2K7DA

Nmr structure of ca2+-bound cabp1 c-domain
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
72
structure length
72
Chain Sequence
ADMIGVKELRDAFREFDTNGDGEISTSELREAMRKLLGHQVGHRDIEEIIRDVDLNGDGRVDFEEFVRMMSR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Metal binding protein
molecule keywords Calcium-binding protein 1
publication title NMR Structure of Ca2+-bound CaBP1 C-domain
rcsb
source organism Homo sapiens
total genus 13
structure length 72
sequence length 72
ec nomenclature
pdb deposition date 2008-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2k7dA00
2CTNA 1CDMA 2JOJA 2Y1MA 1J7QA 5HKZA 1YUSA 1RTP1 3BUMB 1TNWA 3JVTB 3PFVA 3CZTX 1XFXO 2Q4UA 2H61C 4ORAB 3WXAA 2EHBA 3PM8A 3QRXA 3JVTC 1KK8C 1YX8A 1B4CA 2K2FA 1MWNA 1PVBA 1UWOA 1WLZA 1CDPA 3PALA 1LINA 2P6BB 3VROA 1QX2A 1ZFSA 1JFJA 1B9AA 1J7PA 4CIDA 2JXLA 1RFJA 2WCBA 5I2QA 1R6PA 1CLBA 2GGMA 3IQQA 2M7LA 1DGVA 1N2DA 4N1GA 2L50A 1B8CA 1TOPA 4MRXA 3TS5B 3DVEA 4GNKB 4NDCA 1DVIA 1W7JB 2WCEA 3ZNIA 1KSMA 3TS5C 1KSOA 1YRUB 1SR6B 1S6CA 1YR5A 3OX6A 2JTZA 3KHEA 1SR6C 1IWQA 1L7ZA 2LMUA 3JTDB 1YX7A 1FPWA 1NX3A 2LVIA 4PALA 4DCKA 3BYAA 1TCFA 5G08A 1U5IA 2D8NA 4NQGA 1IRJA 1KFXS 1IH0A 2Y1NA 3K21A 1CM1A 1OSAA 1IGVA 1QVIZ 2A4JA 1C07A 4D1EA 1AK8A 2KI6C 1F54A 2KFGA 3NXAA 2K2AA 4YGCB 4YRUA 4QJ3B 1S36A 2PSRA 1EG4A 1ALVA 4DS7A 4TNCA 2KAXA 2LC5A 4GPLB 3SG4A 1CMFA 2AUCA 2KSPA 2OTGC 4DIRA 2KOTA 1SCMC 1DJHA 2JXCA 2ISDA 1A03A 4ORCB 2DOQA 4WQ3A 1XO5A 1BF5A 1CMGA 1ZMZA 3D0YA 3BOWA 3IF7A 2M1KB 2I2RE 1L2OB 2KGRA 3EKJA 1MF8B 2I94A 1K8UA 1AJ5A 1B1GA 1JBAA 1KWOC 4PCWA 1PSRA 4FQOA 1CKKA 1Y1UA 2BCXA 2AMIA 2PMYA 4GGFC 2L51A 3AAKA 3HCMA 3O6BA 3CGAA 1DJGA 4WQ2A 1NUBA 1TNPA 2IS9A 1Q80A 2K8MB 1NX2A 2LE9B 1DJIA 2LHLA 2ZNEA 3IQOA 2JNXA 1JUOA 3PN7C 1SRAA 1ZUZA 2L4HA 2K61A 2LLTA 2H61A 1MUXA 1OMDA 1TTXA 2LMTA 4IL1A 1DT7B 1RK9A 1C7WA 2LNKA 3DVKA 1R2UA 2LUCA 3ICBA 5K89A 2NCPA 3I5IB 2F2OA 1WDCB 3E3RA 1NYAA 1IJ6A 1RJVA 1J1DA 2KAYA 4ETOA 1WY9A 4MEWA 3NSKA 1QVIY 2KGBC 3TDIA 4QJ4B 2K7BA 3I5IC 1KFUL 2K7DA 1U5IB 2LVJA 4QJ5B 1GGWA 2OPOA 2QPTA 3I5GB 4CFQA 5DKQA 1DJZA 1SYMA 3WHUB 1SW8A 1UHHA 1S6JA 1KK7Z 1KQVA 3I5GC 4JWQA 3BQ3A 3LCPC 1QTXA 2F3YA 2KI6D 3GK1A 1TIZA 3A4UB 2KBIA 2PRUA 3WHTB 3KEVA 4YGEB 3CS1A 1CDNA 3VGOA 4P2YB 3FIAA 1K95A 1YUTA 3FS7A 1QASA 1BLQA 2LP2A 1YTZC 2KQ6A 1RWYA 2JZIA 1ZOTB 2JTTA 3A8RA 2JRFA 1HT9A 2NZ0A 1EH2A 3M0WA 2BECA 1CTRA 3TDZA 1PRWA 4OKHA 1H8BA 1K9UA 1PSBA 2WNDA 2L98A 1S5GY 1BOCA 3SG3A 4I5KA 1SCVA 1YRTB 1OQPA 2I18A 2JC2A 2ZKMX 5AXIA 2LV7A 2HQWA 2M9GA 2KHNA 4MZJA 2L0PA 4XYNA 1TCOB 5CSIA 3O4YA 1H4BA 2CNPA 2ZFDA 1A75A 1K96A 2BBMA 1J7OA 1W7IB 3HX4A 2Y4QA 1F4OA 2OS8B 1NX1A 1K2HA 1CFDA 2FOTA 4N1FA 2BE4A 3CR5X 1NCZA 3VRNA 3D10A 2F33A 3I5HB 1Y1XA 4PE4A 3SG5A 4U8DA 2BE6A 1WRZA 1BMOA 2BL0B 3PATA 1A4PA 2V53A 1SY9A 4XJKB 5J3XA 4AOMA 3DVMA 4YGAA 1M39A 5IBWA 1FF1A 1NIWA 2KNEA 1QV0A 2JNFA 2WOSA 1S1EA 4CFRA 2L2EA 2L5XB 3JTDC 2F3ZA 2AAOA 2PASA 2CBLA 2BCAA 4I5LB 1G33A 1ALWA 4JQ0D 3F45A 1KFUS 2NCOA 1N65A 1SPYA 1SL8A 5TNCA 2KI4B 3AAJA 2LP3A 2QACA 1GGZA 1XFYO 1QX7A 3FWCA 1IQ5A 1MQ1A 1MXLC 1YVHA 1NPQA 4L9MA 1NCXA 2CCMA 1NX0A 3EVUA 1K94A 1SK6D 3SG6A 1F70A 1G4YR 1XK4C 1PK0D 1WRKA 2TN4A 2PALA 1F71A 4BY5A 2JPTA 1NP8A 4MSPA 4HSZA 1L2OC 5D69A 1FBVA 2KBMA 3VRPA 1RROA 1XYDA 1LVCD 1CFPA 2E30A 1VRKA 1BR1B 2FCEA 5BPJA 1A29A 2E6WA 1RECA 1UHNA 4C0LA 1OOJA 1F55A 2WC8A 3LLEA 1XVJA 1Y1AA 1XFUO 1QIWA 2M97A 4MZKA 2I7AA 2LLUA 2ZN9A 1CLMA 1ZACA 1Y6WA 1EG3A 1AJ4A 1IJ5A 1TNQA 1UP5A 4BY4A 2EGDA 3TZ1A 3TUYB 1QS7A 4UPGA 4HRHA 5B8IB 1FI5A 1DJXA 3EVRA 4GBAA 2CT9A 3SIBA 4PE7A 4MLWA 1V1GA 1XFZO 4N5XA 2H2KA 1J7RA 1DF0A 1AVSA 4GGNA 1B7TZ 2KQYA 1WDCC 3OX5A 5D7FA 2MA2A 1UUSA 1NWDA 4HREE 3SG7A 2WORA 1UHKA 2MHHA 3BUNB 3I5FB 1AHRA 1B8LA 2MBXA 2LVVA 2M8UA 1B8RA 2CXJA 4C0KA 1FW4A 1F4QA 2LUXA 2MLFC 5HKWA 4JPZB 2MLEC 3KF9A 1JWDA 3GK4X 3FWBA 4A4BA 2JQ6A 4MVFA 3WNXB 1MHOA 4PHKA 5HLVA 1LXFC 4USLA 2O60A 1J1EA 3D0YB 3PSRA 3GOFA 1OMVA 3BOWB 2L4IA 3ZWHA 1CFCA 2G2BA 2M49B 1IG5A 2HQ8A 4NDDA 2NLNA 1C7VA 2KFHA 1BODA 3EK8A 2Y5IA 2KFFA 3RM1A 1K9PA 1CB1A 2COLB 3EVVA 3C1VA 4AQIA 5F6TA 1QLSA 1WLMA 3TDUA 1M63B 1IKUA 1F8HA 4OV2A 3KPXA 4GUKA 1MR8A 1Y0VH 4MN0A 4YBHB 1XFWO 5DKNA 2EC6B 3NSLA 2ZN8A 3OP0A 1XK4A 2GV5A 2B1UA 3PLFB 1UHIA 4OVNF 1YUUA 1YVLA 2JT0A 5CSNA 4PE0A 3DD4A 4M2QA 2BBNA 1UURA 5HKYA 2OS8C 1KK8B 1CFFA 4HRGA 2JT8A 5DKRA 4OR9B 2PVBA 3NSIA 4I5NB 3I5HC 2F8PA 4GGFA 1B7TY 2BL0C 1DF0B 1CM4A 1M31A 1EXRA 3BXKA 3BUXB 2ZRTA 1OZOA 1SL7A 3VRRA 1KK7Y 2MJWB 1KQMB 2F2PA 5KU1A 1NSHA 1PALA 4AQJA 4M2OA 2NXQA 1QV1A 1KQMC 1ODBA 3DF0A 1AP4A 1YURA 1CLLA 4MRYA 1QIVA 3CLNA 1S6IA 3CR2A 5AFPA 2BCBA 2K7CA 1SL9A 3OB2B 5AANA 1QLKA 2M1UA 1EJ3A 3BUWB 3DVJA 2KI4C 1QJTA 3LL8B 1AUIB 4MZLA 5PALA 1MXEA 3VRQA 1BR4B 1GJYA 2RGIA 1G8IA 4PHJA 5KTYA 1SKTA 4P5OE 2LANA 4E68A 2M29A 1LA3A 1DJYA 1A2XA 5CPVA 1HQVA 1BT6A 2LVKA 4PHMA 2BKHB 1XFVO 1IQ3A 2K7OA 4NDBA 1KCYA 4A4CA 2OTGB 1UHJA 3CWGA 4GAOA 3SG2A 1SCMB 1XA5A 2ZRSA 4M2PA 2GGZA 2M0RA 1SBJA 1A75B 3LK1A 1DMOA 2SASA 1QATA 4DUQA 4PE1A 4CPVA 1X02A 2LM5A 3BUOB 2JULA 4CLNA 5AERA 1QXPA 1KWOB 1V1FA 5FYXA 3CR4X 1TN4A 2M3WA 4I5JA 5I8NA 1N0YA 2JU0A 2JT3A 1CDLA 3KO0A 1JF2A 2KYFA 3EKHA 4R1EA 4WRIA 4ICBA 5HLOA 3RLZA 5HYDA 2Q91A 4OCIA 3NSOA 1SMGA 3TUYC 2LLSA 1OE9B 1CNPA 2VRGA 4YGDB 2SCPA 2WCFA 1S5GZ 3LK0A 3OHMB 2BKIB 5I2LA 3SJSA 5GQQC 2LHIA 5CSFA 1BG1A 4PHNA 3PN7B 1BU3A 4ZCVA 1OMRA 3DF0B 1PULA 5JJGA 1D1OA 1B47A 2ZNDA 1JSAA 1K90D 1S3PA 1TRFA 5ER4X 4ORBB 1JF0A 1QX5B 3MSEB 4MBEA 3O78A 1PVAA 2HETA 3EK7A 2HPSA 4PDZA 3I5FC 5ER5A 5JOLA 1J55A 1GQMA 1JC2A 2FJUB 2M7NA 1WRLA 4YI8A 3O2PA 4XJKA 1KFXL 1SNLA 1NCYA 4YGBB 4ZCUA 3SIAA 2MAZA 4F0ZB 2LAPA 1DGUA 3OB1B 3AKAA 1M46A 3CTNA 3EK4A 2LMVA 1DJWA 1EL4A 5AEQA 1K9KA 1DTLA 2KAVA 4Q04A 1OZSA 2K0JA 4GFTA 3H4SE 1LA0A 2KYCA 2R2IA 1S26D 1BJFA 1E8AA 1LKJA 2MRDA 2JWWA 4YI9A 2O5GA 5I2OA 4DRWA 4FTGA 5CSJA 4C0JA 1M45A 1JFKA 5KSZA 1K93D 1TNXA 2HF5A 2KDHA 2G9BA 3AKBA 2FCDA 2LCPA 2EC6C 3GK2A 1FI6A
