2LVVA

Nmr structure of tb24
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
220
structure length
220
Chain Sequence
MGCSGSKDTTNSKDGAASKGGKDGKTTADRKVAWERIRCAIPRDKDAESKSRRIELFKQFDTNGTGKLGFREVLDGCYGILKLDEFTTHLPDIVQRAFDKAKDLGNKVKGVGEEDLVEFLEFRLMLCYIYDIFELTVMFDTMDKDGSLLLELQEFKEALPKLKEWGVDITDATTVFNEIDTNGSGVVTFDEFSCWAVTKKLQVCGDPDGEENGANEGNLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords Flagellar calcium-binding protein TB-24
publication title NMR structure of the calflagin Tb24 flagellar calcium binding protein of Trypanosoma brucei.
pubmed doi rcsb
source organism Trypanosoma brucei brucei
total genus 51
structure length 220
sequence length 220
ec nomenclature
pdb deposition date 2012-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2lvvA00
2M8UA 2ZN8A 1ALVA 3I5HC 2KGBC 2VRGA 4BY4A 3BUNB 2HQWA 3JTDB 1OMRA 3I5HB 1PULA 3AAKA 2KAVA 4OCIA 1UHJA 3EKHA 4YGDB 2ISDA 4WQ3A 1DJZA 3CZTX 4NDDA 2H2KA 1KSOA 1MF8B 1B4CA 2LANA 4PHJA 3I5FC 1IH0A 5D7FA 2H61A 4MN0A 4MZKA 3IQQA 5JOLA 2AMIA 4HRGA 4ORCB 2KOTA 1QVIZ 2O5GA 2E30A 3DVEA 1QATA 1IWQA 3GK2A 4FQOA 2KAXA 1WDCC 1CFCA 1KFUL 2L50A 5BPJA 3FWBA 2BE6A 3SG2A 3BUXB 2HPSA 1KK8C 3DVKA 1Q80A 1RTP1 1CM1A 1L2OC 2F8PA 2JRFA 1NCXA 1CLMA 1K9PA 1LXFC 1XA5A 1YURA 2WORA 1OMDA 1IKUA 1KK8B 1S26D 4NDCA 1KQMC 3TDIA 1L2OB 3CS1A 3IF7A 3OHMB 2K8MB 3KPXA 2JQ6A 1KFXL 4P5OE 4YGEB 1SYMA 2KHNA 2LVVA 1JF0A 1B7TY 2Y4QA 3GK4X 1KQMB 2M7NA 1MXEA 2WCBA 5I2OA 2BBMA 1IGVA 1QS7A 1YVLA 2L2EA 1GQMA 2K2FA 4MVFA 1NCZA 5I2LA 3RM1A 3RLZA 2WOSA 2QPTA 1GGWA 1QXPA 2JTTA 4OKHA 1FF1A 1WLZA 4JQ0D 4P2YB 2KBMA 3CGAA 4MBEA 2Q4UA 1CDMA 2WNDA 3SG7A 2KI4B 3EKJA 3SG6A 3I5GC 3OB1B 4GPLB 1EG3A 1J7RA 1HQVA 1WLMA 3ZWHA 1CDLA 5FYXA 2CT9A 1JWDA 1OMVA 1JC2A 2FOTA 1MR8A 1NP8A 4QJ3B 2EC6C 2OTGC 2NXQA 2ZKMX 1DF0B 2BKHB 2F3YA 2EC6B 3DD4A 1S6JA 1EL4A 2M7LA 1DJYA 2LLUA 3F45A 4YGAA 1XVJA 2I18A 1DMOA 1BF5A 2JXCA 1V1FA 1QTXA 2CBLA 2LLSA 3BXKA 4DIRA 1CKKA 1YUSA 1W7JB 2BL0C 3CR2A 3O6BA 4JPZB 1DF0A 1SK6D 1W7IB 5CSFA 4PDZA 4D1EA 4BY5A 3M0WA 2BL0B 2K7BA 1A29A 1OE9B 1H8BA 1XK4C 2LC5A 3HX4A 5I2QA 2F2PA 2ZRSA 5HKWA 4A4BA 1S5GZ 1LVCD 2K61A 1SPYA 3D0YB 2V53A 1XFVO 1LA0A 2HETA 2KQYA 2M29A 2GGMA 3I5IC 4PHMA 3VROA 3DF0B 2LM5A 5KU1A 1BR4B 1K9UA 4PALA 1SL8A 1TCOB 5HKZA 4HSZA 4M2OA 2RGIA 2P6BB 4GNKB 5AANA 2KI6D 2GGZA 1YRUB 2MBXA 1CMFA 3BQ3A 2R2IA 1QLKA 2LMTA 1C7WA 2LLTA 5TNCA 1DJHA 3PATA 4DRWA 1S36A 1TN4A 3PM8A 1U5IB 1EJ3A 1F4QA 2L0PA 3EVRA 3NSOA 1N0YA 1SMGA 2PMYA 3PALA 1CFFA 1MQ1A 1QVIY 2M3WA 3E3RA 3CR4X 3H4SE 3LK0A 1XYDA 1QIVA 1U5IA 3A4UB 3LCPC 1Y1UA 4I5KA 2I7AA 2SASA 4C0JA 1RJVA 4GUKA 1F55A 4WQ2A 2LE9B 2NCOA 2KFHA 2JT0A 3SIBA 1YUUA 2Y1MA 1KFUS 1ZFSA 2F33A 1LKJA 3D10A 1K94A 1S1EA 2KDHA 2PVBA 1Y1XA 4N5XA 2KYFA 2MAZA 1IRJA 3ICBA 4E68A 5JJGA 1B47A 2JULA 1KWOC 4AQIA 5K89A 1A75A 2M9GA 3EVVA 2LV7A 2KI6C 1F70A 2LVIA 1YR5A 1TNXA 1KFXS 1YTZC 2WCFA 4QJ5B 3I5FB 1UWOA 1F4OA 4YRUA 2JWWA 4PE4A 1NX0A 1F71A 4XYNA 1OQPA 1NCYA 4HRHA 1J7PA 4R1EA 1GGZA 4TNCA 2BECA 4Q04A 1WDCB 2MA2A 1EXRA 1OSAA 2K0JA 2L51A 5B8IB 3KHEA 5HLOA 4GBAA 1V1GA 2LHIA 2ZNDA 2D8NA 1UHNA 1BODA 2M1KB 1CMGA 2M49B 5CSJA 1BOCA 3BOWB 3O78A 2KYCA 3VRPA 1ALWA 2G2BA 4NQGA 4PHKA 3GK1A 4L9MA 2G9BA 4YGBB 2HQ8A 1UUSA 1AJ4A 4MLWA 4OV2A 1YRTB 2BBNA 1QJTA 5HYDA 1Y0VH 1NX2A 1MXLC 4CFQA 1DJIA 1S6CA 1TTXA 5AXIA 1K8UA 3BOWA 1IG5A 1DTLA 2PASA 3O4YA 2F2OA 1C07A 1QV1A 2L98A 3CWGA 3DVMA 1SKTA 1KQVA 1CB1A 2JU0A 2WCEA 1SL7A 1RECA 3EK8A 2A4JA 1SCVA 1PVBA 1S5GY 2I2RE 2NCPA 3I5GB 3VGOA 4M2QA 4CLNA 4HREE 4ORBB 1FW4A 1NX1A 1ZUZA 1J1EA 1QX7A 3CTNA 1B8CA 2KFFA 2K2AA 1SR6C 2OTGB 2ZFDA 1XO5A 5DKNA 1DGVA 3IQOA 1BT6A 1QASA 4GFTA 1FPWA 2M1UA 3KEVA 1JUOA 1XFUO 1A2XA 1NPQA 1HT9A 3TZ1A 4AOMA 2BCAA 1AHRA 1YVHA 1XFYO 3ZNIA 1K9KA 4DS7A 1BLQA 1B8LA 2BKIB 4PE7A 4AQJA 1N65A 1B9AA 1SY9A 1K90D 3SIAA 1BR1B 2LMVA 4CFRA 1CLLA 2EHBA 2MLEC 5I8NA 3KO0A 5CSNA 1AP4A 1FBVA 2ZN9A 1CLBA 1A4PA 2LAPA 4MZLA 1IJ6A 1MHOA 5PALA 3I5IB 1SL9A 1PALA 2M97A 1LA3A 1K93D 3LLEA 4MEWA 4CPVA 1S6IA 1VRKA 2JNFA 3EK7A 1TNPA 1TNWA 4YBHB 2JXLA 3PSRA 3EVUA 1MWNA 3BUWB 3WNXB 1ODBA 2LUXA 2JC2A 1FI6A 2DOQA 4PCWA 3JVTC 2COLB 1IQ5A 4M2PA 1D1OA 4OR9B 3LK1A 1TOPA 1NYAA 3PN7C 1GJYA 2L4IA 2PALA 2KSPA 1CTRA 2LP3A 1ZACA 4JWQA 2PSRA 2LP2A 3WXAA 2MRDA 3MSEB 1EG4A 1AVSA 2L5XB 1UHKA 4MRYA 1DGUA 3WHTB 1K2HA 1G33A 2M0RA 1A03A 1M46A 3FIAA 1A75B 1PK0D 1PRWA 4YI8A 3VRNA 1JSAA 5G08A 2LVKA 2Q91A 1RROA 1DJXA 1XFZO 1CFDA 5DKRA 1JF2A 1NSHA 4A4CA 3OX5A 5KSZA 4QJ4B 1UHHA 4ORAB 2BE4A 1KWOB 3NSLA 1KK7Z 1IQ3A 5HLVA 4YGCB 1CDNA 1CFPA 1JBAA 1QLSA 4MRXA 2LHLA 4ZCUA 3AAJA 1ZMZA 1YX8A 3BYAA 1TNQA 3EK4A 4NDBA 2BCBA 1NUBA 1WRZA 1SCMC 5AFPA 4ETOA 4DCKA 1QX5B 1SNLA 2CCMA 2GV5A 2AAOA 2I94A 2JTZA 4MZJA 4MSPA 5CSIA 2LUCA 1RWYA 1SCMB 2MHHA 4GAOA 3GOFA 1QIWA 1RK9A 2Y1NA 2KNEA 2MJWB 1SRAA 4N1FA 1Y1AA 3NSKA 1ZOTB 4OVNF 1CM4A 2KGRA 1LINA 3KF9A 3OB2B 1R2UA 1J7QA 3AKAA 1YX7A 4XJKB 5F6TA 2AUCA 1CNPA 2F3ZA 1F54A 2NLNA 1C7VA 2K7OA 4F0ZB 3K21A 2K7CA 3BUMB 4I5LB 2CNPA 1G4YR 5ER5A 2JT8A 3HCMA 1F8HA 3BUOB 5J3XA 2KBIA 2OPOA 4GGFC 3O2PA 1SW8A 3NSIA 1WRLA 4XJKA 5GQQC 2FCDA 4DUQA 4USLA 1KCYA 1DJGA 4C0KA 1PVAA 1BMOA 3TDUA 1MUXA 1XFXO 3FWCA 4I5NB 3SG5A 3VRQA 2LMUA 5KTYA 2JOJA 2L4HA 3OX6A 3TS5C 2KI4C 2MLFC 1J7OA 1WY9A 2JZIA 2TN4A 1DVIA 1JFKA 4GGFA 1M63B 4FTGA 1SR6B 3CLNA 3TS5B 1OZOA 3WHUB 5IBWA 1WRKA 1AJ5A 1QV0A 1J1DA 2QACA 1Y6WA 1RFJA 3CR5X 2EGDA 1UHIA 3DVJA 2WC8A 5ER4X 3OP0A 2LNKA 3PFVA 4I5JA 4WRIA 3TDZA 4YI9A 4CIDA 4N1GA 1AUIB 1JFJA 1NIWA 1PSBA 1X02A 2LVJA 5AERA 1QX2A 4U8DA 1B8RA 4PHNA 2ZNEA 2K7DA 1B7TZ 1K96A 1SBJA 1DT7B 5D69A 1UP5A 4ZCVA 2LCPA 2E6WA 2B1UA 2NZ0A 1L7ZA 1B1GA 2OS8C 5DKQA 1TIZA 1UURA 1K95A 2KQ6A 3PLFB 1DJWA 2CXJA 2OS8B 5AEQA 5HKYA 2FJUB 1OOJA 3SG3A 1N2DA 1IJ5A 1TRFA 1J55A 1OZSA 5CPVA 1KK7Y 1CDPA 1NX3A 1XFWO 2Y5IA 3JVTB 1EH2A 1TCFA 2SCPA 3AKBA 2BCXA 1PSRA 3VRRA 3PN7B 1XK4A 1S3PA 1G8IA 3D0YA 1NWDA 3DF0A 3C1VA 1BJFA 1R6PA 1KSMA 4GGNA 4C0LA 1AK8A 2PRUA 1M39A 2JT3A 2CTNA 1BU3A 3QRXA 4PE1A 2KAYA 3LL8B 1M31A 2IS9A 3SJSA 3NXAA 4UPGA 2JPTA 2ZRTA 1BG1A 4PE0A 4ICBA 4IL1A 1FI5A 3A8RA 2HF5A 2JNXA 1E8AA 1M45A 2O60A 3TUYC 1YUTA 3FS7A 3SG4A 2H61C 2KFGA 2FCEA 1H4BA 3TUYB 3JTDC
