3CDNA

Crystal structure of a pheromone binding protein from apis mellifera soaked at ph 4.0
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
116
structure length
116
Chain Sequence
WVPPEVFDLVAEDKARCMSEHGTTQAQIDDVDKGNLVNEPSITCYMYCLLEAFSLVDDEANVDEDIMLGLLPDQLQERAQSVMGKCLPTSGSDNCNKIYNLAKCVQESAPDVWFVI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pheromone-binding protein ASP1
publication title Structural basis of the honey bee PBP pheromone and pH-induced conformational change
pubmed doi rcsb
source organism Apis mellifera
molecule tags Pheromone-binding protein
total genus 41
structure length 116
sequence length 116
ec nomenclature
pdb deposition date 2008-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01395 PBP_GOBP PBP/GOBP family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.20 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 Pheromone/general odorant binding protein domain 3cdnA00
3L47A 2WC6A 3R1VA 4INXA 3QMEA 3DY9A 1TUJA 1OOIX 5EL2A 3V2LA 4FQTA 4F7FA 3FE6A 3L4LA 3S0FA 3B88A 1ORGA 3RZSA 1OOGA 2GTEA 3B86A 1OOFA 3CDNA 3R1PA 3BFBA 2P71A 5DICA 3NHTA 3B6XA 4INWA 1XFRA 3NGVA 3S0AA 3BJHA 3FE8A 2P70A 1QWVA 3NHIA 1DQEA 1OOHA 2QEOA 3PJIA 3D77A 3K1EA 3BFAA 3DYEA 2WCJA 3S0GA 3D73A 2JPOA 3D76A 1LS8A 2WC5A 3D78A 3S0BA 2ERBA 2H8VA 1TWOA 2WCLA 4PT1A 3CABA 3B87A 3B7AA 3S0EA 1C3ZA 1GM0A 3R72A 2KPHA 1OW4A 3BFHA 3S0DA 2FJYA 3CZ0A 2QEBA 3N7HA 2QDIA 1P28A 3D75A 3FE9A 3Q8IA 3CYZA 2QEVA 2WCMA 2L2CA 2QEHA 3CZ2A 2PQLA 1C3YA 3DZTA 2WCKA 3L4AA 3DXLA 4JD9A 4OZDA 3OGNA 3D74A 3VB1A 3CZ1A 1T14A 3R1OA 2WCHA
chains in the Genus database with same CATH superfamily
2M1KB 2PSRA 3KEVA 4INXA 2BKIB 4PE1A 2M0RA 5J3XA 1BMOA 1KFXS 2KAVA 4DUQA 4YBHB 1BU3A 1NCZA 1YR5A 1CM1A 2KQYA 1QATA 1ZFSA 2M7NA 5G08A 3JVTB 4FQTA 1MQ1A 4U8DA 3L4LA 1DGUA 1RECA 1CLLA 1RJVA 1XA5A 3B88A 1IKUA 1DJGA 1J55A 4P2YB 1ORGA 2IS9A 1AJ5A 1OE9B 1C7VA 3H4SE 3EK7A 4HSZA 3OX6A 1YUSA 3EKHA 1DJYA 3M0WA 4MVFA 1B9AA 1S5GY 3ZWHA 1A2XA 2QACA 3A4UB 1QVIZ 1XFVO 3SJSA 4WQ3A 2LAPA 4M2PA 5KSZA 3R1PA 2OPOA 3DF0B 4ORCB 1QV1A 1QTXA 1XFXO 2P71A 3TUYB 1J1DA 3I5FB 3IQQA 1S1EA 4YI8A 1H4BA 3GK1A 1XFRA 3NGVA 1DF0B 2ZRSA 1R6PA 1LA3A 3TUYC 1K90D 1W7IB 3IQOA 1HQVA 3I5FC 5AFPA 4OKHA 3EKJA 4N1FA 1Y0VH 2KI6D 4ZCVA 4F0ZB 5F6TA 1F8HA 4USLA 2Y1NA 1J7PA 4JPZB 4YGEB 1SMGA 3GK4X 4NDCA 3DVEA 1LXFC 3D73A 3DVJA 3D78A 1UHJA 4GFTA 2ERBA 2LUXA 2VRGA 2JOJA 3DVKA 2BNXA 2LCPA 3O4XA 1ZUZA 3VROA 1DJHA 2HQ8A 1QLSA 2AUCA 1FI5A 1KSMA 