3CDNA

Crystal structure of a pheromone binding protein from apis mellifera soaked at ph 4.0
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
116
structure length
116
Chain Sequence
b'WVPPEVFDLVAEDKARCMSEHGTTQAQIDDVDKGNLVNEPSITCYMYCLLEAFSLVDDEANVDEDIMLGLLPDQLQERAQSVMGKCLPTSGSDNCNKIYNLAKCVQESAPDVWFVI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pheromone-binding protein ASP1
publication title Structural basis of the honey bee PBP pheromone and pH-induced conformational change
pubmed doi rcsb
source organism Apis mellifera
molecule tags Pheromone-binding protein
total genus 41
structure length 116
sequence length 116
ec nomenclature
pdb deposition date 2008-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01395 PBP_GOBP PBP/GOBP family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.20 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 Pheromone/general odorant binding protein domain 3cdnA00
3NHIA 3DYEA 1OOHA 3DXLA 1GM0A 2H8VA 3D77A 3BFAA 1T14A 3R1OA 2WCKA 3B86A 5DICA 2QEVA 3D74A 2QEHA 3S0GA 4F7FA 1TWOA 3PJIA 3L47A 2QDIA 4INWA 2JPOA 2P71A 3DZTA 3CZ2A 3OGNA 2QEOA 3CABA 3R72A 3B7AA 3B88A 3N7HA 2GTEA 3NHTA 1TUJA 2P70A 3FE6A 1C3YA 2L2CA 3FE9A 2WCLA 1QWVA 3S0FA 2WCHA 2QEBA 3K1EA 3QMEA 2WCJA 3S0BA 4OZDA 3D76A 3L4LA 3R1VA 3B87A 3R1PA 4JD9A 3CZ1A 3CYZA 2WC6A 2WCMA 3B6XA 3CDNA 3FE8A 1OOGA 3BFHA 3NGVA 3S0AA 1OW4A 3RZSA 3BFBA 3V2LA 2KPHA 3BJHA 3DY9A 3L4AA 1XFRA 3D75A 2FJYA 3S0DA 1P28A 4PT1A 1LS8A 3S0EA 1DQEA 3D78A 1OOFA 3CZ0A 2ERBA 2PQLA 2WC5A 1OOIX 1ORGA 3VB1A 3D73A 4INXA 3Q8IA 5EL2A 4FQTA 1C3ZA
chains in the Genus database with same CATH superfamily
1J7QA 1FBVA 3DXLA 1GM0A 2GV5A 3D77A 1GJYA 2LV7A 2OS8C 3SJSA 1SR6B 5HYDA 1UHKA 3VGOA 2BE4A 1NX2A 2M49B 2PVBA 3B86A 1A29A 2JULA 2A4JA 3KEVA 2CCMA 2CT9A 1L2OC 2KAXA 4Q04A 4YI9A 4DS7A 4ICBA 1UWOA 2CBLA 1Z4HA 2BNXA 3LL8B 1YR5A 2PASA 3UO9A 1SYMA 3DD4A 4WRIA 1QIWA 3S0GA 4F7FA 1MF8B 2TN4A 3IVTA 5PALA 4MVFA 1AUIB 1CFPA 2COLB 3AAJA 1IWQA 1XK4C 2M29A 1YRUB 2P71A 1QXPA 3RLZA 3ZNIA 1YVHA 1KCYA 2WORA 3DVEA 1ALVA 3IF7A 4P2YB 1UHJA 2KLEA 2BE6A 4PHJA 1DELA 2D8NA 1NSHA 2KAYA 3O4XA 3VRQA 1GQMA 4E68A 3PSRA 3FE6A 2M1UA 1QS7A 1K2HA 1B7TY 5HL1A 1C3YA 2V53A 2P6BB 1MQ1A 2WCLA 2KGRA 1B47A 2WC8A 1DEKA 1KWOB 1AJ5A 1MXLC 1QASA 5ER5A 1ZACA 2QEBA 3K1EA 1DJXA 2BCBA 3E3RA 3QMEA 1XFYO 3D76A 3CR5X 2L98A 4XYNA 1S6JA 1AHRA 3SG2A 2MBXA 2OS8B 3GK2A 2KBIA 1M46A 2JNFA 2K0JA 3SS3A 1KQMC 4C0JA 1AP4A 1PSRA 1IQ5A 2JXLA 4PCWA 