chains in the Genus database with same CATH superfamily
1GM0A 2CTNA 1CDMA 2JOJA 2Y1MA 1J7QA 5HKZA 1YUSA 1RTP1 3BUMB 1TNWA 3JVTB 3S0FA 1ORGA 3PFVA 3CZTX 1XFXO 2Q4UA 2H61C 4ORAB 3WXAA 2EHBA 3PM8A 3QRXA 3JVTC 3R1VA 1KK8C 1YX8A 1B4CA 2K2FA 1MWNA 1PVBA 1UWOA 1WLZA 1CDPA 3PALA 1LINA 2P6BB 3VROA 1DQEA 1QX2A 1ZFSA 1JFJA 1B9AA 2KLDA 1J7PA 4CIDA 2JXLA 2L5YA 1RFJA 2WCBA 3IVTA 5I2QA 1C3ZA 1R6PA 2GGMA 1CLBA 3IQQA 2M7LA 1DGVA 1N2DA 4N1GA 2L50A 1B8CA 1TOPA 1C3YA 4MRXA 3TS5B 3DVEA 4GNKB 2QEHA 4NDCA 4FQTA 1DVIA 1W7JB 2WCEA 3ZNIA 1KSMA 3TS5C 1KSOA 1YRUB 1SR6B 1S6CA 1YR5A 3OX6A 2JTZA 3KHEA 1SR6C 1IWQA 1L7ZA 2LMUA 3JTDB 1YX7A 3SS4A 1FPWA 1NX3A 2LVIA 4PALA 5FI2A 4DCKA 3BYAA 1TCFA 5G08A 1U5IA 2D8NA 4NQGA 1IRJA 1KFXS 1XFRA 2WCMA 1IH0A 2Y1NA 3K21A 1CM1A 1OSAA 1IGVA 1QVIZ 2A4JA 1C07A 4D1EA 1AK8A 2KI6C 1F54A 2KFGA 3NXAA 2K2AA 4YGCB 3CDNA 4YRUA 4QJ3B 1S36A 2PSRA 1EG4A 1ALVA 4DS7A 4TNCA 2KAXA 2LC5A 4GPLB 1OW4A 3SG4A 2AUCA 2KSPA 2OTGC 4DIRA 1DC1A 1CMFA 2KOTA 1SCMC 1DJHA 3VB1A 2JXCA 2ISDA 1A03A 4ORCB 2DOQA 4WQ3A 1XO5A 1BF5A 1CMGA 1ZMZA 2WC5A 3D0YA 3BOWA 3IF7A 2M1KB 2I2RE 3NHTA 1L2OB 2KGRA 3EKJA 1MF8B 2I94A 1K8UA 1AJ5A 1B1GA 1JBAA 1KWOC 4PCWA 2BNXA 3PM2A 1PSRA 4FQOA 1CKKA 1Y1UA 2BCXA 2AMIA 2PMYA 4GGFC 2L51A 3AAKA 3HCMA 3O6BA 3CGAA 1DJGA 4WQ2A 1NUBA 1TNPA 3D74A 2IS9A 1Q80A 1W9ZA 3FE6A 2K8MB 1NX2A 2LE9B 1DJIA 2LHLA 2ZNEA 2P70A 3IQOA 2JNXA 4INWA 1JUOA 3PN7C 1SRAA 1ZUZA 2L4HA 2K61A 2LLTA 2H61A 1MUXA 1OMDA 1TTXA 2LMTA 3R1PA 4IL1A 1DT7B 1RK9A 1C7WA 2LNKA 3DVKA 1R2UA 2LUCA 3ICBA 5JOLA 3L4AA 5K89A 2NCPA 3I5IB 2F2OA 1WDCB 3E3RA 1NYAA 1IJ6A 1RJVA 5I94A 1J1DA 2KAYA 4ETOA 1WY9A 4MEWA 3NSKA 1QVIY 2KGBC 3SS3A 3TDIA 4QJ4B 2K7BA 3I5IC 1KFUL 1OOGA 2K7DA 1U5IB 2LVJA 2WCKA 4QJ5B 1GGWA 2OPOA 2QPTA 3I5GB 4CFQA 5DKQA 1DJZA 1SYMA 3WHUB 5ER5A 1SW8A 1UHHA 1P28A 1KK7Z 1S6JA 1KQVA 3I5GC 4JWQA 3BQ3A 3LCPC 1QTXA 2F3YA 2KI6D 3GK1A 4INXA 1TIZA 3A4UB 2KBIA 2PRUA 3WHTB 3KEVA 4YGEB 3CS1A 1CDNA 3D77A 3VGOA 3FE8A 4P2YB 3FIAA 1K95A 1YUTA 3FS7A 1QASA 1BLQA 2LP2A 1YTZC 2KQ6A 1RWYA 2JZIA 1ZOTB 3DXLA 3O4XA 2JTTA 3B88A 3A8RA 2JRFA 1HT9A 2NZ0A 1EH2A 3M0WA 1IIOA 2BECA 1CTRA 3TDZA 1PRWA 4OKHA 1H8BA 1K9UA 1PSBA 2WNDA 2L98A 1S5GY 1BOCA 3SG3A 4I5KA 1SCVA 1YRTB 1OQPA 2I18A 2JC2A 2ZKMX 5AXIA 2LV7A 1Z2CB 2HQWA 2M9GA 2KHNA 4MZJA 2L0PA 4XYNA 1TCOB 2KPHA 3O4YA 5CSIA 2CNPA 1H4BA 2ZFDA 1A75A 1K96A 2BBMA 1J7OA 1W7IB 3HX4A 2Y4QA 4OZDA 1F4OA 2PQLA 2OS8B 1NX1A 1K2HA 1CFDA 2FOTA 4N1FA 2BE4A 3CR5X 1NCZA 3VRNA 3D10A 2F33A 3I5HB 1Y1XA 4PE4A 3SG5A 4U8DA 2BE6A 1WRZA 1BMOA 2BL0B 3PATA 1A4PA 3CABA 2V53A 1SY9A 4XJKB 5FI6A 5J3XA 4AOMA 3DYEA 3DVMA 4YGAA 1M39A 5IBWA 1FF1A 1NIWA 2KNEA 3NGVA 3S0BA 3NHIA 1QV0A 2JNFA 2WOSA 1S1EA 4CFRA 2L2EA 2L5XB 3JTDC 2GTEA 2F3ZA 2AAOA 2PASA 2CBLA 2BCAA 4I5LB 1G33A 1ALWA 4JQ0D 1OOFA 3F45A 1KFUS 2NCOA 1N65A 1SPYA 1SL8A 5TNCA 3BFAA 1QWVA 2KI4B 3AAJA 2BAPA 2LP3A 2QACA 3DY9A 3L4LA 1GGZA 1XFYO 1QX7A 3FWCA 1IQ5A 1MQ1A 1MXLC 1YVHA 1NPQA 2FJYA 4L9MA 1NCXA 2CCMA 1NX0A 3EVUA 1K94A 1SK6D 3SG6A 3OBVA 1F70A 1G4YR 1XK4C 1PK0D 1WRKA 2TN4A 3B86A 3BFHA 2PALA 4IJ7A 4BY5A 2QEBA 1F71A 3B6XA 2JPTA 1NP8A 4MSPA 4HSZA 1L2OC 5D69A 1FBVA 2KBMA 3VRPA 1RROA 1XYDA 1LVCD 1T14A 1CFPA 2E30A 1VRKA 3UO9A 3R1OA 1BR1B 2FCEA 5BPJA 1A29A 2E6WA 1RECA 1UHNA 4C0LA 1OOJA 4KYNA 1F55A 2WC8A 3LLEA 1XVJA 1Y1AA 1XFUO 1QIWA 2M97A 4MZKA 2I7AA 2KLEA 2LLUA 1CLMA 2ZN9A 3CZ2A 1ZACA 1Y6WA 1EG3A 1AJ4A 1IJ5A 1TNQA 1UP5A 3L47A 4BY4A 2EGDA 3TZ1A 3TUYB 1QS7A 4UPGA 4HRHA 5B8IB 1FI5A 1DJXA 3EVRA 4GBAA 3SS5A 2CT9A 3SIBA 4PE7A 4F7FA 4MLWA 1V1GA 3D75A 1XFZO 4N5XA 2H2KA 1J7RA 1DF0A 1AVSA 4GGNA 1B7TZ 2KQYA 1WDCC 3Q8IA 3OX5A 4JD9A 5D7FA 2MA2A 1TWOA 1UUSA 1NWDA 4HREE 3SG7A 2WORA 1UHKA 2MHHA 3BUNB 3I5FB 1AHRA 1B8LA 2MBXA 2LVVA 2M8UA 1B8RA 2CXJA 4C0KA 1FW4A 1F4QA 2LUXA 2MLFC 5HKWA 4JPZB 2MLEC 3KF9A 1JWDA 3GK4X 3FWBA 4A4BA 2JQ6A 4MVFA 3WNXB 1MHOA 4PHKA 5HLVA 1LXFC 4USLA 2O60A 1J1EA 3D0YB 3PSRA 3GOFA 1DEKA 1OMVA 2L4IA 3BOWB 3ZWHA 1CFCA 2G2BA 2M49B 1IG5A 3S0DA 3V2LA 2QEOA 2HQ8A 3B87A 3K1EA 2P71A 4NDDA 2NLNA 1C7VA 2KFHA 1BODA 3EK8A 2Y5IA 2KFFA 3CZ1A 3RM1A 1K9PA 1CB1A 3S0AA 2COLB 3EVVA 3C1VA 4AQIA 5F6TA 1QLSA 1WLMA 3TDUA 1M63B 5HL1A 1IKUA 1F8HA 4OV2A 3KPXA 4GUKA 1MR8A 1Y0VH 2WC6A 4MN0A 4YBHB 1XFWO 5DKNA 2EC6B 3NSLA 2ZN8A 3OP0A 1OOIX 1XK4A 2GV5A 1TUZA 2B1UA 1UHIA 3PLFB 1YUUA 1YVLA 2JT0A 4OVNF 5CSNA 4PE0A 3S0EA 3DD4A 4M2QA 2BBNA 1UURA 3OGNA 2OS8C 3UNWA 5HKYA 4JKTA 1KK8B 1Z4HA 1CFFA 4HRGA 2JT8A 5DKRA 4OR9B 2PVBA 3NSIA 5D3OA 2H8VA 4I5NB 3I5HC 2F8PA 3R72A 4GGFA 1B7TY 2BL0C 1DF0B 1CM4A 1M31A 3DZTA 1EXRA 2WCJA 3BXKA 3BUXB 2ZRTA 1OZOA 1SL7A 3VRRA 1KK7Y 2MJWB 1KQMB 2F2PA 5KU1A 1NSHA 1PALA 2QEVA 3PJIA 3B7AA 4AQJA 4M2OA 2NXQA 1QV1A 1KQMC 1ODBA 3DF0A 1AP4A 1YURA 3S0GA 1CLLA 4MRYA 2ERBA 1OOHA 1QIVA 3CLNA 1S6IA 3CR2A 5AFPA 2BCBA 2WCLA 2K7CA 1SL9A 3RZSA 3OB2B 5AANA 1QLKA 2M1UA 1EJ3A 