2ZN8A

Crystal structure of zn2+-bound form of alg-2
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
166
structure length
166
Chain Sequence
SFLWNVFQRVDKDRSGVISDTELQQALSNGTWTPFNPVTVRSIISMFDRENKAGVNFSEFTGVWKYITDWQNVFRTYDRDNSGMIDKNELKQALSGFGYRLSDQFHDILIRKFDRQGRGQIAFDDFIQGCIVLQRLTDIFRRYDTDQDGWIQVSYEQYLSMVFSIV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Programmed cell death protein 6
publication title Structural Basis for Ca(2+)-Dependent Formation of ALG-2/Alix Peptide Complex: Ca(2+)/EF3-Driven Arginine Switch Mechanism
pubmed doi rcsb
source organism Homo sapiens
molecule tags Apoptosis
total genus 57
structure length 166
sequence length 166
ec nomenclature
pdb deposition date 2008-04-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13202 EF-hand_5 EF hand
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2zn8A00
5HKYA 2LV7A 2WCEA 1FI5A 4YGEB 3KPXA 3PSRA 1DF0A 1RTP1 1QLKA 3NSLA 2LP3A 1UP5A 4A4CA 2ZN8A 1QS7A 1JSAA 3DF0B 3QRXA 1AP4A 3BOWB 2CBLA 2KBIA 5F6TA 2LMUA 1K8UA 4U8DA 4ZCUA 2M29A 1W7JB 2KOTA 4MSPA 1NX0A 4BY4A 2IS9A 1NIWA 3KHEA 2L98A 1SL8A 1QX2A 1S6JA 2LAPA 2JT0A 1IKUA 3LK0A 3RM1A 1ALWA 1IWQA 1YVLA 2MBXA 1J55A 2K7DA 4GPLB 1B8LA 3BQ3A 2SCPA 1K93D 2LM5A 3CLNA 1SR6C 1SPYA 1QJTA 2LCPA 1PSBA 5K89A 2H61A 2DOQA 3NXAA 1G4YR 3ZWHA 1MWNA 4OCIA 1KQMC 2K0JA 2KI6D 1KCYA 3DF0A 4ZCVA 2L4IA 3PFVA 1K9UA 2LUCA 5G08A 1R6PA 2ZN9A 4MEWA 1UUSA 4HREE 1H8BA 2Y4QA 3PM8A 3KEVA 2EHBA 1RFJA 1KK8C 3HCMA 1GGWA 1NCYA 3I5IC 5HKWA 2JT8A 2MLEC 2WC8A 3CR2A 1DGUA 2FCEA 2M97A 4ICBA 1RWYA 4Q04A 4XYNA 4OV2A 3LK1A 2NCPA 1NX1A 4PE1A 4UPGA 1AJ4A 2E6WA 1DJXA 2KQYA 2BL0C 2HF5A 3O78A 4GGFC 2I18A 4GFTA 1M31A 3BUXB 3EVVA 5ER5A 2F3ZA 2F2PA 1B7TY 1DMOA 1EG4A 4GAOA 3CZTX 1C7WA 4I5KA 1YX7A 4CFQA 4N5XA 4M2PA 1JF2A 3WHUB 1AJ5A 1TIZA 4E68A 3SG2A 1J7RA 1J7PA 3WHTB 1BOCA 1A75A 2JC2A 1NCXA 1UHNA 1OMVA 4YI8A 4NDDA 1SMGA 2KFHA 1FW4A 1H4BA 4YGDB 2K61A 2K8MB 3EVRA 4CIDA 1NWDA 3BUWB 2WOSA 3IQQA 4DUQA 1CDLA 2KGRA 1DTLA 2PSRA 5D7FA 3EKJA 3TS5C 1ZFSA 1OZOA 1M46A 2KI4C 2BE6A 3DVKA 1GQMA 1Y1UA 1F71A 5CSNA 4IL1A 4YGBB 1J1EA 3E3RA 3TZ1A 1XFXO 4P5OE 4XJKB 2KNEA 4C0LA 4GNKB 5DKNA 3LL8B 1FBVA 2L51A 1S26D 2Y1MA 2KDHA 5JJGA 1OZSA 1EL4A 1XFUO 1RJVA 1NSHA 2BCBA 1XFZO 4ORAB 5I8NA 1A03A 4DRWA 4FTGA 2JNFA 1S5GY 1HQVA 1TRFA 5FYXA 2V53A 1PALA 1LXFC 1MF8B 1K90D 3KF9A 4MZKA 1XA5A 3SG3A 1NPQA 4M2QA 3DVJA 3TS5B 1CFCA 3HX4A 1QATA 1CLLA 4YBHB 2KYFA 5BPJA 1CLBA 2L5XB 3VRNA 4USLA 1SYMA 4PHJA 2F2OA 2LHIA 5D69A 3JVTB 4GGFA 1F4OA 2KQ6A 4YGAA 1DJIA 3EVUA 1Y0VH 2JNXA 2M9GA 1N65A 2WCFA 1OE9B 1CM4A 1W7IB 4CLNA 1S1EA 1SL9A 1XFYO 5CPVA 1QIWA 5HKZA 2LVIA 3TDUA 2D8NA 2Q4UA 1WRZA 1LVCD 3DD4A 4GUKA 2ZNDA 1MXLC 1TCFA 2RGIA 4OVNF 2L0PA 2PMYA 4I5JA 1FPWA 3CGAA 4GBAA 1GJYA 2LC5A 5KTYA 1TTXA 2L50A 1B7TZ 1HT9A 1M63B 2JXCA 1K94A 2LHLA 4M2OA 2JULA 4CFRA 2H2KA 3GOFA 2M8UA 3SJSA 3WXAA 2F3YA 5KSZA 2NZ0A 5ER4X 2MAZA 3OHMB 1YRUB 1BR1B 3O6BA 3BYAA 2JOJA 1KFUL 3A8RA 4QJ4B 3D10A 5B8IB 1JC2A 4DCKA 2BKHB 3I5HC 1YX8A 3BOWA 4MZJA 4AQIA 2I2RE 2BBNA 2MLFC 1GGZA 2LUXA 3K21A 2OPOA 5I2LA 2K7CA 1SKTA 2MJWB 2QPTA 1TNWA 1ZACA 3I5GB 1YUUA 1YUSA 2AUCA 1NUBA 3VRQA 3JTDB 2K7OA 3D0YB 5DKQA 4N1GA 2JZIA 2KAXA 4YRUA 5GQQC 1ODBA 1XYDA 2HETA 1J1DA 1MHOA 1UWOA 1S5GZ 4CPVA 2LVKA 1QASA 2GV5A 1OSAA 4PCWA 1NYAA 1BLQA 2G9BA 2PASA 1WDCC 1TCOB 1KSOA 3PATA 1F54A 5CSIA 3EK4A 2VRGA 3I5HB 4FQOA 4C0KA 1CMGA 4PE0A 3GK1A 2KI6C 1K95A 1OMRA 1UHJA 2Q91A 3AAJA 2BCAA 1J7QA 4AOMA 1BODA 5CSFA 5KU1A 3OX5A 1L7ZA 1YRTB 1K9PA 2LVJA 1LA3A 1OMDA 1SW8A 2JQ6A 2LVVA 1PRWA 3BUOB 3OX6A 1LKJA 2LLUA 3BUMB 2AMIA 1F8HA 4NDCA 1TNXA 2JPTA 1X02A 1WDCB 4OR9B 5HLVA 3CR4X 2B1UA 1KFXS 1YURA 2MHHA 1CLMA 3SIAA 3PN7B 1F55A 1KWOB 1EJ3A 1SK6D 4NDBA 4I5LB 1U5IB 4HSZA 1SRAA 3FWBA 2K2FA 1ZUZA 2E30A 3JVTC 4MRYA 4WQ3A 3CS1A 5AXIA 1JWDA 2NXQA 3SG4A 5TNCA 2ZFDA 5IBWA 1IH0A 2O60A 1QXPA 2L4HA 2BKIB 1RROA 3DVEA 4PALA 2PRUA 1NP8A 3NSIA 1DJZA 4NQGA 4PHKA 4L9MA 1Y6WA 4YGCB 1LA0A 1CTRA 4WQ2A 3VRPA 2F8PA 3GK2A 1F70A 3OB1B 2L2EA 1XK4C 3SG5A 2CXJA 1M39A 1WLMA 2M49B 2MA2A 2KSPA 3TDZA 2JU0A 1NCZA 2JRFA 1DF0B 2WORA 3KO0A 1UHIA 1EH2A 2K2AA 3AKAA 4OKHA 1BU3A 1QLSA 1CFPA 1B4CA 1B9AA 1YVHA 2FOTA 3OP0A 2ZNEA 3MSEB 3IF7A 5AERA 2LLTA 5JOLA 3F45A 2KHNA 1KSMA 1L2OB 4XJKA 3C1VA 2OS8B 2KGBC 3I5FB 4MZLA 2HQ8A 3EK7A 2WCBA 1IQ3A 2KAVA 2FJUB 3SIBA 2JXLA 4BY5A 4DIRA 3M0WA 1SCMB 4QJ3B 1WLZA 2SASA 1NX2A 3NSOA 3AAKA 2KYCA 1LINA 5AFPA 1CKKA 2K7BA 2KFFA 1B47A 3ICBA 2KFGA 1V1FA 3CTNA 4MN0A 2NCOA 3VRRA 1KK7Y 1IRJA 2LNKA 3PLFB 2Y1NA 5I2QA 1S36A 5DKRA 1A2XA 1PK0D 1BT6A 3I5GC 2EC6B 1AVSA 1BR4B 3JTDC 1RK9A 1DJHA 1TOPA 2QACA 4DS7A 2R2IA 1E8AA 4MBEA 1MR8A 1B8RA 1YTZC 1J7OA 2MRDA 1YR5A 1KFXL 2EGDA 1CB1A 3OB2B 2M1KB 1XFVO 1QV0A 3O2PA 1MQ1A 1IGVA 5PALA 1PULA 2HQWA 1XK4A 2M7NA 1N0YA 1XO5A 2CNPA 1BG1A 1C7VA 1BMOA 2CTNA 1V1GA 1DJGA 1QVIY 4JWQA 4QJ5B 1MUXA 2OTGC 5HYDA 1XFWO 1S3PA 2LANA 2G2BA 4HRGA 4PE4A 1VRKA 1SBJA 2PALA 1G33A 1OOJA 1CNPA 4R1EA 2F33A 2I7AA 2GGMA 4MLWA 1K96A 1EG3A 1IJ5A 1UHKA 1Y1AA 2LE9B 2CCMA 1UURA 2M0RA 2JTZA 1G8IA 1A75B 1WRKA 1FI6A 3A4UB 4I5NB 5CSJA 5J3XA 3PN7C 4PHNA 1AHRA 1BJFA 1KWOC 2A4JA 1JF0A 3NSKA 3VROA 1SY9A 1BF5A 5AEQA 1AK8A 1Q80A 1AUIB 1QX7A 3LCPC 2KAYA 1DJYA 3FS7A 1PVAA 2GGZA 2JTTA 3H4SE 1K9KA 3IQOA 1C07A 2OTGB 1SR6B 2HPSA 3VGOA 1MXEA 1TN4A 3PALA 2LP2A 1RECA 1CFDA 1M45A 1TNQA 2CT9A 1NX3A 1KQMB 4N1FA 2ZRSA 2ZRTA 1XVJA 1CDNA 1ZOTB 3EKHA 1S6CA 4JPZB 3TUYC 5HLOA 2O5GA 1CMFA 1JFKA 2M7LA 2ZKMX 3D0YA 1CDMA 4GGNA 1WY9A 4D1EA 1DJWA 1TNPA 3GK4X 1B8CA 4F0ZB 2M3WA 3CWGA 1WRLA 1KK8B 4JQ0D 3ZNIA 3I5IB 1Y1XA 4ORCB 1QTXA 4HRHA 4MVFA 1OQPA 1IJ6A 1ZMZA 2Y5IA 1KK7Z 2LMTA 2PVBA 1S6IA 3SG6A 3TDIA 3EK8A 1JFJA 1SL7A 1L2OC 2I94A 1DT7B 2OS8C 3DVMA 3I5FC 1QIVA 3LLEA 2BL0B 1A29A 5AANA 1R2UA 1KFUS 4ORBB 4PE7A 1SCMC 3WNXB 3TUYB 1A4PA 1EXRA 3AKBA 3SG7A 3FWCA 2JT3A 3O4YA 1SCVA 1ALVA 1QV1A 4PHMA 1FF1A 1SNLA 1IG5A 2AAOA 2H61C 1PSRA 2FCDA 2JWWA 4PDZA 1CM1A 2ISDA 1UHHA 2TN4A 4C0JA 4YI9A 5I2OA 1JBAA 3BUNB 4A4BA 1PVBA 2BCXA 1F4QA 2LLSA 1K2HA 1CDPA 1QVIZ 2M1UA 2KBMA 2EC6C 1U5IA 1QX5B 4TNCA 1YUTA 2BE4A 2P6BB 4WRIA 1JUOA 2BBMA 1IQ5A 4AQJA 4ETOA 3FIAA 2KI4B 3CR5X 3RLZA 2BECA 1B1GA 1KQVA 2COLB 4MRXA 1D1OA 1CFFA 2NLNA 1N2DA 3BXKA 2WNDA 4P2YB 1DGVA 1DVIA 2LMVA