3SG6A 2H61C 1M45A 4OCIA 5CSIA 1MR8A 2NLNA 3FE8A 3PALA 1L2OB 1OOGA 1A03A 1KFUL 1OSAA 2LUXA 3O4YA 1F4QA 2GGZA 1XFUO 3BOWB 3BFHA 1WLMA 1WRZA 2F3YA 3HCMA 1CFDA 1IGVA 1TNWA 2JWWA 2KSPA 2LP3A 3PN7C 1JC2A 4YGBB 4C0KA 1S5GZ 2LLSA 2O5GA 2QACA 1QX2A 3HX4A 4HRGA 2M0RA 2K7CA 3D10A 1CM4A 5HKZA 2JT0A 5I2OA 3DY9A 2I94A 5HLVA 5HKWA 1XFVO 2MLFC 4GUKA 2LVJA 3BXKA 1EXRA 1LINA 3NXAA 1K96A 1OZOA 2K2FA 5G08A 3F45A 4QJ3B 4UPGA 1P28A 4NQGA 3S0EA 2VRGA 3K21A 5AEQA 2KNEA 2L4IA 1RJVA 4IL1A 5CSJA 2LNKA 2MJWB 3SIBA 3TZ1A 3AAKA 4PE0A 2BAPA 4I5JA 1CDNA 1OOIX 1TRFA 3CLNA 1EJ3A 1CLMA 3VB1A 1U5IB 5B8IB 1AK8A 3KHEA 2L2EA 1N0YA 3SG7A 2MA2A 1EH2A 4I5KA 2ZRSA 4FQTA 4CFRA 1C3ZA 4GAOA 3CR2A 3JTDC 3BUXB 1OOHA 3OX5A 1ALWA 2Y1MA 4ORBB 1KFXL 3DVMA 4MZJA 3WHUB 4CFQA 1S6CA 1QLKA 1TOPA 2WCKA 2AUCA 5I2LA 2BKIB 2F3ZA 2QEVA 2JTTA 1BU3A 3D74A 1CNPA 1KQMB 3BUOB 1F4OA 1IH0A 4GBAA 2M7LA 2B1UA 4JKTA 4YRUA 4USLA 1UP5A 3DF0B 4BY4A 4ORCB 1MXEA 1DF0B 1SK6D 2G9BA 1SL7A 3FWBA 4N1GA 3ZWHA 1J7OA 3UNWA 3PN7B 3L47A 1UUSA 1NUBA 4INWA 2KBMA 3BOWA 3FWCA 3I5GC 5CPVA 1SRAA 2L0PA 2EGDA 2HQWA 1OMRA 2JPTA 5I94A 2BCXA 2KI6D 3WNXB 1C7VA 3CABA 4MZLA 3R72A 2KFGA 5I8NA 1JFJA 1KSMA 4OR9B 3OHMB 5CSFA 1WDCC 2GTEA 3TDUA 1S3PA 1XK4A 1XFXO 1CTRA 2LHLA 1CLLA 1CDLA 1LKJA 1B9AA 1RECA 3KPXA 1CFFA 1FI6A 5AERA 3CS1A 5FI6A 2L50A 1B8LA 2BKHB 2K7BA 2LM5A 4DIRA 1SY9A 1QV0A 2JQ6A 4A4BA 1SCMB 1LVCD 2ZRTA 3OBVA 1Z2CB 2LMVA 2KYCA 1EL4A 1RWYA 2PRUA 1YVLA 3EK7A 3VROA 3S0FA 2M9GA 1R6PA 3OB2B 1NX1A 1U5IA 1QATA 2BCAA 1DJIA 3JTDB 4FQOA 3S0BA 1H8BA 2Q91A 1KSOA 3SG5A 5F6TA 1F71A 3L4LA 2G2BA 1DJWA 2SCPA 1FF1A 4YGDB 3NSKA 4N5XA 3TUYB 1YRTB 2JZIA 2K8MB 2NCPA 4HRHA 1FI5A 2WCBA 3CDNA 2WCMA 4QJ4B 2ZN8A 4N1FA 3OB1B 3ICBA 1S1EA 1A2XA 1C7WA 1BLQA 3NGVA 1TIZA 3S0AA 1FPWA 3BQ3A 4C0LA 3GOFA 2EC6B 1B7TZ 2H61A 3EVRA 3VRRA 2KPHA 3BJHA 2CTNA 3DF0A 3MSEB 5D3OA 1K94A 3WHTB 1JFKA 1TN4A 3L4AA 3I5GB 4D1EA 2FOTA 1RROA 1DF0A 1YUSA 2KGBC 2PMYA 1F55A 3D75A 2E6WA 2FJYA 2LLTA 1WY9A 3SIAA 4CPVA 1M63B 3EKHA 1CMGA 1B4CA 2FCEA 3D0YB 1K9UA 1WDCB 2WOSA 1E8AA 4MN0A 1BT6A 1NX3A 3GK1A 2PQLA 1J7PA 1QX7A 2WC5A 4I5LB 5TNCA 1CB1A 3D73A 4PHKA 4PDZA 1M39A 2JC2A 1EG4A 1BJFA 4MBEA 1PVBA 2MAZA 2L4HA 1PVAA 1GGZA 1BG1A 1G4YR 4MLWA 2H8VA 1KK8B 1ZUZA 3BFAA 1ZMZA 2L5XB 2Y5IA 1TNPA 1BOCA 3C1VA 3PFVA 2JRFA 2LAPA 3RM1A 5K89A 1G33A 4JWQA 1PSBA 1F8HA 2BBNA 2M1KB 3CR4X 5KTYA 1Y1AA 4KYNA 1H4BA 1OQPA 2AAOA 2MHHA 3A4UB 3A8RA 2F8PA 1XFZO 4F0ZB 3OP0A 2HETA 2HF5A 3LK1A 4AQJA 1SCMC 1KK7Y 1DTLA 4OV2A 1IKUA 1JSAA 