chains in the Genus database with same CATH superfamily
2M8UA 2ZN8A 1ALVA 1OOGA 3I5HC 3SS3A 2KGBC 2VRGA 4BY4A 3BUNB 2HQWA 2PYQA 3JTDB 1OMRA 3S0GA 3I5HB 3SS5A 3S0AA 1PULA 3AAKA 3D76A 2KAVA 4OCIA 1UHJA 3EKHA 3OGNA 4YGDB 2ISDA 1DC1A 4WQ3A 1DJZA 3CZTX 4NDDA 2H2KA 1KSOA 1MF8B 2L5YA 1B4CA 2LANA 4PHJA 3I5FC 1IH0A 5D7FA 2H61A 4MN0A 4MZKA 3IQQA 5JOLA 2AMIA 4HRGA 4ORCB 2KOTA 1QVIZ 2O5GA 2E30A 1W9ZA 3DVEA 1QATA 1IWQA 3GK2A 4FQOA 2KAXA 1WDCC 1CFCA 1KFUL 2L50A 1QWVA 5BPJA 3FWBA 3R1OA 2BE6A 3SG2A 3BUXB 2HPSA 1KK8C 3DVKA 1Q80A 1P28A 1CM1A 1RTP1 1L2OC 2F8PA 2JRFA 1NCXA 1CLMA 1K9PA 1LXFC 1XA5A 1YURA 2QEHA 2WORA 1OMDA 1IKUA 1KK8B 1S26D 2KPHA 1KQMC 4NDCA 1L2OB 3CS1A 3TDIA 3IF7A 3OHMB 2K8MB 3KPXA 2JQ6A 1KFXL 2GTEA 4P5OE 1SYMA 2KHNA 2LVVA 3D78A 1JF0A 1B7TY 2Y4QA 3D73A 1ORGA 1KQMB 2M7NA 3GK4X 1MXEA 2WCBA 5I2OA 2BBMA 1IGVA 1QS7A 1YVLA 2L2EA 1GQMA 2K2FA 4MVFA 1NCZA 5I2LA 2BNXA 3RM1A 2WOSA 2QPTA 3RLZA 1QXPA 2JTTA 4OKHA 1FF1A 1WLZA 3S0DA 4JQ0D 1GGWA 4P2YB 2KBMA 1TUZA 3CGAA 4F7FA 4MBEA 2Q4UA 1CDMA 2WNDA 3SG7A 2KI4B 3EKJA 3L47A 3I5GC 3OB1B 4GPLB 3SG6A 1EG3A 3PM2A 1J7RA 1HQVA 1WLMA 2QEOA 3Q8IA 1CDLA 3ZWHA 5FYXA 2CT9A 1JWDA 1OMVA 3VB1A 1JC2A 2FOTA 3RZSA 1MR8A 1NP8A 4QJ3B 3L4LA 2EC6C 2OTGC 3CDNA 3QMEA 2NXQA 2WCLA 2ZKMX 2QDIA 1T14A 1DF0B 2BKHB 2F3YA 2EC6B 3DD4A 1S6JA 1EL4A 2M7LA 1DJYA 2LLUA 3F45A 4YGAA 1XVJA 2I18A 1DMOA 1BF5A 1OOFA 2JXCA 1V1FA 1QTXA 2CBLA 2LLSA 3BXKA 4DIRA 1CKKA 4JKTA 1YUSA 1W7JB 2BL0C 3CR2A 3O6BA 3BFAA 4JPZB 1DF0A 1SK6D 1W7IB 5CSFA 4PDZA 4D1EA 4BY5A 3M0WA 2BL0B 2K7BA 1A29A 1OE9B 1H8BA 1XK4C 3S0FA 2LC5A 3HX4A 5I2QA 3B88A 2F2PA 2ZRSA 5HKWA 4A4BA 1S5GZ 1LVCD 2K61A 1SPYA 3D0YB 2V53A 1XFVO 1LA0A 2HETA 2KQYA 2M29A 2GGMA 3I5IC 4PHMA 3VROA 3DF0B 2LM5A 5DICA 1BR4B 1K9UA 4PALA 1SL8A 1TCOB 5HKZA 4HSZA 4M2OA 5KU1A 2RGIA 2P6BB 4GNKB 5AANA 2WCKA 2KI6D 2GGZA 1YRUB 2MBXA 1CMFA 3BQ3A 2R2IA 1QLKA 2LMTA 3CZ2A 1C7WA 2LLTA 5TNCA 1DJHA 3PATA 4DRWA 1C3ZA 1S36A 1TN4A 3PM8A 1U5IB 1EJ3A 1F4QA 2L0PA 3EVRA 3NSOA 1N0YA 2H8VA 1SMGA 2PMYA 3CABA 3PALA 1CFFA 3R1PA 1MQ1A 1QVIY 2M3WA 3E3RA 3CR4X 3H4SE 3LK0A 1XYDA 1QIVA 1U5IA 3A4UB 3LCPC 4OZDA 1Y1UA 4I5KA 2I7AA 2SASA 4C0JA 1RJVA 3DXLA 4GUKA 1F55A 4WQ2A 2LE9B 2NCOA 2KFHA 2JT0A 3SIBA 1YUUA 2Y1MA 3EG5B 1KFUS 1ZFSA 2F33A 1LKJA 3D10A 1K94A 1S1EA 2KDHA 2PVBA 1Y1XA 4N5XA 2KYFA 2MAZA 1IRJA 3ICBA 4E68A 5JJGA 1B47A 2JULA 1KWOC 4INXA 4AQIA 5HL1A 5K89A 1C3YA 1A75A 2M9GA 3EVVA 3S0EA 2LV7A 2KI6C 1F70A 2LVIA 1YR5A 1TNXA 1KFXS 1YTZC 2WCFA 3S0BA 4QJ5B 3I5FB 1UWOA 1F4OA 2PQLA 4YRUA 2JWWA 4PE4A 1NX0A 1XFRA 4XYNA 1F71A 1OQPA 1NCYA 4HRHA 1J7PA 4R1EA 1GGZA 4TNCA 2BECA 4Q04A 1WDCB 1DELA 2MA2A 1EXRA 1OSAA 2K0JA 2L51A 5B8IB 3KHEA 5HLOA 4GBAA 1V1GA 2LHIA 2ZNDA 2D8NA 1UHNA 1BODA 2M1KB 1CMGA 2M49B 5CSJA 1BOCA 3BOWB 3O78A 2KYCA 4YGEB 1ALWA 2G2BA 4NQGA 4PHKA 3GK1A 4L9MA 3VRPA 2G9BA 4YGBB 2HQ8A 1UUSA 1TWOA 1AJ4A 4MLWA 4OV2A 2WCHA 1YRTB 2BBNA 1QJTA 3BJHA 3D75A 1OOHA 3DZTA 5HYDA 1Y0VH 1NX2A 1MXLC 4CFQA 1DJIA 1S6CA 1TTXA 5AXIA 1K8UA 3BOWA 1IG5A 1DTLA 2PASA 3O4YA 2F2OA 1C07A 1QV1A 2L98A 3CWGA 3D74A 1SKTA 3DVMA 1CB1A 1KQVA 2JU0A 2WCEA 1SL7A 1RECA 3EK8A 2A4JA 1SCVA 1PVBA 2JPOA 1S5GY 2I2RE 2NCPA 3I5GB 3B87A 3VGOA 4M2QA 4CLNA 4HREE 5FI6A 4ORBB 1FW4A 3DY9A 1NX1A 1ZUZA 1J1EA 1QX7A 3N7HA 3CTNA 3V2LA 1B8CA 2KFFA 2K2AA 1SR6C 2OTGB 2ZFDA 1XO5A 5DKNA 1DGVA 3IQOA 1BT6A 3IVTA 1QASA 4KYNA 4GFTA 4JD9A 1FPWA 2M1UA 3KEVA 1JUOA 1XFUO 1A2XA 1NPQA 1HT9A 3TZ1A 4AOMA 2BCAA 1AHRA 1YVHA 1XFYO 3NGVA 3ZNIA 1K9KA 4DS7A 1BLQA 1B8LA 2BKIB 4PE7A 4AQJA 1N65A 1B9AA 1SY9A 4IJ7A 1K90D 4PT1A 3SIAA 1BR1B 1OOIX 2LMVA 4CFRA 1CLLA 2EHBA 2MLEC 5I8NA 3KO0A 5CSNA 1AP4A 1FBVA 2ZN9A 1CLBA 1A4PA 2KLEA 2LAPA 4MZLA 1IJ6A 1MHOA 5PALA 3I5IB 1SL9A 1PALA 2M97A 2K60A 1LA3A 1K93D 3LLEA 4MEWA 4CPVA 1S6IA 1VRKA 2JNFA 3EK7A 1TNPA 1TNWA 3BFHA 4YBHB 2JXLA 3FE8A 3PSRA 3EVUA 1MWNA 3BUWB 3WNXB 1ODBA 2LUXA 3B86A 2JC2A 1FI6A 2DOQA 4PCWA 3UNWA 3JVTC 2COLB 3R72A 1IQ5A 4M2PA 1D1OA 4OR9B 3LK1A 1TOPA 1NYAA 3PN7C 1GJYA 2L4IA 2PALA 2KSPA 1CTRA 2LP3A 3DYEA 3NHIA 1ZACA 4JWQA 2WCJA 2PSRA 2LP2A 3WXAA 2MRDA 3MSEB 1EG4A 1AVSA 2L5XB 2P71A 1UHKA 4MRYA 1DGUA 3WHTB 1K2HA 1G33A 2M0RA 1A03A 1M46A 3B6XA 3FIAA 1A75B 3CYZA 1PK0D 1PRWA 3L4AA 4YI8A 3CZ1A 3VRNA 1JSAA 5G08A 2LVKA 2Q91A 1RROA 1DJXA 1XFZO 1CFDA 3O4XA 5DKRA 1JF2A 1NSHA 4A4CA 3OX5A 5KSZA 4QJ4B 1UHHA 4ORAB 2BE4A 1KWOB 3NSLA 1KK7Z 1IQ3A 5HLVA 4YGCB 1CDNA 2YGUA 1CFPA 1JBAA 1QLSA 4MRXA 2LHLA 4ZCUA 3AAJA 1ZMZA 1YX8A 3BYAA 1TNQA 3EK4A 4NDBA 2BCBA 1NUBA 1WRZA 5EL2A 1SCMC 5AFPA 4ETOA 4DCKA 1QX5B 1SNLA 2CCMA 2GV5A 2AAOA 2I94A 2JTZA 4MZJA 4MSPA 5CSIA 2LUCA 1RWYA 1SCMB 2MHHA 1TUJA 4GAOA 3GOFA 1GM0A 1QIWA 1RK9A 3D77A 2Y1NA 2KNEA 2MJWB 1SRAA 4N1FA 1Y1AA 3NSKA 1ZOTB 