3BUWB 3D76A 3DVJA 2KI4C 1QJTA 3LL8B 1AUIB 4MZLA 5PALA 1MXEA 3VRQA 1BR4B 3CZ0A 1GJYA 2RGIA 1G8IA 4PHJA 5KTYA 2YGUA 1SKTA 4P5OE 2LANA 4E68A 2M29A 1LA3A 1DJYA 1A2XA 5CPVA 1HQVA 1BT6A 2PYQA 2WCHA 2LVKA 4PHMA 2BKHB 1XFVO 1IQ3A 5EL2A 2K7OA 4NDBA 1KCYA 4A4CA 1SSEB 2OTGB 1UHJA 3CWGA 3QMEA 4GAOA 3SG2A 1SCMB 1XA5A 2ZRSA 4M2PA 2GGZA 2M0RA 1SBJA 1A75B 3LK1A 1LS8A 2SASA 1DMOA 1QATA 2L2CA 4DUQA 4PE1A 4CPVA 1X02A 2LM5A 5DICA 3BUOB 2JULA 4CLNA 5AERA 1QXPA 1KWOB 1V1FA 5FYXA 2QDIA 3CR4X 1TN4A 2M3WA 4I5JA 5I8NA 1N0YA 2JU0A 2JT3A 1CDLA 3KO0A 1JF2A 2KYFA 3EKHA 4R1EA 4WRIA 4ICBA 5HLOA 4PT1A 3RLZA 5HYDA 2Q91A 4OCIA 3NSOA 1SMGA 3TUYC 2LLSA 1OE9B 1CNPA 2K60A 2VRGA 2SCPA 2WCFA 4YGDB 1S5GZ 3CYZA 3D73A 3LK0A 3OHMB 2BKIB 5I2LA 3SJSA 5GQQC 2LHIA 5CSFA 1BG1A 4PHNA 3PN7B 1BU3A 4ZCVA 1OMRA 3DF0B 1PULA 5JJGA 1D1OA 1B47A 2ZNDA 1JSAA 1K90D 1S3PA 1TRFA 5ER4X 5FI7A 4ORBB 1JF0A 1QX5B 3MSEB 3BJHA 1TUJA 1PVAA 2HETA 3EK7A 2HPSA 3N7HA 3I5FC 3O78A 4MBEA 4PDZA 1J55A 1GQMA 1JC2A 2FJUB 2M7NA 1WRLA 3EG5B 4YI8A 3O2PA 4XJKA 1KFXL 1SNLA 1NCYA 4YGBB 3FE9A 4ZCUA 3SIAA 2MAZA 4F0ZB 2LAPA 1DGUA 3OB1B 3AKAA 1M46A 3CTNA 3EK4A 2LMVA 1DJWA 1EL4A 5AEQA 3D78A 1K9KA 1DTLA 2KAVA 4Q04A 1OZSA 2K0JA 4GFTA 3H4SE 1LA0A 2KYCA 2R2IA 3BFBA 1S26D 1BJFA 1E8AA 1LKJA 2JPOA 2JWWA 2MRDA 4YI9A 2O5GA 5I2OA 4DRWA 4FTGA 5CSJA 4C0JA 1DELA 1M45A 1JFKA 5KSZA 1K93D 1TNXA 2HF5A 2KDHA 2G9BA 3AKBA 2FCDA 2LCPA 2EC6C 3GK2A 1FI6A
chains in the Genus database with same CATH topology
2CTNA 1CDMA 2JOJA 2Y1MA 1J7QA 5HKZA 1YUSA 1RTP1 3BUMB 1TNWA 3JVTB 3PFVA 3CZTX 1XFXO 2Q4UA 2H61C 4ORAB 3WXAA 2EHBA 3PM8A 3QRXA 3JVTC 1KK8C 1YX8A 1B4CA 2K2FA 1MWNA 1PVBA 1UWOA 1WLZA 1CDPA 3PALA 1LINA 2P6BB 3VROA 1QX2A 1ZFSA 1JFJA 1B9AA 1J7PA 4CIDA 2JXLA 1RFJA 2WCBA 5I2QA 1R6PA 1CLBA 2GGMA 3IQQA 2M7LA 1DGVA 1N2DA 4N1GA 2L50A 1B8CA 1TOPA 4MRXA 3TS5B 3DVEA 4GNKB 4NDCA 1DVIA 1W7JB 2WCEA 3ZNIA 1KSMA 3TS5C 1KSOA 1YRUB 1SR6B 1S6CA 1YR5A 3OX6A 2JTZA 3KHEA 1SR6C 1IWQA 1L7ZA 2LMUA 3JTDB 1YX7A 1FPWA 1NX3A 2LVIA 4PALA 4DCKA 3BYAA 1TCFA 5G08A 1U5IA 2D8NA 4NQGA 1IRJA 1KFXS 1IH0A 2Y1NA 3K21A 1CM1A 1OSAA 1IGVA 1QVIZ 2A4JA 1C07A 4D1EA 1AK8A 2KI6C 1F54A 2KFGA 3NXAA 2K2AA 4YGCB 4YRUA 4QJ3B 1S36A 2PSRA 1EG4A 1ALVA 4DS7A 4TNCA 2KAXA 2LC5A 4GPLB 3SG4A 1CMFA 2AUCA 2KSPA 2OTGC 4DIRA 2KOTA 1SCMC 1DJHA 2JXCA 2ISDA 1A03A 4ORCB 2DOQA 4WQ3A 1XO5A 1BF5A 1CMGA 1ZMZA 3D0YA 3BOWA 3IF7A 2M1KB 2I2RE 1L2OB 2KGRA 3EKJA 1MF8B 2I94A 1K8UA 1AJ5A 1B1GA 1JBAA 1KWOC 4PCWA 1PSRA 4FQOA 1CKKA 1Y1UA 2BCXA 2AMIA 2PMYA 4GGFC 2L51A 3AAKA 3HCMA 3O6BA 3CGAA 1DJGA 4WQ2A 1NUBA 1TNPA 2IS9A 1Q80A 2K8MB 1NX2A 2LE9B 1DJIA 2LHLA 2ZNEA 3IQOA 2JNXA 1JUOA 3PN7C 1SRAA 1ZUZA 2L4HA 2K61A 2LLTA 2H61A 1MUXA 1OMDA 1TTXA 2LMTA 4IL1A 1DT7B 1RK9A 1C7WA 2LNKA 3DVKA 1R2UA 2LUCA 3ICBA 5K89A 2NCPA 3I5IB 2F2OA 1WDCB 3E3RA 1NYAA 1IJ6A 1RJVA 1J1DA 2KAYA 4ETOA 1WY9A 4MEWA 3NSKA 1QVIY 2KGBC 3TDIA 4QJ4B 2K7BA 3I5IC 1KFUL 2K7DA 1U5IB 2LVJA 4QJ5B 1GGWA 2OPOA 2QPTA 3I5GB 4CFQA 5DKQA 1DJZA 1SYMA 3WHUB 1SW8A 1UHHA 1S6JA 1KK7Z 1KQVA 3I5GC 4JWQA 3BQ3A 3LCPC 1QTXA 2F3YA 2KI6D 3GK1A 1TIZA 3A4UB 2KBIA 2PRUA 3WHTB 3KEVA 4YGEB 3CS1A 1CDNA 3VGOA 4P2YB 3FIAA 1K95A 1YUTA 3FS7A 1QASA 1BLQA 2LP2A 1YTZC 2KQ6A 1RWYA 2JZIA 1ZOTB 2JTTA 3A8RA 2JRFA 1HT9A 2NZ0A 1EH2A 3M0WA 2BECA 1CTRA 3TDZA 1PRWA 4OKHA 1H8BA 1K9UA 1PSBA 2WNDA 2L98A 1S5GY 1BOCA 3SG3A 4I5KA 1SCVA 1YRTB 1OQPA 2I18A 2JC2A 2ZKMX 5AXIA 2LV7A 2HQWA 2M9GA 2KHNA 4MZJA 2L0PA 4XYNA 1TCOB 5CSIA 3O4YA 1H4BA 2CNPA 2ZFDA 1A75A 1K96A 2BBMA 1J7OA 1W7IB 3HX4A 2Y4QA 1F4OA 2OS8B 1NX1A 1K2HA 1CFDA 2FOTA 4N1FA 2BE4A 3CR5X 1NCZA 3VRNA 3D10A 2F33A 3I5HB 1Y1XA 4PE4A 3SG5A 4U8DA 2BE6A 1WRZA 1BMOA 2BL0B 3PATA 1A4PA 2V53A 1SY9A 4XJKB 5J3XA 4AOMA 3DVMA 4YGAA 1M39A 5IBWA 1FF1A 1NIWA 2KNEA 1QV0A 2JNFA 2WOSA 1S1EA 4CFRA 2L2EA 2L5XB 3JTDC 2F3ZA 2AAOA 2PASA 2CBLA 2BCAA 4I5LB 1G33A 1ALWA 4JQ0D 3F45A 1KFUS 2NCOA 1N65A 1SPYA 1SL8A 5TNCA 2KI4B 3AAJA 2LP3A 2QACA 1GGZA 1XFYO 1QX7A 3FWCA 1IQ5A 1MQ1A 1MXLC 1YVHA 1NPQA 4L9MA 1NCXA 2CCMA 1NX0A 3EVUA 1K94A 1SK6D 3SG6A 1F70A 1G4YR 1XK4C 1PK0D 1WRKA 2TN4A 2PALA 1F71A 4BY5A 2JPTA 1NP8A 4MSPA 4HSZA 1L2OC 5D69A 1FBVA 2KBMA 3VRPA 1RROA 1XYDA 1LVCD 1CFPA 2E30A 1VRKA 1BR1B 2FCEA 5BPJA 1A29A 2E6WA 1RECA 1UHNA 4C0LA 1OOJA 1F55A 2WC8A 3LLEA 1XVJA 1Y1AA 1XFUO 1QIWA 2M97A 4MZKA 2I7AA 2LLUA 2ZN9A 1CLMA 1ZACA 1Y6WA 1EG3A 1AJ4A 1IJ5A 1TNQA 1UP5A 4BY4A 2EGDA 3TZ1A 3TUYB 1QS7A 4UPGA 4HRHA 5B8IB 1FI5A 1DJXA 3EVRA 4GBAA 2CT9A 3SIBA 4PE7A 4MLWA 1V1GA 1XFZO 4N5XA 2H2KA 1J7RA 1DF0A 1AVSA 4GGNA 1B7TZ 2KQYA 1WDCC 3OX5A 5D7FA 2MA2A 1UUSA 1NWDA 4HREE 3SG7A 2WORA 1UHKA 2MHHA 3BUNB 3I5FB 1AHRA 1B8LA 2MBXA 2LVVA 2M8UA 1B8RA 2CXJA 4C0KA 1FW4A 1F4QA 2LUXA 2MLFC 5HKWA 4JPZB 2MLEC 3KF9A 1JWDA 3GK4X 3FWBA 4A4BA 2JQ6A 4MVFA 3WNXB 1MHOA 4PHKA 5HLVA 1LXFC 4USLA 2O60A 1J1EA 3D0YB 3PSRA 3GOFA 1OMVA 3BOWB 2L4IA 3ZWHA 1CFCA 2G2BA 2M49B 1IG5A 2HQ8A 4NDDA 2NLNA 1C7VA 2KFHA 1BODA 3EK8A 2Y5IA 2KFFA 3RM1A 1K9PA 1CB1A 2COLB 3EVVA 3C1VA 4AQIA 5F6TA 1QLSA 1WLMA 3TDUA 1M63B 1IKUA 1F8HA 4OV2A 3KPXA 4GUKA 1MR8A 1Y0VH 4MN0A 4YBHB 1XFWO 5DKNA 2EC6B 3NSLA 2ZN8A 3OP0A 1XK4A 2GV5A 2B1UA 3PLFB 1UHIA 4OVNF 1YUUA 1YVLA 2JT0A 5CSNA 4PE0A 3DD4A 4M2QA 2BBNA 1UURA 5HKYA 2OS8C 1KK8B 1CFFA 4HRGA 2JT8A 5DKRA 4OR9B 2PVBA 3NSIA 4I5NB 3I5HC 2F8PA 4GGFA 1B7TY 2BL0C 1DF0B 1CM4A 1M31A 1EXRA 3BXKA 3BUXB 2ZRTA 1OZOA 1SL7A 3VRRA 1KK7Y 2MJWB 1KQMB 2F2PA 5KU1A 1NSHA 1PALA 