3CDNA

Crystal structure of a pheromone binding protein from apis mellifera soaked at ph 4.0
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
116
structure length
116
Chain Sequence
WVPPEVFDLVAEDKARCMSEHGTTQAQIDDVDKGNLVNEPSITCYMYCLLEAFSLVDDEANVDEDIMLGLLPDQLQERAQSVMGKCLPTSGSDNCNKIYNLAKCVQESAPDVWFVI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pheromone-binding protein ASP1
publication title Structural basis of the honey bee PBP pheromone and pH-induced conformational change
pubmed doi rcsb
source organism Apis mellifera
molecule tags Pheromone-binding protein
total genus 41
structure length 116
sequence length 116
ec nomenclature
pdb deposition date 2008-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01395 PBP_GOBP PBP/GOBP family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.20 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 Pheromone/general odorant binding protein domain 3cdnA00
3RZSA 3CABA 1OOIX 3DXLA 3R1PA 3CZ1A 3S0BA 3B7AA 3Q8IA 2WC5A 3L4LA 3V2LA 3DYEA 3BJHA 4OZDA 3CZ2A 1ORGA 3BFHA 3PJIA 5DICA 3S0EA 3NHTA 2WCKA 3B87A 1GM0A 3DZTA 3OGNA 2QDIA 2KPHA 3L47A 1OW4A 2QEBA 2PQLA 3NGVA 1OOGA 1C3ZA 2GTEA 1OOHA 3FE8A 1OOFA 2WC6A 1P28A 2QEHA 3S0AA 2JPOA 2P70A 3N7HA 3R72A 1TWOA 2FJYA 3L4AA 3D78A 3D75A 3S0FA 2WCJA 1LS8A 3NHIA 2WCLA 3D74A 3DY9A 3CZ0A 2ERBA 4INWA 1QWVA 2H8VA 4JD9A 4INXA 2WCMA 3R1OA 3FE9A 3FE6A 1T14A 2L2CA 3B86A 3R1VA 5EL2A 1DQEA 3D77A 1TUJA 3B6XA 3B88A 3BFAA 3K1EA 3S0GA 2P71A 3D76A 2WCHA 1XFRA 3CDNA 4PT1A 3QMEA 4FQTA 4F7FA 3D73A 3CYZA 1C3YA 3VB1A 3BFBA 2QEVA 3S0DA 2QEOA
chains in the Genus database with same CATH superfamily
1OMDA 2JT8A 2MAZA 4GBAA 1RWYA 2KLEA 2FJUB 1DVIA 1WRKA 3OBVA 1K96A 1F55A 1BG1A 1YUTA 3I5HB 2K7OA 3R1PA 1AP4A 3OP0A 4CFRA 1M46A 3S0BA 4MRXA 1CNPA 2KAXA 4YGCB 1PVBA 2F33A 3SJSA 1CMFA 1K90D 4CFQA 4D1EA 2ZN8A 1ODBA 4U8DA 1JF0A 4FTGA 1BU3A 1A75A 4OZDA 5CSJA 3CZ2A 1A75B 2LMUA 3BFHA 4NQGA 5I2QA 3PJIA 5K89A 3EK4A 1ZOTB 3TDZA 1QVIZ 