chains in the Genus database with same CATH superfamily
5HKYA 2BAPA 2LV7A 2WCEA 1FI5A 4YGEB 3KPXA 3CZ1A 3PSRA 1DF0A 1RTP1 1QLKA 3NSLA 2LP3A 1UP5A 4PT1A 2ZN8A 1QS7A 4A4CA 3DF0B 1JSAA 3CZ0A 3QRXA 1AP4A 3BOWB 2CBLA 2KBIA 5F6TA 5FI6A 2LMUA 1K8UA 4U8DA 4ZCUA 2M29A 1W7JB 2K60A 2KOTA 4MSPA 1NX0A 4BY4A 2IS9A 1NIWA 3KHEA 3FE9A 2L98A 1SL8A 3SS5A 1QX2A 1S6JA 2LAPA 2JT0A 3FE6A 3LK0A 1IKUA 3RM1A 1ALWA 1IWQA 1YVLA 2MBXA 1J55A 2P70A 2K7DA 1T14A 4GPLB 1B8LA 3BQ3A 2QEVA 2SCPA 1K93D 2JPOA 2LM5A 3CLNA 3CZ2A 1SR6C 1SPYA 1QJTA 2LCPA 1PSBA 4OZDA 5K89A 2H61A 2DOQA 3NXAA 1G4YR 3ZWHA 1MWNA 3N7HA 4OCIA 2QEHA 1KQMC 2K0JA 2KI6D 4JKTA 1KCYA 3DF0A 4ZCVA 2L4IA 3DY9A 1K9UA 3PFVA 2LUCA 5G08A 1R6PA 2ZN9A 4MEWA 2KLDA 1UUSA 3BJHA 4HREE 1H8BA 2Y4QA 3PM8A 3KEVA 2EHBA 1P28A 1RFJA 5EL2A 1KK8C 3HCMA 1GGWA 1NCYA 3I5IC 3UO9A 5HKWA 2JT8A 2MLEC 2WC8A 3CR2A 3R1OA 1DGUA 2FCEA 2M97A 4ICBA 1RWYA 4Q04A 3PM2A 4XYNA 4OV2A 3LK1A 2NCPA 1NX1A 4PE1A 4UPGA 1AJ4A 2E6WA 1DJXA 2KQYA 1DEKA 2BL0C 2HF5A 3O78A 4GGFC 2I18A 4GFTA 1M31A 3BUXB 3EVVA 5ER5A 2F3ZA 2F2PA 1B7TY 3R1PA 2BNXA 1DMOA 2L2CA 1EG4A 4GAOA 3CZTX 1C7WA 4I5KA 1YX7A 4CFQA 4N5XA 4M2PA 1JF2A 3WHUB 1AJ5A 1TIZA 4E68A 3SG2A 1J7RA 1J7PA 3WHTB 4KYNA 1A75A 2JC2A 1BOCA 1NCXA 1UHNA 1OMVA 3NGVA 4YI8A 4NDDA 1SMGA 2KFHA 1FW4A 1H4BA 4YGDB 2K61A 2K8MB 3EVRA 4CIDA 1NWDA 3BUWB 2WOSA 3IQQA 4DUQA 1CDLA 2KGRA 2P71A 1DTLA 2PSRA 5D7FA 3EKJA 3TS5C 1ZFSA 1OZOA 3L47A 1M46A 2KI4C 2BE6A 2WC5A 3DVKA 1GQMA 1Y1UA 1F71A 5CSNA 4IL1A 4YGBB 1J1EA 3E3RA 3TZ1A 1XFXO 4P5OE 3IVTA 4XJKB 2KNEA 4C0LA 2PYQA 4GNKB 5DKNA 4JD9A 3LL8B 1FBVA 2L51A 1S26D 2Y1MA 2KDHA 5JJGA 1OZSA 1EL4A 1XFUO 1RJVA 2PQLA 1NSHA 2BCBA 1XFZO 4ORAB 5I8NA 1A03A 4DRWA 4FTGA 2JNFA 1S5GY 1W9ZA 1HQVA 1TRFA 5FYXA 2V53A 1PALA 1LXFC 1MF8B 1K90D 3KF9A 4MZKA 1XA5A 3SG3A 1NPQA 4M2QA 3DVJA 3B87A 3TS5B 1CFCA 3BFHA 3HX4A 1QATA 1TWOA 1CLLA 4YBHB 2KYFA 5BPJA 1CLBA 2L5XB 3VRNA 4USLA 1SYMA 4PHJA 2F2OA 2LHIA 5D69A 3JVTB 4GGFA 1F4OA 2KQ6A 2WCMA 4YGAA 1DJIA 3EVUA 1DC1A 1Y0VH 2JNXA 2M9GA 1N65A 2WCFA 1OE9B 1CM4A 1DELA 1W7IB 4CLNA 1S1EA 1SL9A 1XFYO 5CPVA 1QIWA 5HKZA 2LVIA 3TDUA 3S0AA 2D8NA 2QEOA 2Q4UA 3BFAA 1WRZA 1LVCD 3DD4A 4GUKA 2ZNDA 1MXLC 1TCFA 2RGIA 4OVNF 3O4XA 1C3YA 2L0PA 2PMYA 4I5JA 1FPWA 3CGAA 5HL1A 4GBAA 1GJYA 3S0EA 2LC5A 5KTYA 1TTXA 2L50A 1B7TZ 1HT9A 1M63B 2JXCA 1K94A 2LHLA 4M2OA 2JULA 4CFRA 2H2KA 3GOFA 2M8UA 3SJSA 3WXAA 2F3YA 5KSZA 2NZ0A 5ER4X 1SSEB 3CDNA 3D73A 2MAZA 2KLEA 3OHMB 3V2LA 1YRUB 3Q8IA 3B6XA 1BR1B 3O6BA 3BYAA 2JOJA 1KFUL 3A8RA 4QJ4B 3D10A 5B8IB 3S0FA 1OOFA 1JC2A 4DCKA 2BKHB 3D78A 3I5HC 1YX8A 3BOWA 4MZJA 4AQIA 5I94A 2I2RE 2BBNA 2MLFC 3L4LA 1GGZA 2LUXA 3K21A 2OPOA 5I2LA 2K7CA 1SKTA 2MJWB 2QPTA 1TNWA 1ZACA 3S0BA 3I5GB 1YUUA 1YUSA 2AUCA 1NUBA 3VRQA 3JTDB 2K7OA 3D0YB 5DKQA 4N1GA 2JZIA 2KAXA 4YRUA 5GQQC 1ODBA 1XYDA 2HETA 1J1DA 1MHOA 1TUJA 1UWOA 1S5GZ 4CPVA 1OOIX 2LVKA 1QASA 2GV5A 1OSAA 4PCWA 1NYAA 1BLQA 2G9BA 2PASA 1WDCC 1TCOB 1KSOA 3PATA 1F54A 5CSIA 3EK4A 1XFRA 2VRGA 3I5HB 4FQOA 4C0KA 1CMGA 4PE0A 3FE8A 3R1VA 3GK1A 2KI6C 2ERBA 1K95A 1OMRA 1UHJA 2Q91A 3AAJA 3DYEA 2BCAA 3NHTA 1J7QA 4AOMA 1BODA 3SS4A 5CSFA 5KU1A 3OX5A 1L7ZA 1YRTB 1K9PA 2LVJA 1LA3A 1OMDA 1SW8A 2JQ6A 2LVVA 1PRWA 3BUOB 3OGNA 3VB1A 3OX6A 1LKJA 2LLUA 5FI7A 3BUMB 2AMIA 3OBVA 1F8HA 4NDCA 1TNXA 2H8VA 2JPTA 1X02A 1WDCB 4OR9B 5HLVA 3CR4X 2B1UA 1KFXS 1YURA 2MHHA 1CLMA 3SIAA 3PN7B 1F55A 1KWOB 1EJ3A 3QMEA 1IIOA 1SK6D 4NDBA 4F7FA 4I5LB 1U5IB 4HSZA 1SRAA 1OOHA 3FWBA 2K2FA 1ZUZA 2E30A 3JVTC 4MRYA 4WQ3A 3CS1A 5AXIA 2WCJA 1JWDA 2NXQA 3SG4A 5TNCA 2ZFDA 5IBWA 1IH0A 2O60A 1QXPA 2L4HA 2BKIB 1RROA 3BFBA 3DVEA 2PRUA 1NP8A 3NSIA 4PALA 5FI2A 1DJZA 4NQGA 1OW4A 4L9MA 1Y6WA 4PHKA 4YGCB 1LA0A 1CTRA 4WQ2A 3D77A 2F8PA 3GK2A 3VRPA 1F70A 3OB1B 2L2EA 1XK4C 2QEBA 3SG5A 2CXJA 1M39A 1WLMA 2M49B 2MA2A 2KSPA 3TDZA 2JU0A 1NCZA 2JRFA 1DF0B 2WORA 3KO0A 3PJIA 1UHIA 1EH2A 2K2AA 3AKAA 4OKHA 1BU3A 1QLSA 1CFPA 3EG5B 1B4CA 1B9AA 1DQEA 1YVHA 2FOTA 2ZNEA 3MSEB 3IF7A 3OP0A 3SS3A 5AERA 2LLTA 3B7AA 5JOLA 3F45A 2KHNA 1KSMA 1L2OB 4XJKA 2GTEA 3C1VA 2OS8B 2KGBC 3I5FB 4MZLA 2HQ8A 3EK7A 2WCBA 1IQ3A 2KAVA 2FJUB 3SIBA 2JXLA 4IJ7A 4BY5A 4DIRA 3M0WA 3R72A 1SCMB 4QJ3B 1WLZA 2SASA 1NX2A 3NSOA 3AAKA 2KYCA 1LINA 4INXA 5AFPA 1CKKA 2K7BA 1QWVA 2KFFA 1B47A 3ICBA 2KFGA 1V1FA 3CTNA 1Z2CB 4MN0A 2NCOA 3VRRA 1KK7Y 1IRJA 2LNKA 3PLFB 2Y1NA 5I2QA 1S36A 5DKRA 1A2XA 3D75A 1PK0D 1BT6A 2KPHA 3I5GC 2EC6B 1AVSA 1BR4B 2WCLA 3JTDC 1RK9A 1DJHA 1TOPA 2QACA 4DS7A 2R2IA 3B86A 1E8AA 4MBEA 1MR8A 1B8RA 1YTZC 1J7OA 2MRDA 1YR5A 3DXLA 1KFXL 3CYZA 2EGDA 1CB1A 3OB2B 2M1KB 1XFVO 1QV0A 3D74A 3O2PA 1MQ1A 1IGVA 5PALA 1PULA 2HQWA 3L4AA 1XK4A 2M7NA 1N0YA 