2K7DA

Nmr structure of ca2+-bound cabp1 c-domain
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
72
structure length
72
Chain Sequence
ADMIGVKELRDAFREFDTNGDGEISTSELREAMRKLLGHQVGHRDIEEIIRDVDLNGDGRVDFEEFVRMMSR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Calcium-binding protein 1
publication title NMR Structure of Ca2+-bound CaBP1 C-domain
rcsb
source organism Homo sapiens
molecule tags Metal binding protein
total genus 13
structure length 72
sequence length 72
ec nomenclature
pdb deposition date 2008-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2k7dA00
2P6BB 4MRXA 4TNCA 3SG5A 1NX0A 2KFHA 2JZIA 1G4YR 4DIRA 1K9PA 4GGFA 1XO5A 2Q91A 3OB1B 2I94A 1K95A 4MVFA 1LA3A 4FTGA 2LLTA 1XA5A 4YGEB 3SG6A 2LM5A 2KOTA 4PHMA 1X02A 3C1VA 1NX1A 1QATA 1NCXA 2WC8A 3D0YA 3PATA 3ZNIA 2L98A 3CZTX 3HX4A 1IQ3A 4YBHB 5K89A 1AK8A 2KYCA 4PE4A 1XFUO 3O2PA 4OV2A 1BR1B 5BPJA 1A29A 3TDUA 1F71A 3GK2A 2KQYA 1KQMB 4L9MA 4PE7A 3QRXA 1OOJA 4HREE 1DT7B 1EL4A 1UHKA 1DJGA 1L2OC 3FWBA 4GPLB 2NZ0A 1J7QA 1NX2A 3PSRA 1S5GZ 1NX3A 2KI6D 4I5JA 4WQ3A 5HLVA 5DKRA 1PALA 2AMIA 3VRRA 1SNLA 4M2QA 1N65A 2K7OA 1KSMA 3A4UB 3BQ3A 1JSAA 2PVBA 3IQQA 1Y6WA 4I5KA 1CDMA 5HKZA 4R1EA 2LLUA 3LL8B 1DJIA 1TNXA 3RLZA 4A4CA 5G08A 2KI4B 1AJ5A 1A75B 1XK4C 2WCFA 3BUWB 1SYMA 1IJ6A 1PVBA 2BCBA 1CMFA 1B8LA 2QACA 1NYAA 2JNFA 4MZLA 2M3WA 3TUYC 1WLZA 1SRAA 4A4BA 3KEVA 2TN4A 3JTDB 4YI8A 1C07A 4OR9B 3SIBA 3F45A 2OTGB 1CDLA 3OHMB 1F4QA 2JPTA 1YUTA 3SG4A 1S3PA 1DJWA 3HCMA 2DOQA 2KYFA 1CLBA 3PFVA 2FJUB 2BL0B 1SK6D 1BLQA 3MSEB 5ER4X 2MLFC 4MSPA 2ZNEA 2QPTA 3PLFB 1VRKA 4MBEA 4GGFC 4YGCB 2CNPA 1MHOA 1Y1AA 2AUCA 1L7ZA 1RJVA 1SKTA 1WDCC 5AANA 1AP4A 4QJ5B 2LCPA 2AAOA 2EC6C 3OX5A 1OQPA 2KSPA 3NSOA 2M97A 2HQ8A 3VRPA 4F0ZB 4P5OE 3OB2B 1Y1UA 4IL1A 5I2LA 3O6BA 3CS1A 3I5GC 2LV7A 2SASA 3CR2A 4JQ0D 1SCVA 3GK4X 2L51A 1TCOB 1KQMC 1LVCD 2BKIB 1K90D 1SL8A 1IH0A 2GGMA 3CWGA 4D1EA 3EK8A 1FBVA 2LVIA 1KK8C 1S1EA 1C7VA 3I5HB 1A4PA 2I7AA 1PULA 1OMDA 1XFYO 4CPVA 5KSZA 3OP0A 4JWQA 3DF0A 2H61A 2JU0A 2LHIA 5AEQA 1S36A 2JRFA 4ICBA 1OZSA 2NXQA 4GBAA 2F2OA 1K8UA 3DF0B 5HLOA 3TDZA 1J7RA 1M39A 1SCMB 1SL7A 2K0JA 4ZCUA 1V1GA 1TCFA 2JT3A 2LP3A 3GK1A 2K7BA 3LK1A 1B8CA 1MR8A 2KBMA 5CSFA 1B7TZ 4ORBB 4GNKB 2L0PA 1QV1A 3SG7A 1H8BA 1KWOB 2R2IA 1OSAA 1R2UA 3O4YA 1CDNA 3LK0A 1CM4A 1BU3A 1K94A 1QVIY 2HETA 5JJGA 2HPSA 3EVVA 1DJYA 5DKQA 2L4HA 1DGVA 1GQMA 4BY5A 3D10A 2JWWA 1M63B 3DVEA 4HRHA 4AOMA 1UHJA 2KAXA 1BOCA 4E68A 1Y1XA 1FI6A 3PALA 4N1GA 3NSLA 1S26D 1BF5A 1W7IB 2OTGC 2KDHA 5CPVA 2Y5IA 2RGIA 1TNQA 1EXRA 4HRGA 2V53A 3BUOB 1GGWA 1QASA 1QJTA 2D8NA 2GV5A 4PHJA 4CLNA 1G8IA 1F70A 2K8MB 2LVVA 2KFFA 4PE0A 5I8NA 2F33A 2WCBA 4OVNF 1YX8A 1J7PA 1CTRA 1YRUB 3PN7B 4I5NB 1JWDA 2OS8B 1GJYA 1LA0A 5PALA 4PDZA 4WRIA 2BBNA 2F8PA 1RTP1 3JVTC 1AHRA 1ZFSA 1IWQA 1TTXA 1ZACA 2WNDA 2F3ZA 1QS7A 1YX7A 2FCDA 2E30A 3TS5B 3BUMB 2PRUA 2ZNDA 4ETOA 1PSRA 1H4BA 4FQOA 5ER5A 2B1UA 1QIVA 3I5FB 1WLMA 5CSJA 2MJWB 1EG3A 2ZFDA 1R6PA 2JTZA 1MF8B 5KU1A 4JPZB 1A75A 2WCEA 1FW4A 1LINA 1UP5A 1N0YA 1SPYA 5KTYA 1YR5A 2M7LA 4Q04A 1NUBA 1DJHA 2KQ6A 4ZCVA 2KBIA 2H61C 1SCMC 1SR6B 3WXAA 1MWNA 2NCPA 1UHHA 3DVMA 2JOJA 3VRNA 1CM1A 5FYXA 1UUSA 3CLNA 1KFUS 2BKHB 1AUIB 1EG4A 1XFXO 3NSKA 1YUUA 4NDBA 1XVJA 2K7CA 1M45A 1CFFA 1DGUA 1QXPA 1DF0B 2COLB 1C7WA 1CKKA 3DD4A 2ZRTA 1TOPA 1BT6A 2G2BA 3WHTB 2JNXA 1K9KA 3SJSA 2K2AA 4YGAA 1OMRA 1QVIZ 1YVLA 2LLSA 2M49B 5DKNA 1SMGA 4AQJA 4CFRA 2K61A 5JOLA 4YI9A 1EH2A 1MQ1A 3A8RA 1TNPA 1OMVA 3IQOA 4ORCB 4C0KA 2JULA 3ZWHA 2ZKMX 1QTXA 2CT9A 2GGZA 4MZKA 1WRKA 3FS7A 1QX7A 3RM1A 1DJZA 5HYDA 4NQGA 1S6CA 1JFKA 2JQ6A 3VRQA 1BODA 1A03A 4PHNA 2KGRA 1QX5B 1IQ5A 3KF9A 1PRWA 2JC2A 4PE1A 3BUNB 1HQVA 2L4IA 4OCIA 3NXAA 4GAOA 2F2PA 3NSIA 2NCOA 4CFQA 1TIZA 2NLNA 4XJKA 3H4SE 1K96A 3AKBA 1NPQA 1F55A 1B4CA 1SY9A 1YURA 1W7JB 1S5GY 1CLLA 1JUOA 1ODBA 1PSBA 4M2OA 3WNXB 3GOFA 2Q4UA 5HKYA 1TRFA 3EK7A 5D7FA 1KK7Y 1L2OB 2EGDA 2O5GA 2CCMA 2Y1NA 2PASA 1PK0D 1UWOA 3EVUA 1WRLA 1WY9A 3BOWB 3I5FC 2BBMA 4HSZA 2LUXA 4XJKB 5CSNA 2LC5A 1KFUL 1KSOA 1UHNA 1KFXS 2KGBC 2LVJA 1DTLA 2KI4C 1IJ5A 2EHBA 1NP8A 3EKHA 4C0JA 1JFJA 3VROA 2A4JA 1B8RA 2O60A 1YUSA 3CR5X 4MZJA 4UPGA 2OPOA 4P2YB 1B47A 1CB1A 1BJFA 2ZRSA 2I18A 4YGBB 3JTDC 1FF1A 5D69A 1B1GA 3AKAA 1DJXA 3TUYB 4PALA 2E6WA 3I5IB 5AFPA 5AXIA 1JC2A 1CDPA 2BL0C 4YGDB 1B9AA 3EKJA 2JTTA 2M1KB 5F6TA 5B8IB 1JBAA 2L5XB 1AVSA 1A2XA 2I2RE 2SCPA 1XFWO 1QLKA 4QJ3B 1F54A 1BMOA 1K9UA 4XYNA 1BR4B 3BYAA 1TN4A 3E3RA 1NCYA 4PCWA 2LMVA 4DS7A 2IS9A 4WQ2A 4DCKA 1QLSA 1WDCB 3ICBA 3O78A 2KNEA 2LMUA 2M7NA 1CMGA 1AJ4A 1U5IA 2EC6B 1F8HA 3K21A 1RFJA 4QJ4B 1NCZA 3D0YB 3M0WA 4ORAB 1OE9B 1U5IB 3AAKA 1J7OA 1XFVO 3I5GB 2M9GA 1XFZO 3I5HC 1NSHA 2LUCA 2M29A 1CFDA 4DRWA 1KFXL 3SIAA 1J1EA 1XYDA 4MEWA 1RK9A 3AAJA 1KQVA 2ISDA 2MHHA 2M1UA 4GFTA 1TNWA 1E8AA 2WOSA 4CIDA 2BCXA 2BECA 2JT8A 1KK8B 3FWCA 3KPXA 1LXFC 4I5LB 1KK7Z 1IKUA 2K7DA 2BE4A 2PALA 3CR4X 1DF0A 3CGAA 1S6JA 1KWOC 2LP2A 2FOTA 1B7TY 2KFGA 4GUKA 2HF5A 1SW8A 2F3YA 1YVHA 4MN0A 1UURA 3BXKA 2LANA 2FCEA 2Y1MA 1EJ3A 2MRDA 2LE9B 2ZN9A 5I2OA 2LVKA 3I5IC 2LMTA 1KCYA 3BUXB 2KAYA 1GGZA 1FPWA 2CXJA 1IG5A 1BG1A 3FIAA 4AQIA 1J1DA 3WHUB 1J55A 4GGNA 1SBJA 3PM8A 2LHLA 1Y0VH 5TNCA 5J3XA 5IBWA 3EK4A 1F4OA 1N2DA 2L2EA 3TDIA 1NWDA 2HQWA 2LNKA 1G33A 3PN7C 4DUQA 2OS8C 1QV0A 1CFCA 4N1FA 3SG3A 2MAZA 1MXEA 1Q80A 1QX2A 1S6IA 1ALWA 1YRTB 4USLA 3VGOA 2PMYA 1V1FA 2BE6A 2JXCA 1MXLC 4YRUA 1IRJA 1RROA 1HT9A 1QIWA 4NDCA 2PSRA 3TS5C 1DMOA 1SL9A 2M8UA 3BOWA 3SG2A 3JVTB 2Y4QA 2K2FA 1M31A 4PHKA 1ZUZA 3KO0A 1NIWA 3LLEA 1DVIA 3DVJA 1CNPA 1RWYA 2H2KA 2KAVA 4C0LA 4NDDA 1FI5A 1D1OA 2CTNA 1CFPA 2LAPA 5AERA 1LKJA 3IF7A 2CBLA 1UHIA 1SR6C 1K2HA 2ZN8A 3CTNA 2WORA 1RECA 1K93D 2KHNA 1XK4A 2L50A 5CSIA 2VRGA 3KHEA 4MRYA 2M0RA 4OKHA 1WRZA 4MLWA 2JT0A 1MUXA 2G9BA 4U8DA 3OX6A 4N5XA 2MBXA 1ALVA 1ZMZA 2MLEC 1JF0A 3TZ1A 1ZOTB 5I2QA 1JF2A 4BY4A 2KI6C 5HKWA 1YTZC 1CLMA 1OZOA 3LCPC 3DVKA 1IGVA 2JXLA 5GQQC 1PVAA 2MA2A 3EVRA 2BCAA 1M46A 4M2PA