4AQJA 4M2OA 2NXQA 1QV1A 1KQMC 1ODBA 3DF0A 1AP4A 1YURA 1CLLA 4MRYA 1QIVA 3CLNA 1S6IA 3CR2A 5AFPA 2BCBA 2K7CA 1SL9A 3OB2B 5AANA 1QLKA 2M1UA 1EJ3A 3BUWB 3DVJA 2KI4C 1QJTA 3LL8B 1AUIB 4MZLA 5PALA 1MXEA 3VRQA 1BR4B 1GJYA 2RGIA 1G8IA 4PHJA 5KTYA 1SKTA 4P5OE 2LANA 4E68A 2M29A 1LA3A 1DJYA 1A2XA 5CPVA 1HQVA 1BT6A 2LVKA 4PHMA 2BKHB 1XFVO 1IQ3A 2K7OA 4NDBA 1KCYA 4A4CA 2OTGB 1UHJA 3CWGA 4GAOA 3SG2A 1SCMB 1XA5A 2ZRSA 4M2PA 2GGZA 2M0RA 1SBJA 1A75B 3LK1A 1DMOA 2SASA 1QATA 4DUQA 4PE1A 4CPVA 1X02A 2LM5A 3BUOB 2JULA 4CLNA 5AERA 1QXPA 1KWOB 1V1FA 5FYXA 3CR4X 1TN4A 2M3WA 4I5JA 5I8NA 1N0YA 2JU0A 2JT3A 1CDLA 3KO0A 1JF2A 2KYFA 3EKHA 4R1EA 4WRIA 4ICBA 5HLOA 3RLZA 5HYDA 2Q91A 4OCIA 3NSOA 1SMGA 3TUYC 2LLSA 1OE9B 1CNPA 2VRGA 4YGDB 2SCPA 2WCFA 1S5GZ 3LK0A 3OHMB 2BKIB 5I2LA 3SJSA 5GQQC 2LHIA 5CSFA 1BG1A 4PHNA 3PN7B 1BU3A 4ZCVA 1OMRA 3DF0B 1PULA 5JJGA 1D1OA 1B47A 2ZNDA 1JSAA 1K90D 1S3PA 1TRFA 5ER4X 4ORBB 1JF0A 1QX5B 3MSEB 4MBEA 3O78A 1PVAA 2HETA 3EK7A 2HPSA 4PDZA 3I5FC 5ER5A 5JOLA 1J55A 1GQMA 1JC2A 2FJUB 2M7NA 1WRLA 4YI8A 3O2PA 4XJKA 1KFXL 1SNLA 1NCYA 4YGBB 4ZCUA 3SIAA 2MAZA 4F0ZB 2LAPA 1DGUA 3OB1B 3AKAA 1M46A 3CTNA 3EK4A 2LMVA 1DJWA 1EL4A 5AEQA 1K9KA 1DTLA 2KAVA 4Q04A 1OZSA 2K0JA 4GFTA 3H4SE 1LA0A 2KYCA 2R2IA 1S26D 1BJFA 1E8AA 1LKJA 2MRDA 2JWWA 4YI9A 2O5GA 5I2OA 4DRWA 4FTGA 5CSJA 4C0JA 1M45A 1JFKA 5KSZA 1K93D 1TNXA 2HF5A 2KDHA 2G9BA 3AKBA 2FCDA 2LCPA 2EC6C 3GK2A 1FI6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CTN A;  1CDM A;  2JOJ A;  2Y1M A;  1J7Q A;  5HKZ A;  1YUS A;  1RTP 1;  3BUM B;  1TNW A;  3JVT B;  3PFV A;  3CZT X;  1XFX O;  2Q4U A;  2H61 C;  4ORA B;  3WXA A;  2EHB A;  3PM8 A;  3QRX A;  3JVT C;  1KK8 C;  1YX8 A;  1B4C A;  2K2F A;  1MWN A;  1PVB A;  1UWO A;  1WLZ A;  1CDP A;  3PAL A;  1LIN A;  2P6B B;  3VRO A;  1QX2 A;  1ZFS A;  1JFJ A;  1B9A A;  1J7P A;  4CID A;  2JXL A;  1RFJ A;  2WCB A;  5I2Q A;  1R6P A;  1CLB A;  2GGM A;  3IQQ A;  2M7L A;  1DGV A;  1N2D A;  4N1G A;  2L50 A;  1B8C A;  1TOP A;  4MRX A;  3TS5 B;  3DVE A;  4GNK B;  4NDC A;  1DVI A;  1W7J B;  2WCE A;  3ZNI A;  1KSM A;  3TS5 C;  1KSO A;  1YRU B;  1SR6 B;  1S6C A;  1YR5 A;  3OX6 A;  2JTZ A;  3KHE A;  1SR6 C;  1IWQ A;  1L7Z A;  2LMU A;  3JTD B;  1YX7 A;  1FPW A;  1NX3 A;  2LVI A;  4PAL A;  4DCK A;  3BYA A;  1TCF A;  5G08 A;  1U5I A;  2D8N A;  4NQG A;  1IRJ A;  1KFX S;  1IH0 A;  2Y1N A;  3K21 A;  1CM1 A;  1OSA A;  1IGV A;  1QVI Z;  2A4J A;  1C07 A;  4D1E A;  1AK8 A;  2KI6 C;  1F54 A;  2KFG A;  3NXA A;  2K2A A;  4YGC B;  4YRU A;  4QJ3 B;  1S36 A;  2PSR A;  1EG4 A;  1ALV A;  4DS7 A;  4TNC A;  2KAX A;  2LC5 A;  4GPL B;  3SG4 A;  1CMF A;  2AUC A;  2KSP A;  2OTG C;  4DIR A;  2KOT A;  1SCM C;  1DJH A;  2JXC A;  2ISD A;  1A03 A;  4ORC B;  2DOQ A;  4WQ3 A;  1XO5 A;  1BF5 A;  1CMG A;  1ZMZ A;  3D0Y A;  3BOW A;  3IF7 A;  2M1K B;  2I2R E;  1L2O B;  2KGR A;  3EKJ A;  1MF8 B;  2I94 A;  1K8U A;  1AJ5 A;  1B1G A;  1JBA A;  1KWO C;  4PCW A;  1PSR A;  4FQO A;  1CKK A;  1Y1U A;  2BCX A;  2AMI A;  2PMY A;  4GGF C;  2L51 A;  3AAK A;  3HCM A;  3O6B A;  3CGA A;  1DJG A;  4WQ2 A;  1NUB A;  1TNP A;  2IS9 A;  1Q80 A;  2K8M B;  1NX2 A;  2LE9 B;  1DJI A;  2LHL A;  2ZNE A;  3IQO A;  2JNX A;  1JUO A;  3PN7 C;  1SRA A;  1ZUZ A;  2L4H A;  2K61 A;  2LLT A;  2H61 A;  1MUX A;  1OMD A;  1TTX A;  2LMT A;  4IL1 A;  1DT7 B;  1RK9 A;  1C7W A;  2LNK A;  3DVK A;  1R2U A;  2LUC A;  3ICB A;  5K89 A;  2NCP A;  3I5I B;  2F2O A;  1WDC B;  3E3R A;  1NYA A;  1IJ6 A;  1RJV A;  1J1D A;  2KAY A;  4ETO A;  1WY9 A;  4MEW A;  3NSK A;  1QVI Y;  2KGB C;  3TDI A;  4QJ4 B;  2K7B A;  3I5I C;  1KFU L;  2K7D A;  1U5I B;  2LVJ A;  4QJ5 B;  1GGW A;  2OPO A;  2QPT A;  3I5G B;  4CFQ A;  5DKQ A;  1DJZ A;  1SYM A;  3WHU B;  1SW8 A;  1UHH A;  1S6J A;  1KK7 Z;  1KQV A;  3I5G C;  4JWQ A;  3BQ3 A;  3LCP C;  1QTX A;  2F3Y A;  2KI6 D;  3GK1 A;  1TIZ A;  3A4U B;  2KBI A;  2PRU A;  3WHT B;  3KEV A;  4YGE B;  3CS1 A;  1CDN A;  3VGO A;  4P2Y B;  3FIA A;  1K95 A;  1YUT A;  3FS7 A;  1QAS A;  1BLQ A;  2LP2 A;  1YTZ C;  2KQ6 A;  1RWY A;  2JZI A;  1ZOT B;  2JTT A;  3A8R A;  2JRF A;  1HT9 A;  2NZ0 A;  1EH2 A;  3M0W A;  2BEC A;  1CTR A;  3TDZ A;  1PRW A;  4OKH A;  1H8B A;  1K9U A;  1PSB A;  2WND A;  2L98 A;  1S5G Y;  1BOC A;  3SG3 A;  4I5K A;  1SCV A;  1YRT B;  1OQP A;  2I18 A;  2JC2 A;  2ZKM X;  5AXI A;  2LV7 A;  2HQW A;  2M9G A;  2KHN A;  4MZJ A;  2L0P A;  4XYN A;  1TCO B;  5CSI A;  3O4Y A;  1H4B A;  2CNP A;  2ZFD A;  1A75 A;  1K96 A;  2BBM A;  1J7O A;  1W7I B;  3HX4 A;  2Y4Q A;  1F4O A;  2OS8 B;  1NX1 A;  1K2H A;  1CFD A;  2FOT A;  4N1F A;  2BE4 A;  3CR5 X;  1NCZ A;  3VRN A;  3D10 A;  2F33 A;  3I5H B;  1Y1X A;  4PE4 A;  3SG5 A;  4U8D A;  2BE6 A;  1WRZ A;  1BMO A;  2BL0 B;  3PAT A;  1A4P A;  2V53 A;  1SY9 A;  4XJK B;  5J3X A;  4AOM A;  3DVM A;  4YGA A;  1M39 A;  5IBW A;  1FF1 A;  1NIW A;  2KNE A;  1QV0 A;  2JNF A;  2WOS A;  1S1E A;  4CFR A;  2L2E A;  2L5X B;  3JTD C;  2F3Z A;  2AAO A;  2PAS A;  2CBL A;  2BCA A;  4I5L B;  1G33 A;  1ALW A;  4JQ0 D;  3F45 A;  1KFU S;  2NCO A;  1N65 A;  1SPY A;  1SL8 A;  5TNC A;  2KI4 B;  3AAJ A;  2LP3 A;  2QAC A;  1GGZ A;  1XFY O;  1QX7 A;  3FWC A;  1IQ5 A;  1MQ1 A;  1MXL C;  1YVH A;  1NPQ A;  4L9M A;  1NCX A;  2CCM A;  1NX0 A;  3EVU A;  1K94 A;  1SK6 D;  3SG6 A;  1F70 A;  1G4Y R;  1XK4 C;  1PK0 D;  1WRK A;  2TN4 A;  2PAL A;  1F71 A;  4BY5 A;  2JPT A;  