2K7DA

Nmr structure of ca2+-bound cabp1 c-domain
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
72
structure length
72
Chain Sequence
ADMIGVKELRDAFREFDTNGDGEISTSELREAMRKLLGHQVGHRDIEEIIRDVDLNGDGRVDFEEFVRMMSR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Calcium-binding protein 1
publication title NMR Structure of Ca2+-bound CaBP1 C-domain
rcsb
source organism Homo sapiens
molecule tags Metal binding protein
total genus 13
structure length 72
sequence length 72
ec nomenclature
pdb deposition date 2008-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2k7dA00
2E6WA 2MRDA 1KK8B 1QIVA 1DJZA 2I18A 1H4BA 3C1VA 2H2KA 3PN7B 2KDHA 2L5XB 1SR6C 1DF0A 3BQ3A 4QJ3B 1IH0A 1XA5A 1F4OA 1NCYA 2JXCA 1XK4C 1ZOTB 1MWNA 1RWYA 2KI4B 2BCAA 4GUKA 1SRAA 1FW4A 4OR9B 1SCMB 2H61C 1BLQA 3IQOA 1S6JA 3SG5A 4AQJA 3GOFA 1JUOA 2F2PA 3O2PA 3ZNIA 1WDCB 3O4YA 1QASA 3PALA 2AMIA 3BUMB 1QLKA 1BMOA 1TN4A 2LMVA 2MJWB 2PASA 3E3RA 1OSAA 5CSNA 2Q91A 1TTXA 5CSFA 4MLWA 1Y1XA 4AQIA 3RLZA 1KFXL 2NXQA 1YUTA 4FTGA 1J7QA 3TDUA 1K8UA 3CGAA 1PK0D 1IGVA 1YVLA 1KK7Y 4C0LA 1VRKA 2MBXA 2EC6C 5JJGA 1XFWO 2M7LA 1KFXS 1KWOB 2CNPA 3DVJA 1JWDA 5K89A 4E68A 1CDMA 2LNKA 3O78A 4YGCB 1U5IB 1C7VA 2JTTA 2LVIA 2Q4UA 2NZ0A 2JTZA 4C0KA 1AP4A 2Y1MA 5HKYA 1C7WA 1JF2A 3RM1A 3BUOB 5HLVA 2B1UA 1A03A 5HKZA 3SG3A 5F6TA 1NYAA 1IG5A 1NP8A 1S6CA 1GQMA 2I7AA 3TS5B 4CPVA 4ETOA 5IBWA 1BJFA 1IJ5A 1KQMB 4A4CA 2L51A 3BYAA 3LCPC 4CFQA 1EL4A 1JSAA 3KHEA 1IQ3A 2JNFA 3LLEA 3TUYB 2M29A 2JRFA 4XYNA 2KAVA 4ICBA 1Y1AA 1CMFA 2KFHA 1CNPA 3I5GC 2AUCA 2Y1NA 2LLSA 1CLMA 3KPXA 1CDNA 3SJSA 5B8IB 4DRWA 2F3YA 1F54A 2LP3A 1RTP1 1RROA 2JC2A 3JVTC 3OB2B 4MZJA 3DVKA 1S3PA 1AVSA 1PULA 1PVAA 1WLZA 1YX8A 1WRLA 1TIZA 5D7FA 1B8RA 3HCMA 1KSOA 3EVUA 2KOTA 4XJKB 2K7CA 3A4UB 1KK8C 1SY9A 1Y1UA 1SW8A 2BKHB 2M9GA 4P5OE 1TOPA 2KNEA 3O6BA 1YRUB 4ZCVA 2BL0B 3FWBA 3PATA 2ZRTA 1K94A 1W7JB 1XFVO 1MUXA 3IQQA 1CLLA 1R6PA 2LCPA 3I5IC 5AEQA 5I8NA 4OV2A 1DVIA 1U5IA 2MHHA 1MF8B 4D1EA 4YGAA 1CDLA 4GGFA 1NX3A 3NSOA 4GPLB 2CTNA 2JU0A 2JZIA 4MN0A 4Q04A 1C07A 1DJGA 4OKHA 2IS9A 1HQVA 2HF5A 3I5HC 4GFTA 1S1EA 2EGDA 1H8BA 4I5LB 2M3WA 1N65A 1KK7Z 3CWGA 4BY4A 2JXLA 3CS1A 3PFVA 2WCEA 2K2FA 1OZOA 2GGZA 2JT0A 3CR4X 3EK7A 2KQ6A 1ZMZA 1BODA 1J1EA 2JOJA 3DF0B 2PVBA 2L98A 1RJVA 1TNWA 1K9PA 1XFZO 2KBMA 1UHNA 1QS7A 2Y4QA 1QX2A 2LMUA 3EVRA 2O5GA 4ORAB 1UHHA 1G4YR 1PSBA 1CMGA 2M7NA 3TDIA 1PRWA 3KO0A 2PRUA 3WXAA 1B1GA 2G9BA 3SIAA 4GGFC 1TCOB 4NDDA 1QJTA 5ER5A 1AUIB 3AKBA 4MZKA 1L2OC 3EVVA 1V1GA 1G8IA 3IF7A 1XFUO 3ICBA 4MVFA 4XJKA 3OP0A 2BE4A 2LANA 1LKJA 1WY9A 3TS5C 1EXRA 3SG4A 1CDPA 1FI5A 2M1UA 1IKUA 5HYDA 5DKNA 3TUYC 2LM5A 5CPVA 1B8CA 1S26D 2LAPA 1OMRA 3CLNA 4HRHA 2ZNDA 1A2XA 1GGZA 1UURA 3I5FB 1K2HA 1SKTA 2M97A 2ZRSA 3MSEB 1DGUA 2L2EA 3JTDB 1LXFC 1NUBA 1YVHA 2CBLA 3VROA 4F0ZB 1K95A 4PCWA 2LE9B 1F55A 4TNCA 3QRXA 2ZKMX 1K90D 4PHJA 2OS8B 1FF1A 2BBMA 1A4PA 1CKKA 2KFFA 5CSJA 3EKJA 2E30A 2LHIA 3ZWHA 1BU3A 1ZFSA 2M1KB 3DF0A 1Q80A 1TCFA 2ZN8A 3DVEA 2KSPA 1N0YA 4QJ4B 3K21A 3LK1A 2BL0C 1XVJA 1XFYO 3OX5A 5G08A 3A8RA 1F70A 1NSHA 3AAKA 2WCFA 1KFUL 2JWWA 2FCEA 2QACA 3SIBA 1XYDA 3NSLA 5D69A 4CFRA 1IRJA 1S5GY 1FI6A 2Y5IA 3BOWB 1NWDA 2QPTA 1UHIA 2K2AA 4JWQA 1XO5A 1GGWA 1KFUS 2MLEC 2VRGA 4M2PA 4PE7A 1N2DA 1QVIY 2SCPA 4PE1A 5HKWA 1F71A 1SL8A 1PALA 3CTNA 4M2OA 2SASA 4YI8A 4CIDA 1QV0A 5J3XA 1QX5B 2EHBA 1QLSA 1QXPA 3DVMA 1JFKA 2HETA 1ALVA 1Y0VH 2JT8A 1YURA 1LA0A 2F2OA 5I2OA 1JFJA 1DTLA 1AK8A 1DMOA 1BR1B 1OMDA 2OTGB 1X02A 1ODBA 4N1GA 3GK2A 1SBJA 2KFGA 3H4SE 3PN7C 3NSIA 2LVJA 2KAXA 2K7BA 4MBEA 2LV7A 1DT7B 2L0PA 2BE6A 2JULA 2KI4C 2K7OA 2NCOA 1HT9A 1SCMC 1UUSA 1CM1A 1KCYA 1J7PA 2KGRA 2EC6B 1DJWA 3LL8B 4A4BA 5KTYA 1SNLA 1WDCC 1J1DA 1DF0B 5DKRA 1S6IA 4HSZA 3FS7A 1QTXA 2PSRA 3I5FC 4NDBA 1LA3A 2F3ZA 2OPOA 2BECA 2NCPA 1SK6D 3JTDC 1SYMA 1M39A 5FYXA 2BBNA 1EG4A 4DS7A 4YRUA 2BKIB 1UHKA 3KEVA 4OVNF 5PALA 4IL1A 1QATA 5AFPA 1MQ1A 4U8DA 2COLB 3HX4A 4WRIA 2I2RE 2WNDA 1TNXA 1AJ5A 1J55A 1EH2A 1KWOC 1CFCA 2LVVA 2CCMA 4PHMA 2KQYA 4MRYA 3I5GB 4YI9A 1WRZA 1NCXA 1MXLC 3GK1A 3VRPA 2KI6C 1S5GZ 3F45A 5ER4X 2ZFDA 4UPGA 1A75B 3JVTB 1MXEA 1WLMA 1QVIZ 1KQMC 3BUWB 2DOQA 1MR8A 2LP2A 2M0RA 1A29A 3KF9A 2BCBA 2GV5A 4MSPA 4NDCA 2NLNA 3SG6A 1KSMA 5KSZA 1BT6A 3D0YB 1M63B 3M0WA 4PE4A 3CR5X 2PMYA 4DUQA 3TDZA 1E8AA 1B9AA 3WHTB 2KYCA 4PALA 5DKQA 4AOMA 1DJIA 1UP5A 3PSRA 2G2BA 4JPZB 4PHNA 1TNPA 4GBAA 2V53A 1CB1A 1QIWA 2AAOA 2MLFC 1J7RA 1IWQA 1B47A 1BR4B 2K8MB 2LUCA 3I5IB 3GK4X 3WNXB 1PSRA 1TNQA 2K0JA 3EKHA 2FOTA 4JQ0D 3CR2A 2M49B 1F4QA 1RFJA 4M2QA 3EK4A 1NCZA 2CXJA 2R2IA 3I5HB 2L4IA 2OTGC 4OCIA 2KYFA 3LK0A 1JC2A 2GGMA 4L9MA 1NX0A 1LINA 4GGNA 4N5XA 4BY5A 5I2QA 4QJ5B 3AKAA 5I2LA 4PDZA 2I94A 3SG7A 3TZ1A 1F8HA 1OQPA 2LLTA 3SG2A 4I5JA 1OMVA 1AHRA 1DGVA 1A75A 1GJYA 3VRQA 3PM8A 2KI6D 1OE9B 4GAOA 2F8PA 4DCKA 4GNKB 2CT9A 5CSIA 2RGIA 4YGBB 4ORBB 1SMGA 3DD4A 1V1FA 1CLBA 1K93D 1R2UA 1L2OB 3D0YA 1SR6B 1B7TZ 1OOJA 4FQOA 2KGBC 1RK9A 3VRRA 2HQWA 3AAJA 3BXKA 3BUXB 4I5NB 4PE0A 5BPJA 5HLOA 2KAYA 2M8UA 1KQVA 1EJ3A 4HREE 4R1EA 2D8NA 5AERA 2LLUA 3FWCA 3D10A 1ALWA 1QV1A 1M45A 1DJYA 4MEWA 1NX2A 3OB1B 3VRNA 1B4CA 2O60A 3BUNB 3CZTX 4MZLA 4NQGA 2LVKA 1W7IB 2HPSA 3NSKA 4YGEB 1K9UA 1EG3A 3OX6A 3PLFB 1FPWA 2JPTA 2PALA 1IJ6A 4PHKA 5AANA 1MHOA 1NX1A 4DIRA 2JQ6A 2WCBA 4CLNA 1TRFA 4P2YB 1JBAA 2MA2A 2MAZA 1M31A 1SPYA 2TN4A 3EK8A 1G33A 1UHJA 1Y6WA 1YX7A 1BOCA 3FIAA 1DJHA 1WRKA 1OZSA 3BOWA 1YRTB 1ZUZA 1BG1A 1SL7A 4HRGA 1B8LA 3NXAA 2K7DA 5TNCA 1D1OA 2FCDA 2ZN9A 4YBHB 1NIWA 1PVBA 2KBIA 5KU1A 2OS8C 5GQQC 4ORCB 1QX7A 1SL9A 2P6BB 1YR5A 2WOSA 4ZCUA 2WC8A 2KHNA 1B7TY 1SCVA 5AXIA 2HQ8A 1IQ5A 1CFDA 1DJXA 1XK4A 5JOLA 4YGDB 4C0JA 1JF0A 1LVCD 2H61A 1NPQA 1FBVA 1CFFA 1UWOA 4WQ2A 1L7ZA 3OHMB 1M46A 1K96A 1XFXO 1ZACA 2BCXA 1AJ4A 1J7OA 1YUUA 2JT3A 2WORA 2F33A 2K61A 2LUXA 2ZNEA 1BF5A 4N1FA 2ISDA 2LC5A 4WQ3A 3VGOA 1CFPA 2LHLA 2JNXA 1YTZC 1K9KA 1RECA 2L4HA 4I5KA 2FJUB 2A4JA 1S36A 3WHUB 1YUSA 2L50A 1CTRA 2LMTA 4MRXA 1CM4A 4USLA