4OVNF 1CM4A 2KGRA 1LINA 3KF9A 3OB2B 3K1EA 1R2UA 1J7QA 5FI7A 1DEKA 2L2CA 3AKAA 1YX7A 4XJKB 2WC6A 5F6TA 2AUCA 1CNPA 2F3ZA 1F54A 2NLNA 1C7VA 2K7OA 4F0ZB 3K21A 2K7CA 3BUMB 4I5LB 3SS4A 2CNPA 1G4YR 5ER5A 2JT8A 3HCMA 1F8HA 3BUOB 5J3XA 2KBIA 1IIOA 2OPOA 4GGFC 3O2PA 1SW8A 3NSIA 2WC5A 1WRLA 4XJKA 5GQQC 4INWA 2FCDA 1OW4A 4USLA 2BAPA 1DJGA 4C0KA 4DUQA 1KCYA 1PVAA 1BMOA 3TDUA 1MUXA 1XFXO 3FWCA 4I5NB 3SG5A 3VRQA 2LMUA 3FE9A 5KTYA 2JOJA 3BFBA 2L4HA 5FI2A 3OX6A 3TS5C 1Z4HA 2KI4C 2MLFC 3NHTA 2WCMA 1J7OA 1WY9A 2JZIA 2TN4A 1DVIA 1JFKA 4GGFA 1M63B 4FTGA 1SR6B 3CLNA 3TS5B 1OZOA 3WHUB 5IBWA 1WRKA 1AJ5A 1QV0A 1J1DA 2QACA 1Y6WA 1RFJA 3CR5X 2FJYA 2EGDA 1UHIA 3DVJA 2WC8A 5ER4X 3OP0A 2LNKA 3PFVA 4I5JA 4WRIA 3TDZA 4YI9A 4CIDA 4FQTA 4N1GA 1AUIB 3FE6A 3CZ0A 1JFJA 1X02A 1NIWA 1PSBA 2LVJA 5AERA 1QX2A 2QEVA 2QEBA 4U8DA 1B8RA 3R1VA 4PHNA 2ZNEA 2K7DA 1B7TZ 1K96A 1SBJA 1DT7B 5D69A 1LS8A 1UP5A 4ZCVA 2LCPA 2E6WA 2B1UA 2NZ0A 1L7ZA 1DQEA 1B1GA 2OS8C 5DKQA 1TIZA 1UURA 1K95A 2KQ6A 3PLFB 1DJWA 2CXJA 2KLDA 2OS8B 5AEQA 5HKYA 2FJUB 1OOJA 3SG3A 5D3OA 1N2DA 1IJ5A 1TRFA 1J55A 1OZSA 5CPVA 1KK7Y 1CDPA 1NX3A 1XFWO 2Y5IA 3JVTB 1EH2A 1TCFA 2SCPA 3AKBA 2BCXA 1Z2CB 1PSRA 3VRRA 3PN7B 1XK4A 1S3PA 1G8IA 3D0YA 1SSEB 1NWDA 3B7AA 3C1VA 3DF0A 1BJFA 1R6PA 1KSMA 4GGNA 4C0LA 1AK8A 2PRUA 1M39A 2JT3A 2CTNA 1BU3A 3QRXA 4PE1A 2KAYA 3LL8B 1M31A 2IS9A 3SJSA 3NXAA 4UPGA 2P70A 2JPTA 2ZRTA 1BG1A 4PE0A 3UO9A 4ICBA 4IL1A 1FI5A 3A8RA 2HF5A 2JNXA 2ERBA 1E8AA 1M45A 2O60A 3TUYC 5I94A 1YUTA 3FS7A 3PJIA 3SG4A 3OBVA 2H61C 2KFGA 2FCEA 1H4BA 3TUYB 3JTDC
chains in the Genus database with same CATH topology
2M8UA 2ZN8A 1ALVA 3I5HC 2KGBC 2VRGA 4BY4A 3BUNB 2HQWA 3JTDB 1OMRA 3I5HB 1PULA 3AAKA 2KAVA 4OCIA 1UHJA 3EKHA 4YGDB 2ISDA 4WQ3A 1DJZA 3CZTX 4NDDA 2H2KA 1KSOA 1MF8B 1B4CA 2LANA 4PHJA 3I5FC 1IH0A 5D7FA 2H61A 4MN0A 4MZKA 3IQQA 5JOLA 2AMIA 4HRGA 4ORCB 2KOTA 1QVIZ 2O5GA 2E30A 3DVEA 1QATA 1IWQA 3GK2A 4FQOA 2KAXA 1WDCC 1CFCA 1KFUL 2L50A 5BPJA 3FWBA 2BE6A 3SG2A 3BUXB 2HPSA 1KK8C 3DVKA 1Q80A 1RTP1 1CM1A 1L2OC 2F8PA 2JRFA 1NCXA 1CLMA 1K9PA 1LXFC 1XA5A 1YURA 2WORA 1OMDA 1IKUA 1KK8B 1S26D 4NDCA 1KQMC 3TDIA 1L2OB 3CS1A 3IF7A 3OHMB 2K8MB 3KPXA 2JQ6A 1KFXL 4P5OE 4YGEB 1SYMA 2KHNA 2LVVA 1JF0A 1B7TY 2Y4QA 3GK4X 1KQMB 2M7NA 1MXEA 2WCBA 5I2OA 2BBMA 1IGVA 1QS7A 1YVLA 2L2EA 1GQMA 2K2FA 4MVFA 1NCZA 5I2LA 3RM1A 3RLZA 2WOSA 2QPTA 1GGWA 1QXPA 2JTTA 4OKHA 1FF1A 1WLZA 4JQ0D 4P2YB 2KBMA 3CGAA 4MBEA 2Q4UA 1CDMA 2WNDA 3SG7A 2KI4B 3EKJA 3SG6A 3I5GC 3OB1B 4GPLB 1EG3A 1J7RA 1HQVA 1WLMA 3ZWHA 1CDLA 5FYXA 2CT9A 1JWDA 1OMVA 1JC2A 2FOTA 1MR8A 1NP8A 4QJ3B 2EC6C 2OTGC 2NXQA 2ZKMX 1DF0B 2BKHB 2F3YA 2EC6B 3DD4A 1S6JA 1EL4A 2M7LA 1DJYA 2LLUA 3F45A 4YGAA 1XVJA 2I18A 1DMOA 1BF5A 2JXCA 1V1FA 1QTXA 2CBLA 2LLSA 3BXKA 4DIRA 1CKKA 1YUSA 1W7JB 2BL0C 3CR2A 3O6BA 4JPZB 1DF0A 1SK6D 1W7IB 5CSFA 4PDZA 4D1EA 4BY5A 3M0WA 2BL0B 2K7BA 1A29A 1OE9B 1H8BA 1XK4C 2LC5A 3HX4A 5I2QA 2F2PA 2ZRSA 5HKWA 4A4BA 1S5GZ 1LVCD 2K61A 1SPYA 3D0YB 2V53A 1XFVO 1LA0A 2HETA 2KQYA 2M29A 2GGMA 3I5IC 4PHMA 3VROA 3DF0B 2LM5A 5KU1A 1BR4B 1K9UA 4PALA 1SL8A 1TCOB 5HKZA 4HSZA 4M2OA 2RGIA 2P6BB 4GNKB 5AANA 2KI6D 2GGZA 1YRUB 2MBXA 1CMFA 3BQ3A 2R2IA 1QLKA 2LMTA 1C7WA 2LLTA 5TNCA 1DJHA 3PATA 4DRWA 1S36A 1TN4A 3PM8A 1U5IB 1EJ3A 1F4QA 2L0PA 3EVRA 3NSOA 1N0YA 1SMGA 2PMYA 3PALA 1CFFA 1MQ1A 1QVIY 2M3WA 3E3RA 3CR4X 3H4SE 3LK0A 1XYDA 1QIVA 1U5IA 3A4UB 3LCPC 1Y1UA 4I5KA 2I7AA 2SASA 4C0JA 1RJVA 4GUKA 1F55A 4WQ2A 2LE9B 2NCOA 2KFHA 2JT0A 3SIBA 1YUUA 2Y1MA 1KFUS 1ZFSA 2F33A 1LKJA 3D10A 1K94A 1S1EA 2KDHA 2PVBA 1Y1XA 4N5XA 2KYFA 2MAZA 1IRJA 3ICBA 4E68A 5JJGA 1B47A 2JULA 1KWOC 4AQIA 5K89A 1A75A 2M9GA 3EVVA 2LV7A 2KI6C 1F70A 2LVIA 1YR5A 1TNXA 1KFXS 1YTZC 2WCFA 4QJ5B 3I5FB 1UWOA 1F4OA 4YRUA 2JWWA 4PE4A 1NX0A 1F71A 4XYNA 1OQPA 1NCYA 4HRHA 1J7PA 4R1EA 1GGZA 4TNCA 2BECA 4Q04A 1WDCB 2MA2A 1EXRA 1OSAA 2K0JA 2L51A 5B8IB 3KHEA 5HLOA 4GBAA 1V1GA 2LHIA 2ZNDA 2D8NA 1UHNA 1BODA 2M1KB 1CMGA 2M49B 5CSJA 1BOCA 3BOWB 3O78A 2KYCA 3VRPA 1ALWA 2G2BA 4NQGA 4PHKA 3GK1A 4L9MA 2G9BA 4YGBB 2HQ8A 1UUSA 1AJ4A 4MLWA 4OV2A 1YRTB 2BBNA 1QJTA 5HYDA 1Y0VH 1NX2A 1MXLC 4CFQA 1DJIA 1S6CA 1TTXA 5AXIA 1K8UA 3BOWA 1IG5A 1DTLA 2PASA 3O4YA 2F2OA 1C07A 1QV1A 2L98A 3CWGA 3DVMA 1SKTA 1KQVA 1CB1A 2JU0A 2WCEA 1SL7A 1RECA 3EK8A 2A4JA 1SCVA 1PVBA 1S5GY 2I2RE 2NCPA 3I5GB 3VGOA 4M2QA 4CLNA 4HREE 4ORBB 1FW4A 1NX1A 1ZUZA 1J1EA 1QX7A 3CTNA 1B8CA 2KFFA 2K2AA 1SR6C 2OTGB 2ZFDA 1XO5A 5DKNA 1DGVA 3IQOA 1BT6A 1QASA 4GFTA 1FPWA 2M1UA 3KEVA 1JUOA 1XFUO 1A2XA 1NPQA 1HT9A 3TZ1A 4AOMA 2BCAA 1AHRA 1YVHA 1XFYO 3ZNIA 1K9KA 4DS7A 1BLQA 1B8LA 2BKIB 4PE7A 4AQJA 1N65A 1B9AA 1SY9A 1K90D 3SIAA 1BR1B 2LMVA 4CFRA 1CLLA 2EHBA 2MLEC 5I8NA 3KO0A 5CSNA 1AP4A 1FBVA 2ZN9A 1CLBA 1A4PA 2LAPA 4MZLA 1IJ6A 1MHOA 5PALA 3I5IB 1SL9A 1PALA 2M97A 1LA3A 1K93D 3LLEA 4MEWA 4CPVA 1S6IA 1VRKA 2JNFA 3EK7A 1TNPA 1TNWA 4YBHB 2JXLA 3PSRA 3EVUA 1MWNA 3BUWB 3WNXB 1ODBA 2LUXA 2JC2A 1FI6A 2DOQA 4PCWA 3JVTC 2COLB 1IQ5A 4M2PA 1D1OA 4OR9B 3LK1A 1TOPA 1NYAA 3PN7C 1GJYA 2L4IA 2PALA 2KSPA 1CTRA 2LP3A 1ZACA 4JWQA 2PSRA 2LP2A 3WXAA 2MRDA 3MSEB 1EG4A 1AVSA 2L5XB 1UHKA 4MRYA 1DGUA 3WHTB 1K2HA 1G33A 2M0RA 1A03A 1M46A 3FIAA 1A75B 1PK0D 1PRWA 4YI8A 3VRNA 1JSAA 5G08A 2LVKA 2Q91A 1RROA 1DJXA 1XFZO 1CFDA 5DKRA 1JF2A 1NSHA 4A4CA 3OX5A 5KSZA 4QJ4B 1UHHA 4ORAB 2BE4A 1KWOB 3NSLA 1KK7Z 1IQ3A 5HLVA 4YGCB 1CDNA 1CFPA 1JBAA 1QLSA 4MRXA 2LHLA 4ZCUA 3AAJA 1ZMZA 1YX8A 3BYAA 1TNQA 3EK4A 