1MWNA

Solution nmr structure of s100b bound to the high-affinity target peptide trtk-12
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
91
structure length
91
Chain Sequence
SELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDEDGDGECDFQEFMAFVSMVTTACHEFFEHE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords S-100 protein, beta chain
publication title Solution NMR structure of S100B bound to the high-affinity target peptide TRTK-12
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Structural protein
total genus 20
structure length 91
sequence length 91
chains with identical sequence B
ec nomenclature
pdb deposition date 2002-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1mwnA00
5DKNA 1DTLA 1PALA 1QATA 1K9PA 3BOWA 1MWNA 2M1KB 4Q04A 3TUYC 3BUNB 3JVTC 1CLLA 4I5JA 2KAXA 3CZTX 4MZJA 2LAPA 2NXQA 3KF9A 2GGZA 3WHTB 5HLOA 1FBVA 1QJTA 2LANA 3SG5A 2JTTA 1SL8A 4HSZA 1RWYA 1S6JA 4FQOA 2JTZA 1AJ5A 4QJ5B 2ZN9A 3OX6A 2CBLA 1B8LA 5FYXA 5I2QA 4MN0A 1KCYA 1OZSA 1X02A 3EKHA 3FS7A 1DJXA 1SRAA 2LMVA 2NCOA 4YGDB 2WC8A 2F2PA 2M97A 1G4YR 1TN4A 5CSFA 1QS7A 1S3PA 2MBXA 2CXJA 2M8UA 2BCBA 3KEVA 1PRWA 3EVUA 4ZCUA 1LA3A 1PULA 1F8HA 2O60A 1NYAA 1RJVA 2JT0A 4GAOA 3KO0A 2HETA 2NZ0A 2NLNA 5HLVA 4OKHA 2KI6D 2M7NA 1N2DA 3O4YA 4M2OA 1A75B 1UHHA 1MHOA 1EJ3A 1IGVA 4I5KA 3SJSA 2F33A 3OB2B 2LVIA 1F54A 2CCMA 1K90D 2OTGC 3DVEA 1C7WA 2LVJA 2FCEA 1UURA 1XFVO 1YVHA 1IQ5A 1KFXS 1AK8A 1QTXA 3D0YA 4PE1A 3OX5A 5JOLA 2SASA 1OZOA 1SKTA 4YGCB 3SG7A 1UHKA 5D7FA 1BF5A 5G08A 1JFJA 2JPTA 4QJ4B 5CSIA 2E6WA 5D69A 1ZUZA 1OOJA 3DVMA 4GFTA 1K94A 2ZKMX 2Q91A 3MSEB 1B4CA 4C0JA 1JBAA 1CMFA 4BY4A 3RLZA 1KFXL 3NSKA 1EXRA 2OPOA 1H8BA 1XK4A 1EG4A 3AAKA 1JF0A 4MZKA 3LCPC 1S5GZ 4PE0A 4I5LB 1RK9A 3NSIA 2PSRA 3SG6A 1UHIA 2WCFA 4L9MA 5HKWA 3BOWB 1A03A 5DKQA 1M39A 2ZNDA 5I8NA 2ZN8A 1EL4A 4CLNA 1TNPA 1YTZC 1UHNA 2KBIA 2KDHA 2LUCA 2PMYA 3AAJA 1QLKA 3BUWB 4M2PA 1RTP1 1SMGA 1PSBA 1VRKA 1GGZA 1Q80A 3OP0A 2KGBC 2KSPA 4ORBB 5AEQA 2PALA 1K93D 1KK7Z 2Y1NA 1UHJA 1G8IA 2KGRA 1BR1B 1R2UA 1PK0D 2K0JA 2KYFA 1TIZA 3VRQA 1IJ6A 2JXLA 3NSLA 2BL0B 1K2HA 3M0WA 1BG1A 2LLTA 2JNXA 5ER4X 4ICBA 4TNCA 1CLBA 1M31A 2LLSA 1B47A 2BL0C 2F2OA 1FF1A 3SG2A 1SW8A 1PVBA 1LINA 4JWQA 1YUTA 2F8PA 5CSNA 2L0PA 3O78A 1W7JB 3EVRA 2EGDA 2G2BA 1U5IA 4U8DA 3VGOA 2OS8B 2LP3A 1QX2A 1YR5A 1ODBA 4PCWA 5I2LA 1CNPA 4DIRA 2GGMA 1DJHA 5I2OA 1J7OA 5AANA 3D0YB 3BXKA 1CDPA 1RFJA 4PE7A 1SR6B 1SCMB 2BBNA 3CR2A 2LUXA 4DS7A 3A4UB 1SR6C 2WCBA 1B7TZ 2AAOA 3TS5B 2JOJA 4WQ3A 1CM4A 1S6CA 3VRPA 3PSRA 1NCXA 1QVIY 4NDDA 3DD4A 3TS5C 2NCPA 2CNPA 2H61A 4YBHB 1GGWA 2BCAA 1SBJA 4MRYA 2Y5IA 2DOQA 4JPZB 2L50A 3TDZA 1NP8A 4ORCB 3SG4A 1S26D 2BE4A 4PHNA 1MQ1A 4YI9A 2LV7A 1OMDA 2I7AA 2KOTA 2JXCA 3AKBA 3FIAA 4MSPA 5GQQC 1DF0A 1J7RA 2M9GA 1H4BA 1NIWA 1TNWA 1LXFC 2JNFA 3O2PA 2KI6C 2ZRTA 1YURA 2LLUA 1QV0A 3LL8B 3PLFB 2LHLA 1UWOA 1OSAA 3TZ1A 4GGNA 2JZIA 2LVVA 1DMOA 2FOTA 2AUCA 2BKIB 3CS1A 4YGAA 2K2FA 1IKUA 1CLMA 3BQ3A 1WRZA 1RECA 2JT8A 2SCPA 1DGVA 1CTRA 1DJYA 2LE9B 4GBAA 4A4CA 5KSZA 2F3YA 1TCFA 1JSAA 3EK8A 1NX2A 1E8AA 5AFPA 2HQ8A 1JFKA 3CLNA 1U5IB 1Y0VH 2JRFA 1QX5B 3FWCA 3LK0A 5HKZA 5KTYA 1NPQA 3C1VA 1IJ5A 1A4PA 1BJFA 2LM5A 3KPXA 5F6TA 5PALA 2M29A 2HQWA 2LMTA 2FCDA 3GOFA 1F55A 1ALVA 1AHRA 5HYDA 3F45A 1WY9A 3AKAA 1AP4A 2KBMA 3OHMB 1KFUS 2KQ6A 5CPVA 2LNKA 1QXPA 1N0YA 5ER5A 5TNCA 1MXLC 3E3RA 2LCPA 1CMGA 4WRIA 1K9KA 2JT3A 3BUMB 4GGFA 2KYCA 4YGBB 3SG3A 3O6BA 1WRKA 1SNLA 2G9BA 3I5IB 3KHEA 1WLZA 2IS9A 1RROA 1K95A 1J1EA 2KAYA 1SCVA 1Y1XA 1FPWA 2D8NA 1J1DA 2JWWA 2WORA 4OCIA 2LP2A 3SIAA 4D1EA 1QIVA 3VROA 3OB1B 1DF0B 3IQQA 4HRHA 2KHNA 1KQMB 1M46A 1BU3A 1SK6D 1WDCB 1YUSA 1KWOB 2KAVA 1CDNA 3PN7B 4QJ3B 1DJIA 2MJWB 3NXAA 1IWQA 2I18A 1KWOC 3ZWHA 3EKJA 2H2KA 2RGIA 1TNQA 3PN7C 4IL1A 2M49B 1CDMA 1OE9B 4PALA 1XFUO 4FTGA 1S5GY 1QASA 4NQGA 1XA5A 3FWBA 1DVIA 1EG3A 4CPVA 1L2OB 2HF5A 4E68A 3DVKA 3PFVA 5DKRA 2MRDA 1FW4A 1BMOA 3PM8A 2CTNA 4GNKB 1L2OC 2ZFDA 2A4JA 2KNEA 1BR4B 1W7IB 4DCKA 4DRWA 3GK1A 1KQVA 3CWGA 3CR4X 4N1FA 2OS8C 3I5GB 1JWDA 2KFGA 1J7QA 3TDIA 1KK7Y 1ZMZA 1YRUB 2KI4B 2LC5A 2ZRSA 1AUIB 3I5GC 3ICBA 4GUKA 4ZCVA 4F0ZB 2AMIA 2ZNEA 1QVIZ 4A4BA 2VRGA 1IQ3A 3ZNIA 2BCXA 2KI4C 1SCMC 4MEWA 3VRNA 3I5FB 2P6BB 4UPGA 5HKYA 2BE6A 3WNXB 2MAZA 1CFPA 3WHUB 3IF7A 2QPTA 1FI6A 1HT9A 2LMUA 3I5FC 4GPLB 2EC6B 1YVLA 1TOPA 2Y1MA 3DF0A 3QRXA 5IBWA 1NX0A 1JUOA 2CT9A 1XK4C 3EK7A 1QLSA 1NUBA 1BOCA 4AQJA 4N1GA 4MLWA 3BUOB 1NWDA 2K7BA 2MHHA 1XO5A 1TTXA 4OV2A 4NDBA 1Y6WA 4AOMA 2M0RA 1LKJA 1S36A 3LLEA 1DJWA 2MA2A 1IRJA 1NCYA 1CB1A 1NX3A 2K61A 2K7CA 3TUYB 1B7TY 2ISDA 1CFCA 1A2XA 3JVTB 2K7DA 1OMVA 1TRFA 1N65A 1UP5A 2L2EA 1C7VA 5J3XA 2QACA 2I94A 2JULA 1EH2A 2WOSA 3SIBA 2E30A 1XFYO 1OQPA 3WXAA 1BODA 2F3ZA 2WNDA 4C0KA 1LA0A 3EK4A 2O5GA 3NSOA 1DGUA 4XJKA 4CFQA 1MUXA 2BKHB 2K8MB 2R2IA 1YX7A 1ZFSA 4ETOA 3JTDB 1L7ZA 3GK4X 1IH0A 5AERA 1WRLA 1SL7A 1OMRA 3HX4A 3JTDC 1BLQA 1CDLA 2K7OA 2LVKA 4XYNA 2Q4UA 3I5HB 3PATA 1NX1A 1CKKA 4P5OE 5CSJA 3CGAA 3I5HC 1YUUA 1UUSA 2OTGB 4MRXA 4OR9B 1DJZA 4MVFA 1CM1A 4CIDA 4BY5A 1PVAA 3IQOA 3DF0B 5JJGA 1JF2A 2K2AA 2Y4QA 1B9AA 1MXEA 2L5XB 4I5NB 2PRUA 5AXIA 2COLB 3A8RA 1BT6A 1ZACA 2FJUB 2H61C 4PHJA 1C07A 1XFZO 1GJYA 3I5IC 1KFUL 3BYAA 4MZLA 1XFXO 1Y1UA 2EHBA 2I2RE 4M2QA 4PE4A 3K21A 1MF8B 1TNXA 4JQ0D 1CFFA 4PDZA 1F4OA 4USLA 4DUQA 1MR8A 1FI5A 1K9UA 1J55A 3RM1A 1HQVA 4HRGA 2L4IA 3HCMA 2LHIA 1YX8A 1K8UA 1KQMC 1R6PA 1WLMA 1WDCC 3EVVA 1YRTB 1A29A 2PASA 4MBEA 4AQIA 1SPYA 2L51A 1S6IA 3PALA 1DT7B 4R1EA 3TDUA 2KFHA 1F70A 1SY9A 4C0LA 5KU1A 2MLEC 4PHMA 1LVCD 1ZOTB 2L98A 1XFWO 2JC2A 1KK8B 2JU0A 2M1UA 1KSMA 2GV5A 2JQ6A 3DVJA 1KK8C 1IG5A 1GQMA 1QV1A 2B1UA 3LK1A 4ORAB 4YRUA 1DJGA 1V1FA 1D1OA 1J7PA 1TCOB 1Y1AA 2HPSA 4XJKB 1K96A 1NSHA 1XVJA 4PHKA 2L4HA 4P2YB 1B1GA 1S1EA 4N5XA 2BECA 1V1GA 1M45A 3D10A 1A75A 1SYMA 1JC2A 5BPJA 5B8IB 4OVNF 1G33A 1AVSA 5K89A 2KQYA 1M63B 3H4SE 2V53A 2BBMA 4YGEB 3CTNA 4NDCA 1AJ4A 2PVBA 1PSRA 2EC6C 4YI8A 1B8CA 2TN4A 1CFDA 3CR5X 4GGFC 1QIWA 4CFRA 1SL9A 1F71A 1KSOA 4WQ2A 1QX7A 2WCEA 1ALWA 2M7LA 1B8RA 2MLFC 3VRRA 4HREE 1F4QA 1NCZA 2M3WA 3GK2A 1XYDA 2KFFA 3BUXB