1R6PA 1DGVA 4GPLB 1XFXO 1FW4A 2NZ0A 3NHTA 4MBEA 3KF9A 1N0YA 2MBXA 1J7QA 1J1DA 1Z2CB 3LCPC 5FI7A 1FF1A 1IWQA 2JT3A 3WNXB 5AFPA 1YRTB 2GV5A 2NXQA 5PALA 2QDIA 4HREE 1GGZA 1W7IB 1WRZA 3UO9A 4DS7A 3L47A 1CDLA 5KTYA 4OCIA 2KI6D 2PQLA 4ZCVA 1SCMB 3FWCA 1C3ZA 4C0KA 4QJ4B 2LLSA 5HYDA 1KQMB 1QS7A 1SW8A 2OPOA 2KSPA 1K9UA 5CSNA 2D8NA 3BUMB 5AEQA 1JUOA 1AJ4A 2L2EA 3TDUA 1A29A 5I8NA 3S0AA 4GUKA 2Y4QA 2ZNDA 2WCBA 3BUNB 3PALA 1QV0A 4MZLA 1OZOA 2V53A 4TNCA 1H8BA 2M0RA 3SG5A 2FOTA 3NHIA 1V1GA 1MUXA 1J55A 1SL9A 3D74A 3DY9A 1UHKA 1W9ZA 1B8LA 2LVKA 3CZ0A 2EC6C 1UHNA 1ZMZA 2OTGC 1TTXA 3BOWA 3LK0A 2JOJA 2M29A 3BOWB 1QX2A 2I7AA 2JTTA 3NSOA 1FI6A 1QWVA 1KK7Z 1Y6WA 2LUXA 1PVAA 1TRFA 4GGNA 1B7TY 4ICBA 4YI9A 1MR8A 1CDMA 1YVLA 1SY9A 1TUZA 2LP3A 3FE9A 4A4BA 4DCKA 2BECA 2GGMA 5KU1A 3HX4A 2GGZA 5EL2A 2JPTA 3D77A 3TZ1A 1JC2A 2KFGA 2PVBA 1RK9A 3I5GB 3B88A 3OB1B 2ZNEA 2QPTA 3AKAA 3IQOA 1PK0D 3BFAA 5FI6A 3S0GA 1EXRA 2ZFDA 1EH2A 2KQYA 3CDNA 3F45A 2LV7A 3I5IC 5BPJA 4YBHB 2SASA 3CR5X 3QMEA 3JVTB 1NX3A 3EVRA 3GK1A 4F7FA 1H4BA 4OVNF 1N65A 4M2OA 4PALA 1ALVA 1C3YA 1G33A 4N1FA 2AMIA 5CSIA 1DT7B 3LL8B 5FI2A 3VB1A 1E8AA 4PE0A 4PHJA 3ICBA 1NWDA 2PASA 2KGRA 2M1UA 1CFCA 1F54A 3VRQA 1F8HA 2Y5IA 4JQ0D 3DXLA 1QATA 1L7ZA 1M31A 1R2UA 1VRKA 4GAOA 2I2RE 4CPVA 3PM2A 4I5KA 1UWOA 2JU0A 3I5HC 2Q4UA 4IJ7A 1FI5A 3V2LA 4WRIA 3CZ1A 1SK6D 3PM8A 1DJHA 3Q8IA 1JBAA 3CR4X 5JOLA 2H61A 1DELA 1NP8A 4MEWA 3CLNA 1S6JA 1F4QA 1WLZA 1CDPA 2H2KA 2L0PA 1SYMA 2BL0B 5AANA 4AQIA 3ZWHA 1DJIA 3MSEB 3IF7A 1JF2A 3ZNIA 1B1GA 1CKKA 1UHHA 1FBVA 1Y0VH 2ISDA 1XYDA 3M0WA 4P5OE 2WCEA 3S0EA 3UNWA 1SCVA 1KCYA 2LHLA 2PMYA 1UHJA 2F2OA 2K60A 1AK8A 1KSMA 2WNDA 1GM0A 3DZTA 5DKQA 1AJ5A 1IGVA 1SMGA 2F3YA 4DIRA 1S5GZ 3FIAA 4MZKA 1B8RA 1SCMC 4GGFA 2CTNA 4PE7A 2RGIA 2JT0A 3K21A 2KYFA 2COLB 4HRHA 1EL4A 1OOHA 4YI8A 3WHUB 1JSAA 1L2OB 1NPQA 1KWOB 2WC6A 1ALWA 1EG4A 2F3ZA 4OR9B 1YUUA 4C0JA 2BBMA 2P70A 1DC1A 1K94A 3BUXB 4OV2A 3N7HA 1KSOA 3EG5B 3D75A 3JTDB 3NSKA 2M7NA 1XVJA 2O5GA 3IVTA 