chains in the Genus database with same CATH superfamily
2E6WA 2MRDA 1KK8B 1QIVA 1DJZA 2I18A 1H4BA 3C1VA 2H2KA 3PN7B 2KDHA 2L5XB 1SR6C 1DF0A 3BQ3A 4QJ3B 1IH0A 1XA5A 1F4OA 1NCYA 2JXCA 1XK4C 1ZOTB 1MWNA 1RWYA 2KI4B 2BCAA 4GUKA 1SRAA 1FW4A 4OR9B 1SCMB 2H61C 1BLQA 3IQOA 1S6JA 2H8VA 3SG5A 3B87A 4AQJA 3GOFA 1JUOA 2F2PA 3O2PA 3ZNIA 1WDCB 5D3OA 3O4YA 2WCJA 1QASA 3PALA 2PQLA 2AMIA 3BUMB 1QLKA 1BMOA 1TN4A 2LMVA 2MJWB 2PASA 3E3RA 1OSAA 5CSNA 2Q91A 1TTXA 5CSFA 4PT1A 4MLWA 1Y1XA 4AQIA 3RLZA 3FE9A 1KFXL 2NXQA 1YUTA 4FTGA 1J7QA 3TDUA 1K8UA 3CGAA 2WC6A 1PK0D 1IGVA 1YVLA 1KK7Y 3B88A 4C0LA 2L2CA 1VRKA 2GTEA 2MBXA 2EC6C 1DELA 5JJGA 1XFWO 2M7LA 1KFXS 1KWOB 2CNPA 3DVJA 1JWDA 5K89A 4KYNA 4E68A 1CDMA 2LNKA 3O78A 1SSEB 4YGCB 1U5IB 3O4XA 1C7VA 2JTTA 2LVIA 2Q4UA 2NZ0A 2JTZA 4C0KA 1AP4A 2Y1MA 5HKYA 1C7WA 2WCKA 1JF2A 3RM1A 3BUOB 5HLVA 2B1UA 1A03A 5HKZA 3SG3A 5F6TA 1NYAA 1IG5A 1NP8A 1S6CA 1GQMA 2I7AA 3TS5B 4CPVA 4ETOA 5IBWA 1BJFA 1IJ5A 1KQMB 4A4CA 2L51A 3BYAA 3LCPC 4CFQA 1ORGA 1EL4A 1JSAA 3KHEA 1IQ3A 2JNFA 3LLEA 3TUYB 2M29A 2JRFA 4XYNA 2KAVA 4ICBA 1Y1AA 5FI7A 2KFHA 1CMFA 1CNPA 3I5GC 2AUCA 2Y1NA 2LLSA 1CLMA 3KPXA 1CDNA 2QEOA 3SJSA 2WCLA 4DRWA 5B8IB 2F3YA 1F54A 2LP3A 1RTP1 3S0GA 1RROA 2JC2A 3JVTC 3OB2B 4MZJA 3DVKA 3DZTA 1S3PA 1AVSA 1PULA 1PVAA 1WLZA 1YX8A 1WRLA 1TIZA 4JKTA 5D7FA 1B8RA 3HCMA 1KSOA 4INWA 2BAPA 3EVUA 2KOTA 2KLEA 4XJKB 2K7CA 3A4UB 1KK8C 1SY9A 1Y1UA 1SW8A 2BKHB 2BNXA 2M9GA 1TOPA 2KNEA 3R1VA 3O6BA 1YRUB 4P5OE 4ZCVA 3V2LA 2BL0B 3FWBA 3PATA 2ZRTA 1K94A 1W7JB 1XFVO 1MUXA 3IQQA 1CLLA 1R6PA 2LCPA 3I5IC 3D75A 5AEQA 5I8NA 4OV2A 1DVIA 1U5IA 2MHHA 3D76A 1MF8B 3OGNA 4D1EA 4YGAA 1CDLA 4GGFA 1NX3A 3NSOA 4GPLB 1C3ZA 2CTNA 2JU0A 2JZIA 4MN0A 4Q04A 1C07A 1DJGA 4OKHA 2IS9A 1Z2CB 1HQVA 2HF5A 3I5HC 4GFTA 1S1EA 2EGDA 1H8BA 3EG5B 4I5LB 5FI2A 2M3WA 1N65A 1KK7Z 3CWGA 4BY4A 2JXLA 3CS1A 3PFVA 2WCEA 2L5YA 2K2FA 1OZOA 2GGZA 2JT0A 3CR4X 3EK7A 1T14A 2KQ6A 1ZMZA 1BODA 1J1EA 2JOJA 3DF0B 2JPOA 2PVBA 3S0EA 2L98A 1RJVA 1TNWA 1K9PA 1XFZO 2KBMA 1C3YA 1UHNA 1QS7A 2Y4QA 1QX2A 2LMUA 3EVRA 2O5GA 4OZDA 4ORAB 1UHHA 1G4YR 1PSBA 3NHIA 1CMGA 1LS8A 2M7NA 3TDIA 1PRWA 3KO0A 2PRUA 3WXAA 1B1GA 2G9BA 3SIAA 4GGFC 1TCOB 4NDDA 1QJTA 5ER5A 1AUIB 3AKBA 4MZKA 1L2OC 3EVVA 3S0AA 1V1GA 1G8IA 3IF7A 1XFUO 3ICBA 4MVFA 4XJKA 3NHTA 3OP0A 2BE4A 2LANA 3VB1A 1LKJA 1WY9A 3TS5C 1EXRA 3SG4A 1CDPA 3D74A 1FI5A 2M1UA 1IKUA 5HYDA 5DKNA 3TUYC 2LM5A 5CPVA 1B8CA 1TWOA 1S26D 2LAPA 1OMRA 3CLNA 4HRHA 2ZNDA 1A2XA 1GGZA 1UURA 3I5FB 1K2HA 1SKTA 2M97A 2ZRSA 3L47A 3MSEB 1DGUA 2L2EA 3JTDB 1LXFC 1NUBA 1YVHA 2CBLA 3VROA 4F0ZB 1K95A 4PCWA 3N7HA 2QEHA 2LE9B 1F55A 4TNCA 3QRXA 2ZKMX 1K90D 4PHJA 2OS8B 1DEKA 1FF1A 2BBMA 1A4PA 1CKKA 2KFFA 5CSJA 3EKJA 2E30A 2LHIA 3ZWHA 1BU3A 1ZFSA 2M1KB 3DF0A 1Q80A 1TCFA 2QEBA 2ZN8A 3DVEA 2KSPA 1N0YA 4QJ4B 3K21A 3LK1A 2BL0C 1XVJA 1XFYO 3OX5A 5G08A 3A8RA 1F70A 1NSHA 3AAKA 2WCFA 1KFUL 2JWWA 2FCEA 2QACA 3SIBA 1XYDA 3NSLA 5D69A 4CFRA 1IRJA 1S5GY 1FI6A 2Y5IA 3BOWB 1NWDA 3R1OA 4INXA 2QPTA 1UHIA 2K2AA 3DYEA 4JWQA 1XO5A 1GGWA 1KFUS 2MLEC 2VRGA 3S0DA 4M2PA 4PE7A 1N2DA 1QVIY 2SCPA 4PE1A 5HKWA 1F71A 1SL8A 1PALA 3OBVA 2P71A 3CTNA 4M2OA 2SASA 4YI8A 4CIDA 1DQEA 1QV0A 5J3XA 1QX5B 2EHBA 3L4LA 1QLSA 1QXPA 3DVMA 1JFKA 2HETA 1ALVA 1Y0VH 2JT8A 1YURA 1LA0A 2F2OA 5I2OA 1JFJA 1DTLA 2KLDA 1AK8A 1DMOA 1BR1B 3CABA 1Z4HA 1OMDA 2WCMA 5EL2A 2OTGB 1IIOA 1X02A 1ODBA 3NGVA 4N1GA 3GK2A 1SBJA 2KFGA 3H4SE 3PN7C 3NSIA 2LVJA 2KAXA 2K7BA 3CDNA 2LV7A 4MBEA 1DT7B 2L0PA 2BE6A 2JULA 2KI4C 2K7OA 2NCOA 1HT9A 1SCMC 1UUSA 4F7FA 1CM1A 3Q8IA 1KCYA 1J7PA 2KGRA 3IVTA 2EC6B 1DJWA 3LL8B 4A4BA 5KTYA 1SNLA 1TUJA 1WDCC 1J1DA 1DF0B 5DKRA 1S6IA 4HSZA 3FS7A 1QTXA 2PSRA 3I5FC 4NDBA 1LA3A 2F3ZA 2OPOA 2BECA 2NCPA 1SK6D 3JTDC 3PM2A 1SYMA 1M39A 5FYXA 2BBNA 1EG4A 4DS7A 4YRUA 2BKIB 1UHKA 3KEVA 3R1PA 4OVNF 5PALA 2ERBA 4IL1A 1QATA 5AFPA 1MQ1A 3B6XA 4U8DA 2QEVA 2COLB 3HX4A 4WRIA 2I2RE 2WNDA 1TNXA 1AJ5A 1J55A 3S0FA 1EH2A 1KWOC 1CFCA 2K60A 2LVVA 2CCMA 4PHMA 2KQYA 4MRYA 3I5GB 4YI9A 1WRZA 1NCXA 1MXLC 3GK1A 3VRPA 2KI6C 1S5GZ 3BJHA 3F45A 5ER4X 2ZFDA 4UPGA 1A75B 3D77A 3JVTB 1MXEA 1WLMA 1QVIZ 2FJYA 1KQMC 3BUWB 2DOQA 1MR8A 2LP2A 2M0RA 3BFAA 1A29A 3KF9A 2BCBA 2GV5A 4MSPA 4NDCA 2NLNA 3SG6A 1KSMA 3CYZA 5KSZA 1BT6A 3D0YB 1M63B 3M0WA 4PE4A 3CR5X 2PMYA 4DUQA 3TDZA 1E8AA 1B9AA 3WHTB 2KYCA 1OW4A 4PALA 5DKQA 1DJIA 1UP5A 3B7AA 4AOMA 1OOFA 3PSRA 2G2BA 4JPZB 4PHNA 1TNPA 4GBAA 2V53A 1CB1A 1QIWA 2AAOA 2MLFC 4IJ7A 3CZ1A 1J7RA 1IWQA 1B47A 1BR4B 2K8MB 2LUCA 3I5IB 3L4AA 3GK4X 3WNXB 1PSRA 1TNQA 2K0JA 3EKHA 2FOTA 4JQ0D 3FE6A 3CR2A 2M49B 1F4QA 1RFJA 4M2QA 3EK4A 1GM0A 1NCZA 2CXJA 2R2IA 3I5HB 2L4IA 2OTGC 4OCIA 2KYFA 3LK0A 1JC2A 2GGMA 4L9MA 1NX0A 1LINA 3CZ0A 4GGNA 4N5XA 4BY5A 5I2QA 4QJ5B 3BFHA 3AKAA 3S0BA 5I2LA 4PDZA 2I94A 3SG7A 3TZ1A 1F8HA 1OQPA 2LLTA 3K1EA 4I5JA 3SG2A 5DICA 1OMVA 1AHRA 1DGVA 3FE8A 1A75A 1GJYA 