2MA2A 3IF7A 1B4CA 1IG5A 3SG5A 1YVLA 1VRKA 3O6BA 3DF0A 3VRPA 3EVUA 1K8UA 2KHNA 3K21A 1C3ZA 2WORA 3PATA 2Q4UA 3BYAA 3BFHA 1G8IA 2BKHB 4CFQA 2FJYA 4DIRA 2TN4A 2K2FA 1JBAA 4A4CA 2GGZA 1JC2A 2LUCA 1PVAA 2M29A 1DJWA 4YGBB 1BR4B 2OTGB 1NUBA 2QEBA 3N7HA 3PALA 1SL7A 1TTXA 1G4YR 2KBMA 2LVJA 3BUMB 1P28A 1IQ5A 4A4BA 3FE9A 2PVBA 1SYMA 3NSIA 1WLMA 1CLBA 5GQQC 2L4HA 2OTGC 2WNDA 2QEVA 2L2CA 2QEHA 3CZ2A 1LINA 2LP2A 5HL1A 1YRTB 2WCEA 2ISDA 2LNKA 1MXLC 4I5KA 4M2OA 3ZNIA 2QPTA 3D0YB 3DXLA 2JWWA 2H61A 3OGNA 4OZDA 2LHLA 2Y5IA 3LLEA 3VB1A 4P5OE 4QJ3B 3SS5A 1T14A 2KFFA 2LMUA 4AQJA 4C0JA 5TNCA 5KTYA 2COLB 2WC6A 3SG2A 4GGNA 3BUXB 1S36A 1G33A 4JWQA 3DVMA 3RM1A 1BOCA 2JC2A 2I7AA 2F2OA 3EVVA 3KO0A 1N65A 2K0JA 5DKRA 1NSHA 1OMVA 2CT9A 2MRDA 3EVRA 4CIDA 1PSRA 1S6JA 5I94A 1SBJA 1E8AA 4OVNF 1PSBA 1YUTA 4MZLA 5DKNA 3TS5B 2I94A 3CTNA 2LMVA 1F70A 1CDPA 5PALA 2P6BB 2AAOA 3S0FA 1M63B 4GBAA 3FWCA 1QV0A 1TN4A 1FW4A 2LLTA 1JSAA 1BODA 2F3ZA 3TS5C 1CMFA 1UUSA 2GTEA 2SCPA 4MRYA 2JZIA 1FI6A 1KWOC 3D0YA 3MSEB 1OOFA 3CDNA 4NQGA 1A75B 1EH2A 4PE7A 3WNXB 1CTRA 5CSFA 3FWBA 3B6XA 3NHTA 2JXLA 1N2DA 1UP5A 2LP3A 1DJZA 4QJ5B 2LHIA 1C07A 1JFJA 3UNWA 1UHIA 4GUKA 2JNFA 4NDBA 4MBEA 1NX1A 3NHIA 2ZKMX 2CXJA 1QVIY 2KLDA 2L5XB 4PE0A 2YGUA 1BT6A 1F71A 3I5HB 5K89A 1DC1A 1S6CA 1LKJA 2MJWB 1C7WA 1GGZA 1U5IA 1IGVA 3D77A 1MR8A 1W9ZA 2JU0A 1CFDA 5FI6A 3AAKA 2K2AA 3DYEA 3EG5B 3I5HC 2GV5A 1L2OB 2G2BA 2JPOA 2WC5A 1CMGA 4N5XA 1J7OA 1MHOA 4BY4A 2BECA 2HPSA 2WCFA 1QIWA 2JQ6A 2G9BA 5HLVA 3I5IB 4GNKB 1TWOA 3CR5X 1TOPA 1LA0A 2LVVA 1A4PA 1L2OC 4PT1A 1TNQA 3CABA 1M45A 1GQMA 1TNXA 1A75A 4PDZA 2LM5A 5AXIA 1B7TZ 2LMTA 1OQPA 1ZACA 2LV7A 2Q91A 3PSRA 1GM0A 2F2PA 2Y1MA 3CS1A 3I5IC 1KCYA 2M49B 4HRGA 2L0PA 2KYCA 1AP4A 1OZSA 1RK9A 1S26D 1UHKA 2KLEA 1MWNA 2MAZA 3A8RA 4GGFC 1EG3A 1XO5A 2NCPA 2M3WA 2ZRTA 1SY9A 2BBMA 3SG6A 5CSNA 2B1UA 2ZFDA 1DGVA 3HX4A 2BAPA 3OB2B 1BR1B 2LLUA 3NSLA 1Y1UA 4D1EA 1FPWA 3TDUA 1S3PA 2D8NA 5AEQA 1AVSA 1HT9A 1JUOA 1YRUB 2L98A 1PRWA 3CYZA 5CSIA 1BLQA 4I5LB 2PQLA 2CBLA 1JWDA 1C3YA 2L51A 3DZTA 2PYQA 3L4AA 3QRXA 1TUZA 4FQOA 1RWYA 1DEKA 1KFUS 1A03A 1CNPA 4YGDB 1UURA 1J7QA 4UPGA 2E30A 1CFPA 3PM2A 3O78A 1OSAA 5AANA 4AOMA 1DF0A 1Z4HA 2I2RE 2HETA 1F55A 1JF0A 2ZNEA 5DKQA 1YTZC 1JF2A 3DD4A 3R1OA 5FYXA 4HREE 4MSPA 5AERA 1IJ5A 3L47A 4MN0A 1V1FA 2LLSA 3QMEA 5I2LA 1IWQA 3DY9A 1KK7Z 4PHMA 1GJYA 1TUJA 1D1OA 3ICBA 1K9UA 1K9PA 1SPYA 3AKAA 2O60A 1OOIX 1KQVA 2BCBA 1NX3A 5ER4X 1LVCD 1AUIB 3IVTA 3KPXA 3FE6A 1EG4A 4MZJA 4I5JA 2L2EA 