1NX0A 1M39A 3TS5B 1Y1UA 1DMOA 1SSEB 2LCPA 3EKHA 3C1VA 1C7VA 1GJYA 4INWA 3WHTB 1F70A 2BE4A 1F71A 5HLVA 3QRXA 1K9PA 1PULA 4N5XA 4ORCB 5HLOA 3R1OA 3SS3A 1AVSA 1CB1A 2JZIA 1NX1A 1LVCD 2LMTA 3AAKA 3FE6A 3RM1A 1DJWA 2L2CA 3B86A 4MSPA 3A4UB 2LMVA 3DVEA 4PE1A 1AUIB 2K0JA 4JWQA 2JULA 1DF0A 2KOTA 3B6XA 2MJWB 5CSFA 5AERA 1IRJA 1DF0B 3O6BA 2L5YA 2BNXA 1SKTA 4L9MA 5FYXA 1LINA 2KLDA 3OX6A 3K1EA 1MWNA 4E68A 5B8IB 1XFRA 2O60A 2TN4A 1SR6B 1XO5A 3JVTC 3O78A 3SG2A 1S6IA 2KBIA 3DD4A 5DKRA 2AAOA 2KQ6A 4FQTA 3PN7C 1KFUS 2L4HA 2LLTA 2KGBC 5D69A 3CYZA 1AHRA 1J1EA 5KSZA 2BAPA 3GK4X 4ZCUA 2K8MB 2M1KB 1NCYA 1YRUB 3I5FC 2QEVA 1UURA 1XK4C 1QX5B 2KI4B 1TN4A 3GK2A 2K2FA 1YUSA 2AUCA 2KNEA 1KFXL 3CABA 1OOIX 2FCDA 1IQ5A 1TOPA 3SG6A 1HQVA 3H4SE 4MN0A 4WQ3A 1J7RA 1KFUL 1BODA 1KK8B 2A4JA 3CGAA 2L4IA 2JRFA 3B7AA 1C07A 2WC5A 4QJ5B 2H61C 3NSLA 2ZN9A 5GQQC 4PCWA 2BKIB 2LHIA 1YX7A 2CT9A 4FQOA 1Z4HA 1MF8B 3L4LA 1J7OA 2BL0C 5F6TA 1QLSA 2JXLA 2KHNA 2OS8C 2Y1MA 4MVFA 1QV1A 2E30A 3KEVA 4PHMA 1ORGA 3E3RA 3CR2A 2EGDA 3FS7A 4AOMA 1BF5A 2Y1NA 2PRUA 4PE4A 1IQ3A 3KO0A 1Y1XA 2P6BB 4M2QA 1PRWA 1TNQA 1TNXA 1X02A 3SG4A 1SL7A 1BMOA 3OX5A 3B87A 2LE9B 3VRRA 3O4XA 2FCEA 3OGNA 1NYAA 1QVIY 3SG3A 2KDHA 1OZSA 5D7FA 4ORBB 2EC6B 3VGOA 2OTGB 2QEBA 4GGFC 4YGEB 2MRDA 1CLBA 2NCPA 2L98A 3NGVA 4NDCA 3LK1A 1OOGA 1MXEA 2GTEA 1L2OC 1KWOC 1LA0A 3EKJA 1DJZA 3LLEA 1NUBA 3FE8A 4ETOA 2K61A 1G8IA 2WCFA 4OKHA 1UUSA 1SL8A 2F2PA 1BJFA 1P28A 2LUCA 1G4YR 1OQPA 1TNWA 1NCZA 2QEHA 4HRGA 2LVJA 1CFDA 3JTDC 4AQJA 1S26D 2FJYA 3D78A 1B7TZ 5J3XA 5HKZA 2B1UA 3NXAA 1IIOA 3TS5C 2KYCA 1DJYA 2LAPA 4R1EA 1TCFA 3I5IB 1IJ5A 2WOSA 2LM5A 1DJGA 2LNKA 2K7DA 3D0YB 1WDCB 1OE9B 2DOQA 1K93D 2WC8A 1KQMC 4INXA 1U5IA 1MXLC 1QXPA 2K2AA 1U5IB 2LVIA 2K7BA 1FPWA 3R1VA 1CLMA 3CZTX 1B9AA 1C7WA 2LANA 1UP5A 2MA2A 2PALA 4JPZB 1KK7Y 2HQ8A 3TUYB 5ER4X 4YRUA 2MLEC 3VRPA 1B47A 2CXJA 4F0ZB 2QACA 1GGWA 3RLZA 1CM1A 4NDBA 1DTLA 1SR6C 1OMVA 1LKJA 2P71A 2R2IA 3D76A 1DGUA 1N2DA 1RJVA 5JJGA 3D10A 4PT1A 4CIDA 