3VRQA 3PM8A 2KI6D 1OE9B 4GAOA 3SS5A 2F8PA 4DCKA 2KPHA 3BFBA 4GNKB 2CT9A 2PYQA 2RGIA 5CSIA 4ORBB 1SMGA 2P70A 4YGBB 3DD4A 1V1FA 1CLBA 3SS4A 1K93D 3DXLA 1R2UA 1L2OB 3D0YA 3UO9A 1SR6B 1B7TZ 2WCHA 1OOJA 4FQOA 2KGBC 5HL1A 1RK9A 3VRRA 2HQWA 3AAJA 3BXKA 3BUXB 4I5NB 4PE0A 5BPJA 5HLOA 2KAYA 2M8UA 1KQVA 1EJ3A 4HREE 4R1EA 2D8NA 5AERA 2LLUA 3FWCA 3D10A 3CZ2A 1ALWA 1QV1A 1M45A 1DJYA 4MEWA 1NX2A 3OB1B 3VRNA 1B4CA 2O60A 1QWVA 3BUNB 3CZTX 4MZLA 4NQGA 2LVKA 1W7IB 2HPSA 3NSKA 3SS3A 4YGEB 1K9UA 1EG3A 3OX6A 3PLFB 1FPWA 2JPTA 2PALA 1IJ6A 4PHKA 5AANA 1MHOA 1NX1A 4DIRA 2JQ6A 2WCBA 4CLNA 1TRFA 4P2YB 1JBAA 3UNWA 2MA2A 2MAZA 1M31A 1SPYA 2TN4A 3EK8A 1G33A 1UHJA 1Y6WA 1YX7A 4FQTA 1BOCA 1W9ZA 3FIAA 1DJHA 1WRKA 1OZSA 3BOWA 1YRTB 1ZUZA 1BG1A 1SL7A 3R72A 4HRGA 3RZSA 1B8LA 3NXAA 2K7DA 3D73A 5TNCA 1D1OA 2FCDA 2ZN9A 4YBHB 1XFRA 1NIWA 1PVBA 2KBIA 3PJIA 5KU1A 2OS8C 5GQQC 4ORCB 5I94A 3B86A 1QX7A 1SL9A 2P6BB 1YR5A 2QDIA 1P28A 2WOSA 4ZCUA 2WC8A 4JD9A 2KHNA 2WC5A 1B7TY 1SCVA 5AXIA 2HQ8A 1IQ5A 1CFDA 1DJXA 1XK4A 5JOLA 4YGDB 3QMEA 4C0JA 1OOGA 1JF0A 1LVCD 2H61A 1NPQA 5FI6A 1FBVA 1CFFA 1UWOA 4WQ2A 1L7ZA 1OOIX 3OHMB 1M46A 1K96A 1XFXO 1ZACA 2BCXA 3DY9A 1AJ4A 1J7OA 1YUUA 1OOHA 2JT3A 2F33A 2K61A 2LUXA 2WORA 2YGUA 2ZNEA 4N1FA 1BF5A 1TUZA 2ISDA 2LC5A 4WQ3A 3VGOA 1CFPA 3D78A 2LHLA 1DC1A 2JNXA 1YTZC 1K9KA 1RECA 2L4HA 4I5KA 2FJUB 2A4JA 1S36A 3WHUB 1YUSA 2L50A 1CTRA 2LMTA 4MRXA 1CM4A 4USLA
chains in the Genus database with same CATH topology
2E6WA 2MRDA 1KK8B 1QIVA 1DJZA 2I18A 1H4BA 3C1VA 2H2KA 3PN7B 2KDHA 2L5XB 1SR6C 1DF0A 3BQ3A 4QJ3B 1IH0A 1XA5A 1F4OA 1NCYA 2JXCA 1XK4C 1ZOTB 1MWNA 1RWYA 2KI4B 2BCAA 4GUKA 1SRAA 1FW4A 4OR9B 1SCMB 2H61C 1BLQA 3IQOA 1S6JA 3SG5A 4AQJA 3GOFA 1JUOA 2F2PA 3O2PA 3ZNIA 1WDCB 3O4YA 1QASA 3PALA 2AMIA 3BUMB 1QLKA 1BMOA 1TN4A 2LMVA 2MJWB 2PASA 3E3RA 1OSAA 5CSNA 2Q91A 1TTXA 5CSFA 4MLWA 1Y1XA 4AQIA 3RLZA 1KFXL 2NXQA 1YUTA 4FTGA 1J7QA 3TDUA 1K8UA 3CGAA 1PK0D 1IGVA 1YVLA 1KK7Y 4C0LA 1VRKA 2MBXA 2EC6C 5JJGA 1XFWO 2M7LA 1KFXS 1KWOB 2CNPA 3DVJA 1JWDA 5K89A 4E68A 1CDMA 2LNKA 3O78A 4YGCB 1U5IB 1C7VA 2JTTA 2LVIA 2Q4UA 2NZ0A 2JTZA 4C0KA 1AP4A 2Y1MA 5HKYA 1C7WA 1JF2A 3RM1A 3BUOB 5HLVA 2B1UA 1A03A 5HKZA 3SG3A 5F6TA 1NYAA 1IG5A 1NP8A 1S6CA 1GQMA 2I7AA 3TS5B 4CPVA 4ETOA 5IBWA 1BJFA 1IJ5A 1KQMB 4A4CA 2L51A 3BYAA 3LCPC 4CFQA 1EL4A 1JSAA 3KHEA 1IQ3A 2JNFA 3LLEA 3TUYB 2M29A 2JRFA 4XYNA 2KAVA 4ICBA 1Y1AA 1CMFA 2KFHA 1CNPA 3I5GC 2AUCA 2Y1NA 2LLSA 1CLMA 3KPXA 1CDNA 3SJSA 5B8IB 4DRWA 2F3YA 1F54A 2LP3A 1RTP1 1RROA 2JC2A 3JVTC 3OB2B 4MZJA 3DVKA 1S3PA 1AVSA 1PULA 1PVAA 1WLZA 1YX8A 1WRLA 1TIZA 5D7FA 1B8RA 3HCMA 1KSOA 3EVUA 2KOTA 4XJKB 2K7CA 3A4UB 1KK8C 1SY9A 1Y1UA 1SW8A 2BKHB 2M9GA 4P5OE 1TOPA 2KNEA 3O6BA 1YRUB 4ZCVA 2BL0B 3FWBA 3PATA 2ZRTA 1K94A 1W7JB 1XFVO 1MUXA 3IQQA 1CLLA 1R6PA 2LCPA 3I5IC 5AEQA 5I8NA 4OV2A 1DVIA 1U5IA 2MHHA 1MF8B 4D1EA 4YGAA 1CDLA 4GGFA 1NX3A 3NSOA 4GPLB 2CTNA 2JU0A 2JZIA 4MN0A 4Q04A 1C07A 1DJGA 4OKHA 2IS9A 1HQVA 2HF5A 3I5HC 4GFTA 1S1EA 2EGDA 1H8BA 4I5LB 2M3WA 1N65A 1KK7Z 3CWGA 4BY4A 2JXLA 3CS1A 3PFVA 2WCEA 2K2FA 1OZOA 2GGZA 2JT0A 3CR4X 3EK7A 2KQ6A 1ZMZA 1BODA 1J1EA 2JOJA 3DF0B 2PVBA 2L98A 1RJVA 1TNWA 1K9PA 1XFZO 2KBMA 1UHNA 1QS7A 2Y4QA 1QX2A 2LMUA 3EVRA 2O5GA 4ORAB 1UHHA 1G4YR 1PSBA 1CMGA 2M7NA 3TDIA 1PRWA 3KO0A 2PRUA 3WXAA 1B1GA 2G9BA 3SIAA 4GGFC 1TCOB 4NDDA 1QJTA 5ER5A 1AUIB 3AKBA 4MZKA 1L2OC 3EVVA 1V1GA 1G8IA 3IF7A 1XFUO 3ICBA 4MVFA 4XJKA 3OP0A 2BE4A 2LANA 1LKJA 1WY9A 3TS5C 1EXRA 3SG4A 1CDPA 1FI5A 2M1UA 1IKUA 5HYDA 5DKNA 3TUYC 2LM5A 5CPVA 1B8CA 1S26D 2LAPA 1OMRA 3CLNA 4HRHA 2ZNDA 1A2XA 1GGZA 1UURA 3I5FB 1K2HA 1SKTA 2M97A 2ZRSA 3MSEB 1DGUA 2L2EA 3JTDB 1LXFC 1NUBA 1YVHA 2CBLA 3VROA 4F0ZB 1K95A 4PCWA 2LE9B 1F55A 4TNCA 3QRXA 2ZKMX 1K90D 4PHJA 2OS8B 1FF1A 2BBMA 1A4PA 1CKKA 2KFFA 5CSJA 3EKJA 2E30A 2LHIA 3ZWHA 1BU3A 1ZFSA 2M1KB 3DF0A 1Q80A 1TCFA 2ZN8A 3DVEA 2KSPA 1N0YA 4QJ4B 3K21A 3LK1A 2BL0C 1XVJA 1XFYO 3OX5A 5G08A 3A8RA 1F70A 1NSHA 3AAKA 2WCFA 1KFUL 2JWWA 2FCEA 2QACA 3SIBA 1XYDA 3NSLA 5D69A 4CFRA 1IRJA 1S5GY 1FI6A 2Y5IA 3BOWB 1NWDA 2QPTA 1UHIA 2K2AA 4JWQA 1XO5A 1GGWA 1KFUS 2MLEC 2VRGA 4M2PA 4PE7A 1N2DA 1QVIY 2SCPA 4PE1A 5HKWA 1F71A 1SL8A 1PALA 3CTNA 4M2OA 2SASA 4YI8A 4CIDA 1QV0A 5J3XA 1QX5B 2EHBA 1QLSA 1QXPA 3DVMA 1JFKA 2HETA 1ALVA 1Y0VH 2JT8A 1YURA 1LA0A 2F2OA 5I2OA 1JFJA 1DTLA 1AK8A 1DMOA 1BR1B 1OMDA 2OTGB 1X02A 1ODBA 4N1GA 3GK2A 1SBJA 2KFGA 3H4SE 3PN7C 3NSIA 2LVJA 2KAXA 2K7BA 4MBEA 2LV7A 1DT7B 2L0PA 2BE6A 2JULA 2KI4C 2K7OA 2NCOA 1HT9A 1SCMC 1UUSA 1CM1A 1KCYA 1J7PA 2KGRA 2EC6B 1DJWA 3LL8B 4A4BA 5KTYA 1SNLA 1WDCC 1J1DA 1DF0B 5DKRA 1S6IA 4HSZA 3FS7A 1QTXA 2PSRA 3I5FC 4NDBA 1LA3A 2F3ZA 2OPOA 2BECA 2NCPA 1SK6D 3JTDC 1SYMA 1M39A 5FYXA 2BBNA 1EG4A 4DS7A 4YRUA 2BKIB 1UHKA 3KEVA 4OVNF 5PALA 4IL1A 1QATA 5AFPA 1MQ1A 4U8DA 2COLB 3HX4A 4WRIA 2I2RE 2WNDA 1TNXA 1AJ5A 1J55A 1EH2A 1KWOC 1CFCA 2LVVA 2CCMA 4PHMA 2KQYA 4MRYA 3I5GB 4YI9A 1WRZA 1NCXA 1MXLC 3GK1A 3VRPA 2KI6C 1S5GZ 3F45A 5ER4X 2ZFDA 4UPGA 1A75B 3JVTB 1MXEA 1WLMA 1QVIZ 1KQMC 3BUWB 2DOQA 1MR8A 2LP2A 2M0RA 1A29A 3KF9A 2BCBA 2GV5A 4MSPA 4NDCA 2NLNA 3SG6A 1KSMA 5KSZA 1BT6A 3D0YB 1M63B 3M0WA 4PE4A 3CR5X 2PMYA 4DUQA 3TDZA 1E8AA 1B9AA 3WHTB 2KYCA 4PALA 5DKQA 4AOMA 1DJIA 1UP5A 3PSRA 2G2BA 4JPZB 4PHNA 1TNPA 4GBAA 2V53A 1CB1A 1QIWA 2AAOA 2MLFC 1J7RA 1IWQA 1B47A 1BR4B 2K8MB 2LUCA 3I5IB 3GK4X 3WNXB 1PSRA 1TNQA 2K0JA 3EKHA 2FOTA 4JQ0D 3CR2A 2M49B 1F4QA 1RFJA 