1UHHA 4MEWA 1PVBA 2F3YA 1OOGA 3CLNA 1K96A 1V1GA 2KFHA 3NSOA 2MBXA 1K94A 3F45A 4NDDA 2FCEA 3WXAA 3GK2A 2EC6B 2PMYA 1PALA 1F54A 3BFBA 1B8LA 3KHEA 3TDIA 4INWA 5FI2A 2JT3A 3HCMA 3S0AA 1XFZO 1Z2CB 2SASA 2BL0B 2EC6C 3BJHA 4YGAA 2P70A 2MHHA 3FE8A 1QWVA 2LVKA 2LANA 1QX2A 3CZTX 2H2KA 2K7BA 1OOHA 3O4YA 1IH0A 4E68A 2K8MB 2NZ0A 1KWOB 1IRJA 2QEOA 3CR4X 2JT8A 2BL0C 2L5YA 1DJXA 1QXPA 1NCXA 2KFGA 1TNWA 2MLEC 5HYDA 3K1EA 1IIOA 2Y4QA 2L50A 1EL4A 2KYFA 3BFAA 5KU1A 2WCJA 4XJKB 3S0GA 1NX2A 2FCDA 3D76A 1LS8A 3OP0A 1OZOA 4PHNA 3S0BA 1CDNA 1NWDA 3SS3A 1K9KA 1XFWO 1DTLA 2FJUB 1WY9A 1AJ4A 2H8VA 3EK8A 1TCOB 4DRWA 1BG1A 2K60A 2V53A 4N1GA 1CLMA 3B87A 1K2HA 3O2PA 1M39A 2R2IA 2AMIA 4I5NB 5I8NA 1KFXL 3R72A 1L7ZA 1M31A 2EGDA 1OMRA 2KPHA 1FBVA 1K95A 2HF5A 2LE9B 2ZNDA 4ORAB 4PE4A 4CPVA 1WLZA 4TNCA 3UO9A 1QX7A 1F4QA 1DMOA 1QASA 3LK0A 1YX7A 5HKWA 5FI7A 1ALVA 1WRKA 2CCMA 2CNPA 5ER5A 1B7TY 1M46A 5I2QA 5IBWA 3D75A 1Y1AA 1NP8A 1WDCB 3OB1B 1Y6WA 4IJ7A 1DJIA 2LC5A 3Q8IA 1SK6D 1QX5B 1R2UA 2WCBA 4FTGA 1DT7B 4PCWA 1RTP1 1B8RA 2JT0A 2WCMA 4XJKA 4C0LA 2KI4B 2KAXA 1WDCC 3BUWB 2KBIA 1NX0A 2KQ6A 2M8UA 2WCKA 3KF9A 5D3OA 2L4IA 3BOWB 2KGRA 1AHRA 3RLZA 1FF1A 1TRFA 3D74A 1XYDA 5HKYA 2ZN8A 4WQ2A 1CDLA 3JVTC 4BY5A 2KI4C 1ALWA 4JQ0D 1TNPA 2KI6C 5JJGA 2WC8A 1N0YA 4ORBB 1NPQA 3R1VA 2KDHA 2EHBA 3D10A 2BCAA 3OX5A 1ZOTB 1CFFA 3SIAA 3SG7A 5HLOA 1BJFA 1S5GZ 2KSPA 3OBVA 1QS7A 5EL2A 4OV2A 5B8IB 3BQ3A 3V2LA 3JTDB 1MF8B 4F7FA 1IQ3A 3SS4A 4ZCUA 1JFKA 1SKTA 1KK7Y 3FS7A 3PLFB 4MLWA 1TIZA 3RZSA 1H8BA 1UWOA 1Y1XA 4MZKA 4JKTA 1KSOA 1MXEA 2FOTA 1XFYO 3BUNB 4AQIA 3JTDC 5D7FA 1KFUL 4GGFA 4GPLB 3NXAA 5JOLA 2F8PA 2K61A 3B86A 3CGAA 1B1GA 1SL8A 3BOWA 3VGOA 4ETOA 4QJ4B 3NSKA 4R1EA 2M97A 5DICA 1K93D 3PFVA 2PASA 3VRRA 3FIAA 1AK8A 4MRXA 2M9GA 1SCMB 3SG4A 3PN7B 3PM8A 1KQMB 4OR9B 2NCOA 2E6WA 3BXKA 4GAOA 2BBNA 2KOTA 1XVJA 1EXRA 1ODBA 4L9MA 2F33A 2K7CA 2O5GA 2H61C 2K7OA 4ICBA 1DQEA 1SCMC 1XK4C 2A4JA 2KNEA 2DOQA 3CR2A 1NIWA 2BE4A 1ZMZA 3PN7C 4IL1A 1KQMC 3TZ1A 3AAJA 1CDMA 4CFRA 1B47A 3PJIA 2NXQA 1J1EA 1IJ6A 4KYNA 1CM4A 1EJ3A 1TCFA 4PHKA 4YGCB 1J7RA 2KGBC 1WRZA 1YUUA 2ZN9A 2JXCA 4HRHA 2BE6A 1W7JB 2OS8B 1CKKA 1GGWA 1OOJA 1NYAA 1MUXA 2WCLA 1CFCA 2JULA 1WRLA 3WHUB 4M2QA 1SR6B 2JNXA 1NCYA 3B7AA 4WRIA 5D69A 1XFUO 3S0EA 2PALA 2OS8C 3AKBA 2WOSA 1CB1A 1F4OA 1OW4A 4DCKA 1B8CA 1XK4A 1YURA 1DVIA 1QIVA 1OMDA 2JPTA 1X02A 3LCPC 3S0DA 1QLKA 2CTNA 1SR6C 2GGMA 3C1VA 1DELA 5CPVA 4XYNA 3CZ0A 2JRFA 3VRQA 2QDIA 3E3RA 3EK4A 1Q80A 1RROA 1SL9A 3I5GB 1KK8B 4Q04A 3LK1A 1BF5A 1SCVA 2LVIA 4PHJA 1PK0D 2K7DA 3TDZA 2RGIA 2JTTA 1U5IB 1SNLA 2JTZA 3CWGA 3LL8B 3GOFA 2M7LA 2BCXA 1UHNA 1KK8C 3I5GC 3OHMB 3WHTB 1SSEB 1SW8A 2PRUA 2I18A 4YRUA 1SRAA 4JD9A 1RFJA 2HQWA 4CLNA 2MLFC 2KAYA 1A29A 2M1UA 2NLNA 3BUOB 5HKZA 4PALA 3VRNA 3SG3A 4DS7A 3SIBA 4YI9A 1S6IA 4OCIA 1YX8A 1YVHA 3CZ1A 1QJTA 5CSJA 4C0KA 1PULA 5BPJA 5I2OA 2WCHA