chains in the Genus database with same CATH superfamily
2P6BB 4MRXA 2GTEA 4TNCA 3SG5A 1NX0A 1LS8A 2KFHA 2JZIA 1G4YR 4DIRA 1K9PA 4GGFA 1XO5A 2Q91A 3OB1B 2I94A 1K95A 4MVFA 1LA3A 4FTGA 2LLTA 1XA5A 4JD9A 4YGEB 2LM5A 2KOTA 4PHMA 3SG6A 1X02A 1XFRA 1NX1A 1QATA 3C1VA 1NCXA 2WC8A 3D0YA 3PATA 3ZNIA 2L98A 3CZTX 3HX4A 1IQ3A 4YBHB 5K89A 1AK8A 2KYCA 4PE4A 1XFUO 3O2PA 4OV2A 1BR1B 5BPJA 1A29A 3TDUA 1F71A 3GK2A 2KQYA 1KQMB 1OOHA 4L9MA 4PE7A 3QRXA 1OOJA 4HREE 1DT7B 1EL4A 1UHKA 1DJGA 1L2OC 3FWBA 4GPLB 3SS4A 2NZ0A 1J7QA 2KLEA 1NX2A 3PSRA 1GM0A 1S5GZ 1NX3A 2KI6D 4I5JA 4WQ3A 5HLVA 5DKRA 1PALA 2AMIA 3VRRA 1SNLA 4M2QA 1N65A 2K7OA 1KSMA 3A4UB 3BQ3A 3SS5A 3DXLA 1JSAA 2PVBA 3IQQA 1Y6WA 3D76A 4I5KA 3Q8IA 1CDMA 2PYQA 5HKZA 4R1EA 2LLUA 5FI6A 3LL8B 1DJIA 1TNXA 3RLZA 4A4CA 5G08A 2KI4B 1AJ5A 1A75B 1XK4C 1ORGA 2WCFA 3BUWB 1SYMA 1IJ6A 1PVBA 2BCBA 5D3OA 1B8LA 1CMFA 2QACA 2JPOA 1NYAA 2JNFA 4MZLA 2M3WA 3TUYC 1WLZA 1SRAA 4A4BA 3KEVA 3D75A 3K1EA 3FE9A 2TN4A 1TUZA 3JTDB 4YI8A 1C07A 2WC6A 4OR9B 3SIBA 3F45A 2OTGB 1CDLA 3OHMB 2WCJA 1F4QA 1DEKA 1YUTA 2JPTA 3SG4A 1S3PA 1DJWA 3HCMA 4INXA 2DOQA 2KYFA 1CLBA 1C3ZA 3PFVA 2FJUB 2BL0B 1SK6D 1BLQA 3MSEB 5ER4X 2MLFC 4MSPA 2ZNEA 2QPTA 3PLFB 1VRKA 3D77A 4MBEA 4GGFC 4YGCB 2CNPA 1MHOA 1Y1AA 1L7ZA 1WDCC 1RJVA 1SKTA 2AUCA 5AANA 1AP4A 4QJ5B 2LCPA 2AAOA 2EC6C 3OX5A 1OQPA 2KSPA 3NSOA 2M97A 2HQ8A 3VRPA 4F0ZB 4P5OE 1IIOA 3OB2B 1Y1UA 4IL1A 5I2LA 2L5YA 3O6BA 3CS1A 3I5GC 2LV7A 2SASA 3CR2A 4JQ0D 1SCVA 3GK4X 2L51A 1TCOB 1KQMC 1LVCD 2BKIB 1K90D 1SL8A 1IH0A 2GGMA 3CWGA 4D1EA 3EK8A 1FBVA 2LVIA 1KK8C 1S1EA 1C7VA 3I5HB 5FI7A 1A4PA 2I7AA 1PULA 1OMDA 3CYZA 1XFYO 3BFBA 4CPVA 5KSZA 3OP0A 4JWQA 3DF0A 1OOFA 2H61A 4IJ7A 2JU0A 2LHIA 5AEQA 1S36A 2JRFA 4ICBA 1OZSA 2NXQA 4GBAA 2F2OA 1K8UA 3DF0B 5HLOA 3TDZA 1J7RA 1M39A 1SCMB 1SL7A 5FI2A 2K0JA 2L2CA 4ZCUA 1V1GA 1TCFA 2JT3A 2LP3A 3GK1A 2K7BA 3LK1A 1B8CA 1MR8A 2KBMA 5CSFA 1B7TZ 4ORBB 4GNKB 2L0PA 1QV1A 3SG7A 1H8BA 1KWOB 2R2IA 1OSAA 1R2UA 2YGUA 3O4YA 1CDNA 2PQLA 1CM4A 3CDNA 3LK0A 1BU3A 1BODA 1K94A 2H8VA 1QVIY 2HETA 5JJGA 2HPSA 3EVVA 1DJYA 5DKQA 2L4HA 3S0BA 1Z2CB 1DGVA 1GQMA 4BY5A 3D10A 2JWWA 1M63B 3DVEA 4HRHA 4AOMA 2WCLA 1UHJA 2KAXA 1BOCA 4E68A 1Y1XA 3B7AA 1FI6A 3FE6A 3PALA 3NSLA 4N1GA 1S26D 1BF5A 1W7IB 2OTGC 2KDHA 5CPVA 2Y5IA 2RGIA 1TNQA 1EXRA 4HRGA 2V53A 3RZSA 3BUOB 1GGWA 1QASA 1QJTA 2D8NA 2GV5A 4PHJA 4CLNA 1G8IA 1F70A 2K8MB 2LVVA 2KFFA 4PE0A 5I8NA 2F33A 2WCBA 4OVNF 1YX8A 3NHIA 1J7PA 1CTRA 1YRUB 3PN7B 4I5NB 1JWDA 2OS8B 1GJYA 1LA0A 5PALA 3S0GA 4PDZA 4WRIA 2BBNA 2F8PA 1RTP1 3JVTC 3N7HA 1AHRA 1ZFSA 1IWQA 1TTXA 1ZACA 2WNDA 2F3ZA 3B6XA 1QS7A 1YX7A 5DICA 2FCDA 3B86A 1SSEB 2E30A 3TS5B 1DC1A 3BUMB 2KPHA 1W9ZA 2PRUA 2ZNDA 4ETOA 1PSRA 1H4BA 4FQOA 3UO9A 5ER5A 2B1UA 1QIVA 3I5FB 1WLMA 5CSJA 2MJWB 1EG3A 2ZFDA 1R6PA 2JTZA 1MF8B 5KU1A 3NGVA 1OOIX 4JPZB 1A75A 2WCEA 1FW4A 1LINA 1UP5A 1N0YA 1SPYA 5KTYA 1YR5A 3IVTA 2M7LA 4Q04A 1NUBA 4JKTA 1DJHA 1T14A 2KQ6A 4ZCVA 2KBIA 2H61C 1SCMC 1SR6B 3WXAA 1MWNA 2NCPA 1UHHA 3DVMA 2JOJA 3VRNA 1CM1A 5FYXA 1UUSA 3CLNA 1KFUS 3V2LA 2BKHB 1AUIB 1EG4A 1XFXO 3BJHA 1YUUA 3NSKA 4NDBA 1XVJA 2K7CA 1M45A 1CFFA 1DGUA 1QXPA 1DF0B 5HL1A 1TWOA 2COLB 3SS3A 1C7WA 1CKKA 3DD4A 2ZRTA 1TOPA 1BT6A 2G2BA 2WCKA 3WHTB 2JNXA 1K9KA 3SJSA 2K2AA 4YGAA 1OMRA 1QVIZ 1YVLA 2LLSA 2M49B 5DKNA 1SMGA 4AQJA 3L4LA 4CFRA 2K61A 3L47A 5JOLA 4YI9A 1EH2A 1MQ1A 1DELA 2FJYA 1TNPA 3A8RA 3NHTA 1OMVA 3IQOA 4ORCB 4C0KA 2JULA 3ZWHA 1C3YA 2ZKMX 1QTXA 2CT9A 2GGZA 4MZKA 1WRKA 3QMEA 3FS7A 1QX7A 3RM1A 1DJZA 5HYDA 4NQGA 1S6CA 1JFKA 2JQ6A 3R1PA 3VRQA 1A03A 4PHNA 2KGRA 3CZ0A 1QX5B 1IQ5A 3KF9A 1PRWA 2JC2A 4PE1A 3BUNB 1HQVA 2L4IA 4OCIA 3NXAA 4GAOA 2F2PA 3NSIA 2NCOA 4CFQA 1TIZA 3PM2A 2NLNA 2K60A 4XJKA 3H4SE 1K96A 3AKBA 3B87A 1NPQA 3VB1A 1F55A 1B4CA 2KLDA 1SY9A 1YURA 1W7JB 1S5GY 1CLLA 1JUOA 1ODBA 1PSBA 4M2OA 3WNXB 3GOFA 2Q4UA 5HKYA 1TRFA 3EK7A 5D7FA 3D73A 1KK7Y 1L2OB 2EGDA 2O5GA 2CCMA 2WCMA 2PASA 1PK0D 1UWOA 2Y1NA 1WRLA 1WY9A 3BOWB 3EVUA 3I5FC 2BBMA 4HSZA 2LUXA 4XJKB 5CSNA 2LC5A 1KFUL 1KSOA 1UHNA 1KFXS 2KGBC 2LVJA 1DTLA 2KI4C 3FE8A 1IJ5A 2EHBA 1NP8A 3EKHA 4C0JA 1JFJA 3VROA 2A4JA 1B8RA 2BNXA 1YUSA 2O60A 3CR5X 2P70A 4MZJA 2OPOA 4UPGA 4P2YB 3S0EA 1B47A 1CB1A 1BJFA 2ZRSA 2I18A 4YGBB 1DQEA 3O4XA 3JTDC 1FF1A 5D69A 3BFHA 1B1GA 3AKAA 1DJXA 3TUYB 4PALA 2E6WA 3I5IB 3R1VA 5AXIA 5AFPA 1JC2A 1CDPA 2BL0C 2QEOA 4YGDB 1B9AA 3EKJA 2JTTA 2M1KB 5F6TA 5B8IB 1JBAA 2L5XB 1AVSA 1A2XA 2I2RE 2SCPA 1XFWO 1QLKA 4QJ3B 1F54A 1BMOA 1K9UA 4FQTA 4XYNA 1BR4B 3BYAA 1TN4A 3E3RA 1NCYA 4OZDA 4PCWA 2LMVA 4DS7A 2IS9A 4WQ2A 4DCKA 1QLSA 1WDCB 3ICBA 3O78A 1OW4A 2KNEA 2LMUA 2M7NA 1CMGA 1AJ4A 1U5IA 2EC6B 1F8HA 3K21A 1RFJA 4QJ4B 1NCZA 3D0YB 3M0WA 4ORAB 1OE9B 1U5IB 3AAKA 1J7OA 1XFVO 3I5GB 1P28A 2M9GA 1XFZO 3I5HC 1NSHA 2LUCA 2M29A 1CFDA 3CABA 4DRWA 1KFXL 3SIAA 1J1EA 1XYDA 4MEWA 1RK9A 3S0AA 2BAPA 3AAJA 1KQVA 2ISDA 