4M2QA 3EK4A 1NCZA 2CXJA 2R2IA 3I5HB 2L4IA 2OTGC 4OCIA 2KYFA 3LK0A 1JC2A 2GGMA 4L9MA 1NX0A 1LINA 4GGNA 4N5XA 4BY5A 5I2QA 4QJ5B 3AKAA 5I2LA 4PDZA 2I94A 3SG7A 3TZ1A 1F8HA 1OQPA 2LLTA 3SG2A 4I5JA 1OMVA 1AHRA 1DGVA 1A75A 1GJYA 3VRQA 3PM8A 2KI6D 1OE9B 4GAOA 2F8PA 4DCKA 4GNKB 2CT9A 5CSIA 2RGIA 4YGBB 4ORBB 1SMGA 3DD4A 1V1FA 1CLBA 1K93D 1R2UA 1L2OB 3D0YA 1SR6B 1B7TZ 1OOJA 4FQOA 2KGBC 1RK9A 3VRRA 2HQWA 3AAJA 3BXKA 3BUXB 4I5NB 4PE0A 5BPJA 5HLOA 2KAYA 2M8UA 1KQVA 1EJ3A 4HREE 4R1EA 2D8NA 5AERA 2LLUA 3FWCA 3D10A 1ALWA 1QV1A 1M45A 1DJYA 4MEWA 1NX2A 3OB1B 3VRNA 1B4CA 2O60A 3BUNB 3CZTX 4MZLA 4NQGA 2LVKA 1W7IB 2HPSA 3NSKA 4YGEB 1K9UA 1EG3A 3OX6A 3PLFB 1FPWA 2JPTA 2PALA 1IJ6A 4PHKA 5AANA 1MHOA 1NX1A 4DIRA 2JQ6A 2WCBA 4CLNA 1TRFA 4P2YB 1JBAA 2MA2A 2MAZA 1M31A 1SPYA 2TN4A 3EK8A 1G33A 1UHJA 1Y6WA 1YX7A 1BOCA 3FIAA 1DJHA 1WRKA 1OZSA 3BOWA 1YRTB 1ZUZA 1BG1A 1SL7A 4HRGA 1B8LA 3NXAA 2K7DA 5TNCA 1D1OA 2FCDA 2ZN9A 4YBHB 1NIWA 1PVBA 2KBIA 5KU1A 2OS8C 5GQQC 4ORCB 1QX7A 1SL9A 2P6BB 1YR5A 2WOSA 4ZCUA 2WC8A 2KHNA 1B7TY 1SCVA 5AXIA 2HQ8A 1IQ5A 1CFDA 1DJXA 1XK4A 5JOLA 4YGDB 4C0JA 1JF0A 1LVCD 2H61A 1NPQA 1FBVA 1CFFA 1UWOA 4WQ2A 1L7ZA 3OHMB 1M46A 1K96A 1XFXO 1ZACA 2BCXA 1AJ4A 1J7OA 1YUUA 2JT3A 2WORA 2F33A 2K61A 2LUXA 2ZNEA 1BF5A 4N1FA 2ISDA 2LC5A 4WQ3A 3VGOA 1CFPA 2LHLA 2JNXA 1YTZC 1K9KA 1RECA 2L4HA 4I5KA 2FJUB 2A4JA 1S36A 3WHUB 1YUSA 2L50A 1CTRA 2LMTA 4MRXA 1CM4A 4USLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E6W A;  2MRD A;  1KK8 B;  1QIV A;  1DJZ A;  2I18 A;  1H4B A;  3C1V A;  2H2K A;  3PN7 B;  2KDH A;  2L5X B;  1SR6 C;  1DF0 A;  3BQ3 A;  4QJ3 B;  1IH0 A;  1XA5 A;  1F4O A;  1NCY A;  2JXC A;  1XK4 C;  1ZOT B;  1MWN A;  1RWY A;  2KI4 B;  2BCA A;  4GUK A;  1SRA A;  1FW4 A;  4OR9 B;  1SCM B;  2H61 C;  1BLQ A;  3IQO A;  1S6J A;  3SG5 A;  4AQJ A;  3GOF A;  1JUO A;  2F2P A;  3O2P A;  3ZNI A;  1WDC B;  3O4Y A;  1QAS A;  3PAL A;  2AMI A;  3BUM B;  1QLK A;  1BMO A;  1TN4 A;  2LMV A;  2MJW B;  2PAS A;  3E3R A;  1OSA A;  5CSN A;  2Q91 A;  1TTX A;  5CSF A;  4MLW A;  1Y1X A;  4AQI A;  3RLZ A;  1KFX L;  2NXQ A;  1YUT A;  4FTG A;  1J7Q A;  3TDU A;  1K8U A;  3CGA A;  1PK0 D;  1IGV A;  1YVL A;  1KK7 Y;  4C0L A;  1VRK A;  2MBX A;  2EC6 C;  5JJG A;  1XFW O;  2M7L A;  1KFX S;  1KWO B;  2CNP A;  3DVJ A;  1JWD A;  5K89 A;  4E68 A;  1CDM A;  2LNK A;  3O78 A;  4YGC B;  1U5I B;  1C7V A;  2JTT A;  2LVI A;  2Q4U A;  2NZ0 A;  2JTZ A;  4C0K A;  1AP4 A;  2Y1M A;  5HKY A;  1C7W A;  1JF2 A;  3RM1 A;  3BUO B;  5HLV A;  2B1U A;  1A03 A;  5HKZ A;  3SG3 A;  5F6T A;  1NYA A;  1IG5 A;  1NP8 A;  1S6C A;  1GQM A;  2I7A A;  3TS5 B;  4CPV A;  4ETO A;  5IBW A;  1BJF A;  1IJ5 A;  1KQM B;  4A4C A;  2L51 A;  3BYA A;  3LCP C;  4CFQ A;  1EL4 A;  1JSA A;  3KHE A;  1IQ3 A;  2JNF A;  3LLE A;  3TUY B;  2M29 A;  2JRF A;  4XYN A;  2KAV A;  4ICB A;  1Y1A A;  1CMF A;  2KFH A;  1CNP A;  3I5G C;  2AUC A;  2Y1N A;  2LLS A;  1CLM A;  3KPX A;  1CDN A;  3SJS A;  5B8I B;  4DRW A;  2F3Y A;  1F54 A;  2LP3 A;  1RTP 1;  1RRO A;  2JC2 A;  3JVT C;  3OB2 B;  4MZJ A;  3DVK A;  1S3P A;  1AVS A;  1PUL A;  1PVA A;  1WLZ A;  1YX8 A;  1WRL A;  1TIZ A;  5D7F A;  1B8R A;  3HCM A;  1KSO A;  3EVU A;  2KOT A;  4XJK B;  2K7C A;  3A4U B;  1KK8 C;  1SY9 A;  1Y1U A;  1SW8 A;  2BKH B;  2M9G A;  4P5O E;  1TOP A;  2KNE A;  3O6B A;  1YRU B;  4ZCV A;  2BL0 B;  3FWB A;  3PAT A;  2ZRT A;  1K94 A;  1W7J B;  1XFV O;  1MUX A;  3IQQ A;  1CLL A;  1R6P A;  2LCP A;  3I5I C;  5AEQ A;  5I8N A;  4OV2 A;  1DVI A;  1U5I A;  2MHH A;  1MF8 B;  4D1E A;  4YGA A;  1CDL A;  4GGF A;  1NX3 A;  3NSO A;  4GPL B;  2CTN A;  2JU0 A;  2JZI A;  4MN0 A;  4Q04 A;  1C07 A;  1DJG A;  4OKH A;  2IS9 A;  1HQV A;  2HF5 A;  3I5H C;  4GFT A;  1S1E A;  2EGD A;  1H8B A;  4I5L B;  2M3W A;  1N65 A;  1KK7 Z;  3CWG A;  4BY4 A;  2JXL A;  3CS1 A;  3PFV A;  2WCE A;  2K2F A;  1OZO A;  2GGZ A;  2JT0 A;  3CR4 X;  3EK7 A;  2KQ6 A;  1ZMZ A;  1BOD A;  1J1E A;  2JOJ A;  3DF0 B;  2PVB A;  2L98 A;  1RJV A;  1TNW A;  1K9P A;  1XFZ O;  2KBM A;  1UHN A;  1QS7 A;  2Y4Q A;  1QX2 A;  2LMU A;  3EVR A;  2O5G A;  4ORA B;  1UHH A;  1G4Y R;  1PSB A;  1CMG A;  2M7N A;  3TDI A;  1PRW A;  3KO0 A;  2PRU A;  3WXA A;  1B1G A;  2G9B A;  3SIA A;  4GGF C;  1TCO B;  4NDD A;  1QJT A;  5ER5 A;  1AUI B;  3AKB A;  4MZK A;  1L2O C;  3EVV A;  1V1G A;  1G8I A;  3IF7 A;  1XFU O;  3ICB A;  4MVF A;  4XJK A;  3OP0 A;  2BE4 A;  2LAN A;  1LKJ A;  1WY9 A;  3TS5 C;  1EXR A;  3SG4 A;  1CDP A;  1FI5 A;  2M1U A;  1IKU A;  5HYD A;  5DKN A;  3TUY C;  2LM5 A;  5CPV A;  1B8C A;  1S26 D;  2LAP A;  1OMR A;  3CLN A;  4HRH A;  2ZND A;  1A2X A;  1GGZ A;  1UUR A;  3I5F B;  1K2H A;  1SKT A;  2M97 A;  2ZRS A;  3MSE B;  1DGU A;  2L2E A;  3JTD B;  1LXF C;  1NUB A;  1YVH A;  2CBL A;  3VRO A;  4F0Z B;  1K95 A;  4PCW A;  2LE9 B;  1F55 A;  4TNC A;  3QRX A;  2ZKM X;  1K90 D;  4PHJ A;  2OS8 B;  1FF1 A;  2BBM A;  1A4P A;  1CKK A;  2KFF A;  5CSJ A;  3EKJ A;  2E30 A;  2LHI A;  3ZWH A;  1BU3 A;  1ZFS A;  2M1K B;  3DF0 A;  1Q80 A;  1TCF A;  2ZN8 A;  3DVE A;  2KSP A;  1N0Y A;  4QJ4 B;  3K21 A;  3LK1 A;  2BL0 C;  1XVJ A;  1XFY O;  3OX5 A;  5G08 A;  3A8R A;  1F70 A;  1NSH A;  3AAK A;  2WCF A;  1KFU L;  2JWW A;  2FCE A;  2QAC A;  3SIB A;  1XYD A;  3NSL A;  5D69 A;  4CFR A;  1IRJ A;  1S5G Y;  1FI6 A;  2Y5I A;  3BOW B;  1NWD A;  2QPT A;  1UHI A;  2K2A A;  4JWQ A;  1XO5 A;  1GGW A;  