chains in the Genus database with same CATH superfamily
5DKNA 1DTLA 1PALA 1QATA 1K9PA 3BOWA 1MWNA 2M1KB 4Q04A 3TUYC 3BFBA 3BUNB 3JVTC 1CLLA 4I5JA 2KAXA 3CZTX 2QDIA 4JKTA 1GM0A 4MZJA 2LAPA 2NXQA 3KF9A 2GGZA 3WHTB 5HLOA 1FBVA 1QJTA 2LANA 3CYZA 2JTTA 1SL8A 3SG5A 5DICA 4HSZA 1RWYA 1S6JA 4FQOA 2JTZA 2L5YA 1AJ5A 4QJ5B 2ZN9A 3OX6A 2CBLA 1B8LA 5FYXA 5I2QA 3QMEA 4MN0A 1OZSA 1X02A 1KCYA 3EKHA 3FS7A 1DJXA 2KLEA 1SRAA 2LMVA 2NCOA 4YGDB 2WC8A 2F2PA 2M97A 1G4YR 1TN4A 5CSFA 1QS7A 1S3PA 2MBXA 2CXJA 2M8UA 3BJHA 2BCBA 3KEVA 1PRWA 3EVUA 1OOHA 4ZCUA 1LA3A 1PULA 1C3YA 2O60A 1F8HA 1NYAA 1RJVA 2JT0A 4GAOA 3KO0A 2HETA 2NZ0A 2NLNA 5HLVA 4OKHA 2KI6D 3UNWA 2M7NA 1N2DA 2PYQA 3O4YA 4M2OA 1A75B 1UHHA 1MHOA 1EJ3A 3DZTA 1IGVA 4I5KA 4JD9A 3SJSA 2F33A 3OB2B 2LVIA 1F54A 2CCMA 1K90D 2OTGC 3DVEA 1C7WA 3CDNA 2LVJA 2FCEA 1UURA 1XFVO 1YVHA 1IQ5A 1KFXS 1AK8A 2K60A 1QTXA 3D0YA 4PE1A 3OX5A 5JOLA 2SASA 1OZOA 1SKTA 4YGCB 3SG7A 4F7FA 1UHKA 5D7FA 1BF5A 5G08A 1JFJA 2JPTA 4QJ4B 5CSIA 2E6WA 5D69A 1ZUZA 1OOJA 3DVMA 4GFTA 1K94A 2ZKMX 2Q91A 3MSEB 1B4CA 4C0JA 1JBAA 1CMFA 4BY4A 3RLZA 1KFXL 3NSKA 1EXRA 2OPOA 1H8BA 1XK4A 1EG4A 3AAKA 3Q8IA 3S0GA 2WC6A 1JF0A 4MZKA 3LCPC 1S5GZ 4PE0A 4I5LB 1RK9A 3NSIA 2PSRA 3SG6A 1UHIA 2WCFA 4L9MA 5HKWA 3BOWB 1A03A 5DKQA 1M39A 2ZNDA 5I8NA 3B88A 2ZN8A 1EL4A 3D73A 4CLNA 1TNPA 1YTZC 1UHNA 2KBIA 2KDHA 2LUCA 2PMYA 3AAJA 3IVTA 1QLKA 3BUWB 4M2PA 1RTP1 1SMGA 1PSBA 1VRKA 1GGZA 1Q80A 3OP0A 2KGBC 2KSPA 1T14A 4ORBB 3PM2A 3L4LA 5AEQA 2PALA 1K93D 1KK7Z 2Y1NA 1UHJA 1G8IA 2KGRA 1BR1B 1R2UA 1PK0D 2K0JA 3CZ0A 2KYFA 1TIZA 3VRQA 1IJ6A 2JXLA 3NSLA 2BL0B 1K2HA 3M0WA 1BG1A 2LLTA 2JNXA 5ER4X 4ICBA 4TNCA 1CLBA 3N7HA 1M31A 2LLSA 1B47A 2BL0C 2F2OA 1DELA 1W9ZA 1FF1A 3SG2A 1SW8A 1PVBA 1LINA 4JWQA 1YUTA 2F8PA 5CSNA 2L0PA 3O78A 1W7JB 3EVRA 2EGDA 2G2BA 1U5IA 4U8DA 3VGOA 2OS8B 2LP3A 1QX2A 3EG5B 1YR5A 1ODBA 4PCWA 5I2LA 1CNPA 4DIRA 2GGMA 1DJHA 5I2OA 1J7OA 5AANA 3D0YB 3BXKA 1CDPA 1RFJA 4PE7A 1SR6B 1SCMB 1TUJA 2BBNA 3CR2A 2LUXA 3L4AA 2WC5A 2H8VA 3A4UB 3S0DA 4DS7A 1SR6C 2WCBA 1B7TZ 2AAOA 3TS5B 2JOJA 4WQ3A 1CM4A 1S6CA 4IJ7A 3VRPA 3PSRA 1NCXA 1QVIY 4NDDA 3DD4A 3TS5C 2NCPA 2CNPA 2H61A 4YBHB 1GGWA 2BCAA 1SBJA 4MRYA 3D78A 2Y5IA 2DOQA 4JPZB 2L50A 3B6XA 3TDZA 1NP8A 4ORCB 3SG4A 1S26D 2BE4A 2QEBA 3S0EA 4PHNA 1MQ1A 4YI9A 2LV7A 1OMDA 2I7AA 2KOTA 2JXCA 3AKBA 4INWA 3FIAA 4MSPA 5GQQC 1DF0A 1J7RA 2M9GA 1H4BA 1NIWA 1TNWA 1LXFC 2JNFA 3O2PA 2KI6C 2ZRTA 1YURA 2LLUA 3PJIA 1QV0A 3LL8B 3PLFB 2LHLA 1UWOA 1OSAA 3TZ1A 4GGNA 2JZIA 2LVVA 1DMOA 2FOTA 2AUCA 2BKIB 3CS1A 4YGAA 2K2FA 1IKUA 1CLMA 2YGUA 3BQ3A 1IIOA 1WRZA 3BFHA 1RECA 3R1PA 2JT8A 2SCPA 1DGVA 1CTRA 1DJYA 2LE9B 4GBAA 4A4CA 5KSZA 4INXA 2F3YA 1TCFA 1JSAA 3FE9A 1OW4A 3EK8A 4PT1A 1NX2A 1E8AA 5AFPA 2HQ8A 1JFKA 3CLNA 1U5IB 3NHIA 1Y0VH 2JRFA 1DEKA 1QX5B 3DY9A 3FWCA 3LK0A 5HL1A 5HKZA 5KTYA 1SSEB 1TUZA 1NPQA 3C1VA 2KPHA 1IJ5A 1A4PA 1BJFA 2LM5A 3KPXA 5F6TA 5PALA 1Z2CB 2M29A 2HQWA 2LMTA 2FCDA 3GOFA 1F55A 1ALVA 1AHRA 5HYDA 3F45A 1WY9A 2WCHA 3AKAA 1AP4A 2KBMA 3OHMB 2BAPA 2QEOA 1KFUS 2KQ6A 5CPVA 2ERBA 2LNKA 1QXPA 1N0YA 5ER5A 5TNCA 1MXLC 3E3RA 2LCPA 1CMGA 4WRIA 1K9KA 2JT3A 3BUMB 4GGFA 2KYCA 4YGBB 3SG3A 3O6BA 1WRKA 5FI7A 1SNLA 2G9BA 3I5IB 3KHEA 1WLZA 2IS9A 3SS5A 1RROA 1K95A 1J1EA 2KAYA 1SCVA 3FE8A 1Y1XA 1FPWA 3UO9A 2D8NA 1J1DA 2JWWA 2WORA 4OCIA 2LP2A 3SIAA 4D1EA 1QIVA 3VROA 3D77A 1DF0B 3OB1B 3IQQA 4HRHA 2KHNA 1KQMB 1M46A 1BU3A 1SK6D 1WDCB 1YUSA 1KWOB 2KAVA 2WCMA 1CDNA 3PN7B 4QJ3B 1DJIA 2MJWB 3NXAA 1IWQA 2I18A 1KWOC 3ZWHA 3EKJA 3K1EA 2H2KA 2RGIA 1TNQA 3PN7C 4IL1A 2M49B 3NGVA 1CDMA 1OE9B 3CZ2A 4PALA 1XFUO 2KLDA 4FTGA 1S5GY 1QASA 2GTEA 4NQGA 1XA5A 3FWBA 1DVIA 1EG3A 4CPVA 1L2OB 2HF5A 4E68A 3DVKA 3PFVA 5DKRA 3R72A 2MRDA 1FW4A 2P71A 1BMOA 3PM8A 2CTNA 4GNKB 1L2OC 3B86A 2ZFDA 2A4JA 2KNEA 1BR4B 1W7IB 4DCKA 3R1VA 4DRWA 3GK1A 1KQVA 1QWVA 3CWGA 3CR4X 4N1FA 2OS8C 3I5GB 1JWDA 2KFGA 1J7QA 3TDIA 1KK7Y 1ZMZA 1YRUB 2KI4B 2LC5A 2ZRSA 1AUIB 3I5GC 3ICBA 4GUKA 4ZCVA 4F0ZB 2AMIA 2QEVA 1QVIZ 2ZNEA 2VRGA 4A4BA 1IQ3A 3ZNIA 2BCXA 2KI4C 1SCMC 4MEWA 3VRNA 3I5FB 2P6BB 4UPGA 5HKYA 2BE6A 3WNXB 1ORGA 2MAZA 1CFPA 3WHUB 3IF7A 2QPTA 1FI6A 1HT9A 2LMUA 3I5FC 4GPLB 2EC6B 1YVLA 1TOPA 2Y1MA 3DF0A 3QRXA 1OOGA 3VB1A 5IBWA 2WCKA 3NHTA 1NX0A 1JUOA 2CT9A 1XK4C 3EK7A 1QLSA 5EL2A 1NUBA 1BOCA 3OGNA 3O4XA 4N1GA 4MLWA 4AQJA 3BUOB 4FQTA 1NWDA 2K7BA 2MHHA 1XO5A 1TTXA 2L2CA 4OV2A 3S0BA 4NDBA 1Y6WA 4AOMA 2M0RA 1LKJA 1S36A 3LLEA 1DJWA 2MA2A 1IRJA 1NCYA 1CB1A 1NX3A 3S0FA 2K61A 2K7CA 3TUYB 5D3OA 1B7TY 2ISDA 1CFCA 2JPOA 1A2XA 3JVTB 2K7DA 1OMVA 1TRFA 1N65A 1UP5A 2L2EA 1C7VA 5J3XA 2QEHA 2QACA 2I94A 2JULA 1EH2A 2WOSA 1C3ZA 3SIBA 2E30A 1LS8A 1XFYO 1OQPA 3WXAA 5I94A 1BODA 2F3ZA 2WNDA 4C0KA 3SS4A 3D75A 1LA0A 3EK4A 2O5GA 3S0AA 3L47A 3NSOA 1DGUA 4XJKA 