chains in the Genus database with same CATH topology
3L47A 2WC6A 3R1VA 4INXA 3QMEA 3DY9A 1TUJA 1OOIX 5EL2A 3V2LA 4FQTA 4F7FA 3FE6A 3L4LA 3S0FA 3B88A 1ORGA 3RZSA 1OOGA 2GTEA 3B86A 1OOFA 3CDNA 3R1PA 3BFBA 2P71A 5DICA 3NHTA 3B6XA 4INWA 1XFRA 3NGVA 3S0AA 3BJHA 3FE8A 2P70A 1QWVA 3NHIA 1DQEA 1OOHA 2QEOA 3PJIA 3D77A 3K1EA 3BFAA 3DYEA 2WCJA 3S0GA 3D73A 2JPOA 3D76A 1LS8A 2WC5A 3D78A 3S0BA 2ERBA 2H8VA 1TWOA 2WCLA 4PT1A 3CABA 3B87A 3B7AA 3S0EA 1C3ZA 1GM0A 3R72A 2KPHA 1OW4A 3BFHA 3S0DA 2FJYA 3CZ0A 2QEBA 3N7HA 2QDIA 1P28A 3D75A 3FE9A 3Q8IA 3CYZA 2QEVA 2WCMA 2L2CA 2QEHA 3CZ2A 2PQLA 1C3YA 3DZTA 2WCKA 3L4AA 3DXLA 4JD9A 4OZDA 3OGNA 3D74A 3VB1A 3CZ1A 1T14A 3R1OA 2WCHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3L47 A;  2WC6 A;  3R1V A;  4INX A;  3QME A;  3DY9 A;  1TUJ A;  1OOI X;  5EL2 A;  3V2L A;  4FQT A;  4F7F A;  3FE6 A;  3L4L A;  3S0F A;  3B88 A;  1ORG A;  3RZS A;  1OOG A;  2GTE A;  3B86 A;  1OOF A;  3CDN A;  3R1P A;  3BFB A;  2P71 A;  5DIC A;  3NHT A;  3B6X A;  4INW A;  1XFR A;  3NGV A;  3S0A A;  3BJH A;  3FE8 A;  2P70 A;  1QWV A;  3NHI A;  1DQE A;  1OOH A;  2QEO A;  3PJI A;  3D77 A;  3K1E A;  3BFA A;  3DYE A;  2WCJ A;  3S0G A;  3D73 A;  2JPO A;  3D76 A;  1LS8 A;  2WC5 A;  3D78 A;  3S0B A;  2ERB A;  2H8V A;  1TWO A;  2WCL A;  4PT1 A;  3CAB A;  3B87 A;  3B7A A;  3S0E A;  1C3Z A;  1GM0 A;  3R72 A;  2KPH A;  1OW4 A;  3BFH A;  3S0D A;  2FJY A;  3CZ0 A;  2QEB A;  3N7H A;  2QDI A;  1P28 A;  3D75 A;  3FE9 A;  3Q8I A;  3CYZ A;  2QEV A;  2WCM A;  2L2C A;  2QEH A;  3CZ2 A;  2PQL A;  1C3Y A;  3DZT A;  2WCK A;  3L4A A;  3DXL A;  4JD9 A;  4OZD A;  3OGN A;  3D74 A;  3VB1 A;  3CZ1 A;  1T14 A;  3R1O A;  2WCH A; 
#chains in the Genus database with same CATH topology