1YX8A 2L5YA 2LLUA 2QDIA 4FTGA 2WCFA 1DT7B 1W7JB 1KK7Z 1VRKA 2JPOA 5CSNA 3EK8A 3CZ2A 3OGNA 1XFWO 3TDZA 1PK0D 1SW8A 3I5HC 3NSLA 5FI2A 1N65A 1G8IA 1IJ5A 2CXJA 4XJKB 1C07A 3TUYC 1YUUA 2E30A 1Y6WA 3B88A 3N7HA 4HREE 1TNXA 4DCKA 3NHTA 4M2PA 3TS5C 4YI8A 1N2DA 4PE1A 4YBHB 1TUZA 4MRYA 1S36A 1SL9A 3IQQA 2I2RE 3PM8A 1DC1A 3LLEA 2FJUB 1IG5A 1QIVA 3BYAA 3D0YA 4OVNF 1SL8A 1UHIA 3I5FB 5J3XA 1BR1B 2EC6C 1SMGA 1Y1XA 4AQIA 1SBJA 5AFPA 3FE9A 1BF5A 1NP8A 1CDPA 1CM1A 3BUMB 1QLSA 2BBMA 2ZNEA 1BODA 1UHHA 1B1GA 2WCJA 1YX7A 4M2QA 2ZN9A 2F2OA 3TDIA 1F70A 4MRXA 4OZDA 2Y4QA 1IRJA 4MEWA 4IJ7A 2NCOA 4PHMA 1DJYA 3LK0A 4GGFA 3R1PA 2K2AA 2DOQA 4U8DA 1W7IB 2WC6A 1KQVA 1FW4A 5KU1A 1SPYA 2OTGC 1DVIA 1NWDA 3GK4X 1MUXA 2LVIA 1OW4A 1MWNA 1WLZA 1V1GA 5ER4X 1LA0A 1K90D 2ZFDA 1DGUA 2LHIA 3CZTX 4P5OE 4GGFC 3AKAA 1UHNA 1R2UA 2JT8A 2CNPA 2KFHA 1CKKA 1KK8C 3EVUA 3DVKA 5DKQA 1YURA 2F2PA 5D7FA 3I5HB 2FCDA 4PE7A 4NDBA 3S0DA 4ZCUA 3CTNA 1Y0VH 5IBWA 1JF2A 1LS8A 5DKNA 4OKHA 2KFFA 2JU0A 4L9MA 2KAVA 1L7ZA 2JNXA 4A4CA 2HPSA 2NXQA 1OOFA 1ZOTB 5JOLA 3BUNB 1AVSA 3TS5B 3H4SE 2JT3A 4XJKA 1TTXA 1IJ6A 4ETOA 1OMVA 5JJGA 2WCEA 4INXA 4NDDA 3NSIA 3Q8IA 3O6BA 1CFCA 1D1OA 1OE9B 3CGAA 1KFUS 2KQYA 1QX5B 1Q80A 1JWDA 3VRNA 1TCFA 3NHIA 1HT9A 2Y1NA 1S26D 3DYEA 3EK4A 3IQOA 1PULA 1T14A 4DRWA 1SKTA 1J7RA 2QPTA 2KI4C 3R1OA 1UURA 4MSPA 1RTP1 1SSEB 2PYQA 4PALA 1DMOA 1QV1A 1EG3A 1IQ3A 5DICA 2L51A 4BY5A 2R2IA 1B8CA 4HSZA 2MLEC 3I5IC 1JBAA 1NCXA 2Q4UA 4AOMA 1SNLA 2YGUA 2QEHA 1GGWA 2K7OA 1K9PA 1DJZA 3BUWB 2OTGB 3I5FC 1DJHA 3NSOA 2IS9A 1TWOA 1LA3A 2M97A 1BMOA 4GGNA 1XYDA 1ZFSA 1SCVA 2KI6C 3PJIA 1QTXA 1JUOA 2EHBA 2BL0B 1J1EA 2PALA 1MHOA 2RGIA 3DZTA 2H2KA 1NCYA 2QEOA 1X02A 3QRXA 5GQQC 4YGAA 1WRKA 3B7AA 4I5NB 5AANA 3SS4A 1TCOB 1DJGA 1K8UA 4YGEB 5I2QA 4QJ5B 1A75B 1JF0A 2GGMA 2LE9B 3KO0A 2SASA 2I7AA 4MZKA 1KFXS 1YUTA 3PATA 1TUJA 1OOJA 1V1FA 1NYAA 2P70A 4JPZB 1M31A 4GPLB 1J1DA 1PALA 2KOTA 1RFJA 1K9KA 5D69A 3JVTC 3LCPC 3M0WA 1CLBA 1S5GY 1CDMA 1PRWA 3OX6A 4CIDA 3VRPA 1CMFA 2AMIA 2L2CA 4DUQA 2LANA 3O78A 4M2OA 4NDCA 1QWVA 1K93D 1QVIY 1YTZC 1Y1UA 3EKJA 2WCHA 2LMUA 2LP2A 2M7NA 1SR6C 2JOJA 3EG5B 1NCZA 1QVIZ 3EVVA 3O2PA 4GFTA 1F54A 2KYFA 2O60A 3AKBA 5BPJA 4CLNA 4PE4A 3DVJA 1ODBA 4JQ0D 2NZ0A 3R1VA 1DGVA 3B87A 2KI4B 1XVJA 2KQ6A 4JD9A 3SG4A 3SS5A 1J55A 1OMDA 3CZ1A 3CYZA 2K7DA 3FS7A 5FYXA 3PM2A 4ZCVA 3SG3A 3B6XA 2KLDA 2LCPA 3I5IB 2JXCA 2M3WA 5HLOA 2K60A 4GNKB 1W9ZA 5DKRA 2ISDA 2M8UA 2OPOA 3CWGA 4WQ3A 5FI7A 2ZNDA 3RZSA 2JTZA 2HQ8A 2WNDA 3BFBA 3FIAA 1XO5A 2KHNA 3V2LA 1RK9A 1K95A 2LVKA 1WRLA 2MRDA 1NX0A 4WQ2A 2LUCA 5HKYA 2K61A 1AJ4A 1OZSA 1QJTA 1HQVA 2LC5A 2LMTA 4TNCA 5AXIA 3KF9A 2KDHA 1B8RA 2LVVA 2ZKMX 1XFRA 2I18A 1LXFC 1NPQA 4YGCB 4PT1A 1DQEA 1NIWA 4PHNA 5KSZA 3WXAA 1IIOA 1TNQA 3D78A 2BECA 3CZ0A 3PLFB 1XA5A 2ERBA 2F33A 4R1EA 1BR4B 1A75A 1A4PA 1ORGA 4ORAB 3JVTB 5EL2A 1KWOC 2PSRA 1S6IA 2BL0C