1KFU S;  2MLE C;  2VRG A;  4M2P A;  4PE7 A;  1N2D A;  1QVI Y;  2SCP A;  4PE1 A;  5HKW A;  1F71 A;  1SL8 A;  1PAL A;  3CTN A;  4M2O A;  2SAS A;  4YI8 A;  4CID A;  1QV0 A;  5J3X A;  1QX5 B;  2EHB A;  1QLS A;  1QXP A;  3DVM A;  1JFK A;  2HET A;  1ALV A;  1Y0V H;  2JT8 A;  1YUR A;  1LA0 A;  2F2O A;  5I2O A;  1JFJ A;  1DTL A;  1AK8 A;  1DMO A;  1BR1 B;  1OMD A;  2OTG B;  1X02 A;  1ODB A;  4N1G A;  3GK2 A;  1SBJ A;  2KFG A;  3H4S E;  3PN7 C;  3NSI A;  2LVJ A;  2KAX A;  2K7B A;  4MBE A;  2LV7 A;  1DT7 B;  2L0P A;  2BE6 A;  2JUL A;  2KI4 C;  2K7O A;  2NCO A;  1HT9 A;  1SCM C;  1UUS A;  1CM1 A;  1KCY A;  1J7P A;  2KGR A;  2EC6 B;  1DJW A;  3LL8 B;  4A4B A;  5KTY A;  1SNL A;  1WDC C;  1J1D A;  1DF0 B;  5DKR A;  1S6I A;  4HSZ A;  3FS7 A;  1QTX A;  2PSR A;  3I5F C;  4NDB A;  1LA3 A;  2F3Z A;  2OPO A;  2BEC A;  2NCP A;  1SK6 D;  3JTD C;  1SYM A;  1M39 A;  5FYX A;  2BBN A;  1EG4 A;  4DS7 A;  4YRU A;  2BKI B;  1UHK A;  3KEV A;  4OVN F;  5PAL A;  4IL1 A;  1QAT A;  5AFP A;  1MQ1 A;  4U8D A;  2COL B;  3HX4 A;  4WRI A;  2I2R E;  2WND A;  1TNX A;  1AJ5 A;  1J55 A;  1EH2 A;  1KWO C;  1CFC A;  2LVV A;  2CCM A;  4PHM A;  2KQY A;  4MRY A;  3I5G B;  4YI9 A;  1WRZ A;  1NCX A;  1MXL C;  3GK1 A;  3VRP A;  2KI6 C;  1S5G Z;  3F45 A;  5ER4 X;  2ZFD A;  4UPG A;  1A75 B;  3JVT B;  1MXE A;  1WLM A;  1QVI Z;  1KQM C;  3BUW B;  2DOQ A;  1MR8 A;  2LP2 A;  2M0R A;  1A29 A;  3KF9 A;  2BCB A;  2GV5 A;  4MSP A;  4NDC A;  2NLN A;  3SG6 A;  1KSM A;  5KSZ A;  1BT6 A;  3D0Y B;  1M63 B;  3M0W A;  4PE4 A;  3CR5 X;  2PMY A;  4DUQ A;  3TDZ A;  1E8A A;  1B9A A;  3WHT B;  2KYC A;  4PAL A;  5DKQ A;  4AOM A;  1DJI A;  1UP5 A;  3PSR A;  2G2B A;  4JPZ B;  4PHN A;  1TNP A;  4GBA A;  2V53 A;  1CB1 A;  1QIW A;  2AAO A;  2MLF C;  1J7R A;  1IWQ A;  1B47 A;  1BR4 B;  2K8M B;  2LUC A;  3I5I B;  3GK4 X;  3WNX B;  1PSR A;  1TNQ A;  2K0J A;  3EKH A;  2FOT A;  4JQ0 D;  3CR2 A;  2M49 B;  1F4Q A;  1RFJ A;  4M2Q A;  3EK4 A;  1NCZ A;  2CXJ A;  2R2I A;  3I5H B;  2L4I A;  2OTG C;  4OCI A;  2KYF A;  3LK0 A;  1JC2 A;  2GGM A;  4L9M A;  1NX0 A;  1LIN A;  4GGN A;  4N5X A;  4BY5 A;  5I2Q A;  4QJ5 B;  3AKA A;  5I2L A;  4PDZ A;  2I94 A;  3SG7 A;  3TZ1 A;  1F8H A;  1OQP A;  2LLT A;  3SG2 A;  4I5J A;  1OMV A;  1AHR A;  1DGV A;  1A75 A;  1GJY A;  3VRQ A;  3PM8 A;  2KI6 D;  1OE9 B;  4GAO A;  2F8P A;  4DCK A;  4GNK B;  2CT9 A;  5CSI A;  2RGI A;  4YGB B;  4ORB B;  1SMG A;  3DD4 A;  1V1F A;  1CLB A;  1K93 D;  1R2U A;  1L2O B;  3D0Y A;  1SR6 B;  1B7T Z;  1OOJ A;  4FQO A;  2KGB C;  1RK9 A;  3VRR A;  2HQW A;  3AAJ A;  3BXK A;  3BUX B;  4I5N B;  4PE0 A;  5BPJ A;  5HLO A;  2KAY A;  2M8U A;  1KQV A;  1EJ3 A;  4HRE E;  4R1E A;  2D8N A;  5AER A;  2LLU A;  3FWC A;  3D10 A;  1ALW A;  1QV1 A;  1M45 A;  1DJY A;  4MEW A;  1NX2 A;  3OB1 B;  3VRN A;  1B4C A;  2O60 A;  3BUN B;  3CZT X;  4MZL A;  4NQG A;  2LVK A;  1W7I B;  2HPS A;  3NSK A;  4YGE B;  1K9U A;  1EG3 A;  3OX6 A;  3PLF B;  1FPW A;  2JPT A;  2PAL A;  1IJ6 A;  4PHK A;  5AAN A;  1MHO A;  1NX1 A;  4DIR A;  2JQ6 A;  2WCB A;  4CLN A;  1TRF A;  4P2Y B;  1JBA A;  2MA2 A;  2MAZ A;  1M31 A;  1SPY A;  2TN4 A;  3EK8 A;  1G33 A;  1UHJ A;  1Y6W A;  1YX7 A;  1BOC A;  3FIA A;  1DJH A;  1WRK A;  1OZS A;  3BOW A;  1YRT B;  1ZUZ A;  1BG1 A;  1SL7 A;  4HRG A;  1B8L A;  3NXA A;  2K7D A;  5TNC A;  1D1O A;  2FCD A;  2ZN9 A;  4YBH B;  1NIW A;  1PVB A;  2KBI A;  5KU1 A;  2OS8 C;  5GQQ C;  4ORC B;  1QX7 A;  1SL9 A;  2P6B B;  1YR5 A;  2WOS A;  4ZCU A;  2WC8 A;  2KHN A;  1B7T Y;  1SCV A;  5AXI A;  2HQ8 A;  1IQ5 A;  1CFD A;  1DJX A;  1XK4 A;  5JOL A;  4YGD B;  4C0J A;  1JF0 A;  1LVC D;  2H61 A;  1NPQ A;  1FBV A;  1CFF A;  1UWO A;  4WQ2 A;  1L7Z A;  3OHM B;  1M46 A;  1K96 A;  1XFX O;  1ZAC A;  2BCX A;  1AJ4 A;  1J7O A;  1YUU A;  2JT3 A;  2WOR A;  2F33 A;  2K61 A;  2LUX A;  2ZNE A;  1BF5 A;  4N1F A;  2ISD A;  2LC5 A;  4WQ3 A;  3VGO A;  1CFP A;  2LHL A;  2JNX A;  1YTZ C;  1K9K A;  1REC A;  2L4H A;  4I5K A;  2FJU B;  2A4J A;  1S36 A;  3WHU B;  1YUS A;  2L50 A;  1CTR A;  2LMT A;  4MRX A;  1CM4 A;  4USL A; 
#chains in the Genus database with same CATH topology
 2E6W A;  2MRD A;  1KK8 B;  1QIV A;  1DJZ A;  2I18 A;  1H4B A;  3C1V A;  2H2K A;  3PN7 B;  2KDH A;  2L5X B;  1SR6 C;  1DF0 A;  3BQ3 A;  4QJ3 B;  1IH0 A;  1XA5 A;  1F4O A;  1NCY A;  2JXC A;  1XK4 C;  1ZOT B;  1MWN A;  1RWY A;  2KI4 B;  2BCA A;  4GUK A;  1SRA A;  1FW4 A;  4OR9 B;  1SCM B;  2H61 C;  1BLQ A;  3IQO A;  1S6J A;  2H8V A;  3SG5 A;  3B87 A;  4AQJ A;  3GOF A;  1JUO A;  2F2P A;  3O2P A;  3ZNI A;  1WDC B;  5D3O A;  3O4Y A;  2WCJ A;  1QAS A;  3PAL A;  2PQL A;  2AMI A;  3BUM B;  1QLK A;  1BMO A;  1TN4 A;  2LMV A;  2MJW B;  2PAS A;  3E3R A;  1OSA A;  5CSN A;  2Q91 A;  1TTX A;  5CSF A;  4PT1 A;  4MLW A;  1Y1X A;  4AQI A;  3RLZ A;  3FE9 A;  1KFX L;  2NXQ A;  1YUT A;  4FTG A;  1J7Q A;  3TDU A;  1K8U A;  3CGA A;  2WC6 A;  1PK0 D;  1IGV A;  1YVL A;  1KK7 Y;  3B88 A;  4C0L A;  2L2C A;  1VRK A;  2GTE A;  2MBX A;  2EC6 C;  1DEL A;  5JJG A;  1XFW O;  2M7L A;  1KFX S;  1KWO B;  2CNP A;  3DVJ A;  1JWD A;  5K89 A;  4KYN A;  4E68 A;  1CDM A;  2LNK A;  3O78 A;  1SSE B;  4YGC B;  1U5I B;  3O4X A;  1C7V A;  2JTT A;  2LVI A;  2Q4U A;  2NZ0 A;  2JTZ A;  4C0K A;  1AP4 A;  2Y1M A;  5HKY A;  1C7W A;  2WCK A;  1JF2 A;  3RM1 A;  3BUO B;  5HLV A;  2B1U A;  1A03 A;  5HKZ A;  3SG3 A;  5F6T