2MHHA 1QWVA 2M1UA 4GFTA 1TNWA 1E8AA 2WOSA 4CIDA 2BCXA 2BECA 2JT8A 1KK8B 3PJIA 3FWCA 2QDIA 3KPXA 1LXFC 5I94A 4I5LB 1KK7Z 1IKUA 2K7DA 2BE4A 2PALA 3CR4X 1DF0A 3CGAA 3R72A 1S6JA 1KWOC 2LP2A 2FOTA 1B7TY 1OOGA 2KFGA 4GUKA 2HF5A 3DY9A 1SW8A 2F3YA 1YVHA 4MN0A 1UURA 3BXKA 2QEHA 2LANA 2FCEA 3BFAA 2Y1MA 4INWA 1EJ3A 3DZTA 2MRDA 2LE9B 2ZN9A 5I2OA 2ERBA 2LVKA 3I5IC 3OGNA 2LMTA 1KCYA 3B88A 2KAYA 3BUXB 1GGZA 1FPWA 2CXJA 1IG5A 2QEVA 3EG5B 1BG1A 3FIAA 4AQIA 2WC5A 1J1DA 3WHUB 1J55A 4GGNA 1SBJA 3OBVA 3PM8A 2LHLA 1Y0VH 5TNCA 5J3XA 5IBWA 3EK4A 1F4OA 1N2DA 2L2EA 3TDIA 1NWDA 2HQWA 2LNKA 5EL2A 1G33A 3PN7C 4DUQA 2OS8C 1QV0A 1CFCA 4KYNA 4N1FA 3SG3A 2MAZA 1MXEA 1Q80A 1QX2A 1S6IA 1ALWA 1YRTB 4USLA 3VGOA 2PMYA 3D74A 3S0FA 1V1FA 2BE6A 2JXCA 1MXLC 4YRUA 1IRJA 1RROA 1HT9A 1QIWA 4NDCA 3R1OA 2PSRA 3TS5C 1DMOA 1SL9A 2M8UA 3BOWA 3SG2A 3JVTB 1Z4HA 2Y4QA 2K2FA 1M31A 4PHKA 3CZ1A 1ZUZA 3KO0A 4PT1A 1NIWA 3LLEA 1DVIA 3DVJA 1CNPA 2QEBA 1RWYA 2H2KA 2KAVA 4C0LA 4NDDA 1FI5A 1D1OA 2CTNA 1CFPA 2LAPA 5AERA 1LKJA 3IF7A 2CBLA 1UHIA 1SR6C 1K2HA 2ZN8A 3CTNA 3UNWA 2WORA 1RECA 1K93D 2KHNA 1XK4A 2L50A 5CSIA 2VRGA 3KHEA 4MRYA 2M0RA 4OKHA 1WRZA 4MLWA 2JT0A 1MUXA 2G9BA 4U8DA 3OX6A 3DYEA 4N5XA 2MBXA 1ALVA 1ZMZA 2MLEC 3CZ2A 3S0DA 1JF0A 3TZ1A 1TUJA 1ZOTB 5I2QA 1JF2A 4BY4A 3L4AA 2KI6C 5HKWA 1YTZC 1CLMA 1OZOA 3LCPC 3DVKA 3D78A 4F7FA 1IGVA 2JXLA 5GQQC 1PVAA 2MA2A 2P71A 3EVRA 2WCHA 2BCAA 1M46A 4M2PA
chains in the Genus database with same CATH topology
2P6BB 4MRXA 4TNCA 3SG5A 1NX0A 2KFHA 2JZIA 1G4YR 4DIRA 1K9PA 4GGFA 1XO5A 2Q91A 3OB1B 2I94A 1K95A 4MVFA 1LA3A 4FTGA 2LLTA 1XA5A 4YGEB 3SG6A 2LM5A 2KOTA 4PHMA 1X02A 3C1VA 1NX1A 1QATA 1NCXA 2WC8A 3D0YA 3PATA 3ZNIA 2L98A 3CZTX 3HX4A 1IQ3A 4YBHB 5K89A 1AK8A 2KYCA 4PE4A 1XFUO 3O2PA 4OV2A 1BR1B 5BPJA 1A29A 3TDUA 1F71A 3GK2A 2KQYA 1KQMB 4L9MA 4PE7A 3QRXA 1OOJA 4HREE 1DT7B 1EL4A 1UHKA 1DJGA 1L2OC 3FWBA 4GPLB 2NZ0A 1J7QA 1NX2A 3PSRA 1S5GZ 1NX3A 2KI6D 4I5JA 4WQ3A 5HLVA 5DKRA 1PALA 2AMIA 3VRRA 1SNLA 4M2QA 1N65A 2K7OA 1KSMA 3A4UB 3BQ3A 1JSAA 2PVBA 3IQQA 1Y6WA 4I5KA 1CDMA 5HKZA 4R1EA 2LLUA 3LL8B 1DJIA 1TNXA 3RLZA 4A4CA 5G08A 2KI4B 1AJ5A 1A75B 1XK4C 2WCFA 3BUWB 1SYMA 1IJ6A 1PVBA 2BCBA 1CMFA 1B8LA 2QACA 1NYAA 2JNFA 4MZLA 2M3WA 3TUYC 1WLZA 1SRAA 4A4BA 3KEVA 2TN4A 3JTDB 4YI8A 1C07A 4OR9B 3SIBA 3F45A 2OTGB 1CDLA 3OHMB 1F4QA 2JPTA 1YUTA 3SG4A 1S3PA 1DJWA 3HCMA 2DOQA 2KYFA 1CLBA 3PFVA 2FJUB 2BL0B 1SK6D 1BLQA 3MSEB 5ER4X 2MLFC 4MSPA 2ZNEA 2QPTA 3PLFB 1VRKA 4MBEA 4GGFC 4YGCB 2CNPA 1MHOA 1Y1AA 2AUCA 1L7ZA 1RJVA 1SKTA 1WDCC 5AANA 1AP4A 4QJ5B 2LCPA 2AAOA 2EC6C 3OX5A 1OQPA 2KSPA 3NSOA 2M97A 2HQ8A 3VRPA 4F0ZB 4P5OE 3OB2B 1Y1UA 4IL1A 5I2LA 3O6BA 3CS1A 3I5GC 2LV7A 2SASA 3CR2A 4JQ0D 1SCVA 3GK4X 2L51A 1TCOB 1KQMC 1LVCD 2BKIB 1K90D 1SL8A 1IH0A 2GGMA 3CWGA 4D1EA 3EK8A 1FBVA 2LVIA 1KK8C 1S1EA 1C7VA 3I5HB 1A4PA 2I7AA 1PULA 1OMDA 1XFYO 4CPVA 5KSZA 3OP0A 4JWQA 3DF0A 2H61A 2JU0A 2LHIA 5AEQA 1S36A 2JRFA 4ICBA 1OZSA 2NXQA 4GBAA 2F2OA 1K8UA 3DF0B 5HLOA 3TDZA 1J7RA 1M39A 1SCMB 1SL7A 2K0JA 4ZCUA 1V1GA 1TCFA 2JT3A 2LP3A 3GK1A 2K7BA 3LK1A 1B8CA 1MR8A 2KBMA 5CSFA 1B7TZ 4ORBB 4GNKB 2L0PA 1QV1A 3SG7A 1H8BA 1KWOB 2R2IA 1OSAA 1R2UA 3O4YA 1CDNA 3LK0A 1CM4A 1BU3A 1K94A 1QVIY 2HETA 5JJGA 2HPSA 3EVVA 1DJYA 5DKQA 2L4HA 1DGVA 1GQMA 4BY5A 3D10A 2JWWA 1M63B 3DVEA 4HRHA 4AOMA 1UHJA 2KAXA 1BOCA 4E68A 1Y1XA 1FI6A 3PALA 4N1GA 3NSLA 1S26D 1BF5A 1W7IB 2OTGC 2KDHA 5CPVA 2Y5IA 2RGIA 1TNQA 1EXRA 4HRGA 2V53A 3BUOB 1GGWA 1QASA 1QJTA 2D8NA 2GV5A 4PHJA 4CLNA 1G8IA 1F70A 2K8MB 2LVVA 2KFFA 4PE0A 5I8NA 2F33A 2WCBA 4OVNF 1YX8A 1J7PA 1CTRA 1YRUB 3PN7B 4I5NB 1JWDA 2OS8B 1GJYA 1LA0A 5PALA 4PDZA 4WRIA 2BBNA 2F8PA 1RTP1 3JVTC 1AHRA 1ZFSA 1IWQA 1TTXA 1ZACA 2WNDA 2F3ZA 1QS7A 1YX7A 2FCDA 2E30A 3TS5B 3BUMB 2PRUA 2ZNDA 4ETOA 1PSRA 1H4BA 4FQOA 5ER5A 2B1UA 1QIVA 3I5FB 1WLMA 5CSJA 2MJWB 1EG3A 2ZFDA 1R6PA 2JTZA 1MF8B 5KU1A 4JPZB 1A75A 2WCEA 1FW4A 1LINA 1UP5A 1N0YA 1SPYA 5KTYA 1YR5A 2M7LA 4Q04A 1NUBA 1DJHA 2KQ6A 4ZCVA 2KBIA 2H61C 1SCMC 1SR6B 3WXAA 1MWNA 2NCPA 1UHHA 3DVMA 2JOJA 3VRNA 1CM1A 5FYXA 1UUSA 3CLNA 1KFUS 2BKHB 1AUIB 1EG4A 1XFXO 3NSKA 1YUUA 4NDBA 1XVJA 2K7CA 1M45A 1CFFA 1DGUA 1QXPA 1DF0B 2COLB 1C7WA 1CKKA 3DD4A 2ZRTA 1TOPA 1BT6A 2G2BA 3WHTB 2JNXA 1K9KA 3SJSA 2K2AA 4YGAA 1OMRA 1QVIZ 1YVLA 2LLSA 2M49B 5DKNA 1SMGA 4AQJA 4CFRA 2K61A 5JOLA 4YI9A 1EH2A 1MQ1A 3A8RA 1TNPA 1OMVA 3IQOA 4ORCB 4C0KA 2JULA 3ZWHA 2ZKMX 1QTXA 2CT9A 2GGZA 4MZKA 1WRKA 3FS7A 1QX7A 3RM1A 1DJZA 5HYDA 4NQGA 1S6CA 1JFKA 2JQ6A 3VRQA 1BODA 1A03A 4PHNA 2KGRA 1QX5B 1IQ5A 3KF9A 1PRWA 2JC2A 4PE1A 3BUNB 1HQVA 2L4IA 4OCIA 3NXAA 4GAOA 2F2PA 3NSIA 2NCOA 4CFQA 1TIZA 2NLNA 4XJKA 3H4SE 1K96A 3AKBA 1NPQA 1F55A 1B4CA 1SY9A 1YURA 1W7JB 1S5GY 1CLLA 1JUOA 1ODBA 1PSBA 4M2OA 3WNXB 3GOFA 2Q4UA 5HKYA 1TRFA 3EK7A 5D7FA 1KK7Y 1L2OB 2EGDA 2O5GA 2CCMA 2Y1NA 2PASA 1PK0D 1UWOA 3EVUA 1WRLA 1WY9A 3BOWB 3I5FC 2BBMA 4HSZA 2LUXA 4XJKB 5CSNA 2LC5A 1KFUL 1KSOA 1UHNA 1KFXS 2KGBC 2LVJA 1DTLA 2KI4C 1IJ5A 2EHBA 1NP8A 3EKHA 4C0JA 1JFJA 3VROA 2A4JA 1B8RA 2O60A 1YUSA 3CR5X 4MZJA 4UPGA 2OPOA 4P2YB 1B47A 1CB1A 1BJFA 2ZRSA 2I18A 4YGBB 3JTDC 1FF1A 5D69A 1B1GA 3AKAA 1DJXA 3TUYB 4PALA 2E6WA 3I5IB 5AFPA 5AXIA 1JC2A 1CDPA 2BL0C 4YGDB 1B9AA 3EKJA 2JTTA 2M1KB 5F6TA 5B8IB 1JBAA 2L5XB 1AVSA 1A2XA 2I2RE 2SCPA 1XFWO 1QLKA 4QJ3B 1F54A 1BMOA 1K9UA 4XYNA 1BR4B 3BYAA 1TN4A 3E3RA 1NCYA 4PCWA 2LMVA 4DS7A 2IS9A 4WQ2A 4DCKA 1QLSA 1WDCB 3ICBA 3O78A 2KNEA 