 2M1K B;  2PSR A;  3KEV A;  4INX A;  2BKI B;  4PE1 A;  2M0R A;  5J3X A;  1BMO A;  1KFX S;  2KAV A;  4DUQ A;  4YBH B;  1BU3 A;  1NCZ A;  1YR5 A;  1CM1 A;  2KQY A;  1QAT A;  1ZFS A;  2M7N A;  5G08 A;  3JVT B;  4FQT A;  1MQ1 A;  4U8D A;  3L4L A;  1DGU A;  1REC A;  1CLL A;  1RJV A;  1XA5 A;  3B88 A;  1IKU A;  1DJG A;  1J55 A;  4P2Y B;  1ORG A;  2IS9 A;  1AJ5 A;  1OE9 B;  1C7V A;  3H4S E;  3EK7 A;  4HSZ A;  3OX6 A;  1YUS A;  3EKH A;  1DJY A;  3M0W A;  4MVF A;  1B9A A;  1S5G Y;  3ZWH A;  1A2X A;  2QAC A;  3A4U B;  1QVI Z;  1XFV O;  3SJS A;  4WQ3 A;  2LAP A;  4M2P A;  5KSZ A;  3R1P A;  2OPO A;  3DF0 B;  4ORC B;  1QV1 A;  1QTX A;  1XFX O;  2P71 A;  3TUY B;  1J1D A;  3I5F B;  3IQQ A;  1S1E A;  4YI8 A;  1H4B A;  3GK1 A;  1XFR A;  3NGV A;  1DF0 B;  2ZRS A;  1R6P A;  1LA3 A;  3TUY C;  1K90 D;  1W7I B;  3IQO A;  1HQV A;  3I5F C;  5AFP A;  4OKH A;  3EKJ A;  4N1F A;  1Y0V H;  2KI6 D;  4ZCV A;  4F0Z B;  5F6T A;  1F8H A;  4USL A;  2Y1N A;  1J7P A;  4JPZ B;  4YGE B;  1SMG A;  3GK4 X;  4NDC A;  3DVE A;  1LXF C;  3D73 A;  3DVJ A;  3D78 A;  1UHJ A;  4GFT A;  2ERB A;  2LUX A;  2VRG A;  2JOJ A;  3DVK A;  2BNX A;  2LCP A;  3O4X A;  1ZUZ A;  3VRO A;  1DJH A;  2HQ8 A;  1QLS A;  2AUC A;  1FI5 A;  1KSM A;  2MA2 A;  3IF7 A;  1B4C A;  1IG5 A;  3SG5 A;  1YVL A;  1VRK A;  3O6B A;  3DF0 A;  3VRP A;  3EVU A;  1K8U A;  2KHN A;  3K21 A;  1C3Z A;  2WOR A;  3PAT A;  2Q4U A;  3BYA A;  3BFH A;  1G8I A;  2BKH B;  4CFQ A;  2FJY A;  4DIR A;  2TN4 A;  2K2F A;  1JBA A;  4A4C A;  2GGZ A;  1JC2 A;  2LUC A;  1PVA A;  2M29 A;  1DJW A;  4YGB B;  1BR4 B;  2OTG B;  1NUB A;  2QEB A;  3N7H A;  3PAL A;  1SL7 A;  1TTX A;  1G4Y R;  2KBM A;  2LVJ A;  3BUM B;  1P28 A;  1IQ5 A;  4A4B A;  3FE9 A;  2PVB A;  1SYM A;  3NSI A;  1WLM A;  1CLB A;  5GQQ C;  2L4H A;  2OTG C;  2WND A;  2QEV A;  2L2C A;  2QEH A;  3CZ2 A;  1LIN A;  2LP2 A;  5HL1 A;  1YRT B;  2WCE A;  2ISD A;  2LNK A;  1MXL C;  4I5K A;  4M2O A;  3ZNI A;  2QPT A;  3D0Y B;  3DXL A;  2JWW A;  2H61 A;  3OGN A;  4OZD A;  2LHL A;  2Y5I A;  3LLE A;  3VB1 A;  4P5O E;  4QJ3 B;  3SS5 A;  1T14 A;  2KFF A;  2LMU A;  4AQJ A;  4C0J A;  5TNC A;  5KTY A;  2COL B;  2WC6 A;  3SG2 A;  4GGN A;  3BUX B;  1S36 A;  1G33 A;  4JWQ A;  3DVM A;  3RM1 A;  1BOC A;  2JC2 A;  2I7A A;  2F2O A;  3EVV A;  3KO0 A;  1N65 A;  2K0J A;  5DKR A;  1NSH A;  1OMV A;  2CT9 A;  2MRD A;  3EVR A;  4CID A;  1PSR A;  1S6J A;  5I94 A;  1SBJ A;  1E8A A;  4OVN F;  1PSB A;  1YUT A;  4MZL A;  5DKN A;  3TS5 B;  2I94 A;  3CTN A;  2LMV A;  1F70 A;  1CDP A;  5PAL A;  2P6B B;  2AAO A;  3S0F A;  1M63 B;  4GBA A;  3FWC A;  1QV0 A;  1TN4 A;  1FW4 A;  2LLT A;  1JSA A;  1BOD A;  2F3Z A;  3TS5 C;  1CMF A;  1UUS A;  2GTE A;  2SCP A;  4MRY A;  2JZI A;  1FI6 A;  1KWO C;  3D0Y A;  3MSE B;  1OOF A;  3CDN A;  4NQG A;  1A75 B;  1EH2 A;  4PE7 A;  3WNX B;  1CTR A;  5CSF