A;  1NYA A;  1IG5 A;  1NP8 A;  1S6C A;  1GQM A;  2I7A A;  3TS5 B;  4CPV A;  4ETO A;  5IBW A;  1BJF A;  1IJ5 A;  1KQM B;  4A4C A;  2L51 A;  3BYA A;  3LCP C;  4CFQ A;  1ORG A;  1EL4 A;  1JSA A;  3KHE A;  1IQ3 A;  2JNF A;  3LLE A;  3TUY B;  2M29 A;  2JRF A;  4XYN A;  2KAV A;  4ICB A;  1Y1A A;  5FI7 A;  2KFH A;  1CMF A;  1CNP A;  3I5G C;  2AUC A;  2Y1N A;  2LLS A;  1CLM A;  3KPX A;  1CDN A;  2QEO A;  3SJS A;  2WCL A;  4DRW A;  5B8I B;  2F3Y A;  1F54 A;  2LP3 A;  1RTP 1;  3S0G A;  1RRO A;  2JC2 A;  3JVT C;  3OB2 B;  4MZJ A;  3DVK A;  3DZT A;  1S3P A;  1AVS A;  1PUL A;  1PVA A;  1WLZ A;  1YX8 A;  1WRL A;  1TIZ A;  4JKT A;  5D7F A;  1B8R A;  3HCM A;  1KSO A;  4INW A;  2BAP A;  3EVU A;  2KOT A;  2KLE A;  4XJK B;  2K7C A;  3A4U B;  1KK8 C;  1SY9 A;  1Y1U A;  1SW8 A;  2BKH B;  2BNX A;  2M9G A;  1TOP A;  2KNE A;  3R1V A;  3O6B A;  1YRU B;  4P5O E;  4ZCV A;  3V2L A;  2BL0 B;  3FWB A;  3PAT A;  2ZRT A;  1K94 A;  1W7J B;  1XFV O;  1MUX A;  3IQQ A;  1CLL A;  1R6P A;  2LCP A;  3I5I C;  3D75 A;  5AEQ A;  5I8N A;  4OV2 A;  1DVI A;  1U5I A;  2MHH A;  3D76 A;  1MF8 B;  3OGN A;  4D1E A;  4YGA A;  1CDL A;  4GGF A;  1NX3 A;  3NSO A;  4GPL B;  1C3Z A;  2CTN A;  2JU0 A;  2JZI A;  4MN0 A;  4Q04 A;  1C07 A;  1DJG A;  4OKH A;  2IS9 A;  1Z2C B;  1HQV A;  2HF5 A;  3I5H C;  4GFT A;  1S1E A;  2EGD A;  1H8B A;  3EG5 B;  4I5L B;  5FI2 A;  2M3W A;  1N65 A;  1KK7 Z;  3CWG A;  4BY4 A;  2JXL A;  3CS1 A;  3PFV A;  2WCE A;  2L5Y A;  2K2F A;  1OZO A;  2GGZ A;  2JT0 A;  3CR4 X;  3EK7 A;  1T14 A;  2KQ6 A;  1ZMZ A;  1BOD A;  1J1E A;  2JOJ A;  3DF0 B;  2JPO A;  2PVB A;  3S0E A;  2L98 A;  1RJV A;  1TNW A;  1K9P A;  1XFZ O;  2KBM A;  1C3Y A;  1UHN A;  1QS7 A;  2Y4Q A;  1QX2 A;  2LMU A;  3EVR A;  2O5G A;  4OZD A;  4ORA B;  1UHH A;  1G4Y R;  1PSB A;  3NHI A;  1CMG A;  1LS8 A;  2M7N A;  3TDI A;  1PRW A;  3KO0 A;  2PRU A;  3WXA A;  1B1G A;  2G9B A;  3SIA A;  4GGF C;  1TCO B;  4NDD A;  1QJT A;  5ER5 A;  1AUI B;  3AKB A;  4MZK A;  1L2O C;  3EVV A;  3S0A A;  1V1G A;  1G8I A;  3IF7 A;  1XFU O;  3ICB A;  4MVF A;  4XJK A;  3NHT A;  3OP0 A;  2BE4 A;  2LAN A;  3VB1 A;  1LKJ A;  1WY9 A;  3TS5 C;  1EXR A;  3SG4 A;  1CDP A;  3D74 A;  1FI5 A;  2M1U A;  1IKU A;  5HYD A;  5DKN A;  3TUY C;  2LM5 A;  5CPV A;  1B8C A;  1TWO A;  1S26 D;  2LAP A;  1OMR A;  3CLN A;  4HRH A;  2ZND A;  1A2X A;  1GGZ A;  1UUR A;  3I5F B;  1K2H A;  1SKT A;  2M97 A;  2ZRS A;  3L47 A;  3MSE B;  1DGU A;  2L2E A;  3JTD B;  1LXF C;  1NUB A;  1YVH A;  2CBL A;  3VRO A;  4F0Z B;  1K95 A;  4PCW A;  3N7H A;  2QEH A;  2LE9 B;  1F55 A;  4TNC A;  3QRX A;  2ZKM X;  1K90 D;  4PHJ A;  2OS8 B;  1DEK A;  1FF1 A;  2BBM A;  1A4P A;  1CKK A;  2KFF A;  5CSJ A;  3EKJ A;  2E30 A;  2LHI A;  3ZWH A;  1BU3 A;  1ZFS A;  2M1K B;  3DF0 A;  1Q80 A;  1TCF A;  2QEB A;  2ZN8 A;  3DVE A;  2KSP A;  1N0Y A;  4QJ4 B;  3K21 A;  3LK1 A;  2BL0 C;  1XVJ A;  1XFY O;  3OX5 A;  5G08 A;  3A8R A;  1F70 A;  1NSH A;  3AAK A;  2WCF A;  1KFU L;  2JWW A;  2FCE A;  2QAC A;  3SIB A;  1XYD A;  3NSL A;  5D69 A;  4CFR A;  1IRJ A;  1S5G Y;  1FI6 A;  2Y5I A;  3BOW B;  1NWD A;  3R1O A;  4INX A;  2QPT A;  1UHI A;  2K2A A;  3DYE A;  4JWQ A;  1XO5 A;  1GGW A;  1KFU S;  2MLE C;  2VRG A;  3S0D A;  4M2P A;  4PE7 A;  1N2D A;  1QVI Y;  2SCP A;  4PE1 A;  5HKW A;  1F71 A;  1SL8 A;  1PAL A;  3OBV A;  2P71 A;  3CTN A;  4M2O A;  2SAS A;  4YI8 A;  4CID A;  1DQE A;  1QV0 A;  5J3X A;  1QX5 B;  2EHB A;  3L4L A;  1QLS A;  1QXP A;  3DVM A;  1JFK A;  2HET A;  1ALV A;  1Y0V H;  2JT8 A;  1YUR A;  1LA0 A;  2F2O A;  5I2O A;  1JFJ A;  1DTL A;  2KLD A;  1AK8 A;  1DMO A;  1BR1 B;  3CAB A;  1Z4H A;  1OMD A;  2WCM A;  5EL2 A;  2OTG B;  1IIO A;  1X02 A;  1ODB A;  3NGV A;  4N1G A;  3GK2 A;  1SBJ A;  2KFG A;  3H4S E;  3PN7 C;  3NSI A;  2LVJ A;  2KAX A;  2K7B A;  3CDN A;  2LV7 A;  4MBE A;  1DT7 B;  2L0P A;  2BE6 A;  2JUL A;  2KI4 C;  2K7O A;  2NCO A;  1HT9 A;  1SCM C;  1UUS A;  4F7F A;  1CM1 A;  3Q8I A;  1KCY A;  1J7P A;  2KGR A;  3IVT A;  2EC6 B;  1DJW A;  3LL8 B;  4A4B A;  5KTY A;  1SNL A;  1TUJ A;  1WDC C;  1J1D A;  1DF0 B;  5DKR A;  1S6I A;  4HSZ A;  3FS7 A;  1QTX A;  2PSR A;  3I5F C;  4NDB A;  1LA3 A;  2F3Z A;  2OPO A;  2BEC A;  2NCP A;  1SK6 D;  3JTD C;  3PM2 A;  1SYM A;  1M39 A;  5FYX A;  2BBN A;  1EG4 A;  4DS7 A;  4YRU A;  2BKI B;  1UHK A;  3KEV A;  3R1P A;  4OVN F;  5PAL A;  2ERB A;  4IL1 A;  1QAT A;  5AFP A;  1MQ1 A;  3B6X A;  4U8D A;  2QEV A;  2COL B;  3HX4 A;  4WRI A;  2I2R E;  2WND A;  1TNX A;  1AJ5 A;  1J55 A;  3S0F A;  1EH2 A;  1KWO C;  1CFC A;  2K60 A;  2LVV A;  2CCM A;  4PHM A;  2KQY A;  4MRY A;  3I5G B;  4YI9 A;  1WRZ A;  1NCX A;  1MXL C;  3GK1 A;  3VRP A;  2KI6 C;  1S5G Z;  3BJH A;  3F45 A;  5ER4 X;  2ZFD A;  4UPG A;  1A75 B;  3D77 A;  3JVT B;  1MXE A;  1WLM A;  1QVI Z;  2FJY A;  1KQM C;  3BUW B;  2DOQ A;  1MR8 A;  2LP2 A;  2M0R A;  3BFA A;  1A29 A;  3KF9 A;  2BCB A;  2GV5 A;  4MSP A;  4NDC A;  2NLN A;  3SG6 A;  1KSM A;  3CYZ A;  5KSZ A;  1BT6 A;  3D0Y B;  1M63 B;  3M0W A;  4PE4 A;  3CR5 X;  2PMY A;  4DUQ A;  3TDZ A;  1E8A A;  1B9A A;  3WHT B;  2KYC A;  1OW4 A;  4PAL A;  5DKQ A;  1DJI A;  1UP5 A;  3B7A A;  4AOM A;  1OOF A;  3PSR A;  2G2B A;  4JPZ B;  4PHN A;  1TNP A;  4GBA A;  2V53 A;  1CB1 A;  1QIW A;  2AAO A;  2MLF C;  4IJ7 A;  3CZ1 A;  1J7R A;  1IWQ A;  1B47 A;  1BR4 B;  2K8M B;  2LUC A;  3I5I B;  3L4A A;  3GK4 