4NDBA 2BCBA 1NUBA 1WRZA 1SCMC 5AFPA 4ETOA 4DCKA 1QX5B 1SNLA 2CCMA 2GV5A 2AAOA 2I94A 2JTZA 4MZJA 4MSPA 5CSIA 2LUCA 1RWYA 1SCMB 2MHHA 4GAOA 3GOFA 1QIWA 1RK9A 2Y1NA 2KNEA 2MJWB 1SRAA 4N1FA 1Y1AA 3NSKA 1ZOTB 4OVNF 1CM4A 2KGRA 1LINA 3KF9A 3OB2B 1R2UA 1J7QA 3AKAA 1YX7A 4XJKB 5F6TA 2AUCA 1CNPA 2F3ZA 1F54A 2NLNA 1C7VA 2K7OA 4F0ZB 3K21A 2K7CA 3BUMB 4I5LB 2CNPA 1G4YR 5ER5A 2JT8A 3HCMA 1F8HA 3BUOB 5J3XA 2KBIA 2OPOA 4GGFC 3O2PA 1SW8A 3NSIA 1WRLA 4XJKA 5GQQC 2FCDA 4DUQA 4USLA 1KCYA 1DJGA 4C0KA 1PVAA 1BMOA 3TDUA 1MUXA 1XFXO 3FWCA 4I5NB 3SG5A 3VRQA 2LMUA 5KTYA 2JOJA 2L4HA 3OX6A 3TS5C 2KI4C 2MLFC 1J7OA 1WY9A 2JZIA 2TN4A 1DVIA 1JFKA 4GGFA 1M63B 4FTGA 1SR6B 3CLNA 3TS5B 1OZOA 3WHUB 5IBWA 1WRKA 1AJ5A 1QV0A 1J1DA 2QACA 1Y6WA 1RFJA 3CR5X 2EGDA 1UHIA 3DVJA 2WC8A 5ER4X 3OP0A 2LNKA 3PFVA 4I5JA 4WRIA 3TDZA 4YI9A 4CIDA 4N1GA 1AUIB 1JFJA 1NIWA 1PSBA 1X02A 2LVJA 5AERA 1QX2A 4U8DA 1B8RA 4PHNA 2ZNEA 2K7DA 1B7TZ 1K96A 1SBJA 1DT7B 5D69A 1UP5A 4ZCVA 2LCPA 2E6WA 2B1UA 2NZ0A 1L7ZA 1B1GA 2OS8C 5DKQA 1TIZA 1UURA 1K95A 2KQ6A 3PLFB 1DJWA 2CXJA 2OS8B 5AEQA 5HKYA 2FJUB 1OOJA 3SG3A 1N2DA 1IJ5A 1TRFA 1J55A 1OZSA 5CPVA 1KK7Y 1CDPA 1NX3A 1XFWO 2Y5IA 3JVTB 1EH2A 1TCFA 2SCPA 3AKBA 2BCXA 1PSRA 3VRRA 3PN7B 1XK4A 1S3PA 1G8IA 3D0YA 1NWDA 3DF0A 3C1VA 1BJFA 1R6PA 1KSMA 4GGNA 4C0LA 1AK8A 2PRUA 1M39A 2JT3A 2CTNA 1BU3A 3QRXA 4PE1A 2KAYA 3LL8B 1M31A 2IS9A 3SJSA 3NXAA 4UPGA 2JPTA 2ZRTA 1BG1A 4PE0A 4ICBA 4IL1A 1FI5A 3A8RA 2HF5A 2JNXA 1E8AA 1M45A 2O60A 3TUYC 1YUTA 3FS7A 3SG4A 2H61C 2KFGA 2FCEA 1H4BA 3TUYB 3JTDC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2M8U A;  2ZN8 A;  1ALV A;  3I5H C;  2KGB C;  2VRG A;  4BY4 A;  3BUN B;  2HQW A;  3JTD B;  1OMR A;  3I5H B;  1PUL A;  3AAK A;  2KAV A;  4OCI A;  1UHJ A;  3EKH A;  4YGD B;  2ISD A;  4WQ3 A;  1DJZ A;  3CZT X;  4NDD A;  2H2K A;  1KSO A;  1MF8 B;  1B4C A;  2LAN A;  4PHJ A;  3I5F C;  1IH0 A;  5D7F A;  2H61 A;  4MN0 A;  4MZK A;  3IQQ A;  5JOL A;  2AMI A;  4HRG A;  4ORC B;  2KOT A;  1QVI Z;  2O5G A;  2E30 A;  3DVE A;  1QAT A;  1IWQ A;  3GK2 A;  4FQO A;  2KAX A;  1WDC C;  1CFC A;  1KFU L;  2L50 A;  5BPJ A;  3FWB A;  2BE6 A;  3SG2 A;  3BUX B;  2HPS A;  1KK8 C;  3DVK A;  1Q80 A;  1RTP 1;  1CM1 A;  1L2O C;  2F8P A;  2JRF A;  1NCX A;  1CLM A;  1K9P A;  1LXF C;  1XA5 A;  1YUR A;  2WOR A;  1OMD A;  1IKU A;  1KK8 B;  1S26 D;  4NDC A;  1KQM C;  3TDI A;  1L2O B;  3CS1 A;  3IF7 A;  3OHM B;  2K8M B;  3KPX A;  2JQ6 A;  1KFX L;  4P5O E;  4YGE B;  1SYM A;  2KHN A;  2LVV A;  1JF0 A;  1B7T Y;  2Y4Q A;  3GK4 X;  1KQM B;  2M7N A;  1MXE A;  2WCB A;  5I2O A;  2BBM A;  1IGV A;  1QS7 A;  1YVL A;  2L2E A;  1GQM A;  2K2F A;  4MVF A;  1NCZ A;  5I2L A;  3RM1 A;  3RLZ A;  2WOS A;  2QPT A;  1GGW A;  1QXP A;  2JTT A;  4OKH A;  1FF1 A;  1WLZ A;  4JQ0 D;  4P2Y B;  2KBM A;  3CGA A;  4MBE A;  2Q4U A;  1CDM A;  2WND A;  3SG7 A;  2KI4 B;  3EKJ A;  3SG6 A;  3I5G C;  3OB1 B;  4GPL B;  1EG3 A;  1J7R A;  1HQV A;  1WLM A;  3ZWH A;  1CDL A;  5FYX A;  2CT9 A;  1JWD A;  1OMV A;  1JC2 A;  2FOT A;  1MR8 A;  1NP8 A;  4QJ3 B;  2EC6 C;  2OTG C;  2NXQ A;  2ZKM X;  1DF0 B;  2BKH B;  2F3Y A;  2EC6 B;  3DD4 A;  1S6J A;  1EL4 A;  2M7L A;  1DJY A;  2LLU A;  3F45 A;  4YGA A;  1XVJ A;  2I18 A;  1DMO A;  1BF5 A;  2JXC A;  1V1F A;  1QTX A;  2CBL A;  2LLS A;  3BXK A;  4DIR A;  1CKK A;  1YUS A;  1W7J B;  2BL0 C;  3CR2 A;  3O6B A;  4JPZ B;  1DF0 A;  1SK6 D;  1W7I B;  5CSF A;  4PDZ A;  4D1E A;  4BY5 A;  3M0W A;  2BL0 B;  2K7B A;  1A29 A;  1OE9 B;  1H8B A;  1XK4 C;  2LC5 A;  3HX4 A;  5I2Q A;  2F2P A;  2ZRS A;  5HKW A;  4A4B A;  1S5G Z;  1LVC D;  2K61 A;  1SPY A;  3D0Y B;  2V53 A;  1XFV O;  1LA0 A;  2HET A;  2KQY A;  2M29 A;  2GGM A;  3I5I C;  4PHM A;  3VRO A;  3DF0 B;  2LM5 A;  5KU1 A;  1BR4 B;  1K9U A;  4PAL A;  1SL8 A;  1TCO B;  5HKZ A;  4HSZ A;  4M2O A;  2RGI A;  2P6B B;  4GNK B;  5AAN A;  2KI6 D;  2GGZ A;  1YRU B;  2MBX A;  1CMF A;  3BQ3 A;  2R2I A;  1QLK A;  2LMT A;  1C7W A;  2LLT A;  5TNC A;  1DJH A;  3PAT A;  4DRW A;  1S36 A;  1TN4 A;  3PM8 A;  1U5I B;  1EJ3 A;  1F4Q A;  2L0P A;  3EVR A;  3NSO A;  1N0Y A;  1SMG A;  2PMY A;  3PAL A;  1CFF A;  1MQ1 A;  1QVI Y;  2M3W A;  3E3R A;  3CR4 X;  3H4S E;  3LK0 A;  1XYD A;  1QIV A;  1U5I A;  3A4U B;  3LCP C;  1Y1U A;  4I5K A;  2I7A A;  2SAS A;  4C0J A;  1RJV A;  4GUK A;  1F55 A;  4WQ2 A;  2LE9 B;  2NCO A;  2KFH A;  2JT0 A;  3SIB A;  1YUU A;  2Y1M A;  1KFU S;  1ZFS A;  2F33 A;  1LKJ A;  3D10 A;  1K94 A;  1S1E A;  2KDH A;  2PVB A;  1Y1X A;  4N5X A;  2KYF A;  2MAZ A;  1IRJ A;  3ICB A;  4E68 A;  5JJG A;  1B47 A;  2JUL A;  1KWO C;  4AQI A;  5K89 A;  1A75 A;  2M9G A;  3EVV A;  2LV7 A;  2KI6 C;  1F70 A;  2LVI A;  1YR5 A;  1TNX A;  1KFX S;  1YTZ C;  2WCF A;  4QJ5 B;  3I5F B;  1UWO A;  1F4O A;  4YRU A;  2JWW A;  4PE4 A;  1NX0 A;  1F71 A;  4XYN A;  1OQP A;  1NCY A;  4HRH A;  1J7P A;  4R1E A;  1GGZ A;  4TNC A;  2BEC A;  4Q04 A;  1WDC B;  2MA2 A;  1EXR A;  1OSA A;  2K0J A;  2L51 A;  5B8I B;  3KHE A;  5HLO A;  4GBA A;  1V1G A;  2LHI A;  2ZND A;  2D8N A;  1UHN A;  1BOD A;  2M1K B;  1CMG A;  2M49 B;  5CSJ A;  1BOC A;  3BOW B;  3O78 A;  2KYC A;  3VRP A;  1ALW A;  2G2B A;  4NQG A;  4PHK A;  3GK1 A;  4L9M A;  2G9B A;  4YGB B;  2HQ8 A;  1UUS A;  1AJ4 A;  4MLW A;  4OV2 A;  1YRT B;  2BBN A;  1QJT A;  5HYD A;  1Y0V H;  1NX2 A;  1MXL C;  4CFQ A;  1DJI A;  1S6C A;  1TTX A;  5AXI A;  1K8U A;  3BOW A;  1IG5 A;  1DTL A;  2PAS A;  