4CFQA 1MUXA 2BKHB 2K8MB 2R2IA 3SS3A 1YX7A 4OZDA 1ZFSA 4ETOA 3JTDB 1L7ZA 3GK4X 1IH0A 5AERA 1WRLA 1SL7A 1OMRA 3HX4A 3JTDC 1BLQA 1CDLA 1OOIX 3RZSA 2K7OA 2LVKA 4XYNA 2Q4UA 3I5HB 3PATA 1NX1A 1CKKA 4P5OE 5CSJA 3B87A 3CGAA 3I5HC 1YUUA 1UUSA 2OTGB 4MRXA 4OR9B 1DJZA 4MVFA 1CM1A 4CIDA 4BY5A 1PVAA 3IQOA 2WCLA 3DF0B 5JJGA 1JF2A 2K2AA 2Y4QA 1B9AA 1MXEA 2L5XB 4I5NB 1Z4HA 2PRUA 3OBVA 2COLB 5AXIA 3D76A 3A8RA 3R1OA 1BT6A 1ZACA 2FJUB 2H61C 4PHJA 1C07A 1XFZO 1GJYA 3I5IC 1KFUL 1XFRA 3BYAA 1XFXO 4MZLA 1Y1UA 2EHBA 2I2RE 4M2QA 4PE4A 3K21A 1MF8B 1TNXA 4JQ0D 1CFFA 4PDZA 1F4OA 4USLA 4DUQA 1MR8A 1FI5A 1K9UA 1J55A 3RM1A 4KYNA 1HQVA 4HRGA 2L4IA 3HCMA 2LHIA 1YX8A 1K8UA 1KQMC 1R6PA 1WLMA 1WDCC 3EVVA 1YRTB 1A29A 2PASA 4MBEA 4AQIA 1SPYA 2L51A 1S6IA 3PALA 1DT7B 3CZ1A 4R1EA 3TDUA 1OOFA 2KFHA 2PQLA 1F70A 1SY9A 3CABA 4C0LA 5KU1A 2MLEC 4PHMA 1LVCD 1ZOTB 2L98A 1XFWO 2JC2A 1KK8B 2JU0A 1TWOA 2M1UA 1KSMA 5FI2A 2GV5A 2JQ6A 3DVJA 1KK8C 1IG5A 1GQMA 3D74A 1QV1A 2B1UA 3LK1A 1DQEA 4ORAB 4YRUA 1DJGA 1V1FA 1D1OA 1J7PA 1TCOB 1Y1AA 2HPSA 4XJKB 1K96A 1NSHA 1XVJA 4PHKA 3V2LA 2WCJA 2L4HA 3B7AA 4P2YB 1B1GA 1S1EA 2BNXA 4N5XA 2BECA 1P28A 1V1GA 1M45A 3D10A 1A75A 1SYMA 1JC2A 3DYEA 3DXLA 4OVNF 5B8IB 5BPJA 1G33A 1AVSA 2P70A 5K89A 2KQYA 1M63B 3H4SE 2V53A 2BBMA 4YGEB 3CTNA 4NDCA 1AJ4A 2PVBA 1DC1A 1PSRA 2EC6C 4YI8A 1B8CA 2FJYA 2TN4A 1CFDA 3CR5X 5FI6A 4GGFC 1QIWA 4CFRA 1SL9A 3BFAA 1KSOA 1F71A 4WQ2A 1QX7A 2WCEA 1ALWA 3FE6A 2M7LA 1B8RA 2MLFC 3VRRA 4HREE 1F4QA 1NCZA 2M3WA 3GK2A 1XYDA 2KFFA 3BUXB
chains in the Genus database with same CATH topology
5DKNA 1DTLA 1PALA 1QATA 1K9PA 3BOWA 1MWNA 2M1KB 4Q04A 3TUYC 3BUNB 3JVTC 1CLLA 4I5JA 2KAXA 3CZTX 4MZJA 2LAPA 2NXQA 3KF9A 2GGZA 3WHTB 5HLOA 1FBVA 1QJTA 2LANA 3SG5A 2JTTA 1SL8A 4HSZA 1RWYA 1S6JA 4FQOA 2JTZA 1AJ5A 4QJ5B 2ZN9A 3OX6A 2CBLA 1B8LA 5FYXA 5I2QA 4MN0A 1KCYA 1OZSA 1X02A 3EKHA 3FS7A 1DJXA 1SRAA 2LMVA 2NCOA 4YGDB 2WC8A 2F2PA 2M97A 1G4YR 1TN4A 5CSFA 1QS7A 1S3PA 2MBXA 2CXJA 2M8UA 2BCBA 3KEVA 1PRWA 3EVUA 4ZCUA 1LA3A 1PULA 1F8HA 2O60A 1NYAA 1RJVA 2JT0A 4GAOA 3KO0A 2HETA 2NZ0A 2NLNA 5HLVA 4OKHA 2KI6D 2M7NA 1N2DA 3O4YA 4M2OA 1A75B 1UHHA 1MHOA 1EJ3A 1IGVA 4I5KA 3SJSA 2F33A 3OB2B 2LVIA 1F54A 2CCMA 1K90D 2OTGC 3DVEA 1C7WA 2LVJA 2FCEA 1UURA 1XFVO 1YVHA 1IQ5A 1KFXS 1AK8A 1QTXA 3D0YA 4PE1A 3OX5A 5JOLA 2SASA 1OZOA 1SKTA 4YGCB 3SG7A 1UHKA 5D7FA 1BF5A 5G08A 1JFJA 2JPTA 4QJ4B 5CSIA 2E6WA 5D69A 1ZUZA 1OOJA 3DVMA 4GFTA 1K94A 2ZKMX 2Q91A 3MSEB 1B4CA 4C0JA 1JBAA 1CMFA 4BY4A 3RLZA 1KFXL 3NSKA 1EXRA 2OPOA 1H8BA 1XK4A 1EG4A 3AAKA 1JF0A 4MZKA 3LCPC 1S5GZ 4PE0A 4I5LB 1RK9A 3NSIA 2PSRA 3SG6A 1UHIA 2WCFA 4L9MA 5HKWA 3BOWB 1A03A 5DKQA 1M39A 2ZNDA 5I8NA 2ZN8A 1EL4A 4CLNA 1TNPA 1YTZC 1UHNA 2KBIA 2KDHA 2LUCA 2PMYA 3AAJA 1QLKA 3BUWB 4M2PA 1RTP1 1SMGA 1PSBA 1VRKA 1GGZA 1Q80A 3OP0A 2KGBC 2KSPA 4ORBB 5AEQA 2PALA 1K93D 1KK7Z 2Y1NA 1UHJA 1G8IA 2KGRA 1BR1B 1R2UA 1PK0D 2K0JA 2KYFA 1TIZA 3VRQA 1IJ6A 2JXLA 3NSLA 2BL0B 1K2HA 3M0WA 1BG1A 2LLTA 2JNXA 5ER4X 4ICBA 4TNCA 1CLBA 1M31A 2LLSA 1B47A 2BL0C 2F2OA 1FF1A 3SG2A 1SW8A 1PVBA 1LINA 4JWQA 1YUTA 2F8PA 5CSNA 2L0PA 3O78A 1W7JB 3EVRA 2EGDA 2G2BA 1U5IA 4U8DA 3VGOA 2OS8B 2LP3A 1QX2A 1YR5A 1ODBA 4PCWA 5I2LA 1CNPA 4DIRA 2GGMA 1DJHA 5I2OA 1J7OA 5AANA 3D0YB 3BXKA 1CDPA 1RFJA 4PE7A 1SR6B 1SCMB 2BBNA 3CR2A 2LUXA 4DS7A 3A4UB 1SR6C 2WCBA 1B7TZ 2AAOA 3TS5B 2JOJA 4WQ3A 1CM4A 1S6CA 3VRPA 3PSRA 1NCXA 1QVIY 4NDDA 3DD4A 3TS5C 2NCPA 2CNPA 2H61A 4YBHB 1GGWA 2BCAA 1SBJA 4MRYA 2Y5IA 2DOQA 4JPZB 2L50A 3TDZA 1NP8A 4ORCB 3SG4A 1S26D 2BE4A 4PHNA 1MQ1A 4YI9A 2LV7A 1OMDA 2I7AA 2KOTA 2JXCA 3AKBA 3FIAA 4MSPA 5GQQC 1DF0A 1J7RA 2M9GA 1H4BA 1NIWA 1TNWA 1LXFC 2JNFA 3O2PA 2KI6C 2ZRTA 1YURA 2LLUA 1QV0A 3LL8B 3PLFB 2LHLA 1UWOA 1OSAA 3TZ1A 4GGNA 2JZIA 2LVVA 1DMOA 2FOTA 2AUCA 2BKIB 3CS1A 4YGAA 2K2FA 1IKUA 1CLMA 3BQ3A 1WRZA 1RECA 2JT8A 2SCPA 1DGVA 1CTRA 1DJYA 2LE9B 4GBAA 4A4CA 5KSZA 2F3YA 1TCFA 1JSAA 3EK8A 1NX2A 1E8AA 5AFPA 2HQ8A 1JFKA 3CLNA 1U5IB 1Y0VH 2JRFA 1QX5B 3FWCA 3LK0A 5HKZA 5KTYA 1NPQA 3C1VA 1IJ5A 1A4PA 1BJFA 2LM5A 3KPXA 5F6TA 5PALA 2M29A 2HQWA 2LMTA 2FCDA 3GOFA 1F55A 1ALVA 1AHRA 5HYDA 3F45A 1WY9A 3AKAA 1AP4A 2KBMA 3OHMB 1KFUS 2KQ6A 5CPVA 2LNKA 1QXPA 1N0YA 5ER5A 5TNCA 1MXLC 3E3RA 2LCPA 1CMGA 4WRIA 1K9KA 2JT3A 3BUMB 4GGFA 2KYCA 4YGBB 3SG3A 3O6BA 1WRKA 1SNLA 2G9BA 3I5IB 3KHEA 1WLZA 2IS9A 1RROA 1K95A 1J1EA 2KAYA 1SCVA 1Y1XA 1FPWA 2D8NA 1J1DA 2JWWA 2WORA 4OCIA 2LP2A 3SIAA 4D1EA 1QIVA 3VROA 3OB1B 1DF0B 3IQQA 4HRHA 2KHNA 1KQMB 1M46A 1BU3A 1SK6D 1WDCB 1YUSA 1KWOB 2KAVA 1CDNA 3PN7B 4QJ3B 1DJIA 2MJWB 3NXAA 1IWQA 2I18A 1KWOC 3ZWHA 3EKJA 2H2KA 2RGIA 1TNQA 3PN7C 4IL1A 2M49B 1CDMA 1OE9B 4PALA 1XFUO 4FTGA 1S5GY 1QASA 4NQGA 1XA5A 3FWBA 1DVIA 1EG3A 4CPVA 1L2OB 2HF5A 4E68A 3DVKA 3PFVA 5DKRA 2MRDA 1FW4A 1BMOA 3PM8A 2CTNA 4GNKB 1L2OC 2ZFDA 2A4JA 2KNEA 1BR4B 1W7IB 4DCKA 4DRWA 3GK1A 1KQVA 3CWGA 3CR4X 4N1FA 2OS8C 3I5GB 1JWDA 2KFGA 1J7QA 3TDIA 1KK7Y 1ZMZA 1YRUB 2KI4B 2LC5A 2ZRSA 1AUIB 3I5GC 3ICBA 4GUKA 4ZCVA 4F0ZB 2AMIA 2ZNEA 1QVIZ 4A4BA 2VRGA 1IQ3A 3ZNIA 2BCXA 2KI4C 1SCMC 4MEWA 3VRNA 3I5FB 2P6BB 4UPGA 5HKYA 2BE6A 3WNXB 2MAZA 1CFPA 3WHUB 3IF7A 2QPTA 1FI6A 1HT9A 2LMUA 3I5FC 4GPLB 2EC6B 1YVLA 1TOPA 2Y1MA 3DF0A 3QRXA 5IBWA 1NX0A 1JUOA 2CT9A 1XK4C 3EK7A 1QLSA 1NUBA 1BOCA 4AQJA 4N1GA 4MLWA 3BUOB 1NWDA 2K7BA 2MHHA 1XO5A 1TTXA 4OV2A 4NDBA 1Y6WA 4AOMA 2M0RA 1LKJA 1S36A 3LLEA 1DJWA 2MA2A 1IRJA 1NCYA 1CB1A 1NX3A 2K61A 2K7CA 3TUYB 1B7TY 2ISDA 