chains in the Genus database with same CATH topology
3NHIA 3DYEA 1OOHA 3DXLA 1GM0A 2H8VA 3D77A 3BFAA 1T14A 3R1OA 2WCKA 3B86A 5DICA 2QEVA 3D74A 2QEHA 3S0GA 4F7FA 1TWOA 3PJIA 3L47A 2QDIA 4INWA 2JPOA 2P71A 3DZTA 3CZ2A 3OGNA 2QEOA 3CABA 3R72A 3B7AA 3B88A 3N7HA 2GTEA 3NHTA 1TUJA 2P70A 3FE6A 1C3YA 2L2CA 3FE9A 2WCLA 1QWVA 3S0FA 2WCHA 2QEBA 3K1EA 3QMEA 2WCJA 3S0BA 4OZDA 3D76A 3L4LA 3R1VA 3B87A 3R1PA 4JD9A 3CZ1A 3CYZA 2WC6A 2WCMA 3B6XA 3CDNA 3FE8A 1OOGA 3BFHA 3NGVA 3S0AA 1OW4A 3RZSA 3BFBA 3V2LA 2KPHA 3BJHA 3DY9A 3L4AA 1XFRA 3D75A 2FJYA 3S0DA 1P28A 4PT1A 1LS8A 3S0EA 1DQEA 3D78A 1OOFA 3CZ0A 2ERBA 2PQLA 2WC5A 1OOIX 1ORGA 3VB1A 3D73A 4INXA 3Q8IA 5EL2A 4FQTA 1C3ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NHI A;  3DYE A;  1OOH A;  3DXL A;  1GM0 A;  2H8V A;  3D77 A;  3BFA A;  1T14 A;  3R1O A;  2WCK A;  3B86 A;  5DIC A;  2QEV A;  3D74 A;  2QEH A;  3S0G A;  4F7F A;  1TWO A;  3PJI A;  3L47 A;  2QDI A;  4INW A;  2JPO A;  2P71 A;  3DZT A;  3CZ2 A;  3OGN A;  2QEO A;  3CAB A;  3R72 A;  3B7A A;  3B88 A;  3N7H A;  2GTE A;  3NHT A;  1TUJ A;  2P70 A;  3FE6 A;  1C3Y A;  2L2C A;  3FE9 A;  2WCL A;  1QWV A;  3S0F A;  2WCH A;  2QEB A;  3K1E A;  3QME A;  2WCJ A;  3S0B A;  4OZD A;  3D76 A;  3L4L A;  3R1V A;  3B87 A;  3R1P A;  4JD9 A;  3CZ1 A;  3CYZ A;  2WC6 A;  2WCM A;  3B6X A;  3CDN A;  3FE8 A;  1OOG A;  3BFH A;  3NGV A;  3S0A A;  1OW4 A;  3RZS A;  3BFB A;  3V2L A;  2KPH A;  3BJH A;  3DY9 A;  3L4A A;  1XFR A;  3D75 A;  2FJY A;  3S0D A;  1P28 A;  4PT1 A;  1LS8 A;  3S0E A;  1DQE A;  3D78 A;  1OOF A;  3CZ0 A;  2ERB A;  2PQL A;  2WC5 A;  1OOI X;  1ORG A;  3VB1 A;  3D73 A;  4INX A;  3Q8I A;  5EL2 A;  4FQT A;  1C3Z A; 
#chains in the Genus database with same CATH topology