2LMUA 2M7NA 1CMGA 1AJ4A 1U5IA 2EC6B 1F8HA 3K21A 1RFJA 4QJ4B 1NCZA 3D0YB 3M0WA 4ORAB 1OE9B 1U5IB 3AAKA 1J7OA 1XFVO 3I5GB 2M9GA 1XFZO 3I5HC 1NSHA 2LUCA 2M29A 1CFDA 4DRWA 1KFXL 3SIAA 1J1EA 1XYDA 4MEWA 1RK9A 3AAJA 1KQVA 2ISDA 2MHHA 2M1UA 4GFTA 1TNWA 1E8AA 2WOSA 4CIDA 2BCXA 2BECA 2JT8A 1KK8B 3FWCA 3KPXA 1LXFC 4I5LB 1KK7Z 1IKUA 2K7DA 2BE4A 2PALA 3CR4X 1DF0A 3CGAA 1S6JA 1KWOC 2LP2A 2FOTA 1B7TY 2KFGA 4GUKA 2HF5A 1SW8A 2F3YA 1YVHA 4MN0A 1UURA 3BXKA 2LANA 2FCEA 2Y1MA 1EJ3A 2MRDA 2LE9B 2ZN9A 5I2OA 2LVKA 3I5IC 2LMTA 1KCYA 3BUXB 2KAYA 1GGZA 1FPWA 2CXJA 1IG5A 1BG1A 3FIAA 4AQIA 1J1DA 3WHUB 1J55A 4GGNA 1SBJA 3PM8A 2LHLA 1Y0VH 5TNCA 5J3XA 5IBWA 3EK4A 1F4OA 1N2DA 2L2EA 3TDIA 1NWDA 2HQWA 2LNKA 1G33A 3PN7C 4DUQA 2OS8C 1QV0A 1CFCA 4N1FA 3SG3A 2MAZA 1MXEA 1Q80A 1QX2A 1S6IA 1ALWA 1YRTB 4USLA 3VGOA 2PMYA 1V1FA 2BE6A 2JXCA 1MXLC 4YRUA 1IRJA 1RROA 1HT9A 1QIWA 4NDCA 2PSRA 3TS5C 1DMOA 1SL9A 2M8UA 3BOWA 3SG2A 3JVTB 2Y4QA 2K2FA 1M31A 4PHKA 1ZUZA 3KO0A 1NIWA 3LLEA 1DVIA 3DVJA 1CNPA 1RWYA 2H2KA 2KAVA 4C0LA 4NDDA 1FI5A 1D1OA 2CTNA 1CFPA 2LAPA 5AERA 1LKJA 3IF7A 2CBLA 1UHIA 1SR6C 1K2HA 2ZN8A 3CTNA 2WORA 1RECA 1K93D 2KHNA 1XK4A 2L50A 5CSIA 2VRGA 3KHEA 4MRYA 2M0RA 4OKHA 1WRZA 4MLWA 2JT0A 1MUXA 2G9BA 4U8DA 3OX6A 4N5XA 2MBXA 1ALVA 1ZMZA 2MLEC 1JF0A 3TZ1A 1ZOTB 5I2QA 1JF2A 4BY4A 2KI6C 5HKWA 1YTZC 1CLMA 1OZOA 3LCPC 3DVKA 1IGVA 2JXLA 5GQQC 1PVAA 2MA2A 3EVRA 2BCAA 1M46A 4M2PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2P6B B;  4MRX A;  4TNC A;  3SG5 A;  1NX0 A;  2KFH A;  2JZI A;  1G4Y R;  4DIR A;  1K9P A;  4GGF A;  1XO5 A;  2Q91 A;  3OB1 B;  2I94 A;  1K95 A;  4MVF A;  1LA3 A;  4FTG A;  2LLT A;  1XA5 A;  4YGE B;  3SG6 A;  2LM5 A;  2KOT A;  4PHM A;  1X02 A;  3C1V A;  1NX1 A;  1QAT A;  1NCX A;  2WC8 A;  3D0Y A;  3PAT A;  3ZNI A;  2L98 A;  3CZT X;  3HX4 A;  1IQ3 A;  4YBH B;  5K89 A;  1AK8 A;  2KYC A;  4PE4 A;  1XFU O;  3O2P A;  4OV2 A;  1BR1 B;  5BPJ A;  1A29 A;  3TDU A;  1F71 A;  3GK2 A;  2KQY A;  1KQM B;  4L9M A;  4PE7 A;  3QRX A;  1OOJ A;  4HRE E;  1DT7 B;  1EL4 A;  1UHK A;  1DJG A;  1L2O C;  3FWB A;  4GPL B;  2NZ0 A;  1J7Q A;  1NX2 A;  3PSR A;  1S5G Z;  1NX3 A;  2KI6 D;  4I5J A;  4WQ3 A;  5HLV A;  5DKR A;  1PAL A;  2AMI A;  3VRR A;  1SNL A;  4M2Q A;  1N65 A;  2K7O A;  1KSM A;  3A4U B;  3BQ3 A;  1JSA A;  2PVB A;  3IQQ A;  1Y6W A;  4I5K A;  1CDM A;  5HKZ A;  4R1E A;  2LLU A;  3LL8 B;  1DJI A;  1TNX A;  3RLZ A;  4A4C A;  5G08 A;  2KI4 B;  1AJ5 A;  1A75 B;  1XK4 C;  2WCF A;  3BUW B;  1SYM A;  1IJ6 A;  1PVB A;  2BCB A;  1CMF A;  1B8L A;  2QAC A;  1NYA A;  2JNF A;  4MZL A;  2M3W A;  3TUY C;  1WLZ A;  1SRA A;  4A4B A;  3KEV A;  2TN4 A;  3JTD B;  4YI8 A;  1C07 A;  4OR9 B;  3SIB A;  3F45 A;  2OTG B;  1CDL A;  3OHM B;  1F4Q A;  2JPT A;  1YUT A;  3SG4 A;  1S3P A;  1DJW A;  3HCM A;  2DOQ A;  2KYF A;  1CLB A;  3PFV A;  2FJU B;  2BL0 B;  1SK6 D;  1BLQ A;  3MSE B;  5ER4 X;  2MLF C;  4MSP A;  2ZNE A;  2QPT A;  3PLF B;  1VRK A;  4MBE A;  4GGF C;  4YGC B;  2CNP A;  1MHO A;  1Y1A A;  2AUC A;  1L7Z A;  1RJV A;  1SKT A;  1WDC C;  5AAN A;  1AP4 A;  4QJ5 B;  2LCP A;  2AAO A;  2EC6 C;  3OX5 A;  1OQP A;  2KSP A;  3NSO A;  2M97 A;  2HQ8 A;  3VRP A;  4F0Z B;  4P5O E;  3OB2 B;  1Y1U A;  4IL1 A;  5I2L A;  3O6B A;  3CS1 A;  3I5G C;  2LV7 A;  2SAS A;  3CR2 A;  4JQ0 D;  1SCV A;  3GK4 X;  2L51 A;  1TCO B;  1KQM C;  1LVC D;  2BKI B;  1K90 D;  1SL8 A;  1IH0 A;  2GGM A;  3CWG A;  4D1E A;  3EK8 A;  1FBV A;  2LVI A;  1KK8 C;  1S1E A;  1C7V A;  3I5H B;  1A4P A;  2I7A A;  1PUL A;  1OMD A;  1XFY O;  4CPV A;  5KSZ A;  3OP0 A;  4JWQ A;  3DF0 A;  2H61 A;  2JU0 A;  2LHI A;  5AEQ A;  1S36 A;  2JRF A;  4ICB A;  1OZS A;  2NXQ A;  4GBA A;  2F2O A;  1K8U A;  3DF0 B;  5HLO A;  3TDZ A;  1J7R A;  1M39 A;  1SCM B;  1SL7 A;  2K0J A;  4ZCU A;  1V1G A;  1TCF A;  2JT3 A;  2LP3 A;  3GK1 A;  2K7B A;  3LK1 A;  1B8C A;  1MR8 A;  2KBM A;  5CSF A;  1B7T Z;  4ORB B;  4GNK B;  2L0P A;  1QV1 A;  3SG7 A;  1H8B A;  1KWO B;  2R2I A;  1OSA A;  1R2U A;  3O4Y A;  1CDN A;  3LK0 A;  1CM4 A;  1BU3 A;  1K94 A;  1QVI Y;  2HET A;  5JJG A;  2HPS A;  3EVV A;  1DJY A;  5DKQ A;  2L4H A;  1DGV A;  1GQM A;  4BY5 A;  3D10 A;  2JWW A;  1M63 B;  3DVE A;  4HRH A;  4AOM A;  1UHJ A;  2KAX A;  1BOC A;  4E68 A;  1Y1X A;  1FI6 A;  3PAL A;  4N1G A;  3NSL A;  1S26 D;  1BF5 A;  1W7I B;  2OTG C;  2KDH A;  5CPV A;  2Y5I A;  2RGI A;  1TNQ A;  1EXR A;  4HRG A;  2V53 A;  3BUO B;  1GGW A;  1QAS A;  1QJT A;  2D8N A;  2GV5 A;  4PHJ A;  4CLN A;  1G8I A;  1F70 A;  2K8M B;  2LVV A;  2KFF A;  4PE0 A;  5I8N A;  2F33 A;  2WCB A;  4OVN F;  1YX8 A;  1J7P A;  1CTR A;  1YRU B;  3PN7 B;  4I5N B;  1JWD A;  2OS8 B;  1GJY A;  1LA0 A;  5PAL A;  4PDZ A;  4WRI A;  2BBN A;  2F8P A;  1RTP 1;  3JVT C;  1AHR A;  1ZFS A;  1IWQ A;  1TTX A;  1ZAC A;  2WND A;  2F3Z A;  1QS7 A;  1YX7 A;  2FCD A;  2E30 A;  3TS5 B;  3BUM B;  2PRU A;  2ZND A;  4ETO A;  1PSR A;  1H4B A;  4FQO A;  5ER5 A;  2B1U A;  1QIV A;  3I5F B;  1WLM A;  5CSJ A;  2MJW B;  1EG3 A;  2ZFD A;  1R6P A;  2JTZ A;  1MF8 B;  5KU1 A;  4JPZ B;  1A75 A;  2WCE A;  1FW4 A;  1LIN A;  1UP5 A;  1N0Y A;  1SPY A;  5KTY A;  1YR5 A;  2M7L A;  4Q04 A;  1NUB A;  1DJH A;  2KQ6 A;  4ZCV A;  2KBI A;  2H61 C;  1SCM C;  1SR6 B;  3WXA A;  1MWN A;  2NCP A;  1UHH A;  3DVM A;  2JOJ A;  3VRN A;  1CM1 A;  5FYX A;  1UUS A;  3CLN A;  1KFU S;  2BKH B;  1AUI B;  1EG4 A;  1XFX O;  