X;  3WNX B;  1PSR A;  1TNQ A;  2K0J A;  3EKH A;  2FOT A;  4JQ0 D;  3FE6 A;  3CR2 A;  2M49 B;  1F4Q A;  1RFJ A;  4M2Q A;  3EK4 A;  1GM0 A;  1NCZ A;  2CXJ A;  2R2I A;  3I5H B;  2L4I A;  2OTG C;  4OCI A;  2KYF A;  3LK0 A;  1JC2 A;  2GGM A;  4L9M A;  1NX0 A;  1LIN A;  3CZ0 A;  4GGN A;  4N5X A;  4BY5 A;  5I2Q A;  4QJ5 B;  3BFH A;  3AKA A;  3S0B A;  5I2L A;  4PDZ A;  2I94 A;  3SG7 A;  3TZ1 A;  1F8H A;  1OQP A;  2LLT A;  3K1E A;  4I5J A;  3SG2 A;  5DIC A;  1OMV A;  1AHR A;  1DGV A;  3FE8 A;  1A75 A;  1GJY A;  3VRQ A;  3PM8 A;  2KI6 D;  1OE9 B;  4GAO A;  3SS5 A;  2F8P A;  4DCK A;  2KPH A;  3BFB A;  4GNK B;  2CT9 A;  2PYQ A;  2RGI A;  5CSI A;  4ORB B;  1SMG A;  2P70 A;  4YGB B;  3DD4 A;  1V1F A;  1CLB A;  3SS4 A;  1K93 D;  3DXL A;  1R2U A;  1L2O B;  3D0Y A;  3UO9 A;  1SR6 B;  1B7T Z;  2WCH A;  1OOJ A;  4FQO A;  2KGB C;  5HL1 A;  1RK9 A;  3VRR A;  2HQW A;  3AAJ A;  3BXK A;  3BUX B;  4I5N B;  4PE0 A;  5BPJ A;  5HLO A;  2KAY A;  2M8U A;  1KQV A;  1EJ3 A;  4HRE E;  4R1E A;  2D8N A;  5AER A;  2LLU A;  3FWC A;  3D10 A;  3CZ2 A;  1ALW A;  1QV1 A;  1M45 A;  1DJY A;  4MEW A;  1NX2 A;  3OB1 B;  3VRN A;  1B4C A;  2O60 A;  1QWV A;  3BUN B;  3CZT X;  4MZL A;  4NQG A;  2LVK A;  1W7I B;  2HPS A;  3NSK A;  3SS3 A;  4YGE B;  1K9U A;  1EG3 A;  3OX6 A;  3PLF B;  1FPW A;  2JPT A;  2PAL A;  1IJ6 A;  4PHK A;  5AAN A;  1MHO A;  1NX1 A;  4DIR A;  2JQ6 A;  2WCB A;  4CLN A;  1TRF A;  4P2Y B;  1JBA A;  3UNW A;  2MA2 A;  2MAZ A;  1M31 A;  1SPY A;  2TN4 A;  3EK8 A;  1G33 A;  1UHJ A;  1Y6W A;  1YX7 A;  4FQT A;  1BOC A;  1W9Z A;  3FIA A;  1DJH A;  1WRK A;  1OZS A;  3BOW A;  1YRT B;  1ZUZ A;  1BG1 A;  1SL7 A;  3R72 A;  4HRG A;  3RZS A;  1B8L A;  3NXA A;  2K7D A;  3D73 A;  5TNC A;  1D1O A;  2FCD A;  2ZN9 A;  4YBH B;  1XFR A;  1NIW A;  1PVB A;  2KBI A;  3PJI A;  5KU1 A;  2OS8 C;  5GQQ C;  4ORC B;  5I94 A;  3B86 A;  1QX7 A;  1SL9 A;  2P6B B;  1YR5 A;  2QDI A;  1P28 A;  2WOS A;  4ZCU A;  2WC8 A;  4JD9 A;  2KHN A;  2WC5 A;  1B7T Y;  1SCV A;  5AXI A;  2HQ8 A;  1IQ5 A;  1CFD A;  1DJX A;  1XK4 A;  5JOL A;  4YGD B;  3QME A;  4C0J A;  1OOG A;  1JF0 A;  1LVC D;  2H61 A;  1NPQ A;  5FI6 A;  1FBV A;  1CFF A;  1UWO A;  4WQ2 A;  1L7Z A;  1OOI X;  3OHM B;  1M46 A;  1K96 A;  1XFX O;  1ZAC A;  2BCX A;  3DY9 A;  1AJ4 A;  1J7O A;  1YUU A;  1OOH A;  2JT3 A;  2F33 A;  2K61 A;  2LUX A;  2WOR A;  2YGU A;  2ZNE A;  4N1F A;  1BF5 A;  1TUZ A;  2ISD A;  2LC5 A;  4WQ3 A;  3VGO A;  1CFP A;  3D78 A;  2LHL A;  1DC1 A;  2JNX A;  1YTZ C;  1K9K A;  1REC A;  2L4H A;  4I5K A;  2FJU B;  2A4J A;  1S36 A;  3WHU B;  1YUS A;  2L50 A;  1CTR A;  2LMT A;  4MRX A;  1CM4 A;  4USL A; 
#chains in the Genus database with same CATH homology
 2E6W A;  2MRD A;  1KK8 B;  1QIV A;  1DJZ A;  2I18 A;  1H4B A;  3C1V A;  2H2K A;  3PN7 B;  2KDH A;  2L5X B;  1SR6 C;  1DF0 A;  3BQ3 A;  4QJ3 B;  1IH0 A;  1XA5 A;  1F4O A;  1NCY A;  2JXC A;  1XK4 C;  1ZOT B;  1MWN A;  1RWY A;  2KI4 B;  2BCA A;  4GUK A;  1SRA A;  1FW4 A;  4OR9 B;  1SCM B;  2H61 C;  1BLQ A;  3IQO A;  1S6J A;  3SG5 A;  4AQJ A;  3GOF A;  1JUO A;  2F2P A;  3O2P A;  3ZNI A;  1WDC B;  3O4Y A;  1QAS A;  3PAL A;  2AMI A;  3BUM B;  1QLK A;  1BMO A;  1TN4 A;  2LMV A;  2MJW B;  2PAS A;  3E3R A;  1OSA A;  5CSN A;  2Q91 A;  1TTX A;  5CSF A;  4MLW A;  1Y1X A;  4AQI A;  3RLZ A;  1KFX L;  2NXQ A;  1YUT A;  4FTG A;  1J7Q A;  3TDU A;  1K8U A;  3CGA A;  1PK0 D;  1IGV A;  1YVL A;  1KK7 Y;  4C0L A;  1VRK A;  2MBX A;  2EC6 C;  5JJG A;  1XFW O;  2M7L A;  1KFX S;  1KWO B;  2CNP A;  3DVJ A;  1JWD A;  5K89 A;  4E68 A;  1CDM A;  2LNK A;  3O78 A;  4YGC B;  1U5I B;  1C7V A;  2JTT A;  2LVI A;  2Q4U A;  2NZ0 A;  2JTZ A;  4C0K A;  1AP4 A;  2Y1M A;  5HKY A;  1C7W A;  1JF2 A;  3RM1 A;  3BUO B;  5HLV A;  2B1U A;  1A03 A;  5HKZ A;  3SG3 A;  5F6T A;  1NYA A;  1IG5 A;  1NP8 A;  1S6C A;  1GQM A;  2I7A A;  3TS5 B;  4CPV A;  4ETO A;  5IBW A;  1BJF A;  1IJ5 A;  1KQM B;  4A4C A;  2L51 A;  3BYA A;  3LCP C;  4CFQ A;  1EL4 A;  1JSA A;  3KHE A;  1IQ3 A;  2JNF A;  3LLE A;  3TUY B;  2M29 A;  2JRF A;  4XYN A;  2KAV A;  4ICB A;  1Y1A A;  1CMF A;  2KFH A;  1CNP A;  3I5G C;  2AUC A;  2Y1N A;  2LLS A;  1CLM A;  3KPX A;  1CDN A;  3SJS A;  5B8I B;  4DRW A;  2F3Y A;  1F54 A;  2LP3 A;  1RTP 1;  1RRO A;  2JC2 A;  3JVT C;  3OB2 B;  4MZJ A;  3DVK A;  1S3P A;  1AVS A;  1PUL A;  1PVA A;  1WLZ A;  1YX8 A;  1WRL A;  1TIZ A;  5D7F A;  1B8R A;  3HCM A;  1KSO A;  3EVU A;  2KOT A;  4XJK B;  2K7C A;  3A4U B;  1KK8 C;  1SY9 A;  1Y1U A;  1SW8 A;  2BKH B;  2M9G A;  4P5O E;  1TOP A;  2KNE A;  3O6B A;  1YRU B;  4ZCV A;  2BL0 B;  3FWB A;  3PAT A;  2ZRT A;  1K94 A;  1W7J B;  1XFV O;  1MUX A;  3IQQ A;  1CLL A;  1R6P A;  2LCP A;  3I5I C;  5AEQ A;  5I8N A;  4OV2 A;  1DVI A;  1U5I A;  2MHH A;  1MF8 B;  4D1E A;  4YGA A;  1CDL A;  4GGF A;  1NX3 A;  3NSO A;  4GPL B;  2CTN A;  2JU0 A;  2JZI A;  4MN0 A;  4Q04 A;  1C07 A;  1DJG A;  4OKH A;  2IS9 A;  1HQV A;  2HF5 A;  3I5H C;  4GFT A;  1S1E A;  2EGD A;  1H8B A;  4I5L B;  2M3W A;  1N65 A;  1KK7 Z;  3CWG A;  4BY4 A;  2JXL A;  3CS1 A;  3PFV A;  2WCE A;  2K2F A;  1OZO A;  2GGZ A;  2JT0 A;  3CR4 X;  3EK7 A;  2KQ6 A;  1ZMZ A;  1BOD A;  1J1E A;  2JOJ A;  3DF0 B;  2PVB A;  2L98 A;  1RJV A;  1TNW A;  1K9P A;  1XFZ O;  2KBM A;  1UHN A;  1QS7 A;  2Y4Q A;  1QX2 A;  2LMU A;  3EVR A;  2O5G A;  4ORA B;  1UHH A;  1G4Y R;  1PSB A;  1CMG A;  