1NP8 A;  4MSP A;  4HSZ A;  1L2O C;  5D69 A;  1FBV A;  2KBM A;  3VRP A;  1RRO A;  1XYD A;  1LVC D;  1CFP A;  2E30 A;  1VRK A;  1BR1 B;  2FCE A;  5BPJ A;  1A29 A;  2E6W A;  1REC A;  1UHN A;  4C0L A;  1OOJ A;  1F55 A;  2WC8 A;  3LLE A;  1XVJ A;  1Y1A A;  1XFU O;  1QIW A;  2M97 A;  4MZK A;  2I7A A;  2LLU A;  2ZN9 A;  1CLM A;  1ZAC A;  1Y6W A;  1EG3 A;  1AJ4 A;  1IJ5 A;  1TNQ A;  1UP5 A;  4BY4 A;  2EGD A;  3TZ1 A;  3TUY B;  1QS7 A;  4UPG A;  4HRH A;  5B8I B;  1FI5 A;  1DJX A;  3EVR A;  4GBA A;  2CT9 A;  3SIB A;  4PE7 A;  4MLW A;  1V1G A;  1XFZ O;  4N5X A;  2H2K A;  1J7R A;  1DF0 A;  1AVS A;  4GGN A;  1B7T Z;  2KQY A;  1WDC C;  3OX5 A;  5D7F A;  2MA2 A;  1UUS A;  1NWD A;  4HRE E;  3SG7 A;  2WOR A;  1UHK A;  2MHH A;  3BUN B;  3I5F B;  1AHR A;  1B8L A;  2MBX A;  2LVV A;  2M8U A;  1B8R A;  2CXJ A;  4C0K A;  1FW4 A;  1F4Q A;  2LUX A;  2MLF C;  5HKW A;  4JPZ B;  2MLE C;  3KF9 A;  1JWD A;  3GK4 X;  3FWB A;  4A4B A;  2JQ6 A;  4MVF A;  3WNX B;  1MHO A;  4PHK A;  5HLV A;  1LXF C;  4USL A;  2O60 A;  1J1E A;  3D0Y B;  3PSR A;  3GOF A;  1OMV A;  3BOW B;  2L4I A;  3ZWH A;  1CFC A;  2G2B A;  2M49 B;  1IG5 A;  2HQ8 A;  4NDD A;  2NLN A;  1C7V A;  2KFH A;  1BOD A;  3EK8 A;  2Y5I A;  2KFF A;  3RM1 A;  1K9P A;  1CB1 A;  2COL B;  3EVV A;  3C1V A;  4AQI A;  5F6T A;  1QLS A;  1WLM A;  3TDU A;  1M63 B;  1IKU A;  1F8H A;  4OV2 A;  3KPX A;  4GUK A;  1MR8 A;  1Y0V H;  4MN0 A;  4YBH B;  1XFW O;  5DKN A;  2EC6 B;  3NSL A;  2ZN8 A;  3OP0 A;  1XK4 A;  2GV5 A;  2B1U A;  3PLF B;  1UHI A;  4OVN F;  1YUU A;  1YVL A;  2JT0 A;  5CSN A;  4PE0 A;  3DD4 A;  4M2Q A;  2BBN A;  1UUR A;  5HKY A;  2OS8 C;  1KK8 B;  1CFF A;  4HRG A;  2JT8 A;  5DKR A;  4OR9 B;  2PVB A;  3NSI A;  4I5N B;  3I5H C;  2F8P A;  4GGF A;  1B7T Y;  2BL0 C;  1DF0 B;  1CM4 A;  1M31 A;  1EXR A;  3BXK A;  3BUX B;  2ZRT A;  1OZO A;  1SL7 A;  3VRR A;  1KK7 Y;  2MJW B;  1KQM B;  2F2P A;  5KU1 A;  1NSH A;  1PAL A;  4AQJ A;  4M2O A;  2NXQ A;  1QV1 A;  1KQM C;  1ODB A;  3DF0 A;  1AP4 A;  1YUR A;  1CLL A;  4MRY A;  1QIV A;  3CLN A;  1S6I A;  3CR2 A;  5AFP A;  2BCB A;  2K7C A;  1SL9 A;  3OB2 B;  5AAN A;  1QLK A;  2M1U A;  1EJ3 A;  3BUW B;  3DVJ A;  2KI4 C;  1QJT A;  3LL8 B;  1AUI B;  4MZL A;  5PAL A;  1MXE A;  3VRQ A;  1BR4 B;  1GJY A;  2RGI A;  1G8I A;  4PHJ A;  5KTY A;  1SKT A;  4P5O E;  2LAN A;  4E68 A;  2M29 A;  1LA3 A;  1DJY A;  1A2X A;  5CPV A;  1HQV A;  1BT6 A;  2LVK A;  4PHM A;  2BKH B;  1XFV O;  1IQ3 A;  2K7O A;  4NDB A;  1KCY A;  4A4C A;  2OTG B;  1UHJ A;  3CWG A;  4GAO A;  3SG2 A;  1SCM B;  1XA5 A;  2ZRS A;  4M2P A;  2GGZ A;  2M0R A;  1SBJ A;  1A75 B;  3LK1 A;  1DMO A;  2SAS A;  1QAT A;  4DUQ A;  4PE1 A;  4CPV A;  1X02 A;  2LM5 A;  3BUO B;  2JUL A;  4CLN A;  5AER A;  1QXP A;  1KWO B;  1V1F A;  5FYX A;  3CR4 X;  1TN4 A;  2M3W A;  4I5J A;  5I8N A;  1N0Y A;  2JU0 A;  2JT3 A;  1CDL A;  3KO0 A;  1JF2 A;  2KYF A;  3EKH A;  4R1E A;  4WRI A;  4ICB A;  5HLO A;  3RLZ A;  5HYD A;  2Q91 A;  4OCI A;  3NSO A;  1SMG A;  3TUY C;  2LLS A;  1OE9 B;  1CNP A;  2VRG A;  4YGD B;  2SCP A;  2WCF A;  1S5G Z;  3LK0 A;  3OHM B;  2BKI B;  5I2L A;  3SJS A;  5GQQ C;  2LHI A;  5CSF A;  1BG1 A;  4PHN A;  3PN7 B;  1BU3 A;  4ZCV A;  1OMR A;  3DF0 B;  1PUL A;  5JJG A;  1D1O A;  1B47 A;  2ZND A;  1JSA A;  1K90 D;  1S3P A;  1TRF A;  5ER4 X;  4ORB B;  1JF0 A;  1QX5 B;  3MSE B;  4MBE A;  3O78 A;  1PVA A;  2HET A;  3EK7 A;  2HPS A;  4PDZ A;  3I5F C;  5ER5 A;  5JOL A;  1J55 A;  1GQM A;  1JC2 A;  2FJU B;  2M7N A;  1WRL A;  4YI8 A;  3O2P A;  4XJK A;  1KFX L;  1SNL A;  1NCY A;  4YGB B;  4ZCU A;  3SIA A;  2MAZ A;  4F0Z B;  2LAP A;  1DGU A;  3OB1 B;  3AKA A;  1M46 A;  3CTN A;  3EK4 A;  2LMV A;  1DJW A;  1EL4 A;  5AEQ A;  1K9K A;  1DTL A;  2KAV A;  4Q04 A;  1OZS A;  2K0J A;  4GFT A;  3H4S E;  1LA0 A;  2KYC A;  2R2I A;  1S26 D;  1BJF A;  1E8A A;  1LKJ A;  2MRD A;  2JWW A;  4YI9 A;  2O5G A;  5I2O A;  4DRW A;  4FTG A;  5CSJ A;  4C0J A;  1M45 A;  1JFK A;  5KSZ A;  1K93 D;  1TNX A;  2HF5 A;  2KDH A;  2G9B A;  3AKB A;  2FCD A;  2LCP A;  2EC6 C;  3GK2 A;  1FI6 A; 
#chains in the Genus database with same CATH topology
 1GM0 A;  2CTN A;  1CDM A;  2JOJ A;  2Y1M A;  1J7Q A;  5HKZ A;  1YUS A;  1RTP 1;  3BUM B;  1TNW A;  3JVT B;  3S0F A;  1ORG A;  3PFV A;  3CZT X;  1XFX O;  2Q4U A;  2H61 C;  4ORA B;  3WXA A;  2EHB A;  3PM8 A;  3QRX A;  3JVT C;  3R1V A;  1KK8 C;  1YX8 A;  1B4C A;  2K2F A;  1MWN A;  1PVB A;  1UWO A;  1WLZ A;  1CDP A;  3PAL A;  1LIN A;  2P6B B;  3VRO A;  1DQE A;  1QX2 A;  1ZFS A;  1JFJ A;  1B9A A;  2KLD A;  1J7P A;  4CID A;  2JXL A;  2L5Y A;  1RFJ A;  2WCB A;  3IVT A;  5I2Q A;  1C3Z A;  1R6P A;  2GGM A;  1CLB A;  3IQQ A;  2M7L A;  1DGV A;  1N2D A;  4N1G A;  2L50 A;  1B8C A;  1TOP A;  1C3Y A;  4MRX A;  3TS5 B;  3DVE A;  4GNK B;  2QEH A;  4NDC A;  4FQT A;  1DVI A;  1W7J B;  2WCE A;  3ZNI A;  1KSM A;  3TS5 C;  1KSO A;  1YRU B;  1SR6 B;  1S6C A;  1YR5 A;  3OX6 A;  2JTZ A;  3KHE A;  1SR6 C;  1IWQ A;  1L7Z A;  2LMU A;  3JTD B;  1YX7 A;  3SS4 A;  1FPW A;  1NX3 A;  2LVI A;  4PAL A;  5FI2 A;  4DCK A;  3BYA A;  1TCF A;  5G08 A;  1U5I A;  2D8N A;  4NQG A;  1IRJ A;  1KFX S;  1XFR A;  2WCM A;  1IH0 A;  2Y1N A;  3K21 A;  1CM1 A;  1OSA A;  1IGV A;  1QVI Z;  2A4J A;  1C07 A;  4D1E A;  1AK8 A;  2KI6 C;  1F54 A;  2KFG A;  3NXA A;  2K2A A;  4YGC B;  3CDN A;  4YRU A;  4QJ3 B;  1S36 A;  2PSR