3O4Y A;  2F2O A;  1C07 A;  1QV1 A;  2L98 A;  3CWG A;  3DVM A;  1SKT A;  1KQV A;  1CB1 A;  2JU0 A;  2WCE A;  1SL7 A;  1REC A;  3EK8 A;  2A4J A;  1SCV A;  1PVB A;  1S5G Y;  2I2R E;  2NCP A;  3I5G B;  3VGO A;  4M2Q A;  4CLN A;  4HRE E;  4ORB B;  1FW4 A;  1NX1 A;  1ZUZ A;  1J1E A;  1QX7 A;  3CTN A;  1B8C A;  2KFF A;  2K2A A;  1SR6 C;  2OTG B;  2ZFD A;  1XO5 A;  5DKN A;  1DGV A;  3IQO A;  1BT6 A;  1QAS A;  4GFT A;  1FPW A;  2M1U A;  3KEV A;  1JUO A;  1XFU O;  1A2X A;  1NPQ A;  1HT9 A;  3TZ1 A;  4AOM A;  2BCA A;  1AHR A;  1YVH A;  1XFY O;  3ZNI A;  1K9K A;  4DS7 A;  1BLQ A;  1B8L A;  2BKI B;  4PE7 A;  4AQJ A;  1N65 A;  1B9A A;  1SY9 A;  1K90 D;  3SIA A;  1BR1 B;  2LMV A;  4CFR A;  1CLL A;  2EHB A;  2MLE C;  5I8N A;  3KO0 A;  5CSN A;  1AP4 A;  1FBV A;  2ZN9 A;  1CLB A;  1A4P A;  2LAP A;  4MZL A;  1IJ6 A;  1MHO A;  5PAL A;  3I5I B;  1SL9 A;  1PAL A;  2M97 A;  1LA3 A;  1K93 D;  3LLE A;  4MEW A;  4CPV A;  1S6I A;  1VRK A;  2JNF A;  3EK7 A;  1TNP A;  1TNW A;  4YBH B;  2JXL A;  3PSR A;  3EVU A;  1MWN A;  3BUW B;  3WNX B;  1ODB A;  2LUX A;  2JC2 A;  1FI6 A;  2DOQ A;  4PCW A;  3JVT C;  2COL B;  1IQ5 A;  4M2P A;  1D1O A;  4OR9 B;  3LK1 A;  1TOP A;  1NYA A;  3PN7 C;  1GJY A;  2L4I A;  2PAL A;  2KSP A;  1CTR A;  2LP3 A;  1ZAC A;  4JWQ A;  2PSR A;  2LP2 A;  3WXA A;  2MRD A;  3MSE B;  1EG4 A;  1AVS A;  2L5X B;  1UHK A;  4MRY A;  1DGU A;  3WHT B;  1K2H A;  1G33 A;  2M0R A;  1A03 A;  1M46 A;  3FIA A;  1A75 B;  1PK0 D;  1PRW A;  4YI8 A;  3VRN A;  1JSA A;  5G08 A;  2LVK A;  2Q91 A;  1RRO A;  1DJX A;  1XFZ O;  1CFD A;  5DKR A;  1JF2 A;  1NSH A;  4A4C A;  3OX5 A;  5KSZ A;  4QJ4 B;  1UHH A;  4ORA B;  2BE4 A;  1KWO B;  3NSL A;  1KK7 Z;  1IQ3 A;  5HLV A;  4YGC B;  1CDN A;  1CFP A;  1JBA A;  1QLS A;  4MRX A;  2LHL A;  4ZCU A;  3AAJ A;  1ZMZ A;  1YX8 A;  3BYA A;  1TNQ A;  3EK4 A;  4NDB A;  2BCB A;  1NUB A;  1WRZ A;  1SCM C;  5AFP A;  4ETO A;  4DCK A;  1QX5 B;  1SNL A;  2CCM A;  2GV5 A;  2AAO A;  2I94 A;  2JTZ A;  4MZJ A;  4MSP A;  5CSI A;  2LUC A;  1RWY A;  1SCM B;  2MHH A;  4GAO A;  3GOF A;  1QIW A;  1RK9 A;  2Y1N A;  2KNE A;  2MJW B;  1SRA A;  4N1F A;  1Y1A A;  3NSK A;  1ZOT B;  4OVN F;  1CM4 A;  2KGR A;  1LIN A;  3KF9 A;  3OB2 B;  1R2U A;  1J7Q A;  3AKA A;  1YX7 A;  4XJK B;  5F6T A;  2AUC A;  1CNP A;  2F3Z A;  1F54 A;  2NLN A;  1C7V A;  2K7O A;  4F0Z B;  3K21 A;  2K7C A;  3BUM B;  4I5L B;  2CNP A;  1G4Y R;  5ER5 A;  2JT8 A;  3HCM A;  1F8H A;  3BUO B;  5J3X A;  2KBI A;  2OPO A;  4GGF C;  3O2P A;  1SW8 A;  3NSI A;  1WRL A;  4XJK A;  5GQQ C;  2FCD A;  4DUQ A;  4USL A;  1KCY A;  1DJG A;  4C0K A;  1PVA A;  1BMO A;  3TDU A;  1MUX A;  1XFX O;  3FWC A;  4I5N B;  3SG5 A;  3VRQ A;  2LMU A;  5KTY A;  2JOJ A;  2L4H A;  3OX6 A;  3TS5 C;  2KI4 C;  2MLF C;  1J7O A;  1WY9 A;  2JZI A;  2TN4 A;  1DVI A;  1JFK A;  4GGF A;  1M63 B;  4FTG A;  1SR6 B;  3CLN A;  3TS5 B;  1OZO A;  3WHU B;  5IBW A;  1WRK A;  1AJ5 A;  1QV0 A;  1J1D A;  2QAC A;  1Y6W A;  1RFJ A;  3CR5 X;  2EGD A;  1UHI A;  3DVJ A;  2WC8 A;  5ER4 X;  3OP0 A;  2LNK A;  3PFV A;  4I5J A;  4WRI A;  3TDZ A;  4YI9 A;  4CID A;  4N1G A;  1AUI B;  1JFJ A;  1NIW A;  1PSB A;  1X02 A;  2LVJ A;  5AER A;  1QX2 A;  4U8D A;  1B8R A;  4PHN A;  2ZNE A;  2K7D A;  1B7T Z;  1K96 A;  1SBJ A;  1DT7 B;  5D69 A;  1UP5 A;  4ZCV A;  2LCP A;  2E6W A;  2B1U A;  2NZ0 A;  1L7Z A;  1B1G A;  2OS8 C;  5DKQ A;  1TIZ A;  1UUR A;  1K95 A;  2KQ6 A;  3PLF B;  1DJW A;  2CXJ A;  2OS8 B;  5AEQ A;  5HKY A;  2FJU B;  1OOJ A;  3SG3 A;  1N2D A;  1IJ5 A;  1TRF A;  1J55 A;  1OZS A;  5CPV A;  1KK7 Y;  1CDP A;  1NX3 A;  1XFW O;  2Y5I A;  3JVT B;  1EH2 A;  1TCF A;  2SCP A;  3AKB A;  2BCX A;  1PSR A;  3VRR A;  3PN7 B;  1XK4 A;  1S3P A;  1G8I A;  3D0Y A;  1NWD A;  3DF0 A;  3C1V A;  1BJF A;  1R6P A;  1KSM A;  4GGN A;  4C0L A;  1AK8 A;  2PRU A;  1M39 A;  2JT3 A;  2CTN A;  1BU3 A;  3QRX A;  4PE1 A;  2KAY A;  3LL8 B;  1M31 A;  2IS9 A;  3SJS A;  3NXA A;  4UPG A;  2JPT A;  2ZRT A;  1BG1 A;  4PE0 A;  4ICB A;  4IL1 A;  1FI5 A;  3A8R A;  2HF5 A;  2JNX A;  1E8A A;  1M45 A;  2O60 A;  3TUY C;  1YUT A;  3FS7 A;  3SG4 A;  2H61 C;  2KFG A;  2FCE A;  1H4B A;  3TUY B;  3JTD C; 
#chains in the Genus database with same CATH topology
 2M8U A;  2ZN8 A;  1ALV A;  1OOG A;  3I5H C;  3SS3 A;  2KGB C;  2VRG A;  4BY4 A;  3BUN B;  2HQW A;  2PYQ A;  3JTD B;  1OMR A;  3S0G A;  3I5H B;  3SS5 A;  3S0A A;  1PUL A;  3AAK A;  3D76 A;  2KAV A;  4OCI A;  1UHJ A;  3EKH A;  3OGN A;  4YGD B;  2ISD A;  1DC1 A;  4WQ3 A;  1DJZ A;  3CZT X;  4NDD A;  2H2K A;  1KSO A;  1MF8 B;  2L5Y A;  1B4C A;  2LAN A;  4PHJ A;  3I5F C;  1IH0 A;  5D7F A;  2H61 A;  4MN0 A;  4MZK A;  3IQQ A;  5JOL A;  2AMI A;  4HRG A;  4ORC B;  2KOT A;  1QVI Z;  2O5G A;  2E30 A;  1W9Z A;  3DVE A;  1QAT A;  1IWQ A;  3GK2 A;  4FQO A;  2KAX A;  1WDC C;  1CFC A;  1KFU L;  2L50 A;  1QWV A;  5BPJ A;  3FWB A;  3R1O A;  2BE6 A;  3SG2 A;  3BUX B;  2HPS A;  1KK8 C;  3DVK A;  1Q80 A;  1P28 A;  1CM1 A;  1RTP 1;  1L2O C;  2F8P A;  2JRF A;  1NCX A;  1CLM A;  1K9P A;  1LXF C;  1XA5 A;  1YUR A;  2QEH A;  2WOR A;  1OMD A;  1IKU A;  1KK8 B;  1S26 D;  2KPH A;  1KQM C;  4NDC A;  1L2O B;  3CS1 A;  3TDI A;  3IF7 A;  3OHM B;  2K8M B;  3KPX A;  2JQ6 A;  1KFX L;  2GTE A;  4P5O E;  1SYM A;  2KHN A;  2LVV A;  3D78 A;  1JF0 A;  1B7T Y;  2Y4Q A;  3D73 A;  1ORG A;  1KQM B;  2M7N A;  3GK4 X;  1MXE A;  2WCB A;  5I2O A;  