1XO5A 2CNPA 1BG1A 1C7VA 1BMOA 2CTNA 1V1GA 1DJGA 1QVIY 4JWQA 4QJ5B 1MUXA 2OTGC 5HYDA 1XFWO 1S3PA 2LANA 2G2BA 4HRGA 4PE4A 1VRKA 1SBJA 2PALA 1G33A 1OOJA 1CNPA 4R1EA 2F33A 3RZSA 2I7AA 2GGMA 4MLWA 1K96A 1EG3A 1OOGA 1IJ5A 4FQTA 1UHKA 1Y1AA 2LE9B 2CCMA 2QDIA 2WC6A 1UURA 1ORGA 2M0RA 2JTZA 1G8IA 1A75B 1WRKA 1FI6A 3A4UB 4I5NB 5CSJA 5J3XA 3PN7C 4PHNA 1AHRA 1BJFA 1KWOC 2A4JA 1JF0A 3NSKA 3VROA 1SY9A 1BF5A 5AEQA 1AK8A 1Q80A 1AUIB 1QX7A 3LCPC 2KAYA 1DJYA 3UNWA 3FS7A 1PVAA 1Z4HA 2GGZA 2JTTA 3H4SE 1K9KA 3IQOA 1C07A 2OTGB 1SR6B 2HPSA 3VGOA 1MXEA 1TN4A 3PALA 2LP2A 1RECA 1CFDA 1M45A 1TNQA 2CT9A 1NX3A 1KQMB 4N1FA 1LS8A 2ZRSA 2ZRTA 1XVJA 1CDNA 1ZOTB 3EKHA 1S6CA 4JPZB 3TUYC 5HLOA 2O5GA 1CMFA 1JFKA 2M7LA 2ZKMX 3D0YA 1CDMA 3DZTA 1WY9A 2FJYA 1DJWA 1TNPA 4GGNA 3GK4X 1B8CA 4D1EA 4F0ZB 2M3WA 2WCKA 3CWGA 1WRLA 1GM0A 1KK8B 3D76A 4JQ0D 3ZNIA 2L5YA 1Y1XA 3I5IB 1QTXA 4ORCB 4HRHA 4MVFA 3K1EA 1OQPA 1IJ6A 1ZMZA 2Y5IA 1KK7Z 2LMTA 2PVBA 1S6IA 3SG6A 3TDIA 3EK8A 1JFJA 1SL7A 1L2OC 2I94A 1DT7B 2OS8C 3DVMA 3I5FC 1QIVA 3LLEA 2BL0B 2WCHA 1A29A 3S0DA 5AANA 1R2UA 1KFUS 4ORBB 4PE7A 1TUZA 1SCMC 3CABA 3WNXB 4INWA 3TUYB 1A4PA 1EXRA 3AKBA 3SG7A 3FWCA 2JT3A 3O4YA 1SCVA 1ALVA 1QV1A 4PHMA 1FF1A 1SNLA 1IG5A 2AAOA 2H61C 1PSRA 2FCDA 2JWWA 4PDZA 1CM1A 2ISDA 1UHHA 2TN4A 4C0JA 4YI9A 5I2OA 1JBAA 3BUNB 1C3ZA 4A4BA 1PVBA 2BCXA 1F4QA 2LLSA 3S0GA 1K2HA 1CDPA 5D3OA 1QVIZ 2M1UA 3B88A 2KBMA 2EC6C 1U5IA 1QX5B 4TNCA 1YUTA 2BE4A 2P6BB 2YGUA 4WRIA 1JUOA 2BBMA 1IQ5A 4AQJA 4ETOA 3FIAA 2KI4B 3CR5X 3RLZA 2BECA 1B1GA 5DICA 1KQVA 2COLB 4MRXA 1D1OA 1CFFA 2NLNA 1N2DA 3BXKA 2WNDA 4P2YB 1DGVA 1DVIA 2LMVA 3NHIA
chains in the Genus database with same CATH topology
5HKYA 2LV7A 2WCEA 1FI5A 4YGEB 3KPXA 3PSRA 1DF0A 1RTP1 1QLKA 3NSLA 2LP3A 1UP5A 4A4CA 2ZN8A 1QS7A 1JSAA 3DF0B 3QRXA 1AP4A 3BOWB 2CBLA 2KBIA 5F6TA 2LMUA 1K8UA 4U8DA 4ZCUA 2M29A 1W7JB 2KOTA 4MSPA 1NX0A 4BY4A 2IS9A 1NIWA 3KHEA 2L98A 1SL8A 1QX2A 1S6JA 2LAPA 2JT0A 1IKUA 3LK0A 3RM1A 1ALWA 1IWQA 1YVLA 2MBXA 1J55A 2K7DA 4GPLB 1B8LA 3BQ3A 2SCPA 1K93D 2LM5A 3CLNA 1SR6C 1SPYA 1QJTA 2LCPA 1PSBA 5K89A 2H61A 2DOQA 3NXAA 1G4YR 3ZWHA 1MWNA 4OCIA 1KQMC 2K0JA 2KI6D 1KCYA 3DF0A 4ZCVA 2L4IA 3PFVA 1K9UA 2LUCA 5G08A 1R6PA 2ZN9A 4MEWA 1UUSA 4HREE 1H8BA 2Y4QA 3PM8A 3KEVA 2EHBA 1RFJA 1KK8C 3HCMA 1GGWA 1NCYA 3I5IC 5HKWA 2JT8A 2MLEC 2WC8A 3CR2A 1DGUA 2FCEA 2M97A 4ICBA 1RWYA 4Q04A 4XYNA 4OV2A 3LK1A 2NCPA 1NX1A 4PE1A 4UPGA 1AJ4A 2E6WA 1DJXA 2KQYA 2BL0C 2HF5A 3O78A 4GGFC 2I18A 4GFTA 1M31A 3BUXB 3EVVA 5ER5A 2F3ZA 2F2PA 1B7TY 1DMOA 1EG4A 4GAOA 3CZTX 1C7WA 4I5KA 1YX7A 4CFQA 4N5XA 4M2PA 1JF2A 3WHUB 1AJ5A 1TIZA 4E68A 3SG2A 1J7RA 1J7PA 3WHTB 1BOCA 1A75A 2JC2A 1NCXA 1UHNA 1OMVA 4YI8A 4NDDA 1SMGA 2KFHA 1FW4A 1H4BA 4YGDB 2K61A 2K8MB 3EVRA 4CIDA 1NWDA 3BUWB 2WOSA 3IQQA 4DUQA 1CDLA 2KGRA 1DTLA 2PSRA 5D7FA 3EKJA 3TS5C 1ZFSA 1OZOA 1M46A 2KI4C 2BE6A 3DVKA 1GQMA 1Y1UA 1F71A 5CSNA 4IL1A 4YGBB 1J1EA 3E3RA 3TZ1A 1XFXO 4P5OE 4XJKB 2KNEA 4C0LA 4GNKB 5DKNA 3LL8B 1FBVA 2L51A 1S26D 2Y1MA 2KDHA 5JJGA 1OZSA 1EL4A 1XFUO 1RJVA 1NSHA 2BCBA 1XFZO 4ORAB 5I8NA 1A03A 4DRWA 4FTGA 2JNFA 1S5GY 1HQVA 1TRFA 5FYXA 2V53A 1PALA 1LXFC 1MF8B 1K90D 3KF9A 4MZKA 1XA5A 3SG3A 1NPQA 4M2QA 3DVJA 3TS5B 1CFCA 3HX4A 1QATA 1CLLA 4YBHB 2KYFA 5BPJA 1CLBA 2L5XB 3VRNA 4USLA 1SYMA 4PHJA 2F2OA 2LHIA 5D69A 3JVTB 4GGFA 1F4OA 2KQ6A 4YGAA 1DJIA 3EVUA 1Y0VH 2JNXA 2M9GA 1N65A 2WCFA 1OE9B 1CM4A 1W7IB 4CLNA 1S1EA 1SL9A 1XFYO 5CPVA 1QIWA 5HKZA 2LVIA 3TDUA 2D8NA 2Q4UA 1WRZA 1LVCD 3DD4A 4GUKA 2ZNDA 1MXLC 1TCFA 2RGIA 4OVNF 2L0PA 2PMYA 4I5JA 1FPWA 3CGAA 4GBAA 1GJYA 2LC5A 5KTYA 1TTXA 2L50A 1B7TZ 1HT9A 1M63B 2JXCA 1K94A 2LHLA 4M2OA 2JULA 4CFRA 2H2KA 3GOFA 2M8UA 3SJSA 3WXAA 2F3YA 5KSZA 2NZ0A 5ER4X 2MAZA 3OHMB 1YRUB 1BR1B 3O6BA 3BYAA 2JOJA 1KFUL 3A8RA 4QJ4B 3D10A 5B8IB 1JC2A 4DCKA 2BKHB 3I5HC 1YX8A 3BOWA 4MZJA 4AQIA 2I2RE 2BBNA 2MLFC 1GGZA 2LUXA 3K21A 2OPOA 5I2LA 2K7CA 1SKTA 2MJWB 2QPTA 1TNWA 1ZACA 3I5GB 1YUUA 1YUSA 2AUCA 1NUBA 3VRQA 3JTDB 2K7OA 3D0YB 5DKQA 4N1GA 2JZIA 2KAXA 4YRUA 5GQQC 1ODBA 1XYDA 2HETA 1J1DA 1MHOA 1UWOA 1S5GZ 4CPVA 2LVKA 1QASA 2GV5A 1OSAA 4PCWA 1NYAA 1BLQA 2G9BA 2PASA 1WDCC 1TCOB 1KSOA 3PATA 1F54A 5CSIA 3EK4A 2VRGA 3I5HB 4FQOA 4C0KA 1CMGA 4PE0A 3GK1A 2KI6C 1K95A 1OMRA 1UHJA 2Q91A 3AAJA 2BCAA 1J7QA 4AOMA 1BODA 5CSFA 5KU1A 3OX5A 1L7ZA 1YRTB 1K9PA 2LVJA 1LA3A 1OMDA 1SW8A 2JQ6A 2LVVA 1PRWA 3BUOB 3OX6A 1LKJA 2LLUA 3BUMB 2AMIA 1F8HA 4NDCA 1TNXA 2JPTA 1X02A 1WDCB 4OR9B 5HLVA 3CR4X 2B1UA 1KFXS 1YURA 2MHHA 1CLMA 3SIAA 3PN7B 1F55A 1KWOB 1EJ3A 1SK6D 4NDBA 4I5LB 1U5IB 4HSZA 1SRAA 3FWBA 2K2FA 1ZUZA 2E30A 3JVTC 4MRYA 4WQ3A 3CS1A 5AXIA 1JWDA 2NXQA 3SG4A 5TNCA 2ZFDA 5IBWA 1IH0A 2O60A 1QXPA 2L4HA 2BKIB 1RROA 3DVEA 4PALA 2PRUA 1NP8A 3NSIA 1DJZA 4NQGA 4PHKA 4L9MA 1Y6WA 4YGCB 1LA0A 1CTRA 4WQ2A 3VRPA 2F8PA 3GK2A 1F70A 3OB1B 2L2EA 1XK4C 3SG5A 2CXJA 1M39A 1WLMA 2M49B 2MA2A 2KSPA 3TDZA 2JU0A 1NCZA 2JRFA 1DF0B 2WORA 3KO0A 1UHIA 1EH2A 2K2AA 3AKAA 4OKHA 1BU3A 1QLSA 1CFPA 1B4CA 1B9AA 1YVHA 2FOTA 3OP0A 2ZNEA 3MSEB 3IF7A 5AERA 2LLTA 5JOLA 3F45A 2KHNA 1KSMA 1L2OB 4XJKA 3C1VA 2OS8B 2KGBC 3I5FB 4MZLA 2HQ8A 3EK7A 2WCBA 1IQ3A 2KAVA 2FJUB 3SIBA 2JXLA 4BY5A 4DIRA 3M0WA 1SCMB 4QJ3B 1WLZA 2SASA 1NX2A 3NSOA 3AAKA 2KYCA 1LINA 5AFPA 1CKKA 2K7BA 2KFFA 1B47A 3ICBA 2KFGA 1V1FA 3CTNA 4MN0A 2NCOA 3VRRA 1KK7Y 1IRJA 2LNKA 3PLFB 2Y1NA 5I2QA 1S36A 5DKRA 1A2XA 1PK0D 1BT6A 3I5GC 2EC6B 1AVSA 1BR4B 3JTDC 1RK9A 1DJHA 1TOPA 2QACA 4DS7A 2R2IA 1E8AA 