A;  1EG4 A;  1ALV A;  4DS7 A;  4TNC A;  2KAX A;  2LC5 A;  4GPL B;  1OW4 A;  3SG4 A;  2AUC A;  2KSP A;  2OTG C;  4DIR A;  1DC1 A;  1CMF A;  2KOT A;  1SCM C;  1DJH A;  3VB1 A;  2JXC A;  2ISD A;  1A03 A;  4ORC B;  2DOQ A;  4WQ3 A;  1XO5 A;  1BF5 A;  1CMG A;  1ZMZ A;  2WC5 A;  3D0Y A;  3BOW A;  3IF7 A;  2M1K B;  2I2R E;  3NHT A;  1L2O B;  2KGR A;  3EKJ A;  1MF8 B;  2I94 A;  1K8U A;  1AJ5 A;  1B1G A;  1JBA A;  1KWO C;  4PCW A;  2BNX A;  3PM2 A;  1PSR A;  4FQO A;  1CKK A;  1Y1U A;  2BCX A;  2AMI A;  2PMY A;  4GGF C;  2L51 A;  3AAK A;  3HCM A;  3O6B A;  3CGA A;  1DJG A;  4WQ2 A;  1NUB A;  1TNP A;  3D74 A;  2IS9 A;  1Q80 A;  1W9Z A;  3FE6 A;  2K8M B;  1NX2 A;  2LE9 B;  1DJI A;  2LHL A;  2ZNE A;  2P70 A;  3IQO A;  2JNX A;  4INW A;  1JUO A;  3PN7 C;  1SRA A;  1ZUZ A;  2L4H A;  2K61 A;  2LLT A;  2H61 A;  1MUX A;  1OMD A;  1TTX A;  2LMT A;  3R1P A;  4IL1 A;  1DT7 B;  1RK9 A;  1C7W A;  2LNK A;  3DVK A;  1R2U A;  2LUC A;  3ICB A;  5JOL A;  3L4A A;  5K89 A;  2NCP A;  3I5I B;  2F2O A;  1WDC B;  3E3R A;  1NYA A;  1IJ6 A;  1RJV A;  5I94 A;  1J1D A;  2KAY A;  4ETO A;  1WY9 A;  4MEW A;  3NSK A;  1QVI Y;  2KGB C;  3SS3 A;  3TDI A;  4QJ4 B;  2K7B A;  3I5I C;  1KFU L;  1OOG A;  2K7D A;  1U5I B;  2LVJ A;  2WCK A;  4QJ5 B;  1GGW A;  2OPO A;  2QPT A;  3I5G B;  4CFQ A;  5DKQ A;  1DJZ A;  1SYM A;  3WHU B;  5ER5 A;  1SW8 A;  1UHH A;  1P28 A;  1KK7 Z;  1S6J A;  1KQV A;  3I5G C;  4JWQ A;  3BQ3 A;  3LCP C;  1QTX A;  2F3Y A;  2KI6 D;  3GK1 A;  4INX A;  1TIZ A;  3A4U B;  2KBI A;  2PRU A;  3WHT B;  3KEV A;  4YGE B;  3CS1 A;  1CDN A;  3D77 A;  3VGO A;  3FE8 A;  4P2Y B;  3FIA A;  1K95 A;  1YUT A;  3FS7 A;  1QAS A;  1BLQ A;  2LP2 A;  1YTZ C;  2KQ6 A;  1RWY A;  2JZI A;  1ZOT B;  3DXL A;  3O4X A;  2JTT A;  3B88 A;  3A8R A;  2JRF A;  1HT9 A;  2NZ0 A;  1EH2 A;  3M0W A;  1IIO A;  2BEC A;  1CTR A;  3TDZ A;  1PRW A;  4OKH A;  1H8B A;  1K9U A;  1PSB A;  2WND A;  2L98 A;  1S5G Y;  1BOC A;  3SG3 A;  4I5K A;  1SCV A;  1YRT B;  1OQP A;  2I18 A;  2JC2 A;  2ZKM X;  5AXI A;  2LV7 A;  1Z2C B;  2HQW A;  2M9G A;  2KHN A;  4MZJ A;  2L0P A;  4XYN A;  1TCO B;  2KPH A;  3O4Y A;  5CSI A;  2CNP A;  1H4B A;  2ZFD A;  1A75 A;  1K96 A;  2BBM A;  1J7O A;  1W7I B;  3HX4 A;  2Y4Q A;  4OZD A;  1F4O A;  2PQL A;  2OS8 B;  1NX1 A;  1K2H A;  1CFD A;  2FOT A;  4N1F A;  2BE4 A;  3CR5 X;  1NCZ A;  3VRN A;  3D10 A;  2F33 A;  3I5H B;  1Y1X A;  4PE4 A;  3SG5 A;  4U8D A;  2BE6 A;  1WRZ A;  1BMO A;  2BL0 B;  3PAT A;  1A4P A;  3CAB A;  2V53 A;  1SY9 A;  4XJK B;  5FI6 A;  5J3X A;  4AOM A;  3DYE A;  3DVM A;  4YGA A;  1M39 A;  5IBW A;  1FF1 A;  1NIW A;  2KNE A;  3NGV A;  3S0B A;  3NHI A;  1QV0 A;  2JNF A;  2WOS A;  1S1E A;  4CFR A;  2L2E A;  2L5X B;  3JTD C;  2GTE A;  2F3Z A;  2AAO A;  2PAS A;  2CBL A;  2BCA A;  4I5L B;  1G33 A;  1ALW A;  4JQ0 D;  1OOF A;  3F45 A;  1KFU S;  2NCO A;  1N65 A;  1SPY A;  1SL8 A;  5TNC A;  3BFA A;  1QWV A;  2KI4 B;  3AAJ A;  2BAP A;  2LP3 A;  2QAC A;  3DY9 A;  3L4L A;  1GGZ A;  1XFY O;  1QX7 A;  3FWC A;  1IQ5 A;  1MQ1 A;  1MXL C;  1YVH A;  1NPQ A;  2FJY A;  4L9M A;  1NCX A;  2CCM A;  1NX0 A;  3EVU A;  1K94 A;  1SK6 D;  3SG6 A;  3OBV A;  1F70 A;  1G4Y R;  1XK4 C;  1PK0 D;  1WRK A;  2TN4 A;  3B86 A;  3BFH A;  2PAL A;  4IJ7 A;  4BY5 A;  2QEB A;  1F71 A;  3B6X A;  2JPT A;  1NP8 A;  4MSP A;  4HSZ A;  1L2O C;  5D69 A;  1FBV A;  2KBM A;  3VRP A;  1RRO A;  1XYD A;  1LVC D;  1T14 A;  1CFP A;  2E30 A;  1VRK A;  3UO9 A;  3R1O A;  1BR1 B;  2FCE A;  5BPJ A;  1A29 A;  2E6W A;  1REC A;  1UHN A;  4C0L A;  1OOJ A;  4KYN A;  1F55 A;  2WC8 A;  3LLE A;  1XVJ A;  1Y1A A;  1XFU O;  1QIW A;  2M97 A;  4MZK A;  2I7A A;  2KLE A;  2LLU A;  1CLM A;  2ZN9 A;  3CZ2 A;  1ZAC A;  1Y6W A;  1EG3 A;  1AJ4 A;  1IJ5 A;  1TNQ A;  1UP5 A;  3L47 A;  4BY4 A;  2EGD A;  3TZ1 A;  3TUY B;  1QS7 A;  4UPG A;  4HRH A;  5B8I B;  1FI5 A;  1DJX A;  3EVR A;  4GBA A;  3SS5 A;  2CT9 A;  3SIB A;  4PE7 A;  4F7F A;  4MLW A;  1V1G A;  3D75 A;  1XFZ O;  4N5X A;  2H2K A;  1J7R A;  1DF0 A;  1AVS A;  4GGN A;  1B7T Z;  2KQY A;  1WDC C;  3Q8I A;  3OX5 A;  4JD9 A;  5D7F A;  2MA2 A;  1TWO A;  1UUS A;  1NWD A;  4HRE E;  3SG7 A;  2WOR A;  1UHK A;  2MHH A;  3BUN B;  3I5F B;  1AHR A;  1B8L A;  2MBX A;  2LVV A;  2M8U A;  1B8R A;  2CXJ A;  4C0K A;  1FW4 A;  1F4Q A;  2LUX A;  2MLF C;  5HKW A;  4JPZ B;  2MLE C;  3KF9 A;  1JWD A;  3GK4 X;  3FWB A;  4A4B A;  2JQ6 A;  4MVF A;  3WNX B;  1MHO A;  4PHK A;  5HLV A;  1LXF C;  4USL A;  2O60 A;  1J1E A;  3D0Y B;  3PSR A;  3GOF A;  1DEK A;  1OMV A;  2L4I A;  3BOW B;  3ZWH A;  1CFC A;  2G2B A;  2M49 B;  1IG5 A;  3S0D A;  3V2L A;  2QEO A;  2HQ8 A;  3B87 A;  3K1E A;  2P71 A;  4NDD A;  2NLN A;  1C7V A;  2KFH A;  1BOD A;  3EK8 A;  2Y5I A;  2KFF A;  3CZ1 A;  3RM1 A;  1K9P A;  1CB1 A;  3S0A A;  2COL B;  3EVV A;  3C1V A;  4AQI A;  5F6T A;  1QLS A;  1WLM A;  3TDU A;  1M63 B;  5HL1 A;  1IKU A;  1F8H A;  4OV2 A;  3KPX A;  4GUK A;  1MR8 A;  1Y0V H;  2WC6 A;  4MN0 A;  4YBH B;  1XFW O;  5DKN A;  2EC6 B;  3NSL A;  2ZN8 A;  3OP0 A;  1OOI X;  1XK4 A;  2GV5 A;  1TUZ A;  2B1U A;  1UHI A;  3PLF B;  1YUU A;  1YVL A;  2JT0 A;  4OVN F;  5CSN A;  4PE0 A;  3S0E A;  3DD4 A;  4M2Q A;  2BBN A;  1UUR A;  3OGN A;  2OS8 C;  3UNW A;  5HKY A;  4JKT A;  1KK8 B;  1Z4H A;  1CFF A;  4HRG A;  2JT8 A;  5DKR A;  4OR9 B;  2PVB A;  3NSI A;  5D3O A;  2H8V A;  4I5N B;  3I5H C;  2F8P