3BYA A;  3CS1 A;  1SRA A;  1CDP A;  2M9G A;  1A75 B;  2P6B B;  1NX1 A;  5G08 A;  1BR4 B;  4ORC B;  1B7T Z;  4MZK A;  1UHK A;  3EVR A;  1J1E A;  1OOJ A;  2BL0 C;  2WCF A;  2L2E A;  4E68 A;  2LLS A;  5PAL A;  4MEW A;  1JSA A;  1CDM A;  5K89 A;  2LHL A;  5HLV A;  1XYD A;  4OKH A;  2H2K A;  1DJG A;  3FS7 A;  1UUR A;  5D69 A;  1XFY O;  2LHI A;  1FPW A;  2LVK A;  5AXI A;  2F8P A;  1OSA A;  3CR4 X;  3D0Y B;  1DT7 B;  4PHK A;  2FOT A;  2CXJ A;  4IL1 A;  1F4O A;  1M31 A;  2KFF A;  2B1U A;  2OPO A;  3A8R A;  4MN0 A;  1CM1 A;  1F70 A;  4U8D A;  2LMU A;  3PAT A;  2I7A A;  1YRT B;  1WRZ A;  4C0J A;  1XFW O;  1N0Y A;  2K2A A;  3KPX A;  3PN7 C;  4BY4 A;  2K61 A;  2LP3 A;  2LLU A;  1IKU A;  1C07 A;  3OB2 B;  1G4Y R;  1BOC A;  4ETO A;  2PRU A;  4MRY A;  5ER5 A;  1MUX A;  1BMO A;  1SL7 A;  2LCP A;  1PRW A;  3I5G C;  2L5X B;  3JVT C;  4GUK A;  1DVI A;  3VRQ A;  1M46 A;  1K94 A;  1K96 A;  3CR5 X;  3FIA A;  2Y4Q A;  3OP0 A;  4N5X A;  2F33 A;  4MZL A;  1BT6 A;  1KK8 C;  4PE7 A;  4L9M A;  5J3X A;  3SG5 A;  3TDU A;  2JTT A;  1CDL A;  4GAO A;  3CTN A;  2PMY A;  3PN7 B;  1KFU L;  2M49 B;  1TNP A;  2F2P A;  1NCY A;  1K9U A;  3LK0 A;  1M63 B;  2AMI A;  1MQ1 A;  2AAO A;  1S6I A;  3VRP A;  1AJ5 A;  1SR6 B;  1TCO B;  3TUY C;  2LAN A;  1EL4 A;  3JVT B;  2OTG C;  2FCD A;  1EJ3 A;  1LA3 A;  3ICB A;  1K93 D;  2LM5 A;  1SCM C;  2SCP A;  1ZUZ A;  3ZNI A;  1ALV A;  2JPT A;  4CLN A;  4P5O E;  2HQW A;  2Y1M A;  1K9K A;  1QTX A;  1QIV A;  5KSZ A;  2KFG A;  2ZKM X;  4NDB A;  1DGV A;  4N1F A;  2LVV A;  4DRW A;  1QAS A;  1M45 A;  1Y0V H;  1TCF A;  4DUQ A;  4PHM A;  4M2O A;  3BUW B;  3I5F C;  5DKR A;  2MBX A;  1B9A A;  2LNK A;  2HQ8 A;  4OR9 B;  3TUY B;  4NDC A;  1SYM A;  2LVJ A;  4ZCU A;  2OTG B;  3AKA A;  1K8U A;  5DKQ A;  1REC A;  1B47 A;  1SCM B;  2H61 C;  1BLQ A;  2EGD A;  1CDN A;  1UP5 A;  1JFJ A;  2K2F A;  3BQ3 A;  1XVJ A;  1PSB A;  4D1E A;  1YUU A;  1XFZ O;  3OHM B;  2NZ0 A;  1J7P A;  5KTY A;  3LK1 A;  2G9B A;  3DVE A;  1SMG A;  2IS9 A;  1QV0 A;  1V1F A;  4AOM A;  2L0P A;  2EC6 C;  3DVJ A;  1XA5 A;  1IJ6 A;  2MLE C;  2F3Z A;  2I94 A;  3KO0 A;  1CLL