1SRAA 3A8RA 1RECA 3VRNA 1CFPA 4I5JA 2L5XB 1K2HA 2HF5A 1B4CA 2BBNA 1Q80A 3D73A 1MHOA 1NCXA 3TDIA 4MRYA 2HPSA 2M49B 1OSAA 2F8PA 2KI4C 1QLKA 3BFBA 3SIAA 4C0LA 2EHBA 2MHHA 1V1FA 3S0DA 4ORAB 1WRLA 2QEOA 4Q04A 1S36A 3RZSA 5TNCA 3SS4A 1DEKA 2JC2A 3EVVA 3I5GC 2NLNA 1CMGA 1S1EA 1PSBA 1UHIA 1A2XA 1QJTA 3KHEA 4PHKA 1KK8C 3VROA 2IS9A 1A03A 1Y1AA 1XA5A 4QJ3B 1KFXS 1ZACA 4HSZA 1BLQA 2KFFA 1LA3A 1RFJA 4A4CA 2PSRA 3EK8A 3PATA 1J7PA 1SNLA 3AAJA 1BR4B 3BUOB 3SG7A 3CS1A 3O4YA 3DYEA 3SIBA 3BJHA 4P2YB 5IBWA 3GOFA 2L50A 2BKHB 1RROA 2L51A 1QASA 1QIWA 2HQWA 2KAYA 2K7CA 3DF0A 5I2OA 3OHMB 3DF0B 1BOCA 1NIWA 4UPGA 5DICA 1M63B 3KPXA 2KI6C 1IJ6A 2JNFA 2CBLA 2M9GA 2KBMA 3DVKA 2HETA 3BQ3A 2G9BA 2WCKA 2JXCA 2I18A 1JFKA 2M3WA 2LC5A 2BE6A 3IQQA 5DKNA 1YURA 1WLMA 2KPHA 2E6WA 4YGDB 4XJKA 1EJ3A 2G2BA 1TCOB 2ZRSA 1YR5A 3O2PA 4XJKB 4CLNA 1OW4A 2NCOA 1BR1B 4XYNA 1NSHA 1K95A 4MZJA 4BY5A 1PALA 1W7JB 1XFWO 1ZFSA 2LVVA 1D1OA 1OOFA 3SS5A 3DVMA 4USLA 1OMRA 1S5GY 1CM4A 1CLLA 1NX2A 2VRGA 4PHNA 3WXAA 1QTXA 1CTRA 1YVHA 5HKWA 1DJXA 4DRWA 2JPOA 1XFUO 2KAVA 1EG3A 3R72A 5AXIA 4BY4A 1TWOA 3L4AA 1BT6A 1YX8A 1QIVA 1JWDA 2M7LA 3S0FA 1MQ1A 1SBJA 2WCJA 1LS8A 5ER5A 2WCLA 1XFYO 3BYAA 4PDZA 5HL1A 3EVUA 1F4OA 1OOJA 2JTZA 2JWWA 2BCBA 2ERBA 3CTNA 1B8CA 2WORA 2MLFC 1WDCC 3HCMA 4N1GA 1K9KA 1CDNA 1KQVA 1RTP1 1S3PA 3PN7B 2H8VA 2ZRTA 3PFVA 4DUQA 4JD9A 5I2LA 2CNPA 3FWBA 1CFFA 2WCMA 1QX7A 3I5FB 2KFHA 1A4PA 4GFTA 1XK4A 3BUWB 4JKTA 1T14A 2PYQA 1JFJA 1XFVO 1DQEA 4I5NB 5HKYA 3TUYC 1TUJA 3PSRA 3BXKA 5CPVA 1ZUZA 2SCPA 4YGBB 1IG5A 1TNPA 1WY9A 2I94A 2M97A 1TIZA 3CWGA 4I5LB 4IL1A 4NDDA 2JNXA 3DVJA 3PLFB 2M8UA 4WQ2A 2BCXA 1LXFC 2Q91A 2WCHA 1YTZC 4KYNA 5G08A 1IKUA 1K8UA 1GQMA 1XFZO 3OB2B 5D3OA 1IH0A 2CCMA 3D0YA 2YGUA 2BCAA 3NSIA 2LP2A 4M2PA 1S6CA 3EK7A 4MLWA 2OS8B 4YGAA 1PSRA 1M45A 5I94A 2ZKMX 4GNKB 1SPYA 2LLUA 3AKBA 1HT9A 2JQ6A
chains in the Genus database with same CATH topology