4MBEA 1MR8A 1B8RA 1YTZC 1J7OA 2MRDA 1YR5A 1KFXL 2EGDA 1CB1A 3OB2B 2M1KB 1XFVO 1QV0A 3O2PA 1MQ1A 1IGVA 5PALA 1PULA 2HQWA 1XK4A 2M7NA 1N0YA 1XO5A 2CNPA 1BG1A 1C7VA 1BMOA 2CTNA 1V1GA 1DJGA 1QVIY 4JWQA 4QJ5B 1MUXA 2OTGC 5HYDA 1XFWO 1S3PA 2LANA 2G2BA 4HRGA 4PE4A 1VRKA 1SBJA 2PALA 1G33A 1OOJA 1CNPA 4R1EA 2F33A 2I7AA 2GGMA 4MLWA 1K96A 1EG3A 1IJ5A 1UHKA 1Y1AA 2LE9B 2CCMA 1UURA 2M0RA 2JTZA 1G8IA 1A75B 1WRKA 1FI6A 3A4UB 4I5NB 5CSJA 5J3XA 3PN7C 4PHNA 1AHRA 1BJFA 1KWOC 2A4JA 1JF0A 3NSKA 3VROA 1SY9A 1BF5A 5AEQA 1AK8A 1Q80A 1AUIB 1QX7A 3LCPC 2KAYA 1DJYA 3FS7A 1PVAA 2GGZA 2JTTA 3H4SE 1K9KA 3IQOA 1C07A 2OTGB 1SR6B 2HPSA 3VGOA 1MXEA 1TN4A 3PALA 2LP2A 1RECA 1CFDA 1M45A 1TNQA 2CT9A 1NX3A 1KQMB 4N1FA 2ZRSA 2ZRTA 1XVJA 1CDNA 1ZOTB 3EKHA 1S6CA 4JPZB 3TUYC 5HLOA 2O5GA 1CMFA 1JFKA 2M7LA 2ZKMX 3D0YA 1CDMA 4GGNA 1WY9A 4D1EA 1DJWA 1TNPA 3GK4X 1B8CA 4F0ZB 2M3WA 3CWGA 1WRLA 1KK8B 4JQ0D 3ZNIA 3I5IB 1Y1XA 4ORCB 1QTXA 4HRHA 4MVFA 1OQPA 1IJ6A 1ZMZA 2Y5IA 1KK7Z 2LMTA 2PVBA 1S6IA 3SG6A 3TDIA 3EK8A 1JFJA 1SL7A 1L2OC 2I94A 1DT7B 2OS8C 3DVMA 3I5FC 1QIVA 3LLEA 2BL0B 1A29A 5AANA 1R2UA 1KFUS 4ORBB 4PE7A 1SCMC 3WNXB 3TUYB 1A4PA 1EXRA 3AKBA 3SG7A 3FWCA 2JT3A 3O4YA 1SCVA 1ALVA 1QV1A 4PHMA 1FF1A 1SNLA 1IG5A 2AAOA 2H61C 1PSRA 2FCDA 2JWWA 4PDZA 1CM1A 2ISDA 1UHHA 2TN4A 4C0JA 4YI9A 5I2OA 1JBAA 3BUNB 4A4BA 1PVBA 2BCXA 1F4QA 2LLSA 1K2HA 1CDPA 1QVIZ 2M1UA 2KBMA 2EC6C 1U5IA 1QX5B 4TNCA 1YUTA 2BE4A 2P6BB 4WRIA 1JUOA 2BBMA 1IQ5A 4AQJA 4ETOA 3FIAA 2KI4B 3CR5X 3RLZA 2BECA 1B1GA 1KQVA 2COLB 4MRXA 1D1OA 1CFFA 2NLNA 1N2DA 3BXKA 2WNDA 4P2YB 1DGVA 1DVIA 2LMVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HKY A;  2LV7 A;  2WCE A;  1FI5 A;  4YGE B;  3KPX A;  3PSR A;  1DF0 A;  1RTP 1;  1QLK A;  3NSL A;  2LP3 A;  1UP5 A;  4A4C A;  2ZN8 A;  1QS7 A;  1JSA A;  3DF0 B;  3QRX A;  1AP4 A;  3BOW B;  2CBL A;  2KBI A;  5F6T A;  2LMU A;  1K8U A;  4U8D A;  4ZCU A;  2M29 A;  1W7J B;  2KOT A;  4MSP A;  1NX0 A;  4BY4 A;  2IS9 A;  1NIW A;  3KHE A;  2L98 A;  1SL8 A;  1QX2 A;  1S6J A;  2LAP A;  2JT0 A;  1IKU A;  3LK0 A;  3RM1 A;  1ALW A;  1IWQ A;  1YVL A;  2MBX A;  1J55 A;  2K7D A;  4GPL B;  1B8L A;  3BQ3 A;  2SCP A;  1K93 D;  2LM5 A;  3CLN A;  1SR6 C;  1SPY A;  1QJT A;  2LCP A;  1PSB A;  5K89 A;  2H61 A;  2DOQ A;  3NXA A;  1G4Y R;  3ZWH A;  1MWN A;  4OCI A;  1KQM C;  2K0J A;  2KI6 D;  1KCY A;  3DF0 A;  4ZCV A;  2L4I A;  3PFV A;  1K9U A;  2LUC A;  5G08 A;  1R6P A;  2ZN9 A;  4MEW A;  1UUS A;  4HRE E;  1H8B A;  2Y4Q A;  3PM8 A;  3KEV A;  2EHB A;  1RFJ A;  1KK8 C;  3HCM A;  1GGW A;  1NCY A;  3I5I C;  5HKW A;  2JT8 A;  2MLE C;  2WC8 A;  3CR2 A;  1DGU A;  2FCE A;  2M97 A;  4ICB A;  1RWY A;  4Q04 A;  4XYN A;  4OV2 A;  3LK1 A;  2NCP A;  1NX1 A;  4PE1 A;  4UPG A;  1AJ4 A;  2E6W A;  1DJX A;  2KQY A;  2BL0 C;  2HF5 A;  3O78 A;  4GGF C;  2I18 A;  4GFT A;  1M31 A;  3BUX B;  3EVV A;  5ER5 A;  2F3Z A;  2F2P A;  1B7T Y;  1DMO A;  1EG4 A;  4GAO A;  3CZT X;  1C7W A;  4I5K A;  1YX7 A;  4CFQ A;  4N5X A;  4M2P A;  1JF2 A;  3WHU B;  1AJ5 A;  1TIZ A;  4E68 A;  3SG2 A;  1J7R A;  1J7P A;  3WHT B;  1BOC A;  1A75 A;  2JC2 A;  1NCX A;  1UHN A;  1OMV A;  4YI8 A;  4NDD A;  1SMG A;  2KFH A;  1FW4 A;  1H4B A;  4YGD B;  2K61 A;  2K8M B;  3EVR A;  4CID A;  1NWD A;  3BUW B;  2WOS A;  3IQQ A;  4DUQ A;  1CDL A;  2KGR A;  1DTL A;  2PSR A;  5D7F A;  3EKJ A;  3TS5 C;  1ZFS A;  1OZO A;  1M46 A;  2KI4 C;  2BE6 A;  3DVK A;  1GQM A;  1Y1U A;  1F71 A;  5CSN A;  4IL1 A;  4YGB B;  1J1E A;  3E3R A;  3TZ1 A;  1XFX O;  4P5O E;  4XJK B;  2KNE A;  4C0L A;  4GNK B;  5DKN A;  3LL8 B;  1FBV A;  2L51 A;  1S26 D;  2Y1M A;  2KDH A;  5JJG A;  1OZS A;  1EL4 A;  1XFU O;  1RJV A;  1NSH A;  2BCB A;  1XFZ O;  4ORA B;  5I8N A;  1A03 A;  4DRW A;  4FTG A;  2JNF A;  1S5G Y;  1HQV A;  1TRF A;  5FYX A;  2V53 A;  1PAL A;  1LXF C;  1MF8 B;  1K90 D;  3KF9 A;  4MZK A;  1XA5 A;  3SG3 A;  1NPQ A;  4M2Q A;  3DVJ A;  3TS5 B;  1CFC A;  3HX4 A;  1QAT A;  1CLL A;  4YBH B;  2KYF A;  5BPJ A;  1CLB A;  2L5X B;  3VRN A;  4USL A;  1SYM A;  4PHJ A;  2F2O A;  2LHI A;  5D69 A;  3JVT B;  4GGF A;  1F4O A;  2KQ6 A;  4YGA A;  1DJI A;  3EVU A;  1Y0V H;  2JNX A;  2M9G A;  1N65 A;  2WCF A;  1OE9 B;  1CM4 A;  1W7I B;  4CLN A;  1S1E A;  1SL9 A;  1XFY O;  5CPV A;  1QIW A;  5HKZ A;  2LVI A;  3TDU A;  2D8N A;  2Q4U A;  1WRZ A;  1LVC D;  3DD4 A;  4GUK A;  2ZND A;  1MXL C;  1TCF A;  2RGI A;  4OVN F;  2L0P A;  2PMY A;  4I5J A;  1FPW A;  3CGA A;  4GBA A;  1GJY A;  2LC5 A;  5KTY A;  1TTX A;  2L50 A;  1B7T Z;  1HT9 A;  1M63 B;  2JXC A;  1K94 A;  2LHL A;  4M2O A;  2JUL A;  4CFR A;  2H2K A;  3GOF A;  2M8U A;  3SJS A;  3WXA A;  2F3Y A;  5KSZ A;  2NZ0 A;  5ER4 X;  2MAZ A;  3OHM B;  1YRU B;  1BR1 B;  3O6B A;  3BYA A;  2JOJ A;  1KFU L;  3A8R A;  4QJ4 B;  3D10 A;  5B8I B;  1JC2 A;  4DCK A;  2BKH B;  3I5H C;  1YX8 A;  3BOW A;  4MZJ A;  4AQI A;  2I2R E;  2BBN A;  2MLF C;  1GGZ A;  2LUX A;  3K21 A;  2OPO A;  5I2L A;  2K7C A;  1SKT A;  2MJW B;  2QPT A;  1TNW A;  1ZAC A;  3I5G B;  1YUU A;  1YUS A;  2AUC A;  1NUB A;  3VRQ A;  3JTD B;  2K7O A;  3D0Y B;  5DKQ A;  4N1G A;  2JZI A;  2KAX A;  4YRU A;  5GQQ C;  1ODB A;  1XYD A;  2HET A;  1J1D A;  1MHO A;  1UWO A;  1S5G Z;  4CPV A;  2LVK A;  1QAS A;  2GV5 A;  1OSA A;  4PCW A;  1NYA A;  1BLQ A;  2G9B A;  2PAS A;  1WDC C;  1TCO B;  1KSO A;  3PAT A;  1F54 A;  5CSI A;  3EK4 A;  2VRG A;  3I5H B;  4FQO A;  4C0K A;  1CMG A;  4PE0 A;  3GK1 A;  2KI6 C;  1K95 A;  1OMR A;  1UHJ A;  2Q91 A;  3AAJ A;  2BCA A;  1J7Q A;  4AOM A;  1BOD A;  5CSF A;  5KU1 A;  3OX5 A;  1L7Z A;  1YRT B;  1K9P A;  2LVJ A;  1LA3 A;  1OMD A;  1SW8 A;  2JQ6 A;  2LVV A;  1PRW A;  3BUO B;  3OX6 A;  1LKJ A;  2LLU A;  3BUM B;  2AMI A;  1F8H A;  4NDC A;  1TNX A;  2JPT A;  1X02 A;  1WDC B;  4OR9 B;  5HLV A;  3CR4 X;  2B1U A;  1KFX S;  1YUR A;  2MHH A;  1CLM A;  3SIA A;  3PN7 B;  1F55 A;  1KWO B;  1EJ3 A;  1SK6 D;  4NDB A;  4I5L B;  1U5I B;  4HSZ A;  1SRA A;  3FWB A;  2K2F A;  1ZUZ A;  2E30 A;  3JVT C;  4MRY A;  4WQ3 A;  3CS1 A;  5AXI A;  1JWD A;  2NXQ A;  3SG4 A;  5TNC A;  2ZFD A;  5IBW A;  1IH0 A;  2O60 A;  1QXP A;  2L4H A;  2BKI B;  1RRO A;  3DVE A;  4PAL A;  2PRU A;  1NP8 A;  3NSI A;  1DJZ A;  4NQG A;  4PHK A;  4L9M A;  1Y6W A;  4YGC B;  1LA0 A;  1CTR A;  4WQ2 A;  3VRP A;  2F8P A;  3GK2 A;  1F70 A;  3OB1 B;  2L2E A;  1XK4 C;  3SG5 A;  2CXJ A;  1M39 A;  1WLM A;  2M49 B;  2MA2 A;  2KSP A;  3TDZ A;  2JU0 A;  1NCZ A;  2JRF A;  1DF0 B;  2WOR A;  3KO0 A;  1UHI A;  1EH2 A;  2K2A A;  3AKA A;  4OKH A;  1BU3 A;  1QLS A;  1CFP A;  1B4C A;  1B9A A;  1YVH A;  2FOT A;  3OP0 A;  2ZNE A;  3MSE B;  3IF7 A;  5AER A;  2LLT A;  5JOL A;  3F45 A;  2KHN A;  1KSM A;  1L2O B;  4XJK A;  3C1V A;  2OS8 B;  2KGB C;  3I5F B;  4MZL A;  2HQ8 A;  3EK7 A;  2WCB A;  1IQ3 A;  2KAV A;  2FJU B;  3SIB A;  2JXL A;  4BY5 A;  4DIR A;  3M0W A;  1SCM B;  4QJ3 B;  1WLZ A;  2SAS A;  1NX2 A;  3NSO A;  3AAK A;  2KYC A;  1LIN A;  5AFP A;  1CKK A;  2K7B A;  2KFF A;  1B47 A;  3ICB A;  2KFG A;  1V1F A;  3CTN A;  4MN0 A;  2NCO A;  3VRR A;  1KK7 Y;  1IRJ A;  2LNK A;  3PLF B;  2Y1N A;  5I2Q A;  1S36 A;  5DKR A;  1A2X A;  1PK0 D;  1BT6 A;  3I5G C;  2EC6 B;  1AVS A;  1BR4 B;  3JTD C;  1RK9 A;  1DJH A;  1TOP A;  2QAC A;  4DS7 A;  2R2I A;  1E8A A;  4MBE A;  1MR8 A;  1B8R A;  1YTZ C;  1J7O A;  2MRD A;  1YR5 A;  1KFX L;  2EGD A;  1CB1 A;  3OB2 B;  2M1K B;  1XFV O;  1QV0 A;  3O2P A;  1MQ1 A;  1IGV A;  5PAL A;  1PUL A;  2HQW A;  1XK4 A;  2M7N A;  1N0Y A;  1XO5 A;  2CNP A;  1BG1 A;  1C7V A;  1BMO A;  2CTN A;  1V1G A;  1DJG A;  1QVI Y;  4JWQ A;  4QJ5 B;  1MUX A;  2OTG C;  5HYD A;  1XFW O;  1S3P A;  2LAN A;  2G2B A;  4HRG A;  4PE4 A;  1VRK A;  1SBJ A;  2PAL A;  1G33 A;  1OOJ A;  1CNP A;  4R1E A;  2F33 A;  2I7A A;  2GGM A;  4MLW A;  1K96 A;  1EG3 A;  1IJ5 A;  1UHK A;  1Y1A A;  2LE9 B;  2CCM A;  1UUR A;  2M0R A;  2JTZ A;  1G8I A;  1A75 B;  1WRK A;  1FI6 A;  3A4U B;  4I5N B;  5CSJ A;  5J3X A;  3PN7 C;  4PHN A;  1AHR A;  1BJF A;  1KWO C;  2A4J A;  1JF0 A;  3NSK A;  3VRO A;  1SY9 A;  1BF5 A;  5AEQ A;  1AK8 A;  1Q80 A;  1AUI B;  1QX7 A;  3LCP C;  2KAY A;  1DJY A;  3FS7 A;  1PVA A;  2GGZ A;  2JTT A;  3H4S E;  1K9K A;  3IQO A;  1C07 A;  2OTG B;  1SR6 B;  2HPS A;  3VGO A;  1MXE A;  1TN4 A;  3PAL A;  2LP2 A;  1REC A;  1CFD A;  1M45 A;  1TNQ A;  2CT9 A;  1NX3 A;  1KQM B;  4N1F A;  2ZRS A;  2ZRT A;  1XVJ A;  1CDN A;  1ZOT B;  3EKH A;  1S6C A;  4JPZ B;  3TUY C;  5HLO A;  2O5G A;  1CMF A;  1JFK A;  2M7L A;  2ZKM X;  3D0Y A;  1CDM A;  4GGN A;  1WY9 A;  4D1E A;  1DJW A;  1TNP A;  3GK4 X;  1B8C A;  4F0Z B;  2M3W A;  3CWG A;  1WRL A;  1KK8 B;  4JQ0 D;  3ZNI A;  3I5I B;  1Y1X A;  4ORC B;  1QTX A;  4HRH A;  4MVF A;  1OQP A;  1IJ6 A;  1ZMZ A;  2Y5I A;  1KK7 Z;  2LMT A;  2PVB A;  1S6I A;  3SG6 A;  3TDI A;  3EK8 A;  1JFJ A;  1SL7 A;  1L2O C;  2I94 A;  1DT7 B;  2OS8 C;  3DVM A;  3I5F C;  1QIV A;  3LLE A;  2BL0 B;  1A29 A;  5AAN A;  1R2U A;  1KFU S;  4ORB B;  4PE7 A;  1SCM C;  3WNX B;  3TUY B;  1A4P A;  1EXR A;  3AKB A;  3SG7 A;  3FWC A;  2JT3 A;  3O4Y A;  1SCV A;  1ALV A;  1QV1 A;  4PHM A;  1FF1 A;  1SNL A;  1IG5 A;  2AAO A;  2H61 C;  1PSR A;  2FCD A;  2JWW A;  4PDZ A;  1CM1 A;  2ISD A;  1UHH A;  2TN4 A;  4C0J A;  4YI9 A;  5I2O A;  1JBA A;  3BUN B;  4A4B A;  1PVB A;  2BCX A;  1F4Q A;  2LLS A;  1K2H A;  1CDP A;  1QVI Z;  2M1U A;  2KBM A;  2EC6 C;  1U5I A;  1QX5 B;  4TNC A;  1YUT A;  2BE4 A;  2P6B B;  4WRI A;  1JUO A;  2BBM A;  1IQ5 A;  4AQJ A;  4ETO A;  3FIA A;  2KI4 B;  3CR5 X;  3RLZ A;  2BEC A;  1B1G A;  1KQV A;  2COL B;  4MRX A;  1D1O A;  1CFF A;  2NLN A;  1N2D A;  3BXK A;  2WND A;  4P2Y B;  1DGV A;  1DVI A;  2LMV A; 
#chains in the Genus database with same CATH topology
 5HKY A;  2BAP A;  2LV7 A;  2WCE A;  1FI5 A;  4YGE B;  3KPX A;  3CZ1 A;  3PSR A;  1DF0 A;  1RTP 1;  1QLK A;  3NSL A;  2LP3 A;  1UP5 A;  4PT1 A;  2ZN8 A;  1QS7 A;  4A4C A;  3DF0 B;  1JSA A;  3CZ0 A;  3QRX A;  1AP4 A;  3BOW B;  2CBL A;  2KBI A;  5F6T A;  5FI6 A;  2LMU A;  1K8U A;  4U8D A;  4ZCU A;  2M29 A;  1W7J B;  2K60 A;  2KOT A;  4MSP A;  1NX0 A;  4BY4 A;  2IS9 A;  1NIW A;  3KHE A;  3FE9 A;  2L98 A;  1SL8 A;  3SS5 A;  1QX2 A;  1S6J A;  2LAP A;  2JT0 A;  3FE6 A;  3LK0 A;  1IKU A;  3RM1 A;  1ALW A;  1IWQ A;  1YVL A;  2MBX A;  1J55 A;  2P70 A;  2K7D A;  1T14 A;  4GPL B;  1B8L A;  3BQ3 A;  2QEV A;  2SCP A;  1K93 D;  2JPO A;  2LM5 A;  3CLN A;  3CZ2 A;  1SR6 C;  1SPY A;  1QJT A;  2LCP A;  1PSB A;  4OZD A;  5K89 A;  2H61 A;  2DOQ A;  3NXA A;  1G4Y R;  3ZWH A;  1MWN A;  3N7H A;  4OCI A;  2QEH A;  1KQM C;  2K0J A;  2KI6 D;  4JKT A;  1KCY A;  3DF0 A;  4ZCV A;  2L4I A;  3DY9 A;  1K9U A;  3PFV A;  2LUC A;  5G08 A;  1R6P A;  2ZN9 A;  4MEW A;  2KLD A;  1UUS A;  3BJH A;  4HRE E;  1H8B A;  2Y4Q A;  3PM8 A;  3KEV A;  2EHB A;  1P28 A;  1RFJ A;  5EL2 A;  1KK8 C;  3HCM A;  1GGW A;  1NCY