A;  3FWB A;  3B6X A;  3NHT A;  2JXL A;  1N2D A;  1UP5 A;  2LP3 A;  1DJZ A;  4QJ5 B;  2LHI A;  1C07 A;  1JFJ A;  3UNW A;  1UHI A;  4GUK A;  2JNF A;  4NDB A;  4MBE A;  1NX1 A;  3NHI A;  2ZKM X;  2CXJ A;  1QVI Y;  2KLD A;  2L5X B;  4PE0 A;  2YGU A;  1BT6 A;  1F71 A;  3I5H B;  5K89 A;  1DC1 A;  1S6C A;  1LKJ A;  2MJW B;  1C7W A;  1GGZ A;  1U5I A;  1IGV A;  3D77 A;  1MR8 A;  1W9Z A;  2JU0 A;  1CFD A;  5FI6 A;  3AAK A;  2K2A A;  3DYE A;  3EG5 B;  3I5H C;  2GV5 A;  1L2O B;  2G2B A;  2JPO A;  2WC5 A;  1CMG A;  4N5X A;  1J7O A;  1MHO A;  4BY4 A;  2BEC A;  2HPS A;  2WCF A;  1QIW A;  2JQ6 A;  2G9B A;  5HLV A;  3I5I B;  4GNK B;  1TWO A;  3CR5 X;  1TOP A;  1LA0 A;  2LVV A;  1A4P A;  1L2O C;  4PT1 A;  1TNQ A;  3CAB A;  1M45 A;  1GQM A;  1TNX A;  1A75 A;  4PDZ A;  2LM5 A;  5AXI A;  1B7T Z;  2LMT A;  1OQP A;  1ZAC A;  2LV7 A;  2Q91 A;  3PSR A;  1GM0 A;  2F2P A;  2Y1M A;  3CS1 A;  3I5I C;  1KCY A;  2M49 B;  4HRG A;  2L0P A;  2KYC A;  1AP4 A;  1OZS A;  1RK9 A;  1S26 D;  1UHK A;  2KLE A;  1MWN A;  2MAZ A;  3A8R A;  4GGF C;  1EG3 A;  1XO5 A;  2NCP A;  2M3W A;  2ZRT A;  1SY9 A;  2BBM A;  3SG6 A;  5CSN A;  2B1U A;  2ZFD A;  1DGV A;  3HX4 A;  2BAP A;  3OB2 B;  1BR1 B;  2LLU A;  3NSL A;  1Y1U A;  4D1E A;  1FPW A;  3TDU A;  1S3P A;  2D8N A;  5AEQ A;  1AVS A;  1HT9 A;  1JUO A;  1YRU B;  2L98 A;  1PRW A;  3CYZ A;  5CSI A;  1BLQ A;  4I5L B;  2PQL A;  2CBL A;  1JWD A;  1C3Y A;  2L51 A;  3DZT A;  2PYQ A;  3L4A A;  3QRX A;  1TUZ A;  4FQO A;  1RWY A;  1DEK A;  1KFU S;  1A03 A;  1CNP A;  4YGD B;  1UUR A;  1J7Q A;  4UPG A;  2E30 A;  1CFP A;  3PM2 A;  3O78 A;  1OSA A;  5AAN A;  4AOM A;  1DF0 A;  1Z4H A;  2I2R E;  2HET A;  1F55 A;  1JF0 A;  2ZNE A;  5DKQ A;  1YTZ C;  1JF2 A;  3DD4 A;  3R1O A;  5FYX A;  4HRE E;  4MSP A;  5AER A;  1IJ5 A;  3L47 A;  4MN0 A;  1V1F A;  2LLS A;  3QME A;  5I2L A;  1IWQ A;  3DY9 A;  1KK7 Z;  4PHM A;  1GJY A;  1TUJ A;  1D1O A;  3ICB A;  1K9U A;  1K9P A;  1SPY A;  3AKA A;  2O60 A;  1OOI X;  1KQV A;  2BCB A;  1NX3 A;  5ER4 X;  1LVC D;  1AUI B;  3IVT A;  3KPX A;  3FE6 A;  1EG4 A;  4MZJ A;  4I5J A;  2L2E A;  1UHH A;  4MEW A;  1PVB A;  2F3Y A;  1OOG A;  3CLN A;  1K96 A;  1V1G A;  2KFH A;  3NSO A;  2MBX A;  1K94 A;  3F45 A;  4NDD A;  2FCE A;  3WXA A;  3GK2 A;  2EC6 B;  2PMY A;  1PAL A;  1F54 A;  3BFB A;  1B8L A;  3KHE A;  3TDI A;  4INW A;  5FI2 A;  2JT3 A;  3HCM A;  3S0A A;  1XFZ O;  1Z2C B;  2SAS A;  2BL0 B;  2EC6 C;  3BJH A;  4YGA A;  2P70 A;  2MHH A;  