1CFCA 1A2XA 3JVTB 2K7DA 1OMVA 1TRFA 1N65A 1UP5A 2L2EA 1C7VA 5J3XA 2QACA 2I94A 2JULA 1EH2A 2WOSA 3SIBA 2E30A 1XFYO 1OQPA 3WXAA 1BODA 2F3ZA 2WNDA 4C0KA 1LA0A 3EK4A 2O5GA 3NSOA 1DGUA 4XJKA 4CFQA 1MUXA 2BKHB 2K8MB 2R2IA 1YX7A 1ZFSA 4ETOA 3JTDB 1L7ZA 3GK4X 1IH0A 5AERA 1WRLA 1SL7A 1OMRA 3HX4A 3JTDC 1BLQA 1CDLA 2K7OA 2LVKA 4XYNA 2Q4UA 3I5HB 3PATA 1NX1A 1CKKA 4P5OE 5CSJA 3CGAA 3I5HC 1YUUA 1UUSA 2OTGB 4MRXA 4OR9B 1DJZA 4MVFA 1CM1A 4CIDA 4BY5A 1PVAA 3IQOA 3DF0B 5JJGA 1JF2A 2K2AA 2Y4QA 1B9AA 1MXEA 2L5XB 4I5NB 2PRUA 5AXIA 2COLB 3A8RA 1BT6A 1ZACA 2FJUB 2H61C 4PHJA 1C07A 1XFZO 1GJYA 3I5IC 1KFUL 3BYAA 4MZLA 1XFXO 1Y1UA 2EHBA 2I2RE 4M2QA 4PE4A 3K21A 1MF8B 1TNXA 4JQ0D 1CFFA 4PDZA 1F4OA 4USLA 4DUQA 1MR8A 1FI5A 1K9UA 1J55A 3RM1A 1HQVA 4HRGA 2L4IA 3HCMA 2LHIA 1YX8A 1K8UA 1KQMC 1R6PA 1WLMA 1WDCC 3EVVA 1YRTB 1A29A 2PASA 4MBEA 4AQIA 1SPYA 2L51A 1S6IA 3PALA 1DT7B 4R1EA 3TDUA 2KFHA 1F70A 1SY9A 4C0LA 5KU1A 2MLEC 4PHMA 1LVCD 1ZOTB 2L98A 1XFWO 2JC2A 1KK8B 2JU0A 2M1UA 1KSMA 2GV5A 2JQ6A 3DVJA 1KK8C 1IG5A 1GQMA 1QV1A 2B1UA 3LK1A 4ORAB 4YRUA 1DJGA 1V1FA 1D1OA 1J7PA 1TCOB 1Y1AA 2HPSA 4XJKB 1K96A 1NSHA 1XVJA 4PHKA 2L4HA 4P2YB 1B1GA 1S1EA 4N5XA 2BECA 1V1GA 1M45A 3D10A 1A75A 1SYMA 1JC2A 5BPJA 5B8IB 4OVNF 1G33A 1AVSA 5K89A 2KQYA 1M63B 3H4SE 2V53A 2BBMA 4YGEB 3CTNA 4NDCA 1AJ4A 2PVBA 1PSRA 2EC6C 4YI8A 1B8CA 2TN4A 1CFDA 3CR5X 4GGFC 1QIWA 4CFRA 1SL9A 1F71A 1KSOA 4WQ2A 1QX7A 2WCEA 1ALWA 2M7LA 1B8RA 2MLFC 3VRRA 4HREE 1F4QA 1NCZA 2M3WA 3GK2A 1XYDA 2KFFA 3BUXB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5DKN A;  1DTL A;  1PAL A;  1QAT A;  1K9P A;  3BOW A;  1MWN A;  2M1K B;  4Q04 A;  3TUY C;  3BUN B;  3JVT C;  1CLL A;  4I5J A;  2KAX A;  3CZT X;  4MZJ A;  2LAP A;  2NXQ A;  3KF9 A;  2GGZ A;  3WHT B;  5HLO A;  1FBV A;  1QJT A;  2LAN A;  3SG5 A;  2JTT A;  1SL8 A;  4HSZ A;  1RWY A;  1S6J A;  4FQO A;  2JTZ A;  1AJ5 A;  4QJ5 B;  2ZN9 A;  3OX6 A;  2CBL A;  1B8L A;  5FYX A;  5I2Q A;  4MN0 A;  1KCY A;  1OZS A;  1X02 A;  3EKH A;  3FS7 A;  1DJX A;  1SRA A;  2LMV A;  2NCO A;  4YGD B;  2WC8 A;  2F2P A;  2M97 A;  1G4Y R;  1TN4 A;  5CSF A;  1QS7 A;  1S3P A;  2MBX A;  2CXJ A;  2M8U A;  2BCB A;  3KEV A;  1PRW A;  3EVU A;  4ZCU A;  1LA3 A;  1PUL A;  1F8H A;  2O60 A;  1NYA A;  1RJV A;  2JT0 A;  4GAO A;  3KO0 A;  2HET A;  2NZ0 A;  2NLN A;  5HLV A;  4OKH A;  2KI6 D;  2M7N A;  1N2D A;  3O4Y A;  4M2O A;  1A75 B;  1UHH A;  1MHO A;  1EJ3 A;  1IGV A;  4I5K A;  3SJS A;  2F33 A;  3OB2 B;  2LVI A;  1F54 A;  2CCM A;  1K90 D;  2OTG C;  3DVE A;  1C7W A;  2LVJ A;  2FCE A;  1UUR A;  1XFV O;  1YVH A;  1IQ5 A;  1KFX S;  1AK8 A;  1QTX A;  3D0Y A;  4PE1 A;  3OX5 A;  5JOL A;  2SAS A;  1OZO A;  1SKT A;  4YGC B;  3SG7 A;  1UHK A;  5D7F A;  1BF5 A;  5G08 A;  1JFJ A;  2JPT A;  4QJ4 B;  5CSI A;  2E6W A;  5D69 A;  1ZUZ A;  1OOJ A;  3DVM A;  4GFT A;  1K94 A;  2ZKM X;  2Q91 A;  3MSE B;  1B4C A;  4C0J A;  1JBA A;  1CMF A;  4BY4 A;  3RLZ A;  1KFX L;  3NSK A;  1EXR A;  2OPO A;  1H8B A;  1XK4 A;  1EG4 A;  3AAK A;  1JF0 A;  4MZK A;  3LCP C;  1S5G Z;  4PE0 A;  4I5L B;  1RK9 A;  3NSI A;  2PSR A;  3SG6 A;  1UHI A;  2WCF A;  4L9M A;  5HKW A;  3BOW B;  1A03 A;  5DKQ A;  1M39 A;  2ZND A;  5I8N A;  2ZN8 A;  1EL4 A;  4CLN A;  1TNP A;  1YTZ C;  1UHN A;  2KBI A;  2KDH A;  2LUC A;  2PMY A;  3AAJ A;  1QLK A;  3BUW B;  4M2P A;  1RTP 1;  1SMG A;  1PSB A;  1VRK A;  1GGZ A;  1Q80 A;  3OP0 A;  2KGB C;  2KSP A;  4ORB B;  5AEQ A;  2PAL A;  1K93 D;  1KK7 Z;  2Y1N A;  1UHJ A;  1G8I A;  2KGR A;  1BR1 B;  1R2U A;  1PK0 D;  2K0J A;  2KYF A;  1TIZ A;  3VRQ A;  1IJ6 A;  2JXL A;  3NSL A;  2BL0 B;  1K2H A;  3M0W A;  1BG1 A;  2LLT A;  2JNX A;  5ER4 X;  4ICB A;  4TNC A;  1CLB A;  1M31 A;  2LLS A;  1B47 A;  2BL0 C;  2F2O A;  1FF1 A;  3SG2 A;  1SW8 A;  1PVB A;  1LIN A;  4JWQ A;  1YUT A;  2F8P A;  5CSN A;  2L0P A;  3O78 A;  1W7J B;  3EVR A;  2EGD A;  2G2B A;  1U5I A;  4U8D A;  3VGO A;  2OS8 B;  2LP3 A;  1QX2 A;  1YR5 A;  1ODB A;  4PCW A;  5I2L A;  1CNP A;  4DIR A;  2GGM A;  1DJH A;  5I2O A;  1J7O A;  5AAN A;  3D0Y B;  3BXK A;  1CDP A;  1RFJ A;  4PE7 A;  1SR6 B;  1SCM B;  2BBN A;  3CR2 A;  2LUX A;  4DS7 A;  3A4U B;  1SR6 C;  2WCB A;  1B7T Z;  2AAO A;  3TS5 B;  2JOJ A;  4WQ3 A;  1CM4 A;  1S6C A;  3VRP A;  3PSR A;  1NCX A;  1QVI Y;  4NDD A;  3DD4 A;  3TS5 C;  2NCP A;  2CNP A;  2H61 A;  4YBH B;  1GGW A;  2BCA A;  1SBJ A;  4MRY A;  2Y5I A;  2DOQ A;  4JPZ B;  2L50 A;  3TDZ A;  1NP8 A;  4ORC B;  3SG4 A;  1S26 D;  2BE4 A;  4PHN A;  1MQ1 A;  4YI9 A;  2LV7 A;  1OMD A;  2I7A A;  2KOT A;  2JXC A;  3AKB A;  3FIA A;  4MSP A;  5GQQ C;  1DF0 A;  1J7R A;  2M9G A;  1H4B A;  1NIW A;  1TNW A;  1LXF C;  2JNF A;  3O2P A;  2KI6 C;  2ZRT A;  1YUR A;  2LLU A;  1QV0 A;  3LL8 B;  3PLF B;  2LHL A;  1UWO A;  1OSA A;  3TZ1 A;  4GGN A;  2JZI A;  2LVV A;  1DMO A;  2FOT A;  2AUC A;  2BKI B;  3CS1 A;  4YGA A;  2K2F A;  1IKU A;  1CLM A;  3BQ3 A;  1WRZ A;  1REC A;  2JT8 A;  2SCP A;  1DGV A;  1CTR A;  1DJY A;  2LE9 B;  4GBA A;  4A4C A;  5KSZ A;  2F3Y A;  1TCF A;  1JSA A;  3EK8 A;  1NX2 A;  1E8A A;  5AFP A;  2HQ8 A;  1JFK A;  3CLN A;  1U5I B;  1Y0V H;  2JRF A;  1QX5 B;  3FWC A;  3LK0 A;  5HKZ A;  5KTY A;  1NPQ A;  3C1V A;  1IJ5 A;  1A4P A;  1BJF A;  2LM5 A;  3KPX A;  5F6T A;  5PAL A;  2M29 A;  2HQW A;  2LMT A;  2FCD A;  3GOF A;  1F55 A;  1ALV A;  1AHR A;  5HYD A;  3F45 A;  1WY9 A;  3AKA A;  1AP4 A;  2KBM A;  3OHM B;  1KFU S;  