A;  3I5I C;  3UO9 A;  5HKW A;  2JT8 A;  2MLE C;  2WC8 A;  3CR2 A;  3R1O A;  1DGU A;  2FCE A;  2M97 A;  4ICB A;  1RWY A;  4Q04 A;  3PM2 A;  4XYN A;  4OV2 A;  3LK1 A;  2NCP A;  1NX1 A;  4PE1 A;  4UPG A;  1AJ4 A;  2E6W A;  1DJX A;  2KQY A;  1DEK A;  2BL0 C;  2HF5 A;  3O78 A;  4GGF C;  2I18 A;  4GFT A;  1M31 A;  3BUX B;  3EVV A;  5ER5 A;  2F3Z A;  2F2P A;  1B7T Y;  3R1P A;  2BNX A;  1DMO A;  2L2C A;  1EG4 A;  4GAO A;  3CZT X;  1C7W A;  4I5K A;  1YX7 A;  4CFQ A;  4N5X A;  4M2P A;  1JF2 A;  3WHU B;  1AJ5 A;  1TIZ A;  4E68 A;  3SG2 A;  1J7R A;  1J7P A;  3WHT B;  4KYN A;  1A75 A;  2JC2 A;  1BOC A;  1NCX A;  1UHN A;  1OMV A;  3NGV A;  4YI8 A;  4NDD A;  1SMG A;  2KFH A;  1FW4 A;  1H4B A;  4YGD B;  2K61 A;  2K8M B;  3EVR A;  4CID A;  1NWD A;  3BUW B;  2WOS A;  3IQQ A;  4DUQ A;  1CDL A;  2KGR A;  2P71 A;  1DTL A;  2PSR A;  5D7F A;  3EKJ A;  3TS5 C;  1ZFS A;  1OZO A;  3L47 A;  1M46 A;  2KI4 C;  2BE6 A;  2WC5 A;  3DVK A;  1GQM A;  1Y1U A;  1F71 A;  5CSN A;  4IL1 A;  4YGB B;  1J1E A;  3E3R A;  3TZ1 A;  1XFX O;  4P5O E;  3IVT A;  4XJK B;  2KNE A;  4C0L A;  2PYQ A;  4GNK B;  5DKN A;  4JD9 A;  3LL8 B;  1FBV A;  2L51 A;  1S26 D;  2Y1M A;  2KDH A;  5JJG A;  1OZS A;  1EL4 A;  1XFU O;  1RJV A;  2PQL A;  1NSH A;  2BCB A;  1XFZ O;  4ORA B;  5I8N A;  1A03 A;  4DRW A;  4FTG A;  2JNF A;  1S5G Y;  1W9Z A;  1HQV A;  1TRF A;  5FYX A;  2V53 A;  1PAL A;  1LXF C;  1MF8 B;  1K90 D;  3KF9 A;  4MZK A;  1XA5 A;  3SG3 A;  1NPQ A;  4M2Q A;  3DVJ A;  3B87 A;  3TS5 B;  1CFC A;  3BFH A;  3HX4 A;  1QAT A;  1TWO A;  1CLL A;  4YBH B;  2KYF A;  5BPJ A;  1CLB A;  2L5X B;  3VRN A;  4USL A;  1SYM A;  4PHJ A;  2F2O A;  2LHI A;  5D69 A;  3JVT B;  4GGF A;  1F4O A;  2KQ6 A;  2WCM A;  4YGA A;  1DJI A;  3EVU A;  1DC1 A;  1Y0V H;  2JNX A;  2M9G A;  1N65 A;  2WCF A;  1OE9 B;  1CM4 A;  1DEL A;  1W7I B;  4CLN A;  1S1E A;  1SL9 A;  1XFY O;  5CPV A;  1QIW A;  5HKZ A;  2LVI A;  3TDU A;  3S0A A;  2D8N A;  2QEO A;  2Q4U A;  3BFA A;  1WRZ A;  1LVC D;  3DD4 A;  4GUK A;  2ZND A;  1MXL C;  1TCF A;  2RGI A;  4OVN F;  3O4X A;  1C3Y A;  2L0P A;  2PMY A;  4I5J A;  1FPW A;  3CGA A;  5HL1 A;  4GBA A;  1GJY A;  3S0E A;  2LC5 A;  5KTY A;  1TTX A;  2L50 A;  1B7T Z;  1HT9 A;  1M63 B;  2JXC A;  1K94 A;  2LHL A;  4M2O A;  2JUL A;  4CFR A;  2H2K A;  3GOF A;  2M8U A;  3SJS A;  3WXA A;  2F3Y A;  5KSZ A;  2NZ0 A;  5ER4 X;  1SSE B;  3CDN A;  3D73 A;  2MAZ A;  2KLE A;  3OHM B;  3V2L A;  1YRU B;  3Q8I A;  3B6X A;  1BR1 B;  3O6B A;  3BYA A;  2JOJ A;  1KFU L;  3A8R A;  4QJ4 B;  3D10 A;  5B8I B;  3S0F A;  1OOF A;  1JC2 A;  4DCK A;  2BKH B;  3D78 A;  3I5H C;  1YX8 A;  3BOW A;  4MZJ A;  4AQI A;  5I94 A;  2I2R E;  2BBN A;  2MLF C;  3L4L A;  1GGZ A;  2LUX A;  3K21 A;  2OPO A;  5I2L A;  2K7C A;  1SKT A;  2MJW B;  2QPT A;  1TNW A;  1ZAC A;  3S0B A;  3I5G B;  1YUU A;  1YUS A;  2AUC A;  1NUB A;  3VRQ A;  3JTD B;  2K7O A;  3D0Y B;  5DKQ A;  4N1G A;  2JZI A;  2KAX A;  4YRU A;  5GQQ C;  1ODB A;  1XYD A;  2HET A;  1J1D A;  1MHO A;  1TUJ A;  1UWO A;  1S5G Z;  4CPV A;  1OOI X;  2LVK A;  1QAS A;  2GV5 A;  1OSA A;  4PCW A;  1NYA A;  1BLQ A;  2G9B A;  2PAS A;  1WDC C;  1TCO B;  1KSO A;  3PAT A;  1F54 A;  5CSI A;  3EK4 A;  1XFR A;  2VRG A;  3I5H B;  4FQO A;  4C0K A;  1CMG A;  4PE0 A;  3FE8 A;  3R1V A;  3GK1 A;  2KI6 C;  2ERB A;  1K95 A;  1OMR A;  1UHJ A;  2Q91 A;  3AAJ A;  3DYE A;  2BCA A;  3NHT A;  1J7Q A;  4AOM A;  1BOD A;  3SS4 A;  5CSF A;  5KU1 A;  3OX5 A;  1L7Z A;  1YRT B;  1K9P A;  2LVJ A;  1LA3 A;  1OMD A;  1SW8 A;  2JQ6 A;  2LVV A;  1PRW A;  3BUO B;  3OGN A;  3VB1 A;  3OX6 A;  1LKJ A;  2LLU A;  5FI7 A;  3BUM B;  2AMI A;  3OBV A;  1F8H A;  4NDC A;  1TNX A;  2H8V A;  2JPT A;  1X02 A;  1WDC B;  4OR9 B;  5HLV A;  3CR4 X;  2B1U A;  1KFX S;  1YUR A;  2MHH A;  1CLM A;  3SIA A;  3PN7 B;  1F55 A;  1KWO B;  1EJ3 A;  3QME A;  1IIO A;  1SK6 D;  4NDB A;  4F7F A;  4I5L B;  1U5I B;  4HSZ A;  1SRA A;  1OOH A;  3FWB A;  2K2F A;  1ZUZ A;  2E30 A;  3JVT C;  4MRY A;  4WQ3 A;  3CS1 A;  5AXI A;  2WCJ A;  1JWD A;  2NXQ A;  3SG4 A;  5TNC A;  2ZFD A;  5IBW A;  1IH0 A;  2O60 A;  1QXP A;  2L4H A;  2BKI B;  1RRO A;  3BFB A;  3DVE A;  2PRU A;  1NP8 A;  3NSI A;  4PAL A;  5FI2 A;  1DJZ A;  4NQG A;  1OW4 A;  4L9M A;  1Y6W A;  4PHK A;  4YGC B;  1LA0 A;  1CTR A;  4WQ2 A;  3D77 A;  2F8P A;  3GK2 A;  3VRP A;  1F70 A;  3OB1 B;  2L2E A;  1XK4 C;  2QEB A;  3SG5 A;  2CXJ A;  1M39 A;  1WLM A;  2M49 B;  2MA2 A;  2KSP A;  3TDZ A;  2JU0 A;  1NCZ A;  2JRF A;  1DF0 B;  2WOR A;  3KO0 A;  3PJI A;  1UHI A;  1EH2 A;  2K2A A;  3AKA A;  4OKH A;  1BU3 A;  1QLS A;  1CFP A;  3EG5 B;  1B4C A;  1B9A A;  1DQE A;  1YVH A;  2FOT A;  2ZNE A;  3MSE B;  3IF7 A;  3OP0 A;  3SS3 A;  5AER A;  2LLT A;  3B7A A;  5JOL A;  3F45 A;  2KHN A;  1KSM A;  1L2O B;  4XJK A;  2GTE A;  3C1V A;  2OS8 B;  2KGB C;  3I5F B;  4MZL A;  2HQ8 A;  3EK7 A;  2WCB A;  1IQ3 A;  2KAV A;  2FJU B;  3SIB A;  2JXL A;  4IJ7 A;  4BY5 A;  4DIR A;  3M0W A;  3R72 A;  1SCM B;  4QJ3 B;  1WLZ A;  2SAS A;  1NX2 A;  3NSO A;  3AAK A;  2KYC A;  1LIN A;  4INX A;  5AFP A;  1CKK A;  2K7B A;  1QWV A;  2KFF A;  1B47 A;  3ICB A;  2KFG A;  1V1F A;  3CTN A;  1Z2C B;  4MN0 A;  2NCO A;  3VRR A;  1KK7 Y;  1IRJ A;  2LNK A;  3PLF B;  2Y1N A;  5I2Q A;  1S36 A;  5DKR A;  1A2X A;  3D75 A;  1PK0 D;  1BT6 A;  2KPH A;  3I5G C;  2EC6 B;  1AVS A;  1BR4 B;  2WCL A;  3JTD C;  1RK9 A;  1DJH A;  1TOP A;  2QAC A;  