 1J7Q A;  1FBV A;  3DXL A;  1GM0 A;  2GV5 A;  3D77 A;  1GJY A;  2LV7 A;  2OS8 C;  3SJS A;  1SR6 B;  5HYD A;  1UHK A;  3VGO A;  2BE4 A;  1NX2 A;  2M49 B;  2PVB A;  3B86 A;  1A29 A;  2JUL A;  2A4J A;  3KEV A;  2CCM A;  2CT9 A;  1L2O C;  2KAX A;  4Q04 A;  4YI9 A;  4DS7 A;  4ICB A;  1UWO A;  2CBL A;  1Z4H A;  2BNX A;  3LL8 B;  1YR5 A;  2PAS A;  3UO9 A;  1SYM A;  3DD4 A;  4WRI A;  1QIW A;  3S0G A;  4F7F A;  1MF8 B;  2TN4 A;  3IVT A;  5PAL A;  4MVF A;  1AUI B;  1CFP A;  2COL B;  3AAJ A;  1IWQ A;  1XK4 C;  2M29 A;  1YRU B;  2P71 A;  1QXP A;  3RLZ A;  3ZNI A;  1YVH A;  1KCY A;  2WOR A;  3DVE A;  1ALV A;  3IF7 A;  4P2Y B;  1UHJ A;  2KLE A;  2BE6 A;  4PHJ A;  1DEL A;  2D8N A;  1NSH A;  2KAY A;  3O4X A;  3VRQ A;  1GQM A;  4E68 A;  3PSR A;  3FE6 A;  2M1U A;  1QS7 A;  1K2H A;  1B7T Y;  5HL1 A;  1C3Y A;  2V53 A;  2P6B B;  1MQ1 A;  2WCL A;  2KGR A;  1B47 A;  2WC8 A;  1DEK A;  1KWO B;  1AJ5 A;  1MXL C;  1QAS A;  5ER5 A;  1ZAC A;  2QEB A;  3K1E A;  1DJX A;  2BCB A;  3E3R A;  3QME A;  1XFY O;  3D76 A;  3CR5 X;  2L98 A;  4XYN A;  1S6J A;  1AHR A;  3SG2 A;  2MBX A;  2OS8 B;  3GK2 A;  2KBI A;  1M46 A;  2JNF A;  2K0J A;  3SS3 A;  1KQM C;  4C0J A;  1AP4 A;  1PSR A;  1IQ5 A;  2JXL A;  4PCW A;  3SG6 A;  2H61 C;  1M45 A;  4OCI A;  5CSI A;  1MR8 A;  2NLN A;  3FE8 A;  3PAL A;  1L2O B;  1OOG A;  1A03 A;  1KFU L;  1OSA A;  2LUX A;  3O4Y A;  1F4Q A;  2GGZ A;  1XFU O;  3BOW B;  3BFH A;  1WLM A;  1WRZ A;  2F3Y A;  3HCM A;  1CFD A;  1IGV A;  1TNW A;  2JWW A;  2KSP A;  2LP3 A;  3PN7 C;  1JC2 A;  4YGB B;  4C0K A;  1S5G Z;  2LLS A;  2O5G A;  2QAC A;  1QX2 A;  3HX4 A;  4HRG A;  2M0R A;  2K7C A;  3D10 A;  1CM4 A;  5HKZ A;  2JT0 A;  5I2O A;  3DY9 A;  2I94 A;  5HLV A;  5HKW A;  1XFV O;  2MLF C;  4GUK A;  2LVJ A;  3BXK A;  1EXR A;  1LIN A;  3NXA A;  1K96 A;  1OZO A;  2K2F A;  5G08 A;  3F45 A;  4QJ3 B;  4UPG A;  1P28 A;  4NQG A;  3S0E A;  2VRG A;  3K21 A;  5AEQ A;  2KNE A;  2L4I A;  1RJV A;  4IL1 A;  5CSJ A;  2LNK A;  2MJW B;  3SIB A;  3TZ1 A;  3AAK A;  4PE0 A;  2BAP A;  4I5J A;  1CDN A;  1OOI X;  1TRF A;  3CLN A;  1EJ3 A;  1CLM A;  3VB1 A;  1U5I B;  5B8I B;  1AK8 A;  3KHE A;  2L2E A;  1N0Y A;  3SG7 A;  2MA2 A;  1EH2 A;  4I5K A;  2ZRS A;  4FQT A;  4CFR A;  1C3Z A;  4GAO A;  3CR2 A;  3JTD C;  3BUX B;  1OOH A;  3OX5 A;  1ALW A;  2Y1M A;  4ORB B;  1KFX L;  3DVM A;  4MZJ A;  3WHU B;  4CFQ A;  1S6C A;  1QLK A;  1TOP A;  2WCK A;  2AUC A;  5I2L A;  2BKI B;  2F3Z A;  2QEV A;  2JTT A;  1BU3 A;  3D74 A;  1CNP A;  1KQM B;  3BUO B;  1F4O A;  1IH0 A;  4GBA A;  2M7L A;  2B1U A;  4JKT A;  4YRU A;  4USL A;  1UP5 A;  3DF0 B;  4BY4 A;  4ORC B;  1MXE A;  1DF0 B;  1SK6 D;  2G9B A;  1SL7 A;  3FWB A;  4N1G A;  3ZWH A;  1J7O A;  3UNW A;  3PN7 B;  3L47 A;  1UUS A;  1NUB A;  4INW A;  2KBM A;  3BOW A;  3FWC A;  3I5G C;  5CPV A;  1SRA A;  2L0P A;  2EGD A;  2HQW