2BBM A;  1IGV A;  1QS7 A;  1YVL A;  2L2E A;  1GQM A;  2K2F A;  4MVF A;  1NCZ A;  5I2L A;  2BNX A;  3RM1 A;  2WOS A;  2QPT A;  3RLZ A;  1QXP A;  2JTT A;  4OKH A;  1FF1 A;  1WLZ A;  3S0D A;  4JQ0 D;  1GGW A;  4P2Y B;  2KBM A;  1TUZ A;  3CGA A;  4F7F A;  4MBE A;  2Q4U A;  1CDM A;  2WND A;  3SG7 A;  2KI4 B;  3EKJ A;  3L47 A;  3I5G C;  3OB1 B;  4GPL B;  3SG6 A;  1EG3 A;  3PM2 A;  1J7R A;  1HQV A;  1WLM A;  2QEO A;  3Q8I A;  1CDL A;  3ZWH A;  5FYX A;  2CT9 A;  1JWD A;  1OMV A;  3VB1 A;  1JC2 A;  2FOT A;  3RZS A;  1MR8 A;  1NP8 A;  4QJ3 B;  3L4L A;  2EC6 C;  2OTG C;  3CDN A;  3QME A;  2NXQ A;  2WCL A;  2ZKM X;  2QDI A;  1T14 A;  1DF0 B;  2BKH B;  2F3Y A;  2EC6 B;  3DD4 A;  1S6J A;  1EL4 A;  2M7L A;  1DJY A;  2LLU A;  3F45 A;  4YGA A;  1XVJ A;  2I18 A;  1DMO A;  1BF5 A;  1OOF A;  2JXC A;  1V1F A;  1QTX A;  2CBL A;  2LLS A;  3BXK A;  4DIR A;  1CKK A;  4JKT A;  1YUS A;  1W7J B;  2BL0 C;  3CR2 A;  3O6B A;  3BFA A;  4JPZ B;  1DF0 A;  1SK6 D;  1W7I B;  5CSF A;  4PDZ A;  4D1E A;  4BY5 A;  3M0W A;  2BL0 B;  2K7B A;  1A29 A;  1OE9 B;  1H8B A;  1XK4 C;  3S0F A;  2LC5 A;  3HX4 A;  5I2Q A;  3B88 A;  2F2P A;  2ZRS A;  5HKW A;  4A4B A;  1S5G Z;  1LVC D;  2K61 A;  1SPY A;  3D0Y B;  2V53 A;  1XFV O;  1LA0 A;  2HET A;  2KQY A;  2M29 A;  2GGM A;  3I5I C;  4PHM A;  3VRO A;  3DF0 B;  2LM5 A;  5DIC A;  1BR4 B;  1K9U A;  4PAL A;  1SL8 A;  1TCO B;  5HKZ A;  4HSZ A;  4M2O A;  5KU1 A;  2RGI A;  2P6B B;  4GNK B;  5AAN A;  2WCK A;  2KI6 D;  2GGZ A;  1YRU B;  2MBX A;  1CMF A;  3BQ3 A;  2R2I A;  1QLK A;  2LMT A;  3CZ2 A;  1C7W A;  2LLT A;  5TNC A;  1DJH A;  3PAT A;  4DRW A;  1C3Z A;  1S36 A;  1TN4 A;  3PM8 A;  1U5I B;  1EJ3 A;  1F4Q A;  2L0P A;  3EVR A;  3NSO A;  1N0Y A;  2H8V A;  1SMG A;  2PMY A;  3CAB A;  3PAL A;  1CFF A;  3R1P A;  1MQ1 A;  1QVI Y;  2M3W A;  3E3R A;  3CR4 X;  3H4S E;  3LK0 A;  1XYD A;  1QIV A;  1U5I A;  3A4U B;  3LCP C;  4OZD A;  1Y1U A;  4I5K A;  2I7A A;  2SAS A;  4C0J A;  1RJV A;  3DXL A;  4GUK A;  1F55 A;  4WQ2 A;  2LE9 B;  2NCO A;  2KFH A;  2JT0 A;  3SIB A;  1YUU A;  2Y1M A;  3EG5 B;  1KFU S;  1ZFS A;  2F33 A;  1LKJ A;  3D10 A;  1K94 A;  1S1E A;  2KDH A;  2PVB A;  1Y1X A;  4N5X A;  2KYF A;  2MAZ A;  1IRJ A;  3ICB A;  4E68 A;  5JJG A;  1B47 A;  2JUL A;  1KWO C;  4INX A;  4AQI A;  5HL1 A;  5K89 A;  1C3Y A;  1A75 A;  2M9G A;  3EVV A;  3S0E A;  2LV7 A;  2KI6 C;  1F70 A;  2LVI A;  1YR5 A;  1TNX A;  1KFX S;  1YTZ C;  2WCF A;  3S0B A;  4QJ5 B;  3I5F B;  1UWO A;  1F4O A;  2PQL A;  4YRU A;  2JWW A;  4PE4 A;  1NX0 A;  1XFR A;  4XYN A;  1F71 A;  1OQP A;  1NCY A;  4HRH A;  1J7P A;  4R1E A;  1GGZ A;  4TNC A;  2BEC A;  4Q04 A;  1WDC B;  1DEL A;  2MA2 A;  1EXR A;  1OSA A;  2K0J A;  2L51 A;  5B8I B;  3KHE A;  5HLO A;  4GBA A;  1V1G A;  2LHI A;  2ZND A;  2D8N A;  1UHN A;  1BOD A;  2M1K B;  1CMG A;  2M49 B;  5CSJ A;  1BOC A;  3BOW B;  3O78 A;  2KYC A;  4YGE B;  1ALW A;  2G2B A;  4NQG A;  4PHK A;  3GK1 A;  4L9M A;  3VRP A;  2G9B A;  4YGB B;  2HQ8 A;  1UUS A;  1TWO A;  1AJ4 A;  4MLW A;  4OV2 A;  2WCH A;  1YRT B;  2BBN A;  1QJT A;  3BJH A;  3D75 A;  1OOH A;  3DZT A;  5HYD A;  1Y0V H;  1NX2 A;  1MXL C;  4CFQ A;  1DJI A;  1S6C A;  1TTX A;  5AXI A;  1K8U A;  3BOW A;  1IG5 A;  1DTL A;  2PAS A;  3O4Y A;  2F2O A;  1C07 A;  1QV1 A;  2L98 A;  3CWG A;  3D74 A;  1SKT A;  3DVM A;  1CB1 A;  1KQV A;  2JU0 A;  2WCE A;  1SL7 A;  1REC A;  3EK8 A;  2A4J A;  1SCV A;  1PVB A;  2JPO A;  1S5G Y;  2I2R E;  2NCP A;  3I5G B;  3B87 A;  3VGO A;  4M2Q A;  4CLN A;  4HRE E;  5FI6 A;  4ORB B;  1FW4 A;  3DY9 A;  1NX1 A;  1ZUZ A;  1J1E A;  1QX7 A;  3N7H A;  3CTN A;  3V2L A;  1B8C A;  2KFF A;  2K2A A;  1SR6 C;  2OTG B;  2ZFD A;  1XO5 A;  5DKN A;  1DGV A;  3IQO A;  1BT6 A;  3IVT A;  1QAS A;  4KYN A;  4GFT A;  4JD9 A;  1FPW A;  2M1U A;  3KEV A;  1JUO A;  1XFU O;  1A2X A;  1NPQ A;  1HT9 A;  3TZ1 A;  4AOM A;  2BCA A;  1AHR A;  1YVH A;  1XFY O;  3NGV A;  3ZNI A;  1K9K A;  4DS7 A;  1BLQ A;  1B8L A;  2BKI B;  4PE7 A;  4AQJ A;  1N65 A;  1B9A A;  1SY9 A;  4IJ7 A;  1K90 D;  4PT1 A;  3SIA A;  1BR1 B;  1OOI X;  2LMV A;  4CFR A;  1CLL A;  2EHB A;  2MLE C;  5I8N A;  3KO0 A;  5CSN A;  1AP4 A;  1FBV A;  2ZN9 A;  1CLB A;  1A4P A;  2KLE A;  2LAP A;  4MZL A;  1IJ6 A;  1MHO A;  5PAL A;  3I5I B;  1SL9 A;  1PAL A;  2M97 A;  2K60 A;  1LA3 A;  1K93 D;  3LLE A;  4MEW A;  4CPV A;  1S6I A;  1VRK A;  2JNF A;  3EK7 A;  1TNP A;  1TNW A;  3BFH A;  4YBH B;  2JXL A;  3FE8 A;  3PSR A;  3EVU A;  1MWN A;  3BUW B;  3WNX B;  1ODB A;  2LUX A;  3B86 A;  2JC2 A;  1FI6 A;  2DOQ A;  4PCW A;  3UNW A;  3JVT C;  2COL B;  3R72 A;  1IQ5 A;  4M2P A;  1D1O A;  4OR9 B;  3LK1 A;  1TOP A;  1NYA A;  3PN7 C;  1GJY A;  2L4I A;  2PAL A;  2KSP A;  1CTR A;  2LP3 A;  3DYE A;  3NHI A;  1ZAC A;  4JWQ A;  2WCJ A;  2PSR A;  2LP2 A;  3WXA A;  2MRD A;  3MSE B;  1EG4 A;  1AVS A;  2L5X B;  2P71 A;  1UHK A;  4MRY A;  1DGU A;  3WHT B;  1K2H A;  1G33 A;  2M0R A;  1A03 A;  1M46 A;  3B6X A;  3FIA A;  1A75 B;  3CYZ A;  1PK0 D;  1PRW A;  3L4A A;  4YI8 A;  3CZ1 A;  3VRN A;  1JSA A;  5G08 A;  2LVK A;  2Q91 A;  1RRO A;  1DJX A;  1XFZ O;  1CFD A;  3O4X A;  5DKR A;  1JF2 A;  1NSH A;  4A4C A;  3OX5 A;  5KSZ A;  4QJ4 B;  1UHH A;  4ORA B;  2BE4 A;  1KWO B;  3NSL A;  1KK7 Z;  1IQ3 A;  5HLV A;  4YGC B;  1CDN A;  2YGU A;  1CFP A;  1JBA A;  1QLS A;  4MRX A;  2LHL A;  4ZCU A;  3AAJ A;  1ZMZ A;  1YX8 A;  3BYA A;  1TNQ A;  3EK4 