4DS7 A;  2R2I A;  3B86 A;  1E8A A;  4MBE A;  1MR8 A;  1B8R A;  1YTZ C;  1J7O A;  2MRD A;  1YR5 A;  3DXL A;  1KFX L;  3CYZ A;  2EGD A;  1CB1 A;  3OB2 B;  2M1K B;  1XFV O;  1QV0 A;  3D74 A;  3O2P A;  1MQ1 A;  1IGV A;  5PAL A;  1PUL A;  2HQW A;  3L4A A;  1XK4 A;  2M7N A;  1N0Y A;  1XO5 A;  2CNP A;  1BG1 A;  1C7V A;  1BMO A;  2CTN A;  1V1G A;  1DJG A;  1QVI Y;  4JWQ A;  4QJ5 B;  1MUX A;  2OTG C;  5HYD A;  1XFW O;  1S3P A;  2LAN A;  2G2B A;  4HRG A;  4PE4 A;  1VRK A;  1SBJ A;  2PAL A;  1G33 A;  1OOJ A;  1CNP A;  4R1E A;  2F33 A;  3RZS A;  2I7A A;  2GGM A;  4MLW A;  1K96 A;  1EG3 A;  1OOG A;  1IJ5 A;  4FQT A;  1UHK A;  1Y1A A;  2LE9 B;  2CCM A;  2QDI A;  2WC6 A;  1UUR A;  1ORG A;  2M0R A;  2JTZ A;  1G8I A;  1A75 B;  1WRK A;  1FI6 A;  3A4U B;  4I5N B;  5CSJ A;  5J3X A;  3PN7 C;  4PHN A;  1AHR A;  1BJF A;  1KWO C;  2A4J A;  1JF0 A;  3NSK A;  3VRO A;  1SY9 A;  1BF5 A;  5AEQ A;  1AK8 A;  1Q80 A;  1AUI B;  1QX7 A;  3LCP C;  2KAY A;  1DJY A;  3UNW A;  3FS7 A;  1PVA A;  1Z4H A;  2GGZ A;  2JTT A;  3H4S E;  1K9K A;  3IQO A;  1C07 A;  2OTG B;  1SR6 B;  2HPS A;  3VGO A;  1MXE A;  1TN4 A;  3PAL A;  2LP2 A;  1REC A;  1CFD A;  1M45 A;  1TNQ A;  2CT9 A;  1NX3 A;  1KQM B;  4N1F A;  1LS8 A;  2ZRS A;  2ZRT A;  1XVJ A;  1CDN A;  1ZOT B;  3EKH A;  1S6C A;  4JPZ B;  3TUY C;  5HLO A;  2O5G A;  1CMF A;  1JFK A;  2M7L A;  2ZKM X;  3D0Y A;  1CDM A;  3DZT A;  1WY9 A;  2FJY A;  1DJW A;  1TNP A;  4GGN A;  3GK4 X;  1B8C A;  4D1E A;  4F0Z B;  2M3W A;  2WCK A;  3CWG A;  1WRL A;  1GM0 A;  1KK8 B;  3D76 A;  4JQ0 D;  3ZNI A;  2L5Y A;  1Y1X A;  3I5I B;  1QTX A;  4ORC B;  4HRH A;  4MVF A;  3K1E A;  1OQP A;  1IJ6 A;  1ZMZ A;  2Y5I A;  1KK7 Z;  2LMT A;  2PVB A;  1S6I A;  3SG6 A;  3TDI A;  3EK8 A;  1JFJ A;  1SL7 A;  1L2O C;  2I94 A;  1DT7 B;  2OS8 C;  3DVM A;  3I5F C;  1QIV A;  3LLE A;  2BL0 B;  2WCH A;  1A29 A;  3S0D A;  5AAN A;  1R2U A;  1KFU S;  4ORB B;  4PE7 A;  1TUZ A;  1SCM C;  3CAB A;  3WNX B;  4INW A;  3TUY B;  1A4P A;  1EXR A;  3AKB A;  3SG7 A;  3FWC A;  2JT3 A;  3O4Y A;  1SCV A;  1ALV A;  1QV1 A;  4PHM A;  1FF1 A;  1SNL A;  1IG5 A;  2AAO A;  2H61 C;  1PSR A;  2FCD A;  2JWW A;  4PDZ A;  1CM1 A;  2ISD A;  1UHH A;  2TN4 A;  4C0J A;  4YI9 A;  5I2O A;  1JBA A;  3BUN B;  1C3Z A;  4A4B A;  1PVB A;  2BCX A;  1F4Q A;  2LLS A;  3S0G A;  1K2H A;  1CDP A;  5D3O A;  1QVI Z;  2M1U A;  3B88 A;  2KBM A;  2EC6 C;  1U5I A;  1QX5 B;  4TNC A;  1YUT A;  2BE4 A;  2P6B B;  2YGU A;  4WRI A;  1JUO A;  2BBM A;  1IQ5 A;  4AQJ A;  4ETO A;  3FIA A;  2KI4 B;  3CR5 X;  3RLZ A;  2BEC A;  1B1G A;  5DIC A;  1KQV A;  2COL B;  4MRX A;  1D1O A;  1CFF A;  2NLN A;  1N2D A;  3BXK A;  2WND A;  4P2Y B;  1DGV A;  1DVI A;  2LMV A;  3NHI A; 
#chains in the Genus database with same CATH homology
 5HKY A;  2LV7 A;  2WCE A;  1FI5 A;  4YGE B;  3KPX A;  3PSR A;  1DF0 A;  1RTP 1;  1QLK A;  3NSL A;  2LP3 A;  1UP5 A;  4A4C A;  2ZN8 A;  1QS7 A;  1JSA A;  3DF0 B;  3QRX A;  1AP4 A;  3BOW B;  2CBL A;  2KBI A;  5F6T A;  2LMU A;  1K8U A;  4U8D A;  4ZCU A;  2M29 A;  1W7J B;  2KOT A;  4MSP A;  1NX0 A;  4BY4 A;  2IS9 A;  1NIW A;  3KHE A;  2L98 A;  1SL8 A;  1QX2 A;  1S6J A;  2LAP A;  2JT0 A;  1IKU A;  3LK0 A;  3RM1 A;  1ALW A;  1IWQ A;  1YVL A;  2MBX A;  1J55 A;  2K7D A;  4GPL B;  1B8L A;  3BQ3 A;  2SCP A;  1K93 D;  2LM5 A;  3CLN A;  1SR6 C;  1SPY A;  1QJT A;  2LCP A;  1PSB A;  5K89 A;  2H61 A;  2DOQ A;  3NXA A;  1G4Y R;  3ZWH A;  1MWN A;  4OCI A;  1KQM C;  2K0J A;  2KI6 D;  1KCY A;  3DF0 A;  4ZCV A;  2L4I A;  3PFV A;  1K9U A;  2LUC A;  5G08 A;  1R6P A;  2ZN9 A;  4MEW A;  1UUS A;  4HRE E;  1H8B A;  2Y4Q A;  3PM8 A;  3KEV A;  2EHB A;  1RFJ A;  1KK8 C;  3HCM A;  1GGW A;  1NCY A;  3I5I C;  5HKW A;  2JT8 A;  2MLE C;  2WC8 A;  3CR2 A;  1DGU A;  2FCE A;  2M97 A;  4ICB A;  1RWY A;  4Q04 A;  4XYN A;  4OV2 A;  3LK1 A;  2NCP A;  1NX1 A;  4PE1 A;  4UPG A;  1AJ4 A;  2E6W A;  1DJX A;  2KQY A;  2BL0 C;  2HF5 A;  3O78 A;  4GGF C;  2I18 A;  4GFT A;  1M31 A;  3BUX B;  3EVV A;  5ER5 A;  2F3Z A;  2F2P A;  1B7T Y;  1DMO A;  1EG4 A;  4GAO A;  3CZT X;  1C7W A;  4I5K A;  1YX7 A;  4CFQ A;  4N5X A;  4M2P A;  1JF2 A;  3WHU B;  1AJ5 A;  1TIZ A;  4E68 A;  3SG2 A;  1J7R A;  1J7P A;  3WHT B;  1BOC A;  1A75 A;  2JC2 A;  1NCX A;  1UHN A;  1OMV A;  4YI8 A;  4NDD A;  1SMG A;  2KFH A;  1FW4 A;  1H4B A;  4YGD B;  2K61 A;  2K8M B;  3EVR A;  4CID A;  1NWD A;  3BUW B;  2WOS A;  3IQQ A;  4DUQ A;  1CDL A;  2KGR A;  1DTL A;  2PSR A;  5D7F A;  3EKJ A;  3TS5 C;  1ZFS A;  1OZO A;  1M46 A;  2KI4 C;  2BE6 A;  3DVK A;  1GQM A;  1Y1U A;  1F71 A;  5CSN A;  4IL1 A;  4YGB B;  1J1E A;  3E3R A;  3TZ1 A;  1XFX O;  4P5O E;  4XJK B;  2KNE A;  4C0L A;  4GNK B;  5DKN A;  3LL8 B;  1FBV A;  2L51 A;  1S26 D;  2Y1M A;  2KDH A;  5JJG A;  1OZS A;  1EL4 A;  1XFU O;  1RJV A;  1NSH A;  2BCB A;  1XFZ O;  4ORA B;  5I8N A;  1A03 A;  4DRW A;  4FTG A;  2JNF A;  1S5G Y;  1HQV A;  1TRF A;  5FYX A;  2V53 A;  1PAL A;  1LXF C;  1MF8 B;  1K90 D;  3KF9 A;  4MZK A;  1XA5 A;  3SG3 A;  1NPQ A;  4M2Q A;  3DVJ A;  3TS5 B;  1CFC A;  3HX4 A;  1QAT A;  1CLL A;  4YBH B;  2KYF A;  5BPJ A;  1CLB A;  2L5X B;  3VRN A;  4USL A;  1SYM A;  4PHJ A;  2F2O A;  2LHI A;  5D69 A;  3JVT B;  4GGF A;  1F4O A;  2KQ6 A;  4YGA A;  1DJI A;  3EVU A;  1Y0V H;  2JNX A;  2M9G A;  1N65 A;  2WCF A;  1OE9 B;  1CM4 A;  1W7I B;  4CLN A;  1S1E A;  1SL9 A;  1XFY O;  5CPV A;  1QIW A;  5HKZ A;  2LVI