A;  1OMR A;  2JPT A;  5I94 A;  2BCX A;  2KI6 D;  3WNX B;  1C7V A;  3CAB A;  4MZL A;  3R72 A;  2KFG A;  5I8N A;  1JFJ A;  1KSM A;  4OR9 B;  3OHM B;  5CSF A;  1WDC C;  2GTE A;  3TDU A;  1S3P A;  1XK4 A;  1XFX O;  1CTR A;  2LHL A;  1CLL A;  1CDL A;  1LKJ A;  1B9A A;  1REC A;  3KPX A;  1CFF A;  1FI6 A;  5AER A;  3CS1 A;  5FI6 A;  2L50 A;  1B8L A;  2BKH B;  2K7B A;  2LM5 A;  4DIR A;  1SY9 A;  1QV0 A;  2JQ6 A;  4A4B A;  1SCM B;  1LVC D;  2ZRT A;  3OBV A;  1Z2C B;  2LMV A;  2KYC A;  1EL4 A;  1RWY A;  2PRU A;  1YVL A;  3EK7 A;  3VRO A;  3S0F A;  2M9G A;  1R6P A;  3OB2 B;  1NX1 A;  1U5I A;  1QAT A;  2BCA A;  1DJI A;  3JTD B;  4FQO A;  3S0B A;  1H8B A;  2Q91 A;  1KSO A;  3SG5 A;  5F6T A;  1F71 A;  3L4L A;  2G2B A;  1DJW A;  2SCP A;  1FF1 A;  4YGD B;  3NSK A;  4N5X A;  3TUY B;  1YRT B;  2JZI A;  2K8M B;  2NCP A;  4HRH A;  1FI5 A;  2WCB A;  3CDN A;  2WCM A;  4QJ4 B;  2ZN8 A;  4N1F A;  3OB1 B;  3ICB A;  1S1E A;  1A2X A;  1C7W A;  1BLQ A;  3NGV A;  1TIZ A;  3S0A A;  1FPW A;  3BQ3 A;  4C0L A;  3GOF A;  2EC6 B;  1B7T Z;  2H61 A;  3EVR A;  3VRR A;  2KPH A;  3BJH A;  2CTN A;  3DF0 A;  3MSE B;  5D3O A;  1K94 A;  3WHT B;  1JFK A;  1TN4 A;  3L4A A;  3I5G B;  4D1E A;  2FOT A;  1RRO A;  1DF0 A;  1YUS A;  2KGB C;  2PMY A;  1F55 A;  3D75 A;  2E6W A;  2FJY A;  2LLT A;  1WY9 A;  3SIA A;  4CPV A;  1M63 B;  3EKH A;  1CMG A;  1B4C A;  2FCE A;  3D0Y B;  1K9U A;  1WDC B;  2WOS A;  1E8A A;  4MN0 A;  1BT6 A;  1NX3 A;  3GK1 A;  2PQL A;  1J7P A;  1QX7 A;  2WC5 A;  4I5L B;  5TNC A;  1CB1 A;  3D73 A;  4PHK A;  4PDZ A;  1M39 A;  2JC2 A;  1EG4 A;  1BJF A;  4MBE A;  1PVB A;  2MAZ A;  2L4H A;  1PVA A;  1GGZ A;  1BG1 A;  1G4Y R;  4MLW A;  2H8V A;  1KK8 B;  1ZUZ A;  3BFA A;  1ZMZ A;  2L5X B;  2Y5I A;  1TNP A;  1BOC A;  3C1V A;  3PFV A;  2JRF A;  2LAP A;  3RM1 A;  5K89 A;  1G33 A;  4JWQ A;  1PSB A;  1F8H A;  2BBN A;  2M1K B;  3CR4 X;  5KTY A;  1Y1A A;  4KYN A;  1H4B A;  1OQP A;  2AAO A;  2MHH A;  3A4U B;  3A8R A;  2F8P A;  1XFZ O;  4F0Z B;  3OP0 A;  2HET A;  2HF5 A;  3LK1 A;  4AQJ A;  1SCM C;  1KK7 Y;  1DTL A;  4OV2 A;  1IKU A;  1JSA A;  1YX8 A;  2L5Y A;  2LLU A;  2QDI A;  4FTG A;  2WCF A;  1DT7 B;  1W7J B;  1KK7 Z;  1VRK A;  2JPO A;  5CSN A;  3EK8 A;  3CZ2 A;  3OGN A;  1XFW O;  3TDZ A;  1PK0 D;  1SW8 A;  3I5H C;  3NSL A;  5FI2 A;  1N65 A;  1G8I A;  1IJ5 A;  2CXJ A;  4XJK B;  1C07 A;  3TUY C;  1YUU A;  2E30 A;  1Y6W A;  3B88 A;  3N7H A;  4HRE E;  1TNX A;  4DCK A;  3NHT A;  4M2P A;  