A;  4NDB A;  2BCB A;  1NUB A;  1WRZ A;  5EL2 A;  1SCM C;  5AFP A;  4ETO A;  4DCK A;  1QX5 B;  1SNL A;  2CCM A;  2GV5 A;  2AAO A;  2I94 A;  2JTZ A;  4MZJ A;  4MSP A;  5CSI A;  2LUC A;  1RWY A;  1SCM B;  2MHH A;  1TUJ A;  4GAO A;  3GOF A;  1GM0 A;  1QIW A;  1RK9 A;  3D77 A;  2Y1N A;  2KNE A;  2MJW B;  1SRA A;  4N1F A;  1Y1A A;  3NSK A;  1ZOT B;  4OVN F;  1CM4 A;  2KGR A;  1LIN A;  3KF9 A;  3OB2 B;  3K1E A;  1R2U A;  1J7Q A;  5FI7 A;  1DEK A;  2L2C A;  3AKA A;  1YX7 A;  4XJK B;  2WC6 A;  5F6T A;  2AUC A;  1CNP A;  2F3Z A;  1F54 A;  2NLN A;  1C7V A;  2K7O A;  4F0Z B;  3K21 A;  2K7C A;  3BUM B;  4I5L B;  3SS4 A;  2CNP A;  1G4Y R;  5ER5 A;  2JT8 A;  3HCM A;  1F8H A;  3BUO B;  5J3X A;  2KBI A;  1IIO A;  2OPO A;  4GGF C;  3O2P A;  1SW8 A;  3NSI A;  2WC5 A;  1WRL A;  4XJK A;  5GQQ C;  4INW A;  2FCD A;  1OW4 A;  4USL A;  2BAP A;  1DJG A;  4C0K A;  4DUQ A;  1KCY A;  1PVA A;  1BMO A;  3TDU A;  1MUX A;  1XFX O;  3FWC A;  4I5N B;  3SG5 A;  3VRQ A;  2LMU A;  3FE9 A;  5KTY A;  2JOJ A;  3BFB A;  2L4H A;  5FI2 A;  3OX6 A;  3TS5 C;  1Z4H A;  2KI4 C;  2MLF C;  3NHT A;  2WCM A;  1J7O A;  1WY9 A;  2JZI A;  2TN4 A;  1DVI A;  1JFK A;  4GGF A;  1M63 B;  4FTG A;  1SR6 B;  3CLN A;  3TS5 B;  1OZO A;  3WHU B;  5IBW A;  1WRK A;  1AJ5 A;  1QV0 A;  1J1D A;  2QAC A;  1Y6W A;  1RFJ A;  3CR5 X;  2FJY A;  2EGD A;  1UHI A;  3DVJ A;  2WC8 A;  5ER4 X;  3OP0 A;  2LNK A;  3PFV A;  4I5J A;  4WRI A;  3TDZ A;  4YI9 A;  4CID A;  4FQT A;  4N1G A;  1AUI B;  3FE6 A;  3CZ0 A;  1JFJ A;  1X02 A;  1NIW A;  1PSB A;  2LVJ A;  5AER A;  1QX2 A;  2QEV A;  2QEB A;  4U8D A;  1B8R A;  3R1V A;  4PHN A;  2ZNE A;  2K7D A;  1B7T Z;  1K96 A;  1SBJ A;  1DT7 B;  5D69 A;  1LS8 A;  1UP5 A;  4ZCV A;  2LCP A;  2E6W A;  2B1U A;  2NZ0 A;  1L7Z A;  1DQE A;  1B1G A;  2OS8 C;  5DKQ A;  1TIZ A;  1UUR A;  1K95 A;  2KQ6 A;  3PLF B;  1DJW A;  2CXJ A;  2KLD A;  2OS8 B;  5AEQ A;  5HKY A;  2FJU B;  1OOJ A;  3SG3 A;  5D3O A;  1N2D A;  1IJ5 A;  1TRF A;  1J55 A;  1OZS A;  5CPV A;  1KK7 Y;  1CDP A;  1NX3 A;  1XFW O;  2Y5I A;  3JVT B;  1EH2 A;  1TCF A;  2SCP A;  3AKB A;  2BCX A;  1Z2C B;  1PSR A;  3VRR A;  3PN7 B;  1XK4 A;  1S3P A;  1G8I A;  3D0Y A;  1SSE B;  1NWD A;  3B7A A;  3C1V A;  3DF0 A;  1BJF A;  1R6P A;  1KSM A;  4GGN A;  4C0L A;  1AK8 A;  2PRU A;  1M39 A;  2JT3 A;  2CTN A;  1BU3 A;  3QRX A;  4PE1 A;  2KAY A;  3LL8 B;  1M31 A;  2IS9 A;  3SJS A;  3NXA A;  4UPG A;  2P70 A;  2JPT A;  2ZRT A;  1BG1 A;  4PE0 A;  3UO9 A;  4ICB A;  4IL1 A;  1FI5 A;  3A8R A;  2HF5 A;  2JNX A;  2ERB A;  1E8A A;  1M45 A;  2O60 A;  3TUY C;  5I94 A;  1YUT A;  3FS7 A;  3PJI A;  3SG4 A;  3OBV A;  2H61 C;  2KFG A;  2FCE A;  1H4B A;  3TUY B;  3JTD C; 
#chains in the Genus database with same CATH homology
 2M8U A;  2ZN8 A;  1ALV A;  3I5H C;  2KGB C;  2VRG A;  4BY4 A;  3BUN B;  2HQW A;  3JTD B;  1OMR A;  3I5H B;  1PUL A;  3AAK A;  2KAV A;  4OCI A;  1UHJ A;  3EKH A;  4YGD B;  2ISD A;  4WQ3 A;  1DJZ A;  3CZT X;  4NDD A;  2H2K A;  1KSO A;  1MF8 B;  1B4C A;  2LAN A;  4PHJ A;  3I5F C;  1IH0 A;  5D7F A;  2H61 A;  4MN0 A;  4MZK A;  3IQQ A;  5JOL A;  2AMI A;  4HRG A;  4ORC B;  2KOT A;  1QVI Z;  2O5G A;  2E30 A;  3DVE A;  1QAT A;  1IWQ A;  3GK2 A;  4FQO A;  2KAX A;  1WDC C;  1CFC A;  1KFU L;  2L50 A;  5BPJ A;  3FWB A;  2BE6 A;  3SG2 A;  3BUX B;  2HPS A;  1KK8 C;  3DVK A;  1Q80 A;  1RTP 1;  1CM1 A;  1L2O C;  2F8P A;  2JRF A;  1NCX A;  1CLM A;  1K9P A;  1LXF C;  1XA5 A;  1YUR A;  2WOR A;  1OMD A;  1IKU A;  1KK8 B;  1S26 D;  4NDC A;  1KQM C;  3TDI A;  1L2O B;  3CS1 A;  3IF7 A;  3OHM B;  2K8M B;  3KPX A;  2JQ6 A;  1KFX L;  4P5O E;  4YGE B;  1SYM A;  2KHN A;  2LVV A;  1JF0 A;  1B7T Y;  2Y4Q A;  3GK4 X;  1KQM B;  2M7N A;  1MXE A;  2WCB A;  5I2O A;  2BBM A;  1IGV A;  1QS7 A;  1YVL A;  2L2E A;  1GQM A;  2K2F A;  4MVF A;  1NCZ A;  5I2L A;  3RM1 A;  3RLZ A;  2WOS A;  2QPT A;  1GGW A;  1QXP A;  2JTT A;  4OKH A;  1FF1 A;  1WLZ A;  4JQ0 D;  4P2Y B;  2KBM A;  3CGA A;  4MBE A;  2Q4U A;  1CDM A;  2WND A;  3SG7 A;  2KI4 B;  3EKJ A;  3SG6 A;  3I5G C;  3OB1 B;  4GPL B;  1EG3 A;  1J7R A;  1HQV A;  1WLM A;  3ZWH A;  1CDL A;  5FYX A;  2CT9 A;  1JWD A;  1OMV A;  1JC2 A;  2FOT A;  1MR8 A;  1NP8 A;  4QJ3 B;  2EC6 C;  2OTG C;  2NXQ A;  2ZKM X;  1DF0 B;  2BKH B;  2F3Y A;  2EC6 B;  3DD4 A;  1S6J A;  1EL4 A;  2M7L A;  1DJY A;  2LLU A;  3F45 A;  4YGA A;  1XVJ A;  2I18 A;  1DMO A;  1BF5 A;  2JXC A;  1V1F A;  1QTX A;  2CBL A;  2LLS A;  3BXK A;  4DIR A;  1CKK A;  1YUS A;  1W7J B;  2BL0 C;  3CR2 A;  3O6B A;  4JPZ B;  1DF0 A;  1SK6 D;  1W7I B;  5CSF A;  4PDZ A;  4D1E A;  4BY5 A;  3M0W A;  2BL0 B;  2K7B A;  1A29 A;  1OE9 B;  1H8B A;  1XK4 C;  2LC5 A;  3HX4 A;  5I2Q A;  2F2P A;  2ZRS A;  5HKW A;  4A4B A;  1S5G Z;  1LVC D;  2K61 A;  1SPY A;  3D0Y B;  2V53 A;  1XFV O;  1LA0 A;  2HET A;  2KQY A;  2M29 A;  2GGM A;  3I5I C;  4PHM A;  3VRO A;  3DF0 B;  2LM5 A;  5KU1 A;  1BR4 B;  1K9U A;  4PAL A;  1SL8 A;  1TCO B;  5HKZ A;  4HSZ A;  4M2O A;  2RGI A;  2P6B B;  4GNK B;  5AAN A;  2KI6 D;  2GGZ A;  1YRU B;  2MBX A;  1CMF A;  3BQ3 A;  2R2I A;  1QLK A;  2LMT A;  1C7W A;  2LLT A;  5TNC A;  1DJH A;  3PAT A;  4DRW A;  1S36 A;  1TN4 A;  3PM8 A;  1U5I B;  1EJ3 A;  1F4Q A;  2L0P A;  3EVR A;  3NSO A;  1N0Y A;  1SMG A;  2PMY A;  3PAL A;  1CFF A;  1MQ1 A;  1QVI Y;  2M3W A;  3E3R A;  3CR4 X;  3H4S E;  3LK0 A;  1XYD A;  1QIV A;  1U5I A;  3A4U B;  3LCP