A;  3TDU A;  2D8N A;  2Q4U A;  1WRZ A;  1LVC D;  3DD4 A;  4GUK A;  2ZND A;  1MXL C;  1TCF A;  2RGI A;  4OVN F;  2L0P A;  2PMY A;  4I5J A;  1FPW A;  3CGA A;  4GBA A;  1GJY A;  2LC5 A;  5KTY A;  1TTX A;  2L50 A;  1B7T Z;  1HT9 A;  1M63 B;  2JXC A;  1K94 A;  2LHL A;  4M2O A;  2JUL A;  4CFR A;  2H2K A;  3GOF A;  2M8U A;  3SJS A;  3WXA A;  2F3Y A;  5KSZ A;  2NZ0 A;  5ER4 X;  2MAZ A;  3OHM B;  1YRU B;  1BR1 B;  3O6B A;  3BYA A;  2JOJ A;  1KFU L;  3A8R A;  4QJ4 B;  3D10 A;  5B8I B;  1JC2 A;  4DCK A;  2BKH B;  3I5H C;  1YX8 A;  3BOW A;  4MZJ A;  4AQI A;  2I2R E;  2BBN A;  2MLF C;  1GGZ A;  2LUX A;  3K21 A;  2OPO A;  5I2L A;  2K7C A;  1SKT A;  2MJW B;  2QPT A;  1TNW A;  1ZAC A;  3I5G B;  1YUU A;  1YUS A;  2AUC A;  1NUB A;  3VRQ A;  3JTD B;  2K7O A;  3D0Y B;  5DKQ A;  4N1G A;  2JZI A;  2KAX A;  4YRU A;  5GQQ C;  1ODB A;  1XYD A;  2HET A;  1J1D A;  1MHO A;  1UWO A;  1S5G Z;  4CPV A;  2LVK A;  1QAS A;  2GV5 A;  1OSA A;  4PCW A;  1NYA A;  1BLQ A;  2G9B A;  2PAS A;  1WDC C;  1TCO B;  1KSO A;  3PAT A;  1F54 A;  5CSI A;  3EK4 A;  2VRG A;  3I5H B;  4FQO A;  4C0K A;  1CMG A;  4PE0 A;  3GK1 A;  2KI6 C;  1K95 A;  1OMR A;  1UHJ A;  2Q91 A;  3AAJ A;  2BCA A;  1J7Q A;  4AOM A;  1BOD A;  5CSF A;  5KU1 A;  3OX5 A;  1L7Z A;  1YRT B;  1K9P A;  2LVJ A;  1LA3 A;  1OMD A;  1SW8 A;  2JQ6 A;  2LVV A;  1PRW A;  3BUO B;  3OX6 A;  1LKJ A;  2LLU A;  3BUM B;  2AMI A;  1F8H A;  4NDC A;  1TNX A;  2JPT A;  1X02 A;  1WDC B;  4OR9 B;  5HLV A;  3CR4 X;  2B1U A;  1KFX S;  1YUR A;  2MHH A;  1CLM A;  3SIA A;  3PN7 B;  1F55 A;  1KWO B;  1EJ3 A;  1SK6 D;  4NDB A;  4I5L B;  1U5I B;  4HSZ A;  1SRA A;  3FWB A;  2K2F A;  1ZUZ A;  2E30 A;  3JVT C;  4MRY A;  4WQ3 A;  3CS1 A;  5AXI A;  1JWD A;  2NXQ A;  3SG4 A;  5TNC A;  2ZFD A;  5IBW A;  1IH0 A;  2O60 A;  1QXP A;  2L4H A;  2BKI B;  1RRO A;  3DVE A;  4PAL A;  2PRU A;  1NP8 A;  3NSI A;  1DJZ A;  4NQG A;  4PHK A;  4L9M A;  1Y6W A;  4YGC B;  1LA0 A;  1CTR A;  4WQ2 A;  3VRP A;  2F8P A;  3GK2 A;  1F70 A;  3OB1 B;  2L2E A;  1XK4 C;  3SG5 A;  2CXJ A;  1M39 A;  1WLM A;  2M49 B;  2MA2 A;  2KSP A;  3TDZ A;  2JU0 A;  1NCZ A;  2JRF A;  1DF0 B;  2WOR A;  3KO0 A;  1UHI A;  1EH2 A;  2K2A A;  3AKA A;  4OKH A;  1BU3 A;  1QLS A;  1CFP A;  1B4C A;  1B9A A;  1YVH A;  2FOT A;  3OP0 A;  2ZNE A;  3MSE B;  3IF7 A;  5AER A;  2LLT A;  5JOL A;  3F45 A;  2KHN A;  1KSM A;  1L2O B;  4XJK A;  3C1V A;  2OS8 B;  2KGB C;  3I5F B;  4MZL A;  2HQ8 A;  3EK7 A;  2WCB A;  1IQ3 A;  2KAV A;  2FJU B;  3SIB A;  2JXL A;  4BY5 A;  4DIR A;  3M0W A;  1SCM B;  4QJ3 B;  1WLZ A;  2SAS A;  1NX2 A;  3NSO A;  3AAK A;  2KYC A;  1LIN A;  5AFP A;  1CKK A;  2K7B A;  2KFF A;  1B47 A;  3ICB A;  2KFG A;  1V1F A;  3CTN A;  4MN0 A;  2NCO A;  3VRR A;  1KK7 Y;  1IRJ A;  2LNK A;  3PLF B;  2Y1N A;  5I2Q A;  1S36 A;  5DKR A;  1A2X A;  1PK0 D;  1BT6 A;  3I5G C;  2EC6 B;  1AVS A;  1BR4 B;  3JTD C;  1RK9 A;  1DJH A;  1TOP A;  2QAC A;  4DS7 A;  2R2I A;  1E8A A;  4MBE A;  1MR8 A;  1B8R A;  1YTZ C;  1J7O A;  2MRD A;  1YR5 A;  1KFX L;  2EGD A;  1CB1 A;  3OB2 B;  2M1K B;  1XFV O;  1QV0 A;  3O2P A;  1MQ1 A;  1IGV A;  5PAL A;  1PUL A;  2HQW A;  1XK4 A;  2M7N A;  1N0Y A;  1XO5 A;  2CNP A;  1BG1 A;  1C7V A;  1BMO A;  2CTN A;  1V1G A;  1DJG A;  1QVI Y;  4JWQ A;  4QJ5 B;  1MUX A;  2OTG C;  5HYD A;  1XFW O;  1S3P A;  2LAN A;  2G2B A;  4HRG A;  4PE4 A;  1VRK A;  1SBJ A;  2PAL A;  1G33 A;  1OOJ A;  1CNP A;  4R1E A;  2F33 A;  2I7A A;  2GGM A;  4MLW A;  1K96 A;  1EG3 A;  1IJ5 A;  1UHK A;  1Y1A A;  2LE9 B;  2CCM A;  1UUR A;  2M0R A;  2JTZ A;  1G8I A;  1A75 B;  1WRK A;  1FI6 A;  3A4U B;  4I5N B;  5CSJ A;  5J3X A;  3PN7 C;  4PHN A;  1AHR A;  1BJF A;  1KWO C;  2A4J A;  1JF0 A;  3NSK A;  3VRO A;  1SY9 A;  1BF5 A;  5AEQ A;  1AK8 A;  1Q80 A;  1AUI B;  1QX7 A;  3LCP C;  2KAY A;  1DJY A;  3FS7 A;  1PVA A;  2GGZ A;  2JTT A;  3H4S E;  1K9K A;  3IQO A;  1C07 A;  2OTG B;  1SR6 B;  2HPS A;  3VGO A;  1MXE A;  1TN4 A;  3PAL A;  2LP2 A;  1REC A;  1CFD A;  1M45 A;  1TNQ A;  2CT9 A;  1NX3 A;  1KQM B;  4N1F A;  2ZRS A;  2ZRT A;  1XVJ A;  1CDN A;  1ZOT B;  3EKH A;  1S6C A;  4JPZ B;  3TUY C;  5HLO A;  2O5G A;  1CMF A;  1JFK A;  2M7L A;  2ZKM X;  3D0Y A;  1CDM A;  4GGN A;  1WY9 A;  4D1E A;  1DJW A;  1TNP A;  3GK4 X;  1B8C A;  4F0Z B;  2M3W A;  3CWG A;  1WRL A;  1KK8 B;  4JQ0 D;  3ZNI A;  3I5I B;  1Y1X A;  4ORC B;  1QTX A;  4HRH A;  4MVF A;  1OQP A;  1IJ6 A;  1ZMZ A;  2Y5I A;  1KK7 Z;  2LMT A;  2PVB A;  1S6I A;  3SG6 A;  3TDI A;  3EK8 A;  1JFJ A;  1SL7 A;  1L2O C;  2I94 A;  1DT7 B;  2OS8 C;  3DVM A;  3I5F C;  1QIV A;  3LLE A;  2BL0 B;  1A29 A;  5AAN A;  1R2U A;  1KFU S;  4ORB B;  4PE7 A;  1SCM C;  3WNX B;  3TUY B;  1A4P A;  1EXR A;  3AKB A;  3SG7 A;  3FWC A;  2JT3 A;  3O4Y A;  1SCV A;  1ALV A;  1QV1 A;  4PHM A;  1FF1 A;  1SNL A;  1IG5 A;  2AAO A;  2H61 C;  1PSR A;  2FCD A;  2JWW A;  4PDZ A;  1CM1 A;  2ISD A;  1UHH A;  2TN4 A;  4C0J A;  4YI9 A;  5I2O A;  1JBA A;  3BUN B;  4A4B A;  1PVB A;  2BCX A;  1F4Q A;  2LLS A;  1K2H A;  1CDP A;  1QVI Z;  2M1U A;  2KBM A;  2EC6 C;  1U5I A;  1QX5 B;  4TNC A;  1YUT A;  2BE4 A;  2P6B B;  4WRI A;  1JUO A;  2BBM A;  1IQ5 A;  4AQJ A;  4ETO A;  3FIA A;  2KI4 B;  3CR5 X;  3RLZ A;  2BEC A;  1B1G A;  1KQV A;  2COL B;  4MRX A;  1D1O A;  1CFF A;  2NLN A;  1N2D A;  3BXK A;  2WND A;  4P2Y B;  1DGV A;  1DVI A;  2LMV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...