3NSK A;  1YUU A;  4NDB A;  1XVJ A;  2K7C A;  1M45 A;  1CFF A;  1DGU A;  1QXP A;  1DF0 B;  2COL B;  1C7W A;  1CKK A;  3DD4 A;  2ZRT A;  1TOP A;  1BT6 A;  2G2B A;  3WHT B;  2JNX A;  1K9K A;  3SJS A;  2K2A A;  4YGA A;  1OMR A;  1QVI Z;  1YVL A;  2LLS A;  2M49 B;  5DKN A;  1SMG A;  4AQJ A;  4CFR A;  2K61 A;  5JOL A;  4YI9 A;  1EH2 A;  1MQ1 A;  3A8R A;  1TNP A;  1OMV A;  3IQO A;  4ORC B;  4C0K A;  2JUL A;  3ZWH A;  2ZKM X;  1QTX A;  2CT9 A;  2GGZ A;  4MZK A;  1WRK A;  3FS7 A;  1QX7 A;  3RM1 A;  1DJZ A;  5HYD A;  4NQG A;  1S6C A;  1JFK A;  2JQ6 A;  3VRQ A;  1BOD A;  1A03 A;  4PHN A;  2KGR A;  1QX5 B;  1IQ5 A;  3KF9 A;  1PRW A;  2JC2 A;  4PE1 A;  3BUN B;  1HQV A;  2L4I A;  4OCI A;  3NXA A;  4GAO A;  2F2P A;  3NSI A;  2NCO A;  4CFQ A;  1TIZ A;  2NLN A;  4XJK A;  3H4S E;  1K96 A;  3AKB A;  1NPQ A;  1F55 A;  1B4C A;  1SY9 A;  1YUR A;  1W7J B;  1S5G Y;  1CLL A;  1JUO A;  1ODB A;  1PSB A;  4M2O A;  3WNX B;  3GOF A;  2Q4U A;  5HKY A;  1TRF A;  3EK7 A;  5D7F A;  1KK7 Y;  1L2O B;  2EGD A;  2O5G A;  2CCM A;  2Y1N A;  2PAS A;  1PK0 D;  1UWO A;  3EVU A;  1WRL A;  1WY9 A;  3BOW B;  3I5F C;  2BBM A;  4HSZ A;  2LUX A;  4XJK B;  5CSN A;  2LC5 A;  1KFU L;  1KSO A;  1UHN A;  1KFX S;  2KGB C;  2LVJ A;  1DTL A;  2KI4 C;  1IJ5 A;  2EHB A;  1NP8 A;  3EKH A;  4C0J A;  1JFJ A;  3VRO A;  2A4J A;  1B8R A;  2O60 A;  1YUS A;  3CR5 X;  4MZJ A;  4UPG A;  2OPO A;  4P2Y B;  1B47 A;  1CB1 A;  1BJF A;  2ZRS A;  2I18 A;  4YGB B;  3JTD C;  1FF1 A;  5D69 A;  1B1G A;  3AKA A;  1DJX A;  3TUY B;  4PAL A;  2E6W A;  3I5I B;  5AFP A;  5AXI A;  1JC2 A;  1CDP A;  2BL0 C;  4YGD B;  1B9A A;  3EKJ A;  2JTT A;  2M1K B;  5F6T A;  5B8I B;  1JBA A;  2L5X B;  1AVS A;  1A2X A;  2I2R E;  2SCP A;  1XFW O;  1QLK A;  4QJ3 B;  1F54 A;  1BMO A;  1K9U A;  4XYN A;  1BR4 B;  3BYA A;  1TN4 A;  3E3R A;  1NCY A;  4PCW A;  2LMV A;  4DS7 A;  2IS9 A;  4WQ2 A;  4DCK A;  1QLS A;  1WDC B;  3ICB A;  3O78 A;  2KNE A;  2LMU A;  2M7N A;  1CMG A;  1AJ4 A;  1U5I A;  2EC6 B;  1F8H A;  3K21 A;  1RFJ A;  4QJ4 B;  1NCZ A;  3D0Y B;  3M0W A;  4ORA B;  1OE9 B;  1U5I B;  3AAK A;  1J7O A;  1XFV O;  3I5G B;  2M9G A;  1XFZ O;  3I5H C;  1NSH A;  2LUC A;  2M29 A;  1CFD A;  4DRW A;  1KFX L;  3SIA A;  1J1E A;  1XYD A;  4MEW A;  1RK9 A;  3AAJ A;  1KQV A;  2ISD A;  2MHH A;  2M1U A;  4GFT A;  1TNW A;  1E8A A;  2WOS A;  4CID A;  2BCX A;  2BEC A;  2JT8 A;  1KK8 B;  3FWC A;  3KPX A;  1LXF C;  4I5L B;  1KK7 Z;  1IKU A;  2K7D A;  2BE4 A;  2PAL A;  3CR4 X;  1DF0 A;  3CGA A;  1S6J A;  1KWO C;  2LP2 A;  2FOT A;  1B7T Y;  2KFG A;  4GUK A;  2HF5 A;  1SW8 A;  2F3Y A;  1YVH A;  4MN0 A;  1UUR A;  3BXK A;  2LAN A;  2FCE A;  2Y1M A;  1EJ3 A;  2MRD A;  2LE9 B;  2ZN9 A;  5I2O A;  2LVK A;  3I5I C;  2LMT A;  1KCY A;  3BUX B;  2KAY A;  1GGZ A;  1FPW A;  2CXJ A;  1IG5 A;  1BG1 A;  3FIA A;  4AQI A;  1J1D A;  3WHU B;  1J55 A;  4GGN A;  1SBJ A;  3PM8 A;  2LHL A;  1Y0V H;  5TNC A;  5J3X A;  5IBW A;  3EK4 A;  1F4O A;  1N2D A;  2L2E A;  3TDI A;  1NWD A;  2HQW A;  2LNK A;  1G33 A;  3PN7 C;  4DUQ A;  2OS8 C;  1QV0 A;  1CFC A;  4N1F A;  3SG3 A;  2MAZ A;  1MXE A;  1Q80 A;  1QX2 A;  1S6I A;  1ALW A;  1YRT B;  4USL A;  3VGO A;  2PMY A;  1V1F A;  2BE6 A;  2JXC A;  1MXL C;  4YRU A;  1IRJ A;  1RRO A;  1HT9 A;  1QIW A;  4NDC A;  2PSR A;  3TS5 C;  1DMO A;  1SL9 A;  2M8U A;  3BOW A;  3SG2 A;  3JVT B;  2Y4Q A;  2K2F A;  1M31 A;  4PHK A;  1ZUZ A;  3KO0 A;  1NIW A;  3LLE A;  1DVI A;  3DVJ A;  1CNP A;  1RWY A;  2H2K A;  2KAV A;  4C0L A;  4NDD A;  1FI5 A;  1D1O A;  2CTN A;  1CFP A;  2LAP A;  5AER A;  1LKJ A;  3IF7 A;  2CBL A;  1UHI A;  1SR6 C;  1K2H A;  2ZN8 A;  3CTN A;  2WOR A;  1REC A;  1K93 D;  2KHN A;  1XK4 A;  2L50 A;  5CSI A;  2VRG A;  3KHE A;  4MRY A;  2M0R A;  4OKH A;  1WRZ A;  4MLW A;  2JT0 A;  1MUX A;  2G9B A;  4U8D A;  3OX6 A;  4N5X A;  2MBX A;  1ALV A;  1ZMZ A;  2MLE C;  1JF0 A;  3TZ1 A;  1ZOT B;  5I2Q A;  1JF2 A;  4BY4 A;  2KI6 C;  5HKW A;  1YTZ C;  1CLM A;  1OZO A;  3LCP C;  3DVK A;  1IGV A;  2JXL A;  5GQQ C;  1PVA A;  2MA2 A;  3EVR A;  2BCA A;  1M46 A;  4M2P A; 
#chains in the Genus database with same CATH topology
 2P6B B;  4MRX A;  2GTE A;  4TNC A;  3SG5 A;  1NX0 A;  1LS8 A;  2KFH A;  2JZI A;  1G4Y R;  4DIR A;  1K9P A;  4GGF A;  1XO5 A;  2Q91 A;  3OB1 B;  2I94 A;  1K95 A;  4MVF A;  1LA3 A;  4FTG A;  2LLT A;  1XA5 A;  4JD9 A;  4YGE B;  2LM5 A;  2KOT A;  4PHM A;  3SG6 A;  1X02 A;  1XFR A;  1NX1 A;  1QAT A;  3C1V A;  1NCX A;  2WC8 A;  3D0Y A;  3PAT A;  3ZNI A;  2L98 A;  3CZT X;  3HX4 A;  1IQ3 A;  4YBH B;  5K89 A;  1AK8 A;  2KYC A;  4PE4 A;  1XFU O;  3O2P A;  4OV2 A;  1BR1 B;  5BPJ A;  1A29 A;  3TDU A;  1F71 A;  3GK2 A;  2KQY A;  1KQM B;  1OOH A;  4L9M A;  4PE7 A;  3QRX A;  1OOJ A;  4HRE E;  1DT7 B;  1EL4 A;  1UHK A;  1DJG A;  1L2O C;  3FWB A;  4GPL B;  3SS4 A;  2NZ0 A;  1J7Q A;  2KLE A;  1NX2 A;  3PSR A;  1GM0 A;  1S5G Z;  1NX3 A;  2KI6 D;  4I5J A;  4WQ3 A;  5HLV A;  5DKR A;  1PAL A;  2AMI A;  3VRR A;  1SNL A;  4M2Q A;  1N65 A;  2K7O A;  1KSM A;  3A4U B;  3BQ3 A;  3SS5 A;  3DXL A;  1JSA A;  2PVB A;  3IQQ A;  1Y6W A;  3D76 A;  4I5K A;  3Q8I A;  1CDM A;  2PYQ A;  5HKZ A;  4R1E A;  2LLU A;  5FI6 A;  3LL8 B;  1DJI A;  1TNX A;  3RLZ A;  4A4C A;  5G08 A;  2KI4 B;  1AJ5 A;  1A75 B;  1XK4 C;  1ORG A;  2WCF A;  3BUW B;  1SYM A;  1IJ6 A;  1PVB A;  2BCB A;  5D3O A;  1B8L A;  1CMF A;  2QAC