3TS5 C;  4YI8 A;  1N2D A;  4PE1 A;  4YBH B;  1TUZ A;  4MRY A;  1S36 A;  1SL9 A;  3IQQ A;  2I2R E;  3PM8 A;  1DC1 A;  3LLE A;  2FJU B;  1IG5 A;  1QIV A;  3BYA A;  3D0Y A;  4OVN F;  1SL8 A;  1UHI A;  3I5F B;  5J3X A;  1BR1 B;  2EC6 C;  1SMG A;  1Y1X A;  4AQI A;  1SBJ A;  5AFP A;  3FE9 A;  1BF5 A;  1NP8 A;  1CDP A;  1CM1 A;  3BUM B;  1QLS A;  2BBM A;  2ZNE A;  1BOD A;  1UHH A;  1B1G A;  2WCJ A;  1YX7 A;  4M2Q A;  2ZN9 A;  2F2O A;  3TDI A;  1F70 A;  4MRX A;  4OZD A;  2Y4Q A;  1IRJ A;  4MEW A;  4IJ7 A;  2NCO A;  4PHM A;  1DJY A;  3LK0 A;  4GGF A;  3R1P A;  2K2A A;  2DOQ A;  4U8D A;  1W7I B;  2WC6 A;  1KQV A;  1FW4 A;  5KU1 A;  1SPY A;  2OTG C;  1DVI A;  1NWD A;  3GK4 X;  1MUX A;  2LVI A;  1OW4 A;  1MWN A;  1WLZ A;  1V1G A;  5ER4 X;  1LA0 A;  1K90 D;  2ZFD A;  1DGU A;  2LHI A;  3CZT X;  4P5O E;  4GGF C;  3AKA A;  1UHN A;  1R2U A;  2JT8 A;  2CNP A;  2KFH A;  1CKK A;  1KK8 C;  3EVU A;  3DVK A;  5DKQ A;  1YUR A;  2F2P A;  5D7F A;  3I5H B;  2FCD A;  4PE7 A;  4NDB A;  3S0D A;  4ZCU A;  3CTN A;  1Y0V H;  5IBW A;  1JF2 A;  1LS8 A;  5DKN A;  4OKH A;  2KFF A;  2JU0 A;  4L9M A;  2KAV A;  1L7Z A;  2JNX A;  4A4C A;  2HPS A;  2NXQ A;  1OOF A;  1ZOT B;  5JOL A;  3BUN B;  1AVS A;  3TS5 B;  3H4S E;  2JT3 A;  4XJK A;  1TTX A;  1IJ6 A;  4ETO A;  1OMV A;  5JJG A;  2WCE A;  4INX A;  4NDD A;  3NSI A;  3Q8I A;  3O6B A;  1CFC A;  1D1O A;  1OE9 B;  3CGA A;  1KFU S;  2KQY A;  1QX5 B;  1Q80 A;  1JWD A;  3VRN A;  1TCF A;  3NHI A;  1HT9 A;  2Y1N A;  1S26 D;  3DYE A;  3EK4 A;  3IQO A;  1PUL A;  1T14 A;  4DRW A;  1SKT A;  1J7R A;  2QPT A;  2KI4 C;  3R1O A;  1UUR A;  4MSP A;  1RTP 1;  1SSE B;  2PYQ A;  4PAL A;  1DMO A;  1QV1 A;  1EG3 A;  1IQ3 A;  5DIC A;  2L51 A;  4BY5 A;  2R2I A;  1B8C A;  4HSZ A;  2MLE C;  3I5I C;  1JBA A;  1NCX A;  2Q4U A;  4AOM A;  1SNL A;  2YGU A;  2QEH A;  1GGW A;  2K7O A;  1K9P A;  1DJZ A;  3BUW B;  2OTG B;  3I5F C;  1DJH A;  3NSO A;  2IS9 A;  1TWO A;  1LA3 A;  2M97 A;  1BMO A;  4GGN A;  1XYD A;  1ZFS A;  1SCV A;  2KI6 C;  3PJI A;  1QTX A;  1JUO A;  2EHB A;  2BL0 B;  1J1E A;  2PAL A;  1MHO A;  2RGI A;  3DZT A;  2H2K A;  1NCY A;  2QEO A;  1X02 A;  3QRX A;  5GQQ C;  4YGA A;  1WRK A;  3B7A A;  4I5N B;  5AAN A;  3SS4 A;  1TCO B;  1DJG A;  1K8U A;  4YGE B;  5I2Q A;  4QJ5 B;  1A75 B;  1JF0 A;  2GGM A;  2LE9 B;  3KO0 A;  2SAS A;  2I7A A;  4MZK A;  1KFX S;  1YUT A;  3PAT A;  1TUJ A;  1OOJ A;  1V1F A;  1NYA A;  2P70 A;  4JPZ B;  1M31 A;  4GPL B;  1J1D A;  1PAL A;  