2KQ6 A;  5CPV A;  2LNK A;  1QXP A;  1N0Y A;  5ER5 A;  5TNC A;  1MXL C;  3E3R A;  2LCP A;  1CMG A;  4WRI A;  1K9K A;  2JT3 A;  3BUM B;  4GGF A;  2KYC A;  4YGB B;  3SG3 A;  3O6B A;  1WRK A;  1SNL A;  2G9B A;  3I5I B;  3KHE A;  1WLZ A;  2IS9 A;  1RRO A;  1K95 A;  1J1E A;  2KAY A;  1SCV A;  1Y1X A;  1FPW A;  2D8N A;  1J1D A;  2JWW A;  2WOR A;  4OCI A;  2LP2 A;  3SIA A;  4D1E A;  1QIV A;  3VRO A;  3OB1 B;  1DF0 B;  3IQQ A;  4HRH A;  2KHN A;  1KQM B;  1M46 A;  1BU3 A;  1SK6 D;  1WDC B;  1YUS A;  1KWO B;  2KAV A;  1CDN A;  3PN7 B;  4QJ3 B;  1DJI A;  2MJW B;  3NXA A;  1IWQ A;  2I18 A;  1KWO C;  3ZWH A;  3EKJ A;  2H2K A;  2RGI A;  1TNQ A;  3PN7 C;  4IL1 A;  2M49 B;  1CDM A;  1OE9 B;  4PAL A;  1XFU O;  4FTG A;  1S5G Y;  1QAS A;  4NQG A;  1XA5 A;  3FWB A;  1DVI A;  1EG3 A;  4CPV A;  1L2O B;  2HF5 A;  4E68 A;  3DVK A;  3PFV A;  5DKR A;  2MRD A;  1FW4 A;  1BMO A;  3PM8 A;  2CTN A;  4GNK B;  1L2O C;  2ZFD A;  2A4J A;  2KNE A;  1BR4 B;  1W7I B;  4DCK A;  4DRW A;  3GK1 A;  1KQV A;  3CWG A;  3CR4 X;  4N1F A;  2OS8 C;  3I5G B;  1JWD A;  2KFG A;  1J7Q A;  3TDI A;  1KK7 Y;  1ZMZ A;  1YRU B;  2KI4 B;  2LC5 A;  2ZRS A;  1AUI B;  3I5G C;  3ICB A;  4GUK A;  4ZCV A;  4F0Z B;  2AMI A;  2ZNE A;  1QVI Z;  4A4B A;  2VRG A;  1IQ3 A;  3ZNI A;  2BCX A;  2KI4 C;  1SCM C;  4MEW A;  3VRN A;  3I5F B;  2P6B B;  4UPG A;  5HKY A;  2BE6 A;  3WNX B;  2MAZ A;  1CFP A;  3WHU B;  3IF7 A;  2QPT A;  1FI6 A;  1HT9 A;  2LMU A;  3I5F C;  4GPL B;  2EC6 B;  1YVL A;  1TOP A;  2Y1M A;  3DF0 A;  3QRX A;  5IBW A;  1NX0 A;  1JUO A;  2CT9 A;  1XK4 C;  3EK7 A;  1QLS A;  1NUB A;  1BOC A;  4AQJ A;  4N1G A;  4MLW A;  3BUO B;  1NWD A;  2K7B A;  2MHH A;  1XO5 A;  1TTX A;  4OV2 A;  4NDB A;  1Y6W A;  4AOM A;  2M0R A;  1LKJ A;  1S36 A;  3LLE A;  1DJW A;  2MA2 A;  1IRJ A;  1NCY A;  1CB1 A;  1NX3 A;  2K61 A;  2K7C A;  3TUY B;  1B7T Y;  2ISD A;  1CFC A;  1A2X A;  3JVT B;  2K7D A;  1OMV A;  1TRF A;  1N65 A;  1UP5 A;  2L2E A;  1C7V A;  5J3X A;  2QAC A;  2I94 A;  2JUL A;  1EH2 A;  2WOS A;  3SIB A;  2E30 A;  1XFY O;  1OQP A;  3WXA A;  1BOD A;  2F3Z A;  2WND A;  4C0K A;  1LA0 A;  3EK4 A;  2O5G A;  3NSO A;  1DGU A;  4XJK A;  4CFQ A;  1MUX A;  2BKH B;  2K8M B;  2R2I A;  1YX7 A;  1ZFS A;  4ETO A;  3JTD B;  1L7Z A;  3GK4 X;  1IH0 A;  5AER A;  1WRL A;  1SL7 A;  1OMR A;  3HX4 A;  3JTD C;  1BLQ A;  1CDL A;  2K7O A;  2LVK A;  4XYN A;  2Q4U A;  3I5H B;  3PAT A;  1NX1 A;  1CKK A;  4P5O E;  5CSJ A;  3CGA A;  3I5H C;  1YUU A;  1UUS A;  2OTG B;  4MRX A;  4OR9 B;  1DJZ A;  4MVF A;  1CM1 A;  4CID A;  4BY5 A;  1PVA A;  3IQO A;  3DF0 B;  5JJG A;  1JF2 A;  2K2A A;  2Y4Q A;  1B9A A;  1MXE A;  2L5X B;  4I5N B;  2PRU A;  5AXI A;  2COL B;  3A8R A;  1BT6 A;  1ZAC A;  2FJU B;  2H61 C;  4PHJ A;  1C07 A;  1XFZ O;  1GJY A;  3I5I C;  1KFU L;  3BYA A;  4MZL A;  1XFX O;  1Y1U A;  2EHB A;  2I2R E;  4M2Q A;  4PE4 A;  3K21 A;  1MF8 B;  1TNX A;  4JQ0 D;  1CFF A;  4PDZ A;  1F4O A;  4USL A;  4DUQ A;  1MR8 A;  1FI5 A;  1K9U A;  1J55 A;  3RM1 A;  1HQV A;  4HRG A;  2L4I A;  3HCM A;  2LHI A;  1YX8 A;  1K8U A;  1KQM C;  1R6P A;  1WLM A;  1WDC C;  3EVV A;  1YRT B;  1A29 A;  2PAS A;  4MBE A;  4AQI A;  1SPY A;  2L51 A;  1S6I A;  3PAL A;  1DT7 B;  4R1E A;  3TDU A;  2KFH A;  1F70 A;  1SY9 A;  4C0L A;  5KU1 A;  2MLE C;  4PHM A;  1LVC D;  1ZOT B;  2L98 A;  1XFW O;  2JC2 A;  1KK8 B;  2JU0 A;  2M1U A;  1KSM A;  2GV5 A;  2JQ6 A;  3DVJ A;  1KK8 C;  1IG5 A;  1GQM A;  1QV1 A;  2B1U A;  3LK1 A;  4ORA B;  4YRU A;  1DJG A;  1V1F A;  1D1O A;  1J7P A;  1TCO B;  1Y1A A;  2HPS A;  4XJK B;  1K96 A;  1NSH A;  1XVJ A;  4PHK A;  2L4H A;  4P2Y B;  1B1G A;  1S1E A;  4N5X A;  2BEC A;  1V1G A;  1M45 A;  3D10 A;  1A75 A;  1SYM A;  1JC2 A;  5BPJ A;  5B8I B;  4OVN F;  1G33 A;  1AVS A;  5K89 A;  2KQY A;  1M63 B;  3H4S E;  2V53 A;  2BBM A;  4YGE B;  3CTN A;  4NDC A;  1AJ4 A;  2PVB A;  1PSR A;  2EC6 C;  4YI8 A;  1B8C A;  2TN4 A;  1CFD A;  3CR5 X;  4GGF C;  1QIW A;  4CFR A;  1SL9 A;  1F71 A;  1KSO A;  4WQ2 A;  1QX7 A;  2WCE A;  1ALW A;  2M7L A;  1B8R A;  2MLF C;  3VRR A;  4HRE E;  1F4Q A;  1NCZ A;  2M3W A;  3GK2 A;  1XYD A;  2KFF A;  3BUX B; 
#chains in the Genus database with same CATH topology
 5DKN A;  1DTL A;  1PAL A;  1QAT A;  1K9P A;  3BOW A;  1MWN A;  2M1K B;  4Q04 A;  3TUY C;  3BFB A;  3BUN B;  3JVT C;  1CLL A;  4I5J A;  2KAX A;  3CZT X;  2QDI A;  4JKT A;  1GM0 A;  4MZJ A;  2LAP A;  2NXQ A;  3KF9 A;  2GGZ A;  3WHT B;  5HLO A;  1FBV A;  1QJT A;  2LAN A;  3CYZ A;  2JTT A;  1SL8 A;  3SG5 A;  5DIC A;  4HSZ A;  1RWY A;  1S6J A;  4FQO A;  2JTZ A;  2L5Y A;  1AJ5 A;  4QJ5 B;  2ZN9 A;  3OX6 A;  2CBL A;  1B8L A;  5FYX A;  5I2Q A;  3QME A;  4MN0 A;  1OZS A;  1X02 A;  1KCY A;  3EKH A;  3FS7 A;  1DJX A;  2KLE A;  1SRA A;  2LMV A;  2NCO A;  4YGD B;  2WC8 A;  2F2P A;  2M97 A;  1G4Y R;  1TN4 A;  5CSF A;  1QS7 A;  1S3P A;  2MBX A;  2CXJ A;  2M8U A;  3BJH A;  2BCB A;  3KEV A;  1PRW A;  3EVU A;  1OOH A;  4ZCU A;  1LA3 A;  1PUL A;  1C3Y A;  2O60 A;  1F8H A;  1NYA A;  1RJV A;  2JT0 A;  4GAO A;  3KO0 A;  2HET A;  2NZ0 A;  2NLN A;  5HLV A;  4OKH A;  2KI6 D;  3UNW A;  2M7N A;  1N2D A;  2PYQ A;  3O4Y A;  4M2O A;  1A75 B;  1UHH A;  1MHO A;  1EJ3 A;  3DZT A;  1IGV A;  4I5K A;  4JD9 A;  3SJS A;  2F33 A;  3OB2 B;  2LVI A;  1F54 A;  2CCM A;  1K90 D;  2OTG C;  3DVE A;  1C7W A;  3CDN A;  2LVJ A;  2FCE A;  1UUR A;  1XFV O;  1YVH A;  1IQ5 