2M7N A;  3TDI A;  1PRW A;  3KO0 A;  2PRU A;  3WXA A;  1B1G A;  2G9B A;  3SIA A;  4GGF C;  1TCO B;  4NDD A;  1QJT A;  5ER5 A;  1AUI B;  3AKB A;  4MZK A;  1L2O C;  3EVV A;  1V1G A;  1G8I A;  3IF7 A;  1XFU O;  3ICB A;  4MVF A;  4XJK A;  3OP0 A;  2BE4 A;  2LAN A;  1LKJ A;  1WY9 A;  3TS5 C;  1EXR A;  3SG4 A;  1CDP A;  1FI5 A;  2M1U A;  1IKU A;  5HYD A;  5DKN A;  3TUY C;  2LM5 A;  5CPV A;  1B8C A;  1S26 D;  2LAP A;  1OMR A;  3CLN A;  4HRH A;  2ZND A;  1A2X A;  1GGZ A;  1UUR A;  3I5F B;  1K2H A;  1SKT A;  2M97 A;  2ZRS A;  3MSE B;  1DGU A;  2L2E A;  3JTD B;  1LXF C;  1NUB A;  1YVH A;  2CBL A;  3VRO A;  4F0Z B;  1K95 A;  4PCW A;  2LE9 B;  1F55 A;  4TNC A;  3QRX A;  2ZKM X;  1K90 D;  4PHJ A;  2OS8 B;  1FF1 A;  2BBM A;  1A4P A;  1CKK A;  2KFF A;  5CSJ A;  3EKJ A;  2E30 A;  2LHI A;  3ZWH A;  1BU3 A;  1ZFS A;  2M1K B;  3DF0 A;  1Q80 A;  1TCF A;  2ZN8 A;  3DVE A;  2KSP A;  1N0Y A;  4QJ4 B;  3K21 A;  3LK1 A;  2BL0 C;  1XVJ A;  1XFY O;  3OX5 A;  5G08 A;  3A8R A;  1F70 A;  1NSH A;  3AAK A;  2WCF A;  1KFU L;  2JWW A;  2FCE A;  2QAC A;  3SIB A;  1XYD A;  3NSL A;  5D69 A;  4CFR A;  1IRJ A;  1S5G Y;  1FI6 A;  2Y5I A;  3BOW B;  1NWD A;  2QPT A;  1UHI A;  2K2A A;  4JWQ A;  1XO5 A;  1GGW A;  1KFU S;  2MLE C;  2VRG A;  4M2P A;  4PE7 A;  1N2D A;  1QVI Y;  2SCP A;  4PE1 A;  5HKW A;  1F71 A;  1SL8 A;  1PAL A;  3CTN A;  4M2O A;  2SAS A;  4YI8 A;  4CID A;  1QV0 A;  5J3X A;  1QX5 B;  2EHB A;  1QLS A;  1QXP A;  3DVM A;  1JFK A;  2HET A;  1ALV A;  1Y0V H;  2JT8 A;  1YUR A;  1LA0 A;  2F2O A;  5I2O A;  1JFJ A;  1DTL A;  1AK8 A;  1DMO A;  1BR1 B;  1OMD A;  2OTG B;  1X02 A;  1ODB A;  4N1G A;  3GK2 A;  1SBJ A;  2KFG A;  3H4S E;  3PN7 C;  3NSI A;  2LVJ A;  2KAX A;  2K7B A;  4MBE A;  2LV7 A;  1DT7 B;  2L0P A;  2BE6 A;  2JUL A;  2KI4 C;  2K7O A;  2NCO A;  1HT9 A;  1SCM C;  1UUS A;  1CM1 A;  1KCY A;  1J7P A;  2KGR A;  2EC6 B;  1DJW A;  3LL8 B;  4A4B A;  5KTY A;  1SNL A;  1WDC C;  1J1D A;  1DF0 B;  5DKR A;  1S6I A;  4HSZ A;  3FS7 A;  1QTX A;  2PSR A;  3I5F C;  4NDB A;  1LA3 A;  2F3Z A;  2OPO A;  2BEC A;  2NCP A;  1SK6 D;  3JTD C;  1SYM A;  1M39 A;  5FYX A;  2BBN A;  1EG4 A;  4DS7 A;  4YRU A;  2BKI B;  1UHK A;  3KEV A;  4OVN F;  5PAL A;  4IL1 A;  1QAT A;  5AFP A;  1MQ1 A;  4U8D A;  2COL B;  3HX4 A;  4WRI A;  2I2R E;  2WND A;  1TNX A;  1AJ5 A;  1J55 A;  1EH2 A;  1KWO C;  1CFC A;  2LVV A;  2CCM A;  4PHM A;  2KQY A;  4MRY A;  3I5G B;  4YI9 A;  1WRZ A;  1NCX A;  1MXL C;  3GK1 A;  3VRP A;  2KI6 C;  1S5G Z;  3F45 A;  5ER4 X;  2ZFD A;  4UPG A;  1A75 B;  3JVT B;  1MXE A;  1WLM A;  1QVI Z;  1KQM C;  3BUW B;  2DOQ A;  1MR8 A;  2LP2 A;  2M0R A;  1A29 A;  3KF9 A;  2BCB A;  2GV5 A;  4MSP A;  4NDC A;  2NLN A;  3SG6 A;  1KSM A;  5KSZ A;  1BT6 A;  3D0Y B;  1M63 B;  3M0W A;  4PE4 A;  3CR5 X;  2PMY A;  4DUQ A;  3TDZ A;  1E8A A;  1B9A A;  3WHT B;  2KYC A;  4PAL A;  5DKQ A;  4AOM A;  1DJI A;  1UP5 A;  3PSR A;  2G2B A;  4JPZ B;  4PHN A;  1TNP A;  4GBA A;  2V53 A;  1CB1 A;  1QIW A;  2AAO A;  2MLF C;  1J7R A;  1IWQ A;  1B47 A;  1BR4 B;  2K8M B;  2LUC A;  3I5I B;  3GK4 X;  3WNX B;  1PSR A;  1TNQ A;  2K0J A;  3EKH A;  2FOT A;  4JQ0 D;  3CR2 A;  2M49 B;  1F4Q A;  1RFJ A;  4M2Q A;  3EK4 A;  1NCZ A;  2CXJ A;  2R2I A;  3I5H B;  2L4I A;  2OTG C;  4OCI A;  2KYF A;  3LK0 A;  1JC2 A;  2GGM A;  4L9M A;  1NX0 A;  1LIN A;  4GGN A;  4N5X A;  4BY5 A;  5I2Q A;  4QJ5 B;  3AKA A;  5I2L A;  4PDZ A;  2I94 A;  3SG7 A;  3TZ1 A;  1F8H A;  1OQP A;  2LLT A;  3SG2 A;  4I5J A;  1OMV A;  1AHR A;  1DGV A;  1A75 A;  1GJY A;  3VRQ A;  3PM8 A;  2KI6 D;  1OE9 B;  4GAO A;  2F8P A;  4DCK A;  4GNK B;  2CT9 A;  5CSI A;  2RGI A;  4YGB B;  4ORB B;  1SMG A;  3DD4 A;  1V1F A;  1CLB A;  1K93 D;  1R2U A;  1L2O B;  3D0Y A;  1SR6 B;  1B7T Z;  1OOJ A;  4FQO A;  2KGB C;  1RK9 A;  3VRR A;  2HQW A;  3AAJ A;  3BXK A;  3BUX B;  4I5N B;  4PE0 A;  5BPJ A;  5HLO A;  2KAY A;  2M8U A;  1KQV A;  1EJ3 A;  4HRE E;  4R1E A;  2D8N A;  5AER A;  2LLU A;  3FWC A;  3D10 A;  1ALW A;  1QV1 A;  1M45 A;  1DJY A;  4MEW A;  1NX2 A;  3OB1 B;  3VRN A;  1B4C A;  2O60 A;  3BUN B;  3CZT X;  4MZL A;  4NQG A;  2LVK A;  1W7I B;  2HPS A;  3NSK A;  4YGE B;  1K9U A;  1EG3 A;  3OX6 A;  3PLF B;  1FPW A;  2JPT A;  2PAL A;  1IJ6 A;  4PHK A;  5AAN A;  1MHO A;  1NX1 A;  4DIR A;  2JQ6 A;  2WCB A;  4CLN A;  1TRF A;  4P2Y B;  1JBA A;  2MA2 A;  2MAZ A;  1M31 A;  1SPY A;  2TN4 A;  3EK8 A;  1G33 A;  1UHJ A;  1Y6W A;  1YX7 A;  1BOC A;  3FIA A;  1DJH A;  1WRK A;  1OZS A;  3BOW A;  1YRT B;  1ZUZ A;  1BG1 A;  1SL7 A;  4HRG A;  1B8L A;  3NXA A;  2K7D A;  5TNC A;  1D1O A;  2FCD A;  2ZN9 A;  4YBH B;  1NIW A;  1PVB A;  2KBI A;  5KU1 A;  2OS8 C;  5GQQ C;  4ORC B;  1QX7 A;  1SL9 A;  2P6B B;  1YR5 A;  2WOS A;  4ZCU A;  2WC8 A;  2KHN A;  1B7T Y;  1SCV A;  5AXI A;  2HQ8 A;  1IQ5 A;  1CFD A;  1DJX A;  1XK4 A;  5JOL A;  4YGD B;  4C0J A;  1JF0 A;  1LVC D;  2H61 A;  1NPQ A;  1FBV A;  1CFF A;  1UWO A;  4WQ2 A;  1L7Z A;  3OHM B;  1M46 A;  1K96 A;  1XFX O;  1ZAC A;  2BCX A;  1AJ4 A;  1J7O A;  1YUU A;  2JT3 A;  2WOR A;  2F33 A;  2K61 A;  2LUX A;  2ZNE A;  1BF5 A;  4N1F A;  2ISD A;  2LC5 A;  4WQ3 A;  3VGO A;  1CFP A;  2LHL A;  2JNX A;  1YTZ C;  1K9K A;  1REC A;  2L4H A;  4I5K A;  2FJU B;  2A4J A;  1S36 A;  3WHU B;  1YUS A;  2L50 A;  1CTR A;  2LMT A;  4MRX A;  1CM4 A;  4USL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...