A;  3R72 A;  4GGF A;  1B7T Y;  2BL0 C;  1DF0 B;  1CM4 A;  1M31 A;  3DZT A;  1EXR A;  2WCJ A;  3BXK A;  3BUX B;  2ZRT A;  1OZO A;  1SL7 A;  3VRR A;  1KK7 Y;  2MJW B;  1KQM B;  2F2P A;  5KU1 A;  1NSH A;  1PAL A;  2QEV A;  3PJI A;  3B7A A;  4AQJ A;  4M2O A;  2NXQ A;  1QV1 A;  1KQM C;  1ODB A;  3DF0 A;  1AP4 A;  1YUR A;  3S0G A;  1CLL A;  4MRY A;  2ERB A;  1OOH A;  1QIV A;  3CLN A;  1S6I A;  3CR2 A;  5AFP A;  2BCB A;  2WCL A;  2K7C A;  1SL9 A;  3RZS A;  3OB2 B;  5AAN A;  1QLK A;  2M1U A;  1EJ3 A;  3BUW B;  3D76 A;  3DVJ A;  2KI4 C;  1QJT A;  3LL8 B;  1AUI B;  4MZL A;  5PAL A;  1MXE A;  3VRQ A;  1BR4 B;  3CZ0 A;  1GJY A;  2RGI A;  1G8I A;  4PHJ A;  5KTY A;  2YGU A;  1SKT A;  4P5O E;  2LAN A;  4E68 A;  2M29 A;  1LA3 A;  1DJY A;  1A2X A;  5CPV A;  1HQV A;  1BT6 A;  2PYQ A;  2WCH A;  2LVK A;  4PHM A;  2BKH B;  1XFV O;  1IQ3 A;  5EL2 A;  2K7O A;  4NDB A;  1KCY A;  4A4C A;  1SSE B;  2OTG B;  1UHJ A;  3CWG A;  3QME A;  4GAO A;  3SG2 A;  1SCM B;  1XA5 A;  2ZRS A;  4M2P A;  2GGZ A;  2M0R A;  1SBJ A;  1A75 B;  3LK1 A;  1LS8 A;  2SAS A;  1DMO A;  1QAT A;  2L2C A;  4DUQ A;  4PE1 A;  4CPV A;  1X02 A;  2LM5 A;  5DIC A;  3BUO B;  2JUL A;  4CLN A;  5AER A;  1QXP A;  1KWO B;  1V1F A;  5FYX A;  2QDI A;  3CR4 X;  1TN4 A;  2M3W A;  4I5J A;  5I8N A;  1N0Y A;  2JU0 A;  2JT3 A;  1CDL A;  3KO0 A;  1JF2 A;  2KYF A;  3EKH A;  4R1E A;  4WRI A;  4ICB A;  5HLO A;  4PT1 A;  3RLZ A;  5HYD A;  2Q91 A;  4OCI A;  3NSO A;  1SMG A;  3TUY C;  2LLS A;  1OE9 B;  1CNP A;  2K60 A;  2VRG A;  2SCP A;  2WCF A;  4YGD B;  1S5G Z;  3CYZ A;  3D73 A;  3LK0 A;  3OHM B;  2BKI B;  5I2L A;  3SJS A;  5GQQ C;  2LHI A;  5CSF A;  1BG1 A;  4PHN A;  3PN7 B;  1BU3 A;  4ZCV A;  1OMR A;  3DF0 B;  1PUL A;  5JJG A;  1D1O A;  1B47 A;  2ZND A;  1JSA A;  1K90 D;  1S3P A;  1TRF A;  5ER4 X;  5FI7 A;  4ORB B;  1JF0 A;  1QX5 B;  3MSE B;  3BJH A;  1TUJ A;  1PVA A;  2HET A;  3EK7 A;  2HPS A;  3N7H A;  3I5F C;  3O78 A;  4MBE A;  4PDZ A;  1J55 A;  1GQM A;  1JC2 A;  2FJU B;  2M7N A;  1WRL A;  3EG5 B;  4YI8 A;  3O2P A;  4XJK A;  1KFX L;  1SNL A;  1NCY A;  4YGB B;  3FE9 A;  4ZCU A;  3SIA A;  2MAZ A;  4F0Z B;  2LAP A;  1DGU A;  3OB1 B;  3AKA A;  1M46 A;  3CTN A;  3EK4 A;  2LMV A;  1DJW A;  1EL4 A;  5AEQ A;  3D78 A;  1K9K A;  1DTL A;  2KAV A;  4Q04 A;  1OZS A;  2K0J A;  4GFT A;  3H4S E;  1LA0 A;  2KYC A;  2R2I A;  3BFB A;  1S26 D;  1BJF A;  1E8A A;  1LKJ A;  2JPO A;  2JWW A;  2MRD A;  4YI9 A;  2O5G A;  5I2O A;  4DRW A;  4FTG A;  5CSJ A;  4C0J A;  1DEL A;  1M45 A;  1JFK A;  5KSZ A;  1K93 D;  1TNX A;  2HF5 A;  2KDH A;  2G9B A;  3AKB A;  2FCD A;  2LCP A;  2EC6 C;  3GK2 A;  1FI6 A; 
#chains in the Genus database with same CATH homology
 2CTN A;  1CDM A;  2JOJ A;  2Y1M A;  1J7Q A;  5HKZ A;  1YUS A;  1RTP 1;  3BUM B;  1TNW A;  3JVT B;  3PFV A;  3CZT X;  1XFX O;  2Q4U A;  2H61 C;  4ORA B;  3WXA A;  2EHB A;  3PM8 A;  3QRX A;  3JVT C;  1KK8 C;  1YX8 A;  1B4C A;  2K2F A;  1MWN A;  1PVB A;  1UWO A;  1WLZ A;  1CDP A;  3PAL A;  1LIN A;  2P6B B;  3VRO A;  1QX2 A;  1ZFS A;  1JFJ A;  1B9A A;  1J7P A;  4CID A;  2JXL A;  1RFJ A;  2WCB A;  5I2Q A;  1R6P A;  1CLB A;  2GGM A;  3IQQ A;  2M7L A;  1DGV A;  1N2D A;  4N1G A;  2L50 A;  1B8C A;  1TOP A;  4MRX A;  3TS5 B;  3DVE A;  4GNK B;  4NDC A;  1DVI A;  1W7J B;  2WCE A;  3ZNI A;  1KSM A;  3TS5 C;  1KSO A;  1YRU B;  1SR6 B;  1S6C A;  1YR5 A;  3OX6 A;  2JTZ A;  3KHE A;  1SR6 C;  1IWQ A;  1L7Z A;  2LMU A;  3JTD B;  1YX7 A;  1FPW A;  1NX3 A;  2LVI A;  4PAL A;  4DCK A;  3BYA A;  1TCF A;  5G08 A;  1U5I A;  2D8N A;  4NQG A;  1IRJ A;  1KFX S;  1IH0 A;  2Y1N A;  3K21 A;  1CM1 A;  1OSA A;  1IGV A;  1QVI Z;  2A4J A;  1C07 A;  4D1E A;  1AK8 A;  2KI6 C;  1F54 A;  2KFG A;  3NXA A;  2K2A A;  4YGC B;  4YRU A;  4QJ3 B;  1S36 A;  2PSR A;  1EG4 A;  1ALV A;  4DS7 A;  4TNC A;  2KAX A;  2LC5 A;  4GPL B;  3SG4 A;  1CMF A;  2AUC A;  2KSP A;  2OTG C;  4DIR A;  2KOT A;  1SCM C;  1DJH A;  2JXC A;  2ISD A;  1A03 A;  4ORC B;  2DOQ A;  4WQ3 A;  1XO5 A;  1BF5 A;  1CMG A;  1ZMZ A;  3D0Y A;  3BOW A;  3IF7 A;  2M1K B;  2I2R E;  1L2O B;  2KGR A;  3EKJ A;  1MF8 B;  2I94 A;  1K8U A;  1AJ5 A;  1B1G A;  1JBA A;  1KWO C;  4PCW A;  1PSR A;  4FQO A;  1CKK A;  1Y1U A;  2BCX A;  2AMI A;  2PMY A;  4GGF C;  2L51 A;  3AAK A;  3HCM A;  3O6B A;  3CGA A;  1DJG A;  4WQ2 A;  1NUB A;  1TNP A;  2IS9 A;  1Q80 A;  2K8M B;  1NX2 A;  2LE9 B;  1DJI A;  2LHL A;  2ZNE A;  3IQO A;  2JNX A;  1JUO A;  3PN7 C;  1SRA A;  1ZUZ A;  2L4H A;  2K61 A;  2LLT A;  2H61 A;  1MUX A;  1OMD A;  1TTX A;  2LMT A;  4IL1 A;  1DT7 B;  1RK9 A;  1C7W A;  2LNK A;  3DVK A;  1R2U A;  2LUC A;  3ICB A;  5K89 A;  2NCP A;  3I5I B;  2F2O A;  1WDC B;  3E3R A;  1NYA A;  1IJ6 A;  1RJV A;  1J1D A;  2KAY A;  4ETO A;  1WY9 A;  4MEW A;  3NSK A;  1QVI Y;  2KGB C;  3TDI A;  4QJ4 B;  2K7B A;  3I5I C;  1KFU L;  2K7D A;  1U5I B;  2LVJ A;  4QJ5 B;  1GGW A;  2OPO A;  2QPT A;  3I5G B;  4CFQ A;  5DKQ A;  1DJZ A;  1SYM A;  3WHU B;  1SW8 A;  1UHH A;  1S6J A;  1KK7 Z;  1KQV A;  3I5G C;  4JWQ A;  3BQ3 A;  3LCP C;  1QTX A;  2F3Y A;  2KI6 D;  3GK1 A;  1TIZ A;  3A4U B;  2KBI A;  2PRU A;  3WHT B;  3KEV A;  4YGE B;  3CS1 A;  1CDN A;  3VGO A;  4P2Y B;  3FIA A;  1K95 A;  1YUT A;  3FS7 A;  1QAS A;  1BLQ A;  2LP2 A;  1YTZ C;  2KQ6 A;  1RWY A;  2JZI A;  1ZOT B;  2JTT A;  3A8R A;  2JRF A;  1HT9 A;  2NZ0 A;  1EH2 A;  3M0W A;  