A;  1KFX S;  1AK8 A;  2K60 A;  1QTX A;  3D0Y A;  4PE1 A;  3OX5 A;  5JOL A;  2SAS A;  1OZO A;  1SKT A;  4YGC B;  3SG7 A;  4F7F A;  1UHK A;  5D7F A;  1BF5 A;  5G08 A;  1JFJ A;  2JPT A;  4QJ4 B;  5CSI A;  2E6W A;  5D69 A;  1ZUZ A;  1OOJ A;  3DVM A;  4GFT A;  1K94 A;  2ZKM X;  2Q91 A;  3MSE B;  1B4C A;  4C0J A;  1JBA A;  1CMF A;  4BY4 A;  3RLZ A;  1KFX L;  3NSK A;  1EXR A;  2OPO A;  1H8B A;  1XK4 A;  1EG4 A;  3AAK A;  3Q8I A;  3S0G A;  2WC6 A;  1JF0 A;  4MZK A;  3LCP C;  1S5G Z;  4PE0 A;  4I5L B;  1RK9 A;  3NSI A;  2PSR A;  3SG6 A;  1UHI A;  2WCF A;  4L9M A;  5HKW A;  3BOW B;  1A03 A;  5DKQ A;  1M39 A;  2ZND A;  5I8N A;  3B88 A;  2ZN8 A;  1EL4 A;  3D73 A;  4CLN A;  1TNP A;  1YTZ C;  1UHN A;  2KBI A;  2KDH A;  2LUC A;  2PMY A;  3AAJ A;  3IVT A;  1QLK A;  3BUW B;  4M2P A;  1RTP 1;  1SMG A;  1PSB A;  1VRK A;  1GGZ A;  1Q80 A;  3OP0 A;  2KGB C;  2KSP A;  1T14 A;  4ORB B;  3PM2 A;  3L4L A;  5AEQ A;  2PAL A;  1K93 D;  1KK7 Z;  2Y1N A;  1UHJ A;  1G8I A;  2KGR A;  1BR1 B;  1R2U A;  1PK0 D;  2K0J A;  3CZ0 A;  2KYF A;  1TIZ A;  3VRQ A;  1IJ6 A;  2JXL A;  3NSL A;  2BL0 B;  1K2H A;  3M0W A;  1BG1 A;  2LLT A;  2JNX A;  5ER4 X;  4ICB A;  4TNC A;  1CLB A;  3N7H A;  1M31 A;  2LLS A;  1B47 A;  2BL0 C;  2F2O A;  1DEL A;  1W9Z A;  1FF1 A;  3SG2 A;  1SW8 A;  1PVB A;  1LIN A;  4JWQ A;  1YUT A;  2F8P A;  5CSN A;  2L0P A;  3O78 A;  1W7J B;  3EVR A;  2EGD A;  2G2B A;  1U5I A;  4U8D A;  3VGO A;  2OS8 B;  2LP3 A;  1QX2 A;  3EG5 B;  1YR5 A;  1ODB A;  4PCW A;  5I2L A;  1CNP A;  4DIR A;  2GGM A;  1DJH A;  5I2O A;  1J7O A;  5AAN A;  3D0Y B;  3BXK A;  1CDP A;  1RFJ A;  4PE7 A;  1SR6 B;  1SCM B;  1TUJ A;  2BBN A;  3CR2 A;  2LUX A;  3L4A A;  2WC5 A;  2H8V A;  3A4U B;  3S0D A;  4DS7 A;  1SR6 C;  2WCB A;  1B7T Z;  2AAO A;  3TS5 B;  2JOJ A;  4WQ3 A;  1CM4 A;  1S6C A;  4IJ7 A;  3VRP A;  3PSR A;  1NCX A;  1QVI Y;  4NDD A;  3DD4 A;  3TS5 C;  2NCP A;  2CNP A;  2H61 A;  4YBH B;  1GGW A;  2BCA A;  1SBJ A;  4MRY A;  3D78 A;  2Y5I A;  2DOQ A;  4JPZ B;  2L50 A;  3B6X A;  3TDZ A;  1NP8 A;  4ORC B;  3SG4 A;  1S26 D;  2BE4 A;  2QEB A;  3S0E A;  4PHN A;  1MQ1 A;  4YI9 A;  2LV7 A;  1OMD A;  2I7A A;  2KOT A;  2JXC A;  3AKB A;  4INW A;  3FIA A;  4MSP A;  5GQQ C;  1DF0 A;  1J7R A;  2M9G A;  1H4B A;  1NIW A;  1TNW A;  1LXF C;  2JNF A;  3O2P A;  2KI6 C;  2ZRT A;  1YUR A;  2LLU A;  3PJI A;  1QV0 A;  3LL8 B;  3PLF B;  2LHL A;  1UWO A;  1OSA A;  3TZ1 A;  4GGN A;  2JZI A;  2LVV A;  1DMO A;  2FOT A;  2AUC A;  2BKI B;  3CS1 A;  4YGA A;  2K2F A;  1IKU A;  1CLM A;  2YGU A;  3BQ3 A;  1IIO A;  1WRZ A;  3BFH A;  1REC A;  3R1P A;  2JT8 A;  2SCP A;  1DGV A;  1CTR A;  1DJY A;  2LE9 B;  4GBA A;  4A4C A;  5KSZ A;  4INX A;  2F3Y A;  1TCF A;  1JSA A;  3FE9 A;  1OW4 A;  3EK8 A;  4PT1 A;  1NX2 A;  1E8A A;  5AFP A;  2HQ8 A;  1JFK A;  3CLN A;  1U5I B;  3NHI A;  1Y0V H;  2JRF A;  1DEK A;  1QX5 B;  3DY9 A;  3FWC A;  3LK0 A;  5HL1 A;  5HKZ A;  5KTY A;  1SSE B;  1TUZ A;  1NPQ A;  3C1V A;  2KPH A;  1IJ5 A;  1A4P A;  1BJF A;  2LM5 A;  3KPX A;  5F6T A;  5PAL A;  1Z2C B;  2M29 A;  2HQW A;  2LMT A;  2FCD A;  3GOF A;  1F55 A;  1ALV A;  1AHR A;  5HYD A;  3F45 A;  1WY9 A;  2WCH A;  3AKA A;  1AP4 A;  2KBM A;  3OHM B;  2BAP A;  2QEO A;  1KFU S;  2KQ6 A;  5CPV A;  2ERB A;  2LNK A;  1QXP A;  1N0Y A;  5ER5 A;  5TNC A;  1MXL C;  3E3R A;  2LCP A;  1CMG A;  4WRI A;  1K9K A;  2JT3 A;  3BUM B;  4GGF A;  2KYC A;  4YGB B;  3SG3 A;  3O6B A;  1WRK A;  5FI7 A;  1SNL A;  2G9B A;  3I5I B;  3KHE A;  1WLZ A;  2IS9 A;  3SS5 A;  1RRO A;  1K95 A;  1J1E A;  2KAY A;  1SCV A;  3FE8 A;  1Y1X A;  1FPW A;  3UO9 A;  2D8N A;  1J1D A;  2JWW A;  2WOR A;  4OCI A;  2LP2 A;  3SIA A;  4D1E A;  1QIV A;  3VRO A;  3D77 A;  1DF0 B;  3OB1 B;  3IQQ A;  4HRH A;  2KHN A;  1KQM B;  1M46 A;  1BU3 A;  1SK6 D;  1WDC B;  1YUS A;  1KWO B;  2KAV A;  2WCM A;  1CDN A;  3PN7 B;  4QJ3 B;  1DJI A;  2MJW B;  3NXA A;  1IWQ A;  2I18 A;  1KWO C;  3ZWH A;  3EKJ A;  3K1E A;  2H2K A;  2RGI A;  1TNQ A;  3PN7 C;  4IL1 A;  2M49 B;  3NGV A;  1CDM A;  1OE9 B;  3CZ2 A;  4PAL A;  1XFU O;  2KLD A;  4FTG A;  1S5G Y;  1QAS A;  2GTE A;  4NQG A;  1XA5 A;  3FWB A;  1DVI A;  1EG3 A;  4CPV A;  1L2O B;  2HF5 A;  4E68 A;  3DVK A;  3PFV A;  5DKR A;  3R72 A;  2MRD A;  1FW4 A;  2P71 A;  1BMO A;  3PM8 A;  2CTN A;  4GNK B;  1L2O C;  3B86 A;  2ZFD A;  2A4J A;  2KNE A;  1BR4 B;  1W7I B;  4DCK A;  3R1V A;  4DRW A;  3GK1 A;  1KQV A;  1QWV A;  3CWG A;  3CR4 X;  4N1F A;  2OS8 C;  3I5G B;  1JWD A;  2KFG A;  1J7Q A;  3TDI A;  1KK7 Y;  1ZMZ A;  1YRU B;  2KI4 B;  2LC5 A;  2ZRS A;  1AUI B;  3I5G C;  3ICB A;  4GUK A;  4ZCV A;  4F0Z B;  2AMI A;  2QEV A;  1QVI Z;  2ZNE A;  2VRG A;  4A4B A;  1IQ3 A;  3ZNI A;  2BCX A;  2KI4 C;  1SCM C;  4MEW A;  3VRN A;  3I5F B;  2P6B B;  4UPG A;  5HKY A;  2BE6 A;  3WNX B;  1ORG A;  2MAZ A;  1CFP A;  3WHU B;  3IF7 A;  2QPT A;  1FI6 A;  1HT9 A;  2LMU A;  3I5F C;  4GPL B;  2EC6 B;  1YVL A;  1TOP A;  2Y1M A;  3DF0 A;  3QRX A;  1OOG A;  3VB1 A;  5IBW A;  2WCK A;  3NHT A;  1NX0 A;  1JUO A;  2CT9 A;  1XK4 C;  3EK7 A;  1QLS A;  5EL2 A;  1NUB A;  1BOC A;  3OGN A;  3O4X A;  4N1G A;  4MLW A;  4AQJ A;  3BUO B;  4FQT A;  1NWD A;  2K7B A;  2MHH A;  1XO5 A;  1TTX A;  2L2C A;  4OV2 A;  3S0B A;  4NDB A;  1Y6W A;  4AOM A;  2M0R A;  1LKJ A;  1S36 A;  3LLE A;  1DJW A;  2MA2 A;  1IRJ A;  1NCY A;  1CB1 A;  1NX3 A;  3S0F A;  2K61 A;  2K7C A;  