3FE8 A;  1QWV A;  2LVK A;  2LAN A;  1QX2 A;  3CZT X;  2H2K A;  2K7B A;  1OOH A;  3O4Y A;  1IH0 A;  4E68 A;  2K8M B;  2NZ0 A;  1KWO B;  1IRJ A;  2QEO A;  3CR4 X;  2JT8 A;  2BL0 C;  2L5Y A;  1DJX A;  1QXP A;  1NCX A;  2KFG A;  1TNW A;  2MLE C;  5HYD A;  3K1E A;  1IIO A;  2Y4Q A;  2L50 A;  1EL4 A;  2KYF A;  3BFA A;  5KU1 A;  2WCJ A;  4XJK B;  3S0G A;  1NX2 A;  2FCD A;  3D76 A;  1LS8 A;  3OP0 A;  1OZO A;  4PHN A;  3S0B A;  1CDN A;  1NWD A;  3SS3 A;  1K9K A;  1XFW O;  1DTL A;  2FJU B;  1WY9 A;  1AJ4 A;  2H8V A;  3EK8 A;  1TCO B;  4DRW A;  1BG1 A;  2K60 A;  2V53 A;  4N1G A;  1CLM A;  3B87 A;  1K2H A;  3O2P A;  1M39 A;  2R2I A;  2AMI A;  4I5N B;  5I8N A;  1KFX L;  3R72 A;  1L7Z A;  1M31 A;  2EGD A;  1OMR A;  2KPH A;  1FBV A;  1K95 A;  2HF5 A;  2LE9 B;  2ZND A;  4ORA B;  4PE4 A;  4CPV A;  1WLZ A;  4TNC A;  3UO9 A;  1QX7 A;  1F4Q A;  1DMO A;  1QAS A;  3LK0 A;  1YX7 A;  5HKW A;  5FI7 A;  1ALV A;  1WRK A;  2CCM A;  2CNP A;  5ER5 A;  1B7T Y;  1M46 A;  5I2Q A;  5IBW A;  3D75 A;  1Y1A A;  1NP8 A;  1WDC B;  3OB1 B;  1Y6W A;  4IJ7 A;  1DJI A;  2LC5 A;  3Q8I A;  1SK6 D;  1QX5 B;  1R2U A;  2WCB A;  4FTG A;  1DT7 B;  4PCW A;  1RTP 1;  1B8R A;  2JT0 A;  2WCM A;  4XJK A;  4C0L A;  2KI4 B;  2KAX A;  1WDC C;  3BUW B;  2KBI A;  1NX0 A;  2KQ6 A;  2M8U A;  2WCK A;  3KF9 A;  5D3O A;  2L4I A;  3BOW B;  2KGR A;  1AHR A;  3RLZ A;  1FF1 A;  1TRF A;  3D74 A;  1XYD A;  5HKY A;  2ZN8 A;  4WQ2 A;  1CDL A;  3JVT C;  4BY5 A;  2KI4 C;  1ALW A;  4JQ0 D;  1TNP A;  2KI6 C;  5JJG A;  2WC8 A;  1N0Y A;  4ORB B;  1NPQ A;  3R1V A;  2KDH A;  2EHB A;  3D10 A;  2BCA A;  3OX5 A;  1ZOT B;  1CFF A;  3SIA A;  3SG7 A;  5HLO A;  1BJF A;  1S5G Z;  2KSP A;  3OBV A;  1QS7 A;  5EL2 A;  4OV2 A;  5B8I B;  3BQ3 A;  3V2L A;  3JTD B;  1MF8 B;  4F7F A;  1IQ3 A;  3SS4 A;  4ZCU A;  1JFK A;  1SKT A;  1KK7 Y;  3FS7 A;  3PLF B;  4MLW A;  1TIZ A;  3RZS A;  1H8B A;  1UWO A;  1Y1X A;  4MZK A;  4JKT A;  1KSO A;  1MXE A;  2FOT A;  1XFY O;  3BUN B;  4AQI A;  3JTD C;  5D7F A;  1KFU L;  4GGF A;  4GPL B;  3NXA A;  5JOL A;  2F8P A;  2K61 A;  3B86 A;  3CGA A;  1B1G A;  1SL8 A;  3BOW A;  3VGO A;  4ETO A;  4QJ4 B;  3NSK A;  4R1E A;  2M97 A;  5DIC A;  1K93 D;  3PFV A;  2PAS A;  3VRR A;  3FIA A;  1AK8 A;  4MRX A;  2M9G A;  1SCM B;  3SG4 A;  3PN7 B;  3PM8 A;  1KQM B;  4OR9 B;  2NCO A;  2E6W A;  3BXK A;  4GAO A;  2BBN A;  2KOT A;  1XVJ A;  1EXR A;  1ODB A;  4L9M A;  2F33 A;  2K7C A;  2O5G A;  2H61 C;  2K7O A;  4ICB A;  1DQE A;  