A;  2JPO A;  1NYA A;  2JNF A;  4MZL A;  2M3W A;  3TUY C;  1WLZ A;  1SRA A;  4A4B A;  3KEV A;  3D75 A;  3K1E A;  3FE9 A;  2TN4 A;  1TUZ A;  3JTD B;  4YI8 A;  1C07 A;  2WC6 A;  4OR9 B;  3SIB A;  3F45 A;  2OTG B;  1CDL A;  3OHM B;  2WCJ A;  1F4Q A;  1DEK A;  1YUT A;  2JPT A;  3SG4 A;  1S3P A;  1DJW A;  3HCM A;  4INX A;  2DOQ A;  2KYF A;  1CLB A;  1C3Z A;  3PFV A;  2FJU B;  2BL0 B;  1SK6 D;  1BLQ A;  3MSE B;  5ER4 X;  2MLF C;  4MSP A;  2ZNE A;  2QPT A;  3PLF B;  1VRK A;  3D77 A;  4MBE A;  4GGF C;  4YGC B;  2CNP A;  1MHO A;  1Y1A A;  1L7Z A;  1WDC C;  1RJV A;  1SKT A;  2AUC A;  5AAN A;  1AP4 A;  4QJ5 B;  2LCP A;  2AAO A;  2EC6 C;  3OX5 A;  1OQP A;  2KSP A;  3NSO A;  2M97 A;  2HQ8 A;  3VRP A;  4F0Z B;  4P5O E;  1IIO A;  3OB2 B;  1Y1U A;  4IL1 A;  5I2L A;  2L5Y A;  3O6B A;  3CS1 A;  3I5G C;  2LV7 A;  2SAS A;  3CR2 A;  4JQ0 D;  1SCV A;  3GK4 X;  2L51 A;  1TCO B;  1KQM C;  1LVC D;  2BKI B;  1K90 D;  1SL8 A;  1IH0 A;  2GGM A;  3CWG A;  4D1E A;  3EK8 A;  1FBV A;  2LVI A;  1KK8 C;  1S1E A;  1C7V A;  3I5H B;  5FI7 A;  1A4P A;  2I7A A;  1PUL A;  1OMD A;  3CYZ A;  1XFY O;  3BFB A;  4CPV A;  5KSZ A;  3OP0 A;  4JWQ A;  3DF0 A;  1OOF A;  2H61 A;  4IJ7 A;  2JU0 A;  2LHI A;  5AEQ A;  1S36 A;  2JRF A;  4ICB A;  1OZS A;  2NXQ A;  4GBA A;  2F2O A;  1K8U A;  3DF0 B;  5HLO A;  3TDZ A;  1J7R A;  1M39 A;  1SCM B;  1SL7 A;  5FI2 A;  2K0J A;  2L2C A;  4ZCU A;  1V1G A;  1TCF A;  2JT3 A;  2LP3 A;  3GK1 A;  2K7B A;  3LK1 A;  1B8C A;  1MR8 A;  2KBM A;  5CSF A;  1B7T Z;  4ORB B;  4GNK B;  2L0P A;  1QV1 A;  3SG7 A;  1H8B A;  1KWO B;  2R2I A;  1OSA A;  1R2U A;  2YGU A;  3O4Y A;  1CDN A;  2PQL A;  1CM4 A;  3CDN A;  3LK0 A;  1BU3 A;  1BOD A;  1K94 A;  2H8V A;  1QVI Y;  2HET A;  5JJG A;  2HPS A;  3EVV A;  1DJY A;  5DKQ A;  2L4H A;  3S0B A;  1Z2C B;  1DGV A;  1GQM A;  4BY5 A;  3D10 A;  2JWW A;  1M63 B;  3DVE A;  4HRH A;  4AOM A;  2WCL A;  1UHJ A;  2KAX A;  1BOC A;  4E68 A;  1Y1X A;  3B7A A;  1FI6 A;  3FE6 A;  3PAL A;  3NSL A;  4N1G A;  1S26 D;  1BF5 A;  1W7I B;  2OTG C;  2KDH A;  5CPV A;  2Y5I A;  2RGI A;  1TNQ A;  1EXR A;  4HRG A;  2V53 A;  3RZS A;  3BUO B;  1GGW A;  1QAS A;  1QJT A;  2D8N A;  2GV5 A;  4PHJ A;  4CLN A;  1G8I A;  1F70 A;  2K8M B;  2LVV A;  2KFF A;  4PE0 A;  5I8N A;  2F33 A;  2WCB A;  4OVN F;  1YX8 A;  3NHI A;  1J7P A;  1CTR A;  1YRU B;  3PN7 B;  4I5N B;  1JWD A;  2OS8 B;  1GJY A;  1LA0 A;  5PAL A;  3S0G A;  4PDZ A;  4WRI A;  2BBN A;  2F8P A;  1RTP 1;  3JVT C;  3N7H A;  1AHR A;  1ZFS A;  1IWQ A;  1TTX A;  1ZAC A;  2WND A;  2F3Z A;  3B6X A;  1QS7 A;  1YX7 A;  5DIC A;  2FCD A;  3B86 A;  1SSE B;  2E30 A;  3TS5 B;  1DC1 A;  3BUM B;  2KPH A;  1W9Z A;  2PRU A;  2ZND A;  4ETO A;  1PSR A;  1H4B A;  4FQO A;  3UO9 A;  5ER5 A;  2B1U A;  1QIV A;  3I5F B;  1WLM A;  5CSJ A;  2MJW B;  1EG3 A;  2ZFD A;  1R6P A;  2JTZ A;  1MF8 B;  5KU1 A;  3NGV A;  1OOI X;  4JPZ B;  1A75 A;  2WCE A;  1FW4 A;  1LIN A;  1UP5 A;  1N0Y A;  1SPY A;  5KTY A;  1YR5 A;  3IVT A;  2M7L A;  4Q04 A;  1NUB A;  4JKT A;  1DJH A;  1T14 A;  2KQ6 A;  4ZCV A;  2KBI A;  2H61 C;  1SCM C;  1SR6 B;  3WXA A;  1MWN A;  2NCP A;  1UHH A;  3DVM A;  2JOJ A;  3VRN A;  1CM1 A;  5FYX A;  1UUS A;  3CLN A;  1KFU S;  3V2L A;  2BKH B;  1AUI B;  1EG4 A;  1XFX O;  3BJH A;  1YUU A;  3NSK A;  4NDB A;  1XVJ A;  2K7C A;  1M45 A;  1CFF A;  1DGU A;  1QXP A;  1DF0 B;  5HL1 A;  1TWO A;  2COL B;  3SS3 A;  1C7W A;  1CKK A;  3DD4 A;  2ZRT A;  1TOP A;  1BT6 A;  2G2B A;  2WCK A;  3WHT B;  2JNX A;  1K9K A;  3SJS A;  2K2A A;  4YGA A;  1OMR A;  1QVI Z;  1YVL A;  2LLS A;  2M49 B;  5DKN A;  1SMG A;  4AQJ A;  3L4L A;  4CFR A;  2K61 A;  3L47 A;  5JOL A;  4YI9 A;  1EH2 A;  1MQ1 A;  1DEL A;  2FJY A;  1TNP A;  3A8R A;  3NHT A;  1OMV A;  3IQO A;  4ORC B;  4C0K A;  2JUL A;  3ZWH A;  1C3Y A;  2ZKM X;  1QTX A;  2CT9 A;  2GGZ A;  4MZK A;  1WRK A;  3QME A;  3FS7 A;  1QX7 A;  3RM1 A;  1DJZ A;  5HYD A;  4NQG A;  1S6C A;  1JFK A;  2JQ6 A;  3R1P A;  3VRQ A;  1A03 A;  4PHN A;  2KGR A;  3CZ0 A;  1QX5 B;  1IQ5 A;  3KF9 A;  1PRW A;  2JC2 A;  4PE1 A;  3BUN B;  1HQV A;  2L4I A;  4OCI A;  3NXA A;  4GAO A;  2F2P A;  3NSI A;  2NCO A;  4CFQ A;  1TIZ A;  3PM2 A;  2NLN A;  2K60 A;  4XJK A;  3H4S E;  1K96 A;  3AKB A;  3B87 A;  1NPQ A;  3VB1 A;  1F55 A;  1B4C A;  2KLD A;  1SY9 A;  1YUR A;  1W7J B;  1S5G Y;  1CLL A;  1JUO A;  1ODB A;  1PSB A;  4M2O A;  3WNX B;  3GOF A;  2Q4U A;  5HKY A;  1TRF A;  3EK7 A;  5D7F A;  3D73 A;  1KK7 Y;  1L2O B;  2EGD A;  2O5G A;  2CCM A;  2WCM A;  2PAS A;  1PK0 D;  1UWO A;  2Y1N A;  1WRL A;  1WY9 A;  3BOW B;  3EVU A;  3I5F C;  2BBM A;  4HSZ A;  2LUX A;  4XJK B;  5CSN A;  2LC5 A;  1KFU L;  1KSO A;  1UHN A;  1KFX S;  2KGB C;  2LVJ A;  1DTL A;  2KI4 C;  3FE8 A;  1IJ5 A;  2EHB A;  1NP8 A;  3EKH A;  4C0J A;  1JFJ A;  3VRO A;  2A4J A;  1B8R A;  2BNX A;  1YUS A;  2O60 A;  3CR5 X;  2P70 A;  4MZJ A;  2OPO A;  4UPG A;  4P2Y B;  3S0E A;  1B47 A;  1CB1 A;  1BJF A;  2ZRS A;  2I18 A;  4YGB B;  1DQE A;  3O4X A;  3JTD C;  1FF1 A;  5D69 A;  3BFH A;  1B1G A;  3AKA A;  1DJX A;  3TUY B;  4PAL A;  2E6W A;  3I5I B;  3R1V A;  5AXI A;  5AFP A;  1JC2 A;  1CDP A;  2BL0 C;  2QEO A;  4YGD B;  1B9A A;  3EKJ A;  2JTT A;  2M1K B;  5F6T A;  5B8I B;  1JBA A;  2L5X B;  1AVS A;  1A2X A;  2I2R E;  2SCP A;  1XFW O;  1QLK A;  4QJ3 B;  1F54 A;  1BMO A;  1K9U A;  4FQT A;  4XYN A;  1BR4 B;  3BYA A;  1TN4 