3TUY B;  5D3O A;  1B7T Y;  2ISD A;  1CFC A;  2JPO A;  1A2X A;  3JVT B;  2K7D A;  1OMV A;  1TRF A;  1N65 A;  1UP5 A;  2L2E A;  1C7V A;  5J3X A;  2QEH A;  2QAC A;  2I94 A;  2JUL A;  1EH2 A;  2WOS A;  1C3Z A;  3SIB A;  2E30 A;  1LS8 A;  1XFY O;  1OQP A;  3WXA A;  5I94 A;  1BOD A;  2F3Z A;  2WND A;  4C0K A;  3SS4 A;  3D75 A;  1LA0 A;  3EK4 A;  2O5G A;  3S0A A;  3L47 A;  3NSO A;  1DGU A;  4XJK A;  4CFQ A;  1MUX A;  2BKH B;  2K8M B;  2R2I A;  3SS3 A;  1YX7 A;  4OZD A;  1ZFS A;  4ETO A;  3JTD B;  1L7Z A;  3GK4 X;  1IH0 A;  5AER A;  1WRL A;  1SL7 A;  1OMR A;  3HX4 A;  3JTD C;  1BLQ A;  1CDL A;  1OOI X;  3RZS A;  2K7O A;  2LVK A;  4XYN A;  2Q4U A;  3I5H B;  3PAT A;  1NX1 A;  1CKK A;  4P5O E;  5CSJ A;  3B87 A;  3CGA A;  3I5H C;  1YUU A;  1UUS A;  2OTG B;  4MRX A;  4OR9 B;  1DJZ A;  4MVF A;  1CM1 A;  4CID A;  4BY5 A;  1PVA A;  3IQO A;  2WCL A;  3DF0 B;  5JJG A;  1JF2 A;  2K2A A;  2Y4Q A;  1B9A A;  1MXE A;  2L5X B;  4I5N B;  1Z4H A;  2PRU A;  3OBV A;  2COL B;  5AXI A;  3D76 A;  3A8R A;  3R1O A;  1BT6 A;  1ZAC A;  2FJU B;  2H61 C;  4PHJ A;  1C07 A;  1XFZ O;  1GJY A;  3I5I C;  1KFU L;  1XFR A;  3BYA A;  1XFX O;  4MZL A;  1Y1U A;  2EHB A;  2I2R E;  4M2Q A;  4PE4 A;  3K21 A;  1MF8 B;  1TNX A;  4JQ0 D;  1CFF A;  4PDZ A;  1F4O A;  4USL A;  4DUQ A;  1MR8 A;  1FI5 A;  1K9U A;  1J55 A;  3RM1 A;  4KYN A;  1HQV A;  4HRG A;  2L4I A;  3HCM A;  2LHI A;  1YX8 A;  1K8U A;  1KQM C;  1R6P A;  1WLM A;  1WDC C;  3EVV A;  1YRT B;  1A29 A;  2PAS A;  4MBE A;  4AQI A;  1SPY A;  2L51 A;  1S6I A;  3PAL A;  1DT7 B;  3CZ1 A;  4R1E A;  3TDU A;  1OOF A;  2KFH A;  2PQL A;  1F70 A;  1SY9 A;  3CAB A;  4C0L A;  5KU1 A;  2MLE C;  4PHM A;  1LVC D;  1ZOT B;  2L98 A;  1XFW O;  2JC2 A;  1KK8 B;  2JU0 A;  1TWO A;  2M1U A;  1KSM A;  5FI2 A;  2GV5 A;  2JQ6 A;  3DVJ A;  1KK8 C;  1IG5 A;  1GQM A;  3D74 A;  1QV1 A;  2B1U A;  3LK1 A;  1DQE A;  4ORA B;  4YRU A;  1DJG A;  1V1F A;  1D1O A;  1J7P A;  1TCO B;  1Y1A A;  2HPS A;  4XJK B;  1K96 A;  1NSH A;  1XVJ A;  4PHK A;  3V2L A;  2WCJ A;  2L4H A;  3B7A A;  4P2Y B;  1B1G A;  1S1E A;  2BNX A;  4N5X A;  2BEC A;  1P28 A;  1V1G A;  1M45 A;  3D10 A;  1A75 A;  1SYM A;  1JC2 A;  3DYE A;  3DXL A;  4OVN F;  5B8I B;  5BPJ A;  1G33 A;  1AVS A;  2P70 A;  5K89 A;  2KQY A;  1M63 B;  3H4S E;  2V53 A;  2BBM A;  4YGE B;  3CTN A;  4NDC A;  1AJ4 A;  2PVB A;  1DC1 A;  1PSR A;  2EC6 C;  4YI8 A;  1B8C A;  2FJY A;  2TN4 A;  1CFD A;  3CR5 X;  5FI6 A;  4GGF C;  1QIW A;  4CFR A;  1SL9 A;  3BFA A;  1KSO A;  1F71 A;  4WQ2 A;  1QX7 A;  2WCE A;  1ALW A;  3FE6 A;  2M7L A;  1B8R A;  2MLF C;  3VRR A;  4HRE E;  1F4Q A;  1NCZ A;  2M3W A;  3GK2 A;  1XYD A;  2KFF A;  3BUX B; 
#chains in the Genus database with same CATH homology
 5DKN A;  1DTL A;  1PAL A;  1QAT A;  1K9P A;  3BOW A;  1MWN A;  2M1K B;  4Q04 A;  3TUY C;  3BUN B;  3JVT C;  1CLL A;  4I5J A;  2KAX A;  3CZT X;  4MZJ A;  2LAP A;  2NXQ A;  3KF9 A;  2GGZ A;  3WHT B;  5HLO A;  1FBV A;  1QJT A;  2LAN A;  3SG5 A;  2JTT A;  1SL8 A;  4HSZ A;  1RWY A;  1S6J A;  4FQO A;  2JTZ A;  1AJ5 A;  4QJ5 B;  2ZN9 A;  3OX6 A;  2CBL A;  1B8L A;  5FYX A;  5I2Q A;  4MN0 A;  1KCY A;  1OZS A;  1X02 A;  3EKH A;  3FS7 A;  1DJX A;  1SRA A;  2LMV A;  2NCO A;  4YGD B;  2WC8 A;  2F2P A;  2M97 A;  1G4Y R;  1TN4 A;  5CSF A;  1QS7 A;  1S3P A;  2MBX A;  2CXJ A;  2M8U A;  2BCB A;  3KEV A;  1PRW A;  3EVU A;  4ZCU A;  1LA3 A;  1PUL A;  1F8H A;  2O60 A;  1NYA A;  1RJV A;  2JT0 A;  4GAO A;  3KO0 A;  2HET A;  2NZ0 A;  2NLN A;  5HLV A;  4OKH A;  2KI6 D;  2M7N A;  1N2D A;  3O4Y A;  4M2O A;  1A75 B;  1UHH A;  1MHO A;  1EJ3 A;  1IGV A;  4I5K A;  3SJS A;  2F33 A;  3OB2 B;  2LVI A;  1F54 A;  2CCM A;  1K90 D;  2OTG C;  3DVE A;  1C7W A;  2LVJ A;  2FCE A;  1UUR A;  1XFV O;  1YVH A;  1IQ5 A;  1KFX S;  1AK8 A;  1QTX A;  3D0Y A;  4PE1 A;  3OX5 A;  5JOL A;  2SAS A;  1OZO A;  1SKT A;  4YGC B;  3SG7 A;  1UHK A;  5D7F A;  1BF5 A;  5G08 A;  1JFJ A;  2JPT A;  4QJ4 B;  5CSI A;  2E6W A;  5D69 A;  1ZUZ A;  1OOJ A;  3DVM A;  4GFT A;  1K94 A;  2ZKM X;  2Q91 A;  3MSE B;  1B4C A;  4C0J A;  1JBA A;  1CMF A;  4BY4 A;  3RLZ A;  1KFX L;  3NSK A;  1EXR A;  2OPO A;  1H8B A;  1XK4 A;  1EG4 A;  3AAK A;  1JF0 A;  4MZK A;  3LCP C;  1S5G Z;  4PE0 A;  4I5L B;  1RK9 A;  3NSI A;  2PSR A;  3SG6 A;  1UHI A;  2WCF A;  4L9M A;  5HKW A;  3BOW B;  1A03 A;  5DKQ A;  1M39 A;  2ZND A;  5I8N A;  2ZN8 A;  1EL4 A;  4CLN A;  1TNP A;  1YTZ C;  1UHN A;  2KBI A;  2KDH A;  2LUC A;  2PMY A;  3AAJ A;  1QLK A;  3BUW B;  4M2P A;  1RTP 1;  1SMG A;  1PSB A;  1VRK A;  1GGZ A;  1Q80 A;  3OP0 A;  2KGB C;  2KSP A;  4ORB B;  5AEQ A;  2PAL A;  1K93 D;  1KK7 Z;  2Y1N A;  1UHJ A;  1G8I A;  2KGR A;  1BR1 B;  1R2U A;  1PK0 D;  2K0J A;  2KYF A;  1TIZ A;  3VRQ A;  1IJ6 A;  2JXL A;  3NSL A;  2BL0 B;  1K2H A;  3M0W A;  1BG1 A;  2LLT A;  2JNX A;  5ER4 X;  4ICB A;  4TNC A;  1CLB A;  1M31 A;  2LLS A;  1B47 A;  2BL0 C;  2F2O A;  1FF1 A;  3SG2 A;  1SW8 A;  1PVB A;  1LIN A;  4JWQ A;  1YUT A;  2F8P A;  5CSN A;  2L0P A;  3O78 A;  1W7J B;  3EVR A;  2EGD A;  2G2B A;  1U5I A;  4U8D A;  3VGO A;  2OS8 B;  2LP3 A;  1QX2 A;  1YR5 A;  1ODB A;  4PCW A;  5I2L A;  1CNP A;  4DIR A;  2GGM A;  1DJH A;  5I2O A;  1J7O A;  5AAN A;  3D0Y B;  3BXK A;  1CDP A;  1RFJ A;  4PE7 A;  1SR6 B;  1SCM B;  2BBN A;  3CR2 A;  2LUX A;  4DS7 A;  3A4U B;  1SR6 C;  2WCB A;  1B7T Z;  2AAO A;  3TS5 B;  2JOJ A;  4WQ3 