1SCM C;  1XK4 C;  2A4J A;  2KNE A;  2DOQ A;  3CR2 A;  1NIW A;  2BE4 A;  1ZMZ A;  3PN7 C;  4IL1 A;  1KQM C;  3TZ1 A;  3AAJ A;  1CDM A;  4CFR A;  1B47 A;  3PJI A;  2NXQ A;  1J1E A;  1IJ6 A;  4KYN A;  1CM4 A;  1EJ3 A;  1TCF A;  4PHK A;  4YGC B;  1J7R A;  2KGB C;  1WRZ A;  1YUU A;  2ZN9 A;  2JXC A;  4HRH A;  2BE6 A;  1W7J B;  2OS8 B;  1CKK A;  1GGW A;  1OOJ A;  1NYA A;  1MUX A;  2WCL A;  1CFC A;  2JUL A;  1WRL A;  3WHU B;  4M2Q A;  1SR6 B;  2JNX A;  1NCY A;  3B7A A;  4WRI A;  5D69 A;  1XFU O;  3S0E A;  2PAL A;  2OS8 C;  3AKB A;  2WOS A;  1CB1 A;  1F4O A;  1OW4 A;  4DCK A;  1B8C A;  1XK4 A;  1YUR A;  1DVI A;  1QIV A;  1OMD A;  2JPT A;  1X02 A;  3LCP C;  3S0D A;  1QLK A;  2CTN A;  1SR6 C;  2GGM A;  3C1V A;  1DEL A;  5CPV A;  4XYN A;  3CZ0 A;  2JRF A;  3VRQ A;  2QDI A;  3E3R A;  3EK4 A;  1Q80 A;  1RRO A;  1SL9 A;  3I5G B;  1KK8 B;  4Q04 A;  3LK1 A;  1BF5 A;  1SCV A;  2LVI A;  4PHJ A;  1PK0 D;  2K7D A;  3TDZ A;  2RGI A;  2JTT A;  1U5I B;  1SNL A;  2JTZ A;  3CWG A;  3LL8 B;  3GOF A;  2M7L A;  2BCX A;  1UHN A;  1KK8 C;  3I5G C;  3OHM B;  3WHT B;  1SSE B;  1SW8 A;  2PRU A;  2I18 A;  4YRU A;  1SRA A;  4JD9 A;  1RFJ A;  2HQW A;  4CLN A;  2MLF C;  2KAY A;  1A29 A;  2M1U A;  2NLN A;  3BUO B;  5HKZ A;  4PAL A;  3VRN A;  3SG3 A;  4DS7 A;  3SIB A;  4YI9 A;  1S6I A;  4OCI A;  1YX8 A;  1YVH A;  3CZ1 A;  1QJT A;  5CSJ A;  4C0K A;  1PUL A;  5BPJ A;  5I2O A;  2WCH A; 
#chains in the Genus database with same CATH homology
 3L47 A;  2WC6 A;  3R1V A;  4INX A;  3QME A;  3DY9 A;  1TUJ A;  1OOI X;  5EL2 A;  3V2L A;  4FQT A;  4F7F A;  3FE6 A;  3L4L A;  3S0F A;  3B88 A;  1ORG A;  3RZS A;  1OOG A;  2GTE A;  3B86 A;  1OOF A;  3CDN A;  3R1P A;  3BFB A;  2P71 A;  5DIC A;  3NHT A;  3B6X A;  4INW A;  1XFR A;  3NGV A;  3S0A A;  3BJH A;  3FE8 A;  2P70 A;  1QWV A;  3NHI A;  1DQE A;  1OOH A;  2QEO A;  3PJI A;  3D77 A;  3K1E A;  3BFA A;  3DYE A;  2WCJ A;  3S0G A;  3D73 A;  2JPO A;  3D76 A;  1LS8 A;  2WC5 A;  3D78 A;  3S0B A;  2ERB A;  2H8V A;  1TWO A;  2WCL A;  4PT1 A;  3CAB A;  3B87 A;  3B7A A;  3S0E A;  1C3Z A;  1GM0 A;  3R72 A;  2KPH A;  1OW4 A;  3BFH A;  3S0D A;  2FJY A;  3CZ0 A;  2QEB A;  3N7H A;  2QDI A;  1P28 A;  3D75 A;  3FE9 A;  3Q8I A;  3CYZ A;  2QEV A;  2WCM A;  2L2C A;  2QEH A;  3CZ2 A;  2PQL A;  1C3Y A;  3DZT A;  2WCK A;  3L4A A;  3DXL A;  4JD9 A;  4OZD A;  3OGN A;  3D74 A;  3VB1 A;  3CZ1 A;  1T14 A;  3R1O A;  2WCH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...