A;  3E3R A;  1NCY A;  4OZD A;  4PCW A;  2LMV A;  4DS7 A;  2IS9 A;  4WQ2 A;  4DCK A;  1QLS A;  1WDC B;  3ICB A;  3O78 A;  1OW4 A;  2KNE A;  2LMU A;  2M7N A;  1CMG A;  1AJ4 A;  1U5I A;  2EC6 B;  1F8H A;  3K21 A;  1RFJ A;  4QJ4 B;  1NCZ A;  3D0Y B;  3M0W A;  4ORA B;  1OE9 B;  1U5I B;  3AAK A;  1J7O A;  1XFV O;  3I5G B;  1P28 A;  2M9G A;  1XFZ O;  3I5H C;  1NSH A;  2LUC A;  2M29 A;  1CFD A;  3CAB A;  4DRW A;  1KFX L;  3SIA A;  1J1E A;  1XYD A;  4MEW A;  1RK9 A;  3S0A A;  2BAP A;  3AAJ A;  1KQV A;  2ISD A;  2MHH A;  1QWV A;  2M1U A;  4GFT A;  1TNW A;  1E8A A;  2WOS A;  4CID A;  2BCX A;  2BEC A;  2JT8 A;  1KK8 B;  3PJI A;  3FWC A;  2QDI A;  3KPX A;  1LXF C;  5I94 A;  4I5L B;  1KK7 Z;  1IKU A;  2K7D A;  2BE4 A;  2PAL A;  3CR4 X;  1DF0 A;  3CGA A;  3R72 A;  1S6J A;  1KWO C;  2LP2 A;  2FOT A;  1B7T Y;  1OOG A;  2KFG A;  4GUK A;  2HF5 A;  3DY9 A;  1SW8 A;  2F3Y A;  1YVH A;  4MN0 A;  1UUR A;  3BXK A;  2QEH A;  2LAN A;  2FCE A;  3BFA A;  2Y1M A;  4INW A;  1EJ3 A;  3DZT A;  2MRD A;  2LE9 B;  2ZN9 A;  5I2O A;  2ERB A;  2LVK A;  3I5I C;  3OGN A;  2LMT A;  1KCY A;  3B88 A;  2KAY A;  3BUX B;  1GGZ A;  1FPW A;  2CXJ A;  1IG5 A;  2QEV A;  3EG5 B;  1BG1 A;  3FIA A;  4AQI A;  2WC5 A;  1J1D A;  3WHU B;  1J55 A;  4GGN A;  1SBJ A;  3OBV A;  3PM8 A;  2LHL A;  1Y0V H;  5TNC A;  5J3X A;  5IBW A;  3EK4 A;  1F4O A;  1N2D A;  2L2E A;  3TDI A;  1NWD A;  2HQW A;  2LNK A;  5EL2 A;  1G33 A;  3PN7 C;  4DUQ A;  2OS8 C;  1QV0 A;  1CFC A;  4KYN A;  4N1F A;  3SG3 A;  2MAZ A;  1MXE A;  1Q80 A;  1QX2 A;  1S6I A;  1ALW A;  1YRT B;  4USL A;  3VGO A;  2PMY A;  3D74 A;  3S0F A;  1V1F A;  2BE6 A;  2JXC A;  1MXL C;  4YRU A;  1IRJ A;  1RRO A;  1HT9 A;  1QIW A;  4NDC A;  3R1O A;  2PSR A;  3TS5 C;  1DMO A;  1SL9 A;  2M8U A;  3BOW A;  3SG2 A;  3JVT B;  1Z4H A;  2Y4Q A;  2K2F A;  1M31 A;  4PHK A;  3CZ1 A;  1ZUZ A;  3KO0 A;  4PT1 A;  1NIW A;  3LLE A;  1DVI A;  3DVJ A;  1CNP A;  2QEB A;  1RWY A;  2H2K A;  2KAV A;  4C0L A;  4NDD A;  1FI5 A;  1D1O A;  2CTN A;  1CFP A;  2LAP A;  5AER A;  1LKJ A;  3IF7 A;  2CBL A;  1UHI A;  1SR6 C;  1K2H A;  2ZN8 A;  3CTN A;  3UNW A;  2WOR A;  1REC A;  1K93 D;  2KHN A;  1XK4 A;  2L50 A;  5CSI A;  2VRG A;  3KHE A;  4MRY A;  2M0R A;  4OKH A;  1WRZ A;  4MLW A;  2JT0 A;  1MUX A;  2G9B A;  4U8D A;  3OX6 A;  3DYE A;  4N5X A;  2MBX A;  1ALV A;  1ZMZ A;  2MLE C;  3CZ2 A;  3S0D A;  1JF0 A;  3TZ1 A;  1TUJ A;  1ZOT B;  5I2Q A;  1JF2 A;  4BY4 A;  3L4A A;  2KI6 C;  5HKW A;  1YTZ C;  1CLM A;  1OZO A;  3LCP C;  3DVK A;  3D78 A;  4F7F A;  1IGV A;  2JXL A;  5GQQ C;  1PVA A;  2MA2 A;  2P71 A;  3EVR A;  2WCH A;  2BCA A;  1M46 A;  4M2P A; 
#chains in the Genus database with same CATH homology
 2P6B B;  4MRX A;  4TNC A;  3SG5 A;  1NX0 A;  2KFH A;  2JZI A;  1G4Y R;  4DIR A;  1K9P A;  4GGF A;  1XO5 A;  2Q91 A;  3OB1 B;  2I94 A;  1K95 A;  4MVF A;  1LA3 A;  4FTG A;  2LLT A;  1XA5 A;  4YGE B;  3SG6 A;  2LM5 A;  2KOT A;  4PHM A;  1X02 A;  3C1V A;  1NX1 A;  1QAT A;  1NCX A;  2WC8 A;  3D0Y A;  3PAT A;  3ZNI A;  2L98 A;  3CZT X;  3HX4 A;  1IQ3 A;  4YBH B;  5K89 A;  1AK8 A;  2KYC A;  4PE4 A;  1XFU O;  3O2P A;  4OV2 A;  1BR1 B;  5BPJ A;  1A29 A;  3TDU A;  1F71 A;  3GK2 A;  2KQY A;  1KQM B;  4L9M A;  4PE7 A;  3QRX A;  1OOJ A;  4HRE E;  1DT7 B;  1EL4 A;  1UHK A;  1DJG A;  1L2O C;  3FWB A;  4GPL B;  2NZ0 A;  1J7Q A;  1NX2 A;  3PSR A;  1S5G Z;  1NX3 A;  2KI6 D;  4I5J A;  4WQ3 A;  5HLV A;  5DKR A;  1PAL A;  2AMI A;  3VRR A;  1SNL A;  4M2Q A;  1N65 A;  2K7O A;  1KSM A;  3A4U B;  3BQ3 A;  1JSA A;  2PVB A;  3IQQ A;  1Y6W A;  4I5K A;  1CDM A;  5HKZ A;  4R1E A;  2LLU A;  3LL8 B;  1DJI A;  1TNX A;  3RLZ A;  4A4C A;  5G08 A;  2KI4 B;  1AJ5 A;  1A75 B;  1XK4 C;  2WCF A;  3BUW B;  1SYM A;  1IJ6 A;  1PVB A;  2BCB A;  1CMF A;  1B8L A;  2QAC A;  1NYA A;  2JNF A;  4MZL A;  2M3W A;  3TUY C;  1WLZ A;  1SRA A;  4A4B A;  3KEV A;  2TN4 A;  3JTD B;  4YI8 A;  1C07 A;  4OR9 B;  3SIB A;  3F45 A;  2OTG B;  1CDL A;  3OHM B;  1F4Q A;  2JPT A;  1YUT A;  3SG4 A;  1S3P A;  1DJW A;  3HCM A;  2DOQ A;  2KYF A;  1CLB A;  3PFV A;  2FJU B;  2BL0 B;  1SK6 D;  1BLQ A;  3MSE B;  5ER4 X;  2MLF C;  4MSP A;  2ZNE A;  2QPT A;  3PLF B;  1VRK A;  4MBE A;  4GGF C;  4YGC B;  2CNP A;  1MHO A;  1Y1A A;  2AUC A;  1L7Z A;  1RJV A;  1SKT A;  1WDC C;  5AAN A;  1AP4 A;  4QJ5 B;  2LCP A;  2AAO A;  2EC6 C;  3OX5 A;  1OQP A;  2KSP A;  3NSO A;  2M97 A;  2HQ8 A;  3VRP A;  4F0Z B;  4P5O E;  3OB2 B;  1Y1U A;  4IL1 A;  5I2L A;  3O6B A;  3CS1 A;  3I5G C;  2LV7 A;  2SAS A;  3CR2 A;  4JQ0 D;  1SCV A;  3GK4 X;  2L51 A;  1TCO B;  1KQM C;  1LVC D;  2BKI B;  1K90 D;  1SL8 A;  1IH0 A;  2GGM A;  3CWG A;  4D1E A;  3EK8 A;  1FBV A;  2LVI A;  1KK8 C;  1S1E A;  1C7V A;  3I5H B;  1A4P A;  2I7A A;  1PUL A;  1OMD A;  1XFY O;  4CPV A;  5KSZ A;  3OP0 A;  4JWQ A;  3DF0 A;  2H61 A;  2JU0 A;  2LHI A;  5AEQ A;  1S36 A;  2JRF A;  4ICB A;  1OZS A;  2NXQ A;  4GBA A;  2F2O A;  1K8U A;  3DF0 B;  5HLO A;  3TDZ A;  1J7R A;  1M39 A;  1SCM B;  1SL7 A;  2K0J A;  4ZCU A;  1V1G A;  1TCF A;  2JT3 A;  2LP3 A;  3GK1 A;  2K7B A;  3LK1 A;  1B8C A;  1MR8 A;  2KBM A;  5CSF A;  1B7T Z;  4ORB B;  4GNK B;  2L0P A;  1QV1 A;  3SG7 A;  1H8B A;  1KWO B;  2R2I A;  1OSA A;  1R2U A;  3O4Y A;  1CDN A;  3LK0 A;  1CM4 A;  1BU3 A;  1K94 A;  1QVI Y;  2HET A;  5JJG A;  2HPS A;  3EVV A;  1DJY A;  5DKQ A;  2L4H A;  1DGV A;  