A;  1CM4 A;  1S6C A;  3VRP A;  3PSR A;  1NCX A;  1QVI Y;  4NDD A;  3DD4 A;  3TS5 C;  2NCP A;  2CNP A;  2H61 A;  4YBH B;  1GGW A;  2BCA A;  1SBJ A;  4MRY A;  2Y5I A;  2DOQ A;  4JPZ B;  2L50 A;  3TDZ A;  1NP8 A;  4ORC B;  3SG4 A;  1S26 D;  2BE4 A;  4PHN A;  1MQ1 A;  4YI9 A;  2LV7 A;  1OMD A;  2I7A A;  2KOT A;  2JXC A;  3AKB A;  3FIA A;  4MSP A;  5GQQ C;  1DF0 A;  1J7R A;  2M9G A;  1H4B A;  1NIW A;  1TNW A;  1LXF C;  2JNF A;  3O2P A;  2KI6 C;  2ZRT A;  1YUR A;  2LLU A;  1QV0 A;  3LL8 B;  3PLF B;  2LHL A;  1UWO A;  1OSA A;  3TZ1 A;  4GGN A;  2JZI A;  2LVV A;  1DMO A;  2FOT A;  2AUC A;  2BKI B;  3CS1 A;  4YGA A;  2K2F A;  1IKU A;  1CLM A;  3BQ3 A;  1WRZ A;  1REC A;  2JT8 A;  2SCP A;  1DGV A;  1CTR A;  1DJY A;  2LE9 B;  4GBA A;  4A4C A;  5KSZ A;  2F3Y A;  1TCF A;  1JSA A;  3EK8 A;  1NX2 A;  1E8A A;  5AFP A;  2HQ8 A;  1JFK A;  3CLN A;  1U5I B;  1Y0V H;  2JRF A;  1QX5 B;  3FWC A;  3LK0 A;  5HKZ A;  5KTY A;  1NPQ A;  3C1V A;  1IJ5 A;  1A4P A;  1BJF A;  2LM5 A;  3KPX A;  5F6T A;  5PAL A;  2M29 A;  2HQW A;  2LMT A;  2FCD A;  3GOF A;  1F55 A;  1ALV A;  1AHR A;  5HYD A;  3F45 A;  1WY9 A;  3AKA A;  1AP4 A;  2KBM A;  3OHM B;  1KFU S;  2KQ6 A;  5CPV A;  2LNK A;  1QXP A;  1N0Y A;  5ER5 A;  5TNC A;  1MXL C;  3E3R A;  2LCP A;  1CMG A;  4WRI A;  1K9K A;  2JT3 A;  3BUM B;  4GGF A;  2KYC A;  4YGB B;  3SG3 A;  3O6B A;  1WRK A;  1SNL A;  2G9B A;  3I5I B;  3KHE A;  1WLZ A;  2IS9 A;  1RRO A;  1K95 A;  1J1E A;  2KAY A;  1SCV A;  1Y1X A;  1FPW A;  2D8N A;  1J1D A;  2JWW A;  2WOR A;  4OCI A;  2LP2 A;  3SIA A;  4D1E A;  1QIV A;  3VRO A;  3OB1 B;  1DF0 B;  3IQQ A;  4HRH A;  2KHN A;  1KQM B;  1M46 A;  1BU3 A;  1SK6 D;  1WDC B;  1YUS A;  1KWO B;  2KAV A;  1CDN A;  3PN7 B;  4QJ3 B;  1DJI A;  2MJW B;  3NXA A;  1IWQ A;  2I18 A;  1KWO C;  3ZWH A;  3EKJ A;  2H2K A;  2RGI A;  1TNQ A;  3PN7 C;  4IL1 A;  2M49 B;  1CDM A;  1OE9 B;  4PAL A;  1XFU O;  4FTG A;  1S5G Y;  1QAS A;  4NQG A;  1XA5 A;  3FWB A;  1DVI A;  1EG3 A;  4CPV A;  1L2O B;  2HF5 A;  4E68 A;  3DVK A;  3PFV A;  5DKR A;  2MRD A;  1FW4 A;  1BMO A;  3PM8 A;  2CTN A;  4GNK B;  1L2O C;  2ZFD A;  2A4J A;  2KNE A;  1BR4 B;  1W7I B;  4DCK A;  4DRW A;  3GK1 A;  1KQV A;  3CWG A;  3CR4 X;  4N1F A;  2OS8 C;  3I5G B;  1JWD A;  2KFG A;  1J7Q A;  3TDI A;  1KK7 Y;  1ZMZ A;  1YRU B;  2KI4 B;  2LC5 A;  2ZRS A;  1AUI B;  3I5G C;  3ICB A;  4GUK A;  4ZCV A;  4F0Z B;  2AMI A;  2ZNE A;  1QVI Z;  4A4B A;  2VRG A;  1IQ3 A;  3ZNI A;  2BCX A;  2KI4 C;  1SCM C;  4MEW A;  3VRN A;  3I5F B;  2P6B B;  4UPG A;  5HKY A;  2BE6 A;  3WNX B;  2MAZ A;  1CFP A;  3WHU B;  3IF7 A;  2QPT A;  1FI6 A;  1HT9 A;  2LMU A;  3I5F C;  4GPL B;  2EC6 B;  1YVL A;  1TOP A;  2Y1M A;  3DF0 A;  3QRX A;  5IBW A;  1NX0 A;  1JUO A;  2CT9 A;  1XK4 C;  3EK7 A;  1QLS A;  1NUB A;  1BOC A;  4AQJ A;  4N1G A;  4MLW A;  3BUO B;  1NWD A;  2K7B A;  2MHH A;  1XO5 A;  1TTX A;  4OV2 A;  4NDB A;  1Y6W A;  4AOM A;  2M0R A;  1LKJ A;  1S36 A;  3LLE A;  1DJW A;  2MA2 A;  1IRJ A;  1NCY A;  1CB1 A;  1NX3 A;  2K61 A;  2K7C A;  3TUY B;  1B7T Y;  2ISD A;  1CFC A;  1A2X A;  3JVT B;  2K7D A;  1OMV A;  1TRF A;  1N65 A;  1UP5 A;  2L2E A;  1C7V A;  5J3X A;  2QAC A;  2I94 A;  2JUL A;  1EH2 A;  2WOS A;  3SIB A;  2E30 A;  1XFY O;  1OQP A;  3WXA A;  1BOD A;  2F3Z A;  2WND A;  4C0K A;  1LA0 A;  3EK4 A;  2O5G A;  3NSO A;  1DGU A;  4XJK A;  4CFQ A;  1MUX A;  2BKH B;  2K8M B;  2R2I A;  1YX7 A;  1ZFS A;  4ETO A;  3JTD B;  1L7Z A;  3GK4 X;  1IH0 A;  5AER A;  1WRL A;  1SL7 A;  1OMR A;  3HX4 A;  3JTD C;  1BLQ A;  1CDL A;  2K7O A;  2LVK A;  4XYN A;  2Q4U A;  3I5H B;  3PAT A;  1NX1 A;  1CKK A;  4P5O E;  5CSJ A;  3CGA A;  3I5H C;  1YUU A;  1UUS A;  2OTG B;  4MRX A;  4OR9 B;  1DJZ A;  4MVF A;  1CM1 A;  4CID A;  4BY5 A;  1PVA A;  3IQO A;  3DF0 B;  5JJG A;  1JF2 A;  2K2A A;  2Y4Q A;  1B9A A;  1MXE A;  2L5X B;  4I5N B;  2PRU A;  5AXI A;  2COL B;  3A8R A;  1BT6 A;  1ZAC A;  2FJU B;  2H61 C;  4PHJ A;  1C07 A;  1XFZ O;  1GJY A;  3I5I C;  1KFU L;  3BYA A;  4MZL A;  1XFX O;  1Y1U A;  2EHB A;  2I2R E;  4M2Q A;  4PE4 A;  3K21 A;  1MF8 B;  1TNX A;  4JQ0 D;  1CFF A;  4PDZ A;  1F4O A;  4USL A;  4DUQ A;  1MR8 A;  1FI5 A;  1K9U A;  1J55 A;  3RM1 A;  1HQV A;  4HRG A;  2L4I A;  3HCM A;  2LHI A;  1YX8 A;  1K8U A;  1KQM C;  1R6P A;  1WLM A;  1WDC C;  3EVV A;  1YRT B;  1A29 A;  2PAS A;  4MBE A;  4AQI A;  1SPY A;  2L51 A;  1S6I A;  3PAL A;  1DT7 B;  4R1E A;  3TDU A;  2KFH A;  1F70 A;  1SY9 A;  4C0L A;  5KU1 A;  2MLE C;  4PHM A;  1LVC D;  1ZOT B;  2L98 A;  1XFW O;  2JC2 A;  1KK8 B;  2JU0 A;  2M1U A;  1KSM A;  2GV5 A;  2JQ6 A;  3DVJ A;  1KK8 C;  1IG5 A;  1GQM A;  1QV1 A;  2B1U A;  3LK1 A;  4ORA B;  4YRU A;  1DJG A;  1V1F A;  1D1O A;  1J7P A;  1TCO B;  1Y1A A;  2HPS A;  4XJK B;  1K96 A;  1NSH A;  1XVJ A;  4PHK A;  2L4H A;  4P2Y B;  1B1G A;  1S1E A;  4N5X A;  2BEC A;  1V1G A;  1M45 A;  3D10 A;  1A75 A;  1SYM A;  1JC2 A;  5BPJ A;  5B8I B;  4OVN F;  1G33 A;  1AVS A;  5K89 A;  2KQY A;  1M63 B;  3H4S E;  2V53 A;  2BBM A;  4YGE B;  3CTN A;  4NDC A;  1AJ4 A;  2PVB A;  1PSR A;  2EC6 C;  4YI8 A;  1B8C A;  2TN4 A;  1CFD A;  3CR5 X;  4GGF C;  1QIW A;  4CFR A;  1SL9 A;  1F71 A;  1KSO A;  4WQ2 A;  1QX7 A;  2WCE A;  1ALW A;  2M7L A;  1B8R A;  2MLF C;  3VRR A;  4HRE E;  1F4Q A;  1NCZ A;  2M3W A;  3GK2 A;  1XYD A;  2KFF A;  3BUX B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...