2KOT A;  1RFJ A;  1K9K A;  5D69 A;  3JVT C;  3LCP C;  3M0W A;  1CLB A;  1S5G Y;  1CDM A;  1PRW A;  3OX6 A;  4CID A;  3VRP A;  1CMF A;  2AMI A;  2L2C A;  4DUQ A;  2LAN A;  3O78 A;  4M2O A;  4NDC A;  1QWV A;  1K93 D;  1QVI Y;  1YTZ C;  1Y1U A;  3EKJ A;  2WCH A;  2LMU A;  2LP2 A;  2M7N A;  1SR6 C;  2JOJ A;  3EG5 B;  1NCZ A;  1QVI Z;  3EVV A;  3O2P A;  4GFT A;  1F54 A;  2KYF A;  2O60 A;  3AKB A;  5BPJ A;  4CLN A;  4PE4 A;  3DVJ A;  1ODB A;  4JQ0 D;  2NZ0 A;  3R1V A;  1DGV A;  3B87 A;  2KI4 B;  1XVJ A;  2KQ6 A;  4JD9 A;  3SG4 A;  3SS5 A;  1J55 A;  1OMD A;  3CZ1 A;  3CYZ A;  2K7D A;  3FS7 A;  5FYX A;  3PM2 A;  4ZCV A;  3SG3 A;  3B6X A;  2KLD A;  2LCP A;  3I5I B;  2JXC A;  2M3W A;  5HLO A;  2K60 A;  4GNK B;  1W9Z A;  5DKR A;  2ISD A;  2M8U A;  2OPO A;  3CWG A;  4WQ3 A;  5FI7 A;  2ZND A;  3RZS A;  2JTZ A;  2HQ8 A;  2WND A;  3BFB A;  3FIA A;  1XO5 A;  2KHN A;  3V2L A;  1RK9 A;  1K95 A;  2LVK A;  1WRL A;  2MRD A;  1NX0 A;  4WQ2 A;  2LUC A;  5HKY A;  2K61 A;  1AJ4 A;  1OZS A;  1QJT A;  1HQV A;  2LC5 A;  2LMT A;  4TNC A;  5AXI A;  3KF9 A;  2KDH A;  1B8R A;  2LVV A;  2ZKM X;  1XFR A;  2I18 A;  1LXF C;  1NPQ A;  4YGC B;  4PT1 A;  1DQE A;  1NIW A;  4PHN A;  5KSZ A;  3WXA A;  1IIO A;  1TNQ A;  3D78 A;  2BEC A;  3CZ0 A;  3PLF B;  1XA5 A;  2ERB A;  2F33 A;  4R1E A;  1BR4 B;  1A75 A;  1A4P A;  1ORG A;  4ORA B;  3JVT B;  5EL2 A;  1KWO C;  2PSR A;  1S6I A;  2BL0 C; 
#chains in the Genus database with same CATH homology
 3NHI A;  3DYE A;  1OOH A;  3DXL A;  1GM0 A;  2H8V A;  3D77 A;  3BFA A;  1T14 A;  3R1O A;  2WCK A;  3B86 A;  5DIC A;  2QEV A;  3D74 A;  2QEH A;  3S0G A;  4F7F A;  1TWO A;  3PJI A;  3L47 A;  2QDI A;  4INW A;  2JPO A;  2P71 A;  3DZT A;  3CZ2 A;  3OGN A;  2QEO A;  3CAB A;  3R72 A;  3B7A A;  3B88 A;  3N7H A;  2GTE A;  3NHT A;  1TUJ A;  2P70 A;  3FE6 A;  1C3Y A;  2L2C A;  3FE9 A;  2WCL A;  1QWV A;  3S0F A;  2WCH A;  2QEB A;  3K1E A;  3QME A;  2WCJ A;  3S0B A;  4OZD A;  3D76 A;  3L4L A;  3R1V A;  3B87 A;  3R1P A;  4JD9 A;  3CZ1 A;  3CYZ A;  2WC6 A;  2WCM A;  3B6X A;  3CDN A;  3FE8 A;  1OOG A;  3BFH A;  3NGV A;  3S0A A;  1OW4 A;  3RZS A;  3BFB A;  3V2L A;  2KPH A;  3BJH A;  3DY9 A;  3L4A A;  1XFR A;  3D75 A;  2FJY A;  3S0D A;  1P28 A;  4PT1 A;  1LS8 A;  3S0E A;  1DQE A;  3D78 A;  1OOF A;  3CZ0 A;  2ERB A;  2PQL A;  2WC5 A;  1OOI X;  1ORG A;  3VB1 A;  3D73 A;  4INX A;  3Q8I A;  5EL2 A;  4FQT A;  1C3Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...