2BEC A;  1CTR A;  3TDZ A;  1PRW A;  4OKH A;  1H8B A;  1K9U A;  1PSB A;  2WND A;  2L98 A;  1S5G Y;  1BOC A;  3SG3 A;  4I5K A;  1SCV A;  1YRT B;  1OQP A;  2I18 A;  2JC2 A;  2ZKM X;  5AXI A;  2LV7 A;  2HQW A;  2M9G A;  2KHN A;  4MZJ A;  2L0P A;  4XYN A;  1TCO B;  5CSI A;  3O4Y A;  1H4B A;  2CNP A;  2ZFD A;  1A75 A;  1K96 A;  2BBM A;  1J7O A;  1W7I B;  3HX4 A;  2Y4Q A;  1F4O A;  2OS8 B;  1NX1 A;  1K2H A;  1CFD A;  2FOT A;  4N1F A;  2BE4 A;  3CR5 X;  1NCZ A;  3VRN A;  3D10 A;  2F33 A;  3I5H B;  1Y1X A;  4PE4 A;  3SG5 A;  4U8D A;  2BE6 A;  1WRZ A;  1BMO A;  2BL0 B;  3PAT A;  1A4P A;  2V53 A;  1SY9 A;  4XJK B;  5J3X A;  4AOM A;  3DVM A;  4YGA A;  1M39 A;  5IBW A;  1FF1 A;  1NIW A;  2KNE A;  1QV0 A;  2JNF A;  2WOS A;  1S1E A;  4CFR A;  2L2E A;  2L5X B;  3JTD C;  2F3Z A;  2AAO A;  2PAS A;  2CBL A;  2BCA A;  4I5L B;  1G33 A;  1ALW A;  4JQ0 D;  3F45 A;  1KFU S;  2NCO A;  1N65 A;  1SPY A;  1SL8 A;  5TNC A;  2KI4 B;  3AAJ A;  2LP3 A;  2QAC A;  1GGZ A;  1XFY O;  1QX7 A;  3FWC A;  1IQ5 A;  1MQ1 A;  1MXL C;  1YVH A;  1NPQ A;  4L9M A;  1NCX A;  2CCM A;  1NX0 A;  3EVU A;  1K94 A;  1SK6 D;  3SG6 A;  1F70 A;  1G4Y R;  1XK4 C;  1PK0 D;  1WRK A;  2TN4 A;  2PAL A;  1F71 A;  4BY5 A;  2JPT A;  1NP8 A;  4MSP A;  4HSZ A;  1L2O C;  5D69 A;  1FBV A;  2KBM A;  3VRP A;  1RRO A;  1XYD A;  1LVC D;  1CFP A;  2E30 A;  1VRK A;  1BR1 B;  2FCE A;  5BPJ A;  1A29 A;  2E6W A;  1REC A;  1UHN A;  4C0L A;  1OOJ A;  1F55 A;  2WC8 A;  3LLE A;  1XVJ A;  1Y1A A;  1XFU O;  1QIW A;  2M97 A;  4MZK A;  2I7A A;  2LLU A;  2ZN9 A;  1CLM A;  1ZAC A;  1Y6W A;  1EG3 A;  1AJ4 A;  1IJ5 A;  1TNQ A;  1UP5 A;  4BY4 A;  2EGD A;  3TZ1 A;  3TUY B;  1QS7 A;  4UPG A;  4HRH A;  5B8I B;  1FI5 A;  1DJX A;  3EVR A;  4GBA A;  2CT9 A;  3SIB A;  4PE7 A;  4MLW A;  1V1G A;  1XFZ O;  4N5X A;  2H2K A;  1J7R A;  1DF0 A;  1AVS A;  4GGN A;  1B7T Z;  2KQY A;  1WDC C;  3OX5 A;  5D7F A;  2MA2 A;  1UUS A;  1NWD A;  4HRE E;  3SG7 A;  2WOR A;  1UHK A;  2MHH A;  3BUN B;  3I5F B;  1AHR A;  1B8L A;  2MBX A;  2LVV A;  2M8U A;  1B8R A;  2CXJ A;  4C0K A;  1FW4 A;  1F4Q A;  2LUX A;  2MLF C;  5HKW A;  4JPZ B;  2MLE C;  3KF9 A;  1JWD A;  3GK4 X;  3FWB A;  4A4B A;  2JQ6 A;  4MVF A;  3WNX B;  1MHO A;  4PHK A;  5HLV A;  1LXF C;  4USL A;  2O60 A;  1J1E A;  3D0Y B;  3PSR A;  3GOF A;  1OMV A;  3BOW B;  2L4I A;  3ZWH A;  1CFC A;  2G2B A;  2M49 B;  1IG5 A;  2HQ8 A;  4NDD A;  2NLN A;  1C7V A;  2KFH A;  1BOD A;  3EK8 A;  2Y5I A;  2KFF A;  3RM1 A;  1K9P A;  1CB1 A;  2COL B;  3EVV A;  3C1V A;  4AQI A;  5F6T A;  1QLS A;  1WLM A;  3TDU A;  1M63 B;  1IKU A;  1F8H A;  4OV2 A;  3KPX A;  4GUK A;  1MR8 A;  1Y0V H;  4MN0 A;  4YBH B;  1XFW O;  5DKN A;  2EC6 B;  3NSL A;  2ZN8 A;  3OP0 A;  1XK4 A;  2GV5 A;  2B1U A;  3PLF B;  1UHI A;  4OVN F;  1YUU A;  1YVL A;  2JT0 A;  5CSN A;  4PE0 A;  3DD4 A;  4M2Q A;  2BBN A;  1UUR A;  5HKY A;  2OS8 C;  1KK8 B;  1CFF A;  4HRG A;  2JT8 A;  5DKR A;  4OR9 B;  2PVB A;  3NSI A;  4I5N B;  3I5H C;  2F8P A;  4GGF A;  1B7T Y;  2BL0 C;  1DF0 B;  1CM4 A;  1M31 A;  1EXR A;  3BXK A;  3BUX B;  2ZRT A;  1OZO A;  1SL7 A;  3VRR A;  1KK7 Y;  2MJW B;  1KQM B;  2F2P A;  5KU1 A;  1NSH A;  1PAL A;  4AQJ A;  4M2O A;  2NXQ A;  1QV1 A;  1KQM C;  1ODB A;  3DF0 A;  1AP4 A;  1YUR A;  1CLL A;  4MRY A;  1QIV A;  3CLN A;  1S6I A;  3CR2 A;  5AFP A;  2BCB A;  2K7C A;  1SL9 A;  3OB2 B;  5AAN A;  1QLK A;  2M1U A;  1EJ3 A;  3BUW B;  3DVJ A;  2KI4 C;  1QJT A;  3LL8 B;  1AUI B;  4MZL A;  5PAL A;  1MXE A;  3VRQ A;  1BR4 B;  1GJY A;  2RGI A;  1G8I A;  4PHJ A;  5KTY A;  1SKT A;  4P5O E;  2LAN A;  4E68 A;  2M29 A;  1LA3 A;  1DJY A;  1A2X A;  5CPV A;  1HQV A;  1BT6 A;  2LVK A;  4PHM A;  2BKH B;  1XFV O;  1IQ3 A;  2K7O A;  4NDB A;  1KCY A;  4A4C A;  2OTG B;  1UHJ A;  3CWG A;  4GAO A;  3SG2 A;  1SCM B;  1XA5 A;  2ZRS A;  4M2P A;  2GGZ A;  2M0R A;  1SBJ A;  1A75 B;  3LK1 A;  1DMO A;  2SAS A;  1QAT A;  4DUQ A;  4PE1 A;  4CPV A;  1X02 A;  2LM5 A;  3BUO B;  2JUL A;  4CLN A;  5AER A;  1QXP A;  1KWO B;  1V1F A;  5FYX A;  3CR4 X;  1TN4 A;  2M3W A;  4I5J A;  5I8N A;  1N0Y A;  2JU0 A;  2JT3 A;  1CDL A;  3KO0 A;  1JF2 A;  2KYF A;  3EKH A;  4R1E A;  4WRI A;  4ICB A;  5HLO A;  3RLZ A;  5HYD A;  2Q91 A;  4OCI A;  3NSO A;  1SMG A;  3TUY C;  2LLS A;  1OE9 B;  1CNP A;  2VRG A;  4YGD B;  2SCP A;  2WCF A;  1S5G Z;  3LK0 A;  3OHM B;  2BKI B;  5I2L A;  3SJS A;  5GQQ C;  2LHI A;  5CSF A;  1BG1 A;  4PHN A;  3PN7 B;  1BU3 A;  4ZCV A;  1OMR A;  3DF0 B;  1PUL A;  5JJG A;  1D1O A;  1B47 A;  2ZND A;  1JSA A;  1K90 D;  1S3P A;  1TRF A;  5ER4 X;  4ORB B;  1JF0 A;  1QX5 B;  3MSE B;  4MBE A;  3O78 A;  1PVA A;  2HET A;  3EK7 A;  2HPS A;  4PDZ A;  3I5F C;  5ER5 A;  5JOL A;  1J55 A;  1GQM A;  1JC2 A;  2FJU B;  2M7N A;  1WRL A;  4YI8 A;  3O2P A;  4XJK A;  1KFX L;  1SNL A;  1NCY A;  4YGB B;  4ZCU A;  3SIA A;  2MAZ A;  4F0Z B;  2LAP A;  1DGU A;  3OB1 B;  3AKA A;  1M46 A;  3CTN A;  3EK4 A;  2LMV A;  1DJW A;  1EL4 A;  5AEQ A;  1K9K A;  1DTL A;  2KAV A;  4Q04 A;  1OZS A;  2K0J A;  4GFT A;  3H4S E;  1LA0 A;  2KYC A;  2R2I A;  1S26 D;  1BJF A;  1E8A A;  1LKJ A;  2MRD A;  2JWW A;  4YI9 A;  2O5G A;  5I2O A;  4DRW A;  4FTG A;  5CSJ A;  4C0J A;  1M45 A;  1JFK A;  5KSZ A;  1K93 D;  1TNX A;  2HF5 A;  2KDH A;  2G9B A;  3AKB A;  2FCD A;  2LCP A;  2EC6 C;  3GK2 A;  1FI6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...