C;  1Y1U A;  4I5K A;  2I7A A;  2SAS A;  4C0J A;  1RJV A;  4GUK A;  1F55 A;  4WQ2 A;  2LE9 B;  2NCO A;  2KFH A;  2JT0 A;  3SIB A;  1YUU A;  2Y1M A;  1KFU S;  1ZFS A;  2F33 A;  1LKJ A;  3D10 A;  1K94 A;  1S1E A;  2KDH A;  2PVB A;  1Y1X A;  4N5X A;  2KYF A;  2MAZ A;  1IRJ A;  3ICB A;  4E68 A;  5JJG A;  1B47 A;  2JUL A;  1KWO C;  4AQI A;  5K89 A;  1A75 A;  2M9G A;  3EVV A;  2LV7 A;  2KI6 C;  1F70 A;  2LVI A;  1YR5 A;  1TNX A;  1KFX S;  1YTZ C;  2WCF A;  4QJ5 B;  3I5F B;  1UWO A;  1F4O A;  4YRU A;  2JWW A;  4PE4 A;  1NX0 A;  1F71 A;  4XYN A;  1OQP A;  1NCY A;  4HRH A;  1J7P A;  4R1E A;  1GGZ A;  4TNC A;  2BEC A;  4Q04 A;  1WDC B;  2MA2 A;  1EXR A;  1OSA A;  2K0J A;  2L51 A;  5B8I B;  3KHE A;  5HLO A;  4GBA A;  1V1G A;  2LHI A;  2ZND A;  2D8N A;  1UHN A;  1BOD A;  2M1K B;  1CMG A;  2M49 B;  5CSJ A;  1BOC A;  3BOW B;  3O78 A;  2KYC A;  3VRP A;  1ALW A;  2G2B A;  4NQG A;  4PHK A;  3GK1 A;  4L9M A;  2G9B A;  4YGB B;  2HQ8 A;  1UUS A;  1AJ4 A;  4MLW A;  4OV2 A;  1YRT B;  2BBN A;  1QJT A;  5HYD A;  1Y0V H;  1NX2 A;  1MXL C;  4CFQ A;  1DJI A;  1S6C A;  1TTX A;  5AXI A;  1K8U A;  3BOW A;  1IG5 A;  1DTL A;  2PAS A;  3O4Y A;  2F2O A;  1C07 A;  1QV1 A;  2L98 A;  3CWG A;  3DVM A;  1SKT A;  1KQV A;  1CB1 A;  2JU0 A;  2WCE A;  1SL7 A;  1REC A;  3EK8 A;  2A4J A;  1SCV A;  1PVB A;  1S5G Y;  2I2R E;  2NCP A;  3I5G B;  3VGO A;  4M2Q A;  4CLN A;  4HRE E;  4ORB B;  1FW4 A;  1NX1 A;  1ZUZ A;  1J1E A;  1QX7 A;  3CTN A;  1B8C A;  2KFF A;  2K2A A;  1SR6 C;  2OTG B;  2ZFD A;  1XO5 A;  5DKN A;  1DGV A;  3IQO A;  1BT6 A;  1QAS A;  4GFT A;  1FPW A;  2M1U A;  3KEV A;  1JUO A;  1XFU O;  1A2X A;  1NPQ A;  1HT9 A;  3TZ1 A;  4AOM A;  2BCA A;  1AHR A;  1YVH A;  1XFY O;  3ZNI A;  1K9K A;  4DS7 A;  1BLQ A;  1B8L A;  2BKI B;  4PE7 A;  4AQJ A;  1N65 A;  1B9A A;  1SY9 A;  1K90 D;  3SIA A;  1BR1 B;  2LMV A;  4CFR A;  1CLL A;  2EHB A;  2MLE C;  5I8N A;  3KO0 A;  5CSN A;  1AP4 A;  1FBV A;  2ZN9 A;  1CLB A;  1A4P A;  2LAP A;  4MZL A;  1IJ6 A;  1MHO A;  5PAL A;  3I5I B;  1SL9 A;  1PAL A;  2M97 A;  1LA3 A;  1K93 D;  3LLE A;  4MEW A;  4CPV A;  1S6I A;  1VRK A;  2JNF A;  3EK7 A;  1TNP A;  1TNW A;  4YBH B;  2JXL A;  3PSR A;  3EVU A;  1MWN A;  3BUW B;  3WNX B;  1ODB A;  2LUX A;  2JC2 A;  1FI6 A;  2DOQ A;  4PCW A;  3JVT C;  2COL B;  1IQ5 A;  4M2P A;  1D1O A;  4OR9 B;  3LK1 A;  1TOP A;  1NYA A;  3PN7 C;  1GJY A;  2L4I A;  2PAL A;  2KSP A;  1CTR A;  2LP3 A;  1ZAC A;  4JWQ A;  2PSR A;  2LP2 A;  3WXA A;  2MRD A;  3MSE B;  1EG4 A;  1AVS A;  2L5X B;  1UHK A;  4MRY A;  1DGU A;  3WHT B;  1K2H A;  1G33 A;  2M0R A;  1A03 A;  1M46 A;  3FIA A;  1A75 B;  1PK0 D;  1PRW A;  4YI8 A;  3VRN A;  1JSA A;  5G08 A;  2LVK A;  2Q91 A;  1RRO A;  1DJX A;  1XFZ O;  1CFD A;  5DKR A;  1JF2 A;  1NSH A;  4A4C A;  3OX5 A;  5KSZ A;  4QJ4 B;  1UHH A;  4ORA B;  2BE4 A;  1KWO B;  3NSL A;  1KK7 Z;  1IQ3 A;  5HLV A;  4YGC B;  1CDN A;  1CFP A;  1JBA A;  1QLS A;  4MRX A;  2LHL A;  4ZCU A;  3AAJ A;  1ZMZ A;  1YX8 A;  3BYA A;  1TNQ A;  3EK4 A;  4NDB A;  2BCB A;  1NUB A;  1WRZ A;  1SCM C;  5AFP A;  4ETO A;  4DCK A;  1QX5 B;  1SNL A;  2CCM A;  2GV5 A;  2AAO A;  2I94 A;  2JTZ A;  4MZJ A;  4MSP A;  5CSI A;  2LUC A;  1RWY A;  1SCM B;  2MHH A;  4GAO A;  3GOF A;  1QIW A;  1RK9 A;  2Y1N A;  2KNE A;  2MJW B;  1SRA A;  4N1F A;  1Y1A A;  3NSK A;  1ZOT B;  4OVN F;  1CM4 A;  2KGR A;  1LIN A;  3KF9 A;  3OB2 B;  1R2U A;  1J7Q A;  3AKA A;  1YX7 A;  4XJK B;  5F6T A;  2AUC A;  1CNP A;  2F3Z A;  1F54 A;  2NLN A;  1C7V A;  2K7O A;  4F0Z B;  3K21 A;  2K7C A;  3BUM B;  4I5L B;  2CNP A;  1G4Y R;  5ER5 A;  2JT8 A;  3HCM A;  1F8H A;  3BUO B;  5J3X A;  2KBI A;  2OPO A;  4GGF C;  3O2P A;  1SW8 A;  3NSI A;  1WRL A;  4XJK A;  5GQQ C;  2FCD A;  4DUQ A;  4USL A;  1KCY A;  1DJG A;  4C0K A;  1PVA A;  1BMO A;  3TDU A;  1MUX A;  1XFX O;  3FWC A;  4I5N B;  3SG5 A;  3VRQ A;  2LMU A;  5KTY A;  2JOJ A;  2L4H A;  3OX6 A;  3TS5 C;  2KI4 C;  2MLF C;  1J7O A;  1WY9 A;  2JZI A;  2TN4 A;  1DVI A;  1JFK A;  4GGF A;  1M63 B;  4FTG A;  1SR6 B;  3CLN A;  3TS5 B;  1OZO A;  3WHU B;  5IBW A;  1WRK A;  1AJ5 A;  1QV0 A;  1J1D A;  2QAC A;  1Y6W A;  1RFJ A;  3CR5 X;  2EGD A;  1UHI A;  3DVJ A;  2WC8 A;  5ER4 X;  3OP0 A;  2LNK A;  3PFV A;  4I5J A;  4WRI A;  3TDZ A;  4YI9 A;  4CID A;  4N1G A;  1AUI B;  1JFJ A;  1NIW A;  1PSB A;  1X02 A;  2LVJ A;  5AER A;  1QX2 A;  4U8D A;  1B8R A;  4PHN A;  2ZNE A;  2K7D A;  1B7T Z;  1K96 A;  1SBJ A;  1DT7 B;  5D69 A;  1UP5 A;  4ZCV A;  2LCP A;  2E6W A;  2B1U A;  2NZ0 A;  1L7Z A;  1B1G A;  2OS8 C;  5DKQ A;  1TIZ A;  1UUR A;  1K95 A;  2KQ6 A;  3PLF B;  1DJW A;  2CXJ A;  2OS8 B;  5AEQ A;  5HKY A;  2FJU B;  1OOJ A;  3SG3 A;  1N2D A;  1IJ5 A;  1TRF A;  1J55 A;  1OZS A;  5CPV A;  1KK7 Y;  1CDP A;  1NX3 A;  1XFW O;  2Y5I A;  3JVT B;  1EH2 A;  1TCF A;  2SCP A;  3AKB A;  2BCX A;  1PSR A;  3VRR A;  3PN7 B;  1XK4 A;  1S3P A;  1G8I A;  3D0Y A;  1NWD A;  3DF0 A;  3C1V A;  1BJF A;  1R6P A;  1KSM A;  4GGN A;  4C0L A;  1AK8 A;  2PRU A;  1M39 A;  2JT3 A;  2CTN A;  1BU3 A;  3QRX A;  4PE1 A;  2KAY A;  3LL8 B;  1M31 A;  2IS9 A;  3SJS A;  3NXA A;  4UPG A;  2JPT A;  2ZRT A;  1BG1 A;  4PE0 A;  4ICB A;  4IL1 A;  1FI5 A;  3A8R A;  2HF5 A;  2JNX A;  1E8A A;  1M45 A;  2O60 A;  3TUY C;  1YUT A;  3FS7 A;  3SG4 A;  2H61 C;  2KFG A;  2FCE A;  1H4B A;  3TUY B;  3JTD C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...