A;  1JWD A;  1K90 D;  1KQV A;  1JBA A;  4ICB A;  3O2P A;  2E6W A;  3O4Y A;  1ALW A;  3A4U B;  1DMO A;  2WOR A;  1TOP A;  1F55 A;  1CMF A;  3FWC A;  1CMG A;  1QV1 A;  5I8N A;  2JUL A;  1EXR A;  2JOJ A;  4WRI A;  2PVB A;  2SAS A;  2WCE A;  4C0L A;  1S5G Y;  1Q80 A;  2HET A;  1V1G A;  3PSR A;  4OCI A;  1DJI A;  3HCM A;  5CSI A;  4GGF C;  3NXA A;  2QPT A;  2DOQ A;  2F3Y A;  4R1E A;  1QVI Y;  4TNC A;  5CSN A;  2KOT A;  5F6T A;  1QIW A;  2K8M B;  1ZAC A;  1SKT A;  1ZOT B;  2BCA A;  2JXL A;  1NX3 A;  1PUL A;  1NP8 A;  1JF0 A;  1A03 A;  1G8I A;  1E8A A;  1TTX A;  2KI4 B;  1SBJ A;  2G2B A;  1U5I A;  5ER4 X;  1YUT A;  3DF0 B;  2KHN A;  1NPQ A;  1RK9 A;  2K0J A;  3IQO A;  1RRO A;  5I2O A;  1KK7 Y;  4ORB B;  2JRF A;  2BBM A;  1R2U A;  4MZJ A;  3O6B A;  2LMT A;  1UUS A;  1ZFS A;  4CFR A;  3OX6 A;  2BBN A;  4HSZ A;  1MHO A;  1WLM A;  2BKI B;  3VRR A;  1CLB A;  4XJK A;  2BCX A;  3CGA A;  3IF7 A;  2MRD A;  2A4J A;  4PAL A;  2WC8 A;  2E30 A;  1CM4 A;  1YX7 A;  3QRX A;  2CBL A;  1JFK A;  1J1D A;  1SW8 A;  2M7N A;  4GNK B;  2KSP A;  2JC2 A;  2ZFD A;  3D10 A;  2PSR A;  2BE4 A;  1SR6 C;  3EKJ A;  3CLN A;  2JU0 A;  1BF5 A;  4I5K A;  3CR2 A;  1OZO A;  3PAL A;  5CSJ A;  2M0R A;  3E3R A;  3MSE B;  1C7W A;  1W7I B;  2ZND A;  1WY9 A;  2BKH B;  2NCP A;  5FYX A;  2JT3 A;  2NLN A;  4HRH A;  2BCB A;  4N1G A;  1U5I B;  1CTR A;  1DJY A;  1D1O A;  2LLT A;  1JUO A;  1NX0 A;  4JQ0 D;  1J55 A;  1PK0 D;  1QJT A;  1BU3 A;  3TZ1 A;  1LIN A;  3EVU A;  4M2Q A;  4PE1 A;  1BG1 A;  2KYF A;  2HPS A;  1DTL A;  2L51 A;  1QAT A;  3OB1 B;  2L50 A;  1XK4 A;  3IQQ A;  1IWQ A;  2ISD A;  1WLZ A;  4P2Y B;  4YGE B;  1BOD A;  3NSL A;  1IQ3 A;  4QJ3 B;  1X02 A;  4XJK B;  1LA0 A;  4PCW A;  1L7Z A;  4DCK A;  1RFJ A;  1J7R A;  3GOF A;  4FTG A;  1NX2 A;  2K7B A;  1WRL A;  4PE0 A;  2KNE A;  4PHJ A;  1M39 A;  3TDZ A;  4MLW A;  1AUI B;  1YUR A;  2L4H A;  2MJW B;  2WOS A;  4FQO A;  4AQJ A;  1CB1 A;  1XO5 A;  4JWQ A;  1UWO A;  2NXQ A;  2GV5 A;  1MXL C;  3K21 A;  1UHJ A;  2PAS A;  3WHT B;  1PVA A;  3CWG A;  1S3P A;  2WCB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...