1GQM A;  4BY5 A;  3D10 A;  2JWW A;  1M63 B;  3DVE A;  4HRH A;  4AOM A;  1UHJ A;  2KAX A;  1BOC A;  4E68 A;  1Y1X A;  1FI6 A;  3PAL A;  4N1G A;  3NSL A;  1S26 D;  1BF5 A;  1W7I B;  2OTG C;  2KDH A;  5CPV A;  2Y5I A;  2RGI A;  1TNQ A;  1EXR A;  4HRG A;  2V53 A;  3BUO B;  1GGW A;  1QAS A;  1QJT A;  2D8N A;  2GV5 A;  4PHJ A;  4CLN A;  1G8I A;  1F70 A;  2K8M B;  2LVV A;  2KFF A;  4PE0 A;  5I8N A;  2F33 A;  2WCB A;  4OVN F;  1YX8 A;  1J7P A;  1CTR A;  1YRU B;  3PN7 B;  4I5N B;  1JWD A;  2OS8 B;  1GJY A;  1LA0 A;  5PAL A;  4PDZ A;  4WRI A;  2BBN A;  2F8P A;  1RTP 1;  3JVT C;  1AHR A;  1ZFS A;  1IWQ A;  1TTX A;  1ZAC A;  2WND A;  2F3Z A;  1QS7 A;  1YX7 A;  2FCD A;  2E30 A;  3TS5 B;  3BUM B;  2PRU A;  2ZND A;  4ETO A;  1PSR A;  1H4B A;  4FQO A;  5ER5 A;  2B1U A;  1QIV A;  3I5F B;  1WLM A;  5CSJ A;  2MJW B;  1EG3 A;  2ZFD A;  1R6P A;  2JTZ A;  1MF8 B;  5KU1 A;  4JPZ B;  1A75 A;  2WCE A;  1FW4 A;  1LIN A;  1UP5 A;  1N0Y A;  1SPY A;  5KTY A;  1YR5 A;  2M7L A;  4Q04 A;  1NUB A;  1DJH A;  2KQ6 A;  4ZCV A;  2KBI A;  2H61 C;  1SCM C;  1SR6 B;  3WXA A;  1MWN A;  2NCP A;  1UHH A;  3DVM A;  2JOJ A;  3VRN A;  1CM1 A;  5FYX A;  1UUS A;  3CLN A;  1KFU S;  2BKH B;  1AUI B;  1EG4 A;  1XFX O;  3NSK A;  1YUU A;  4NDB A;  1XVJ A;  2K7C A;  1M45 A;  1CFF A;  1DGU A;  1QXP A;  1DF0 B;  2COL B;  1C7W A;  1CKK A;  3DD4 A;  2ZRT A;  1TOP A;  1BT6 A;  2G2B A;  3WHT B;  2JNX A;  1K9K A;  3SJS A;  2K2A A;  4YGA A;  1OMR A;  1QVI Z;  1YVL A;  2LLS A;  2M49 B;  5DKN A;  1SMG A;  4AQJ A;  4CFR A;  2K61 A;  5JOL A;  4YI9 A;  1EH2 A;  1MQ1 A;  3A8R A;  1TNP A;  1OMV A;  3IQO A;  4ORC B;  4C0K A;  2JUL A;  3ZWH A;  2ZKM X;  1QTX A;  2CT9 A;  2GGZ A;  4MZK A;  1WRK A;  3FS7 A;  1QX7 A;  3RM1 A;  1DJZ A;  5HYD A;  4NQG A;  1S6C A;  1JFK A;  2JQ6 A;  3VRQ A;  1BOD A;  1A03 A;  4PHN A;  2KGR A;  1QX5 B;  1IQ5 A;  3KF9 A;  1PRW A;  2JC2 A;  4PE1 A;  3BUN B;  1HQV A;  2L4I A;  4OCI A;  3NXA A;  4GAO A;  2F2P A;  3NSI A;  2NCO A;  4CFQ A;  1TIZ A;  2NLN A;  4XJK A;  3H4S E;  1K96 A;  3AKB A;  1NPQ A;  1F55 A;  1B4C A;  1SY9 A;  1YUR A;  1W7J B;  1S5G Y;  1CLL A;  1JUO A;  1ODB A;  1PSB A;  4M2O A;  3WNX B;  3GOF A;  2Q4U A;  5HKY A;  1TRF A;  3EK7 A;  5D7F A;  1KK7 Y;  1L2O B;  2EGD A;  2O5G A;  2CCM A;  2Y1N A;  2PAS A;  1PK0 D;  1UWO A;  3EVU A;  1WRL A;  1WY9 A;  3BOW B;  3I5F C;  2BBM A;  4HSZ A;  2LUX A;  4XJK B;  5CSN A;  2LC5 A;  1KFU L;  1KSO A;  1UHN A;  1KFX S;  2KGB C;  2LVJ A;  1DTL A;  2KI4 C;  1IJ5 A;  2EHB A;  1NP8 A;  3EKH A;  4C0J A;  1JFJ A;  3VRO A;  2A4J A;  1B8R A;  2O60 A;  1YUS A;  3CR5 X;  4MZJ A;  4UPG A;  2OPO A;  4P2Y B;  1B47 A;  1CB1 A;  1BJF A;  2ZRS A;  2I18 A;  4YGB B;  3JTD C;  1FF1 A;  5D69 A;  1B1G A;  3AKA A;  1DJX A;  3TUY B;  4PAL A;  2E6W A;  3I5I B;  5AFP A;  5AXI A;  1JC2 A;  1CDP A;  2BL0 C;  4YGD B;  1B9A A;  3EKJ A;  2JTT A;  2M1K B;  5F6T A;  5B8I B;  1JBA A;  2L5X B;  1AVS A;  1A2X A;  2I2R E;  2SCP A;  1XFW O;  1QLK A;  4QJ3 B;  1F54 A;  1BMO A;  1K9U A;  4XYN A;  1BR4 B;  3BYA A;  1TN4 A;  3E3R A;  1NCY A;  4PCW A;  2LMV A;  4DS7 A;  2IS9 A;  4WQ2 A;  4DCK A;  1QLS A;  1WDC B;  3ICB A;  3O78 A;  2KNE A;  2LMU A;  2M7N A;  1CMG A;  1AJ4 A;  1U5I A;  2EC6 B;  1F8H A;  3K21 A;  1RFJ A;  4QJ4 B;  1NCZ A;  3D0Y B;  3M0W A;  4ORA B;  1OE9 B;  1U5I B;  3AAK A;  1J7O A;  1XFV O;  3I5G B;  2M9G A;  1XFZ O;  3I5H C;  1NSH A;  2LUC A;  2M29 A;  1CFD A;  4DRW A;  1KFX L;  3SIA A;  1J1E A;  1XYD A;  4MEW A;  1RK9 A;  3AAJ A;  1KQV A;  2ISD A;  2MHH A;  2M1U A;  4GFT A;  1TNW A;  1E8A A;  2WOS A;  4CID A;  2BCX A;  2BEC A;  2JT8 A;  1KK8 B;  3FWC A;  3KPX A;  1LXF C;  4I5L B;  1KK7 Z;  1IKU A;  2K7D A;  2BE4 A;  2PAL A;  3CR4 X;  1DF0 A;  3CGA A;  1S6J A;  1KWO C;  2LP2 A;  2FOT A;  1B7T Y;  2KFG A;  4GUK A;  2HF5 A;  1SW8 A;  2F3Y A;  1YVH A;  4MN0 A;  1UUR A;  3BXK A;  2LAN A;  2FCE A;  2Y1M A;  1EJ3 A;  2MRD A;  2LE9 B;  2ZN9 A;  5I2O A;  2LVK A;  3I5I C;  2LMT A;  1KCY A;  3BUX B;  2KAY A;  1GGZ A;  1FPW A;  2CXJ A;  1IG5 A;  1BG1 A;  3FIA A;  4AQI A;  1J1D A;  3WHU B;  1J55 A;  4GGN A;  1SBJ A;  3PM8 A;  2LHL A;  1Y0V H;  5TNC A;  5J3X A;  5IBW A;  3EK4 A;  1F4O A;  1N2D A;  2L2E A;  3TDI A;  1NWD A;  2HQW A;  2LNK A;  1G33 A;  3PN7 C;  4DUQ A;  2OS8 C;  1QV0 A;  1CFC A;  4N1F A;  3SG3 A;  2MAZ A;  1MXE A;  1Q80 A;  1QX2 A;  1S6I A;  1ALW A;  1YRT B;  4USL A;  3VGO A;  2PMY A;  1V1F A;  2BE6 A;  2JXC A;  1MXL C;  4YRU A;  1IRJ A;  1RRO A;  1HT9 A;  1QIW A;  4NDC A;  2PSR A;  3TS5 C;  1DMO A;  1SL9 A;  2M8U A;  3BOW A;  3SG2 A;  3JVT B;  2Y4Q A;  2K2F A;  1M31 A;  4PHK A;  1ZUZ A;  3KO0 A;  1NIW A;  3LLE A;  1DVI A;  3DVJ A;  1CNP A;  1RWY A;  2H2K A;  2KAV A;  4C0L A;  4NDD A;  1FI5 A;  1D1O A;  2CTN A;  1CFP A;  2LAP A;  5AER A;  1LKJ A;  3IF7 A;  2CBL A;  1UHI A;  1SR6 C;  1K2H A;  2ZN8 A;  3CTN A;  2WOR A;  1REC A;  1K93 D;  2KHN A;  1XK4 A;  2L50 A;  5CSI A;  2VRG A;  3KHE A;  4MRY A;  2M0R A;  4OKH A;  1WRZ A;  4MLW A;  2JT0 A;  1MUX A;  2G9B A;  4U8D A;  3OX6 A;  4N5X A;  2MBX A;  1ALV A;  1ZMZ A;  2MLE C;  1JF0 A;  3TZ1 A;  1ZOT B;  5I2Q A;  1JF2 A;  4BY4 A;  2KI6 C;  5HKW A;  1YTZ C;  1CLM A;  1OZO A;  3LCP C;  3DVK A;  1IGV A;  2JXL A;  5GQQ C;  1PVA A;  2MA2 A;  3EVR A;  2BCA A;  1M46 A;  4M2P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...