3RZSA 3CABA 1OOIX 3DXLA 3R1PA 3CZ1A 3S0BA 3B7AA 3Q8IA 2WC5A 3L4LA 3V2LA 3DYEA 3BJHA 4OZDA 3CZ2A 1ORGA 3BFHA 3PJIA 5DICA 3S0EA 3NHTA 2WCKA 3B87A 1GM0A 3DZTA 3OGNA 2QDIA 2KPHA 3L47A 1OW4A 2QEBA 2PQLA 3NGVA 1OOGA 1C3ZA 2GTEA 1OOHA 3FE8A 1OOFA 2WC6A 1P28A 2QEHA 3S0AA 2JPOA 2P70A 3N7HA 3R72A 1TWOA 2FJYA 3L4AA 3D78A 3D75A 3S0FA 2WCJA 1LS8A 3NHIA 2WCLA 3D74A 3DY9A 3CZ0A 2ERBA 4INWA 1QWVA 2H8VA 4JD9A 4INXA 2WCMA 3R1OA 3FE9A 3FE6A 1T14A 2L2CA 3B86A 3R1VA 5EL2A 1DQEA 3D77A 1TUJA 3B6XA 3B88A 3BFAA 3K1EA 3S0GA 2P71A 3D76A 2WCHA 1XFRA 3CDNA 4PT1A 3QMEA 4FQTA 4F7FA 3D73A 3CYZA 1C3YA 3VB1A 3BFBA 2QEVA 3S0DA 2QEOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RZS A;  3CAB A;  1OOI X;  3DXL A;  3R1P A;  3CZ1 A;  3S0B A;  3B7A A;  3Q8I A;  2WC5 A;  3L4L A;  3V2L A;  3DYE A;  3BJH A;  4OZD A;  3CZ2 A;  1ORG A;  3BFH A;  3PJI A;  5DIC A;  3S0E A;  3NHT A;  2WCK A;  3B87 A;  1GM0 A;  3DZT A;  3OGN A;  2QDI A;  2KPH A;  3L47 A;  1OW4 A;  2QEB A;  2PQL A;  3NGV A;  1OOG A;  1C3Z A;  2GTE A;  1OOH A;  3FE8 A;  1OOF A;  2WC6 A;  1P28 A;  2QEH A;  3S0A A;  2JPO A;  2P70 A;  3N7H A;  3R72 A;  1TWO A;  2FJY A;  3L4A A;  3D78 A;  3D75 A;  3S0F A;  2WCJ A;  1LS8 A;  3NHI A;  2WCL A;  3D74 A;  3DY9 A;  3CZ0 A;  2ERB A;  4INW A;  1QWV A;  2H8V A;  4JD9 A;  4INX A;  2WCM A;  3R1O A;  3FE9 A;  3FE6 A;  1T14 A;  2L2C A;  3B86 A;  3R1V A;  5EL2 A;  1DQE A;  3D77 A;  1TUJ A;  3B6X A;  3B88 A;  3BFA A;  3K1E A;  3S0G A;  2P71 A;  3D76 A;  2WCH A;  1XFR A;  3CDN A;  4PT1 A;  3QME A;  4FQT A;  4F7F A;  3D73 A;  3CYZ A;  1C3Y A;  3VB1 A;  3BFB A;  2QEV A;  3S0D A;  2QEO A; 
#chains in the Genus database with same CATH topology
 1OMD A;  2JT8 A;  2MAZ A;  4GBA A;  1RWY A;  2KLE A;  2FJU B;  1DVI A;  1WRK A;  3OBV A;  1K96 A;  1F55 A;  1BG1 A;  1YUT A;  3I5H B;  2K7O A;  3R1P A;  1AP4 A;  3OP0 A;  4CFR A;  1M46 A;  3S0B A;  4MRX A;  1CNP A;  2KAX A;  4YGC B;  1PVB A;  2F33 A;  3SJS A;  1CMF A;  1K90 D;  4CFQ A;  4D1E A;  2ZN8 A;  1ODB A;  4U8D A;  1JF0 A;  4FTG A;  1BU3 A;  1A75 A;  4OZD A;  5CSJ A;  3CZ2 A;  1A75 B;  2LMU A;  3BFH A;  4NQG A;  5I2Q A;  3PJI A;  5K89 A;  3EK4 A;  1ZOT B;  3TDZ A;  1QVI Z;  1R6P A;  1DGV A;  4GPL B;  1XFX O;  1FW4 A;  2NZ0 A;  3NHT A;  4MBE A;  3KF9 A;  1N0Y A;  2MBX A;  1J7Q A;  1J1D A;  1Z2C B;  3LCP C;  5FI7 A;  1FF1 A;  1IWQ A;  2JT3 A;  3WNX B;  5AFP A;  1YRT B;  2GV5 A;  2NXQ A;  5PAL A;  2QDI A;  4HRE E;  1GGZ A;  1W7I B;  1WRZ A;  3UO9 A;  4DS7 A;  3L47 A;  1CDL A;  5KTY A;  4OCI A;  2KI6 D;  2PQL A;  4ZCV A;  1SCM B;  3FWC A;  1C3Z A;  4C0K A;  4QJ4 B;  2LLS A;  5HYD A;  1KQM B;  1QS7 A;  1SW8 A;  2OPO A;  2KSP A;  1K9U A;  5CSN A;  2D8N A;  3BUM B;  5AEQ A;  1JUO A;  1AJ4 A;  2L2E A;  3TDU A;  1A29 A;  5I8N A;  3S0A A;  4GUK A;  2Y4Q A;  2ZND A;  2WCB A;  3BUN B;  3PAL A;  1QV0 A;  4MZL A;  1OZO A;  2V53 A;  4TNC A;  1H8B A;  2M0R A;  3SG5 A;  2FOT A;  3NHI A;  1V1G A;  1MUX A;  1J55 A;  1SL9 A;  3D74 A;  3DY9 A;  1UHK A;  1W9Z A;  1B8L A;  2LVK A;  3CZ0 A;  2EC6 C;  1UHN A;  1ZMZ A;  2OTG C;  1TTX A;  3BOW A;  3LK0 A;  2JOJ A;  2M29 A;  3BOW B;  1QX2 A;  2I7A A;  2JTT A;  3NSO A;  1FI6 A;  1QWV A;  1KK7 Z;  1Y6W A;  2LUX A;  1PVA A;  1TRF A;  4GGN A;  1B7T Y;  4ICB A;  4YI9 A;  1MR8 A;  1CDM A;  1YVL A;  1SY9 A;  1TUZ A;  2LP3 A;  3FE9 A;  4A4B A;  4DCK A;  2BEC A;  2GGM A;  5KU1 A;  3HX4 A;  2GGZ A;  5EL2 A;  2JPT A;  3D77 A;  3TZ1 A;  1JC2 A;  2KFG A;  2PVB A;  1RK9 A;  3I5G B;  3B88 A;  3OB1 B;  2ZNE A;  2QPT A;  3AKA A;  3IQO A;  1PK0 D;  3BFA A;  5FI6 A;  3S0G A;  1EXR A;  2ZFD A;  1EH2 A;  2KQY A;  3CDN A;  3F45 A;  2LV7 A;  3I5I C;  5BPJ A;  4YBH B;  2SAS A;  3CR5 X;  3QME A;  3JVT B;  1NX3 A;  3EVR A;  3GK1 A;  4F7F A;  1H4B A;  4OVN F;  1N65 A;  4M2O A;  4PAL A;  1ALV A;  1C3Y A;  1G33 A;  4N1F A;  2AMI A;  5CSI A;  1DT7 B;  3LL8 B;  5FI2 A;  3VB1 A;  1E8A A;  4PE0 A;  4PHJ A;  3ICB A;  1NWD A;  2PAS A;  2KGR A;  2M1U A;  1CFC A;  1F54 A;  3VRQ A;  1F8H A;  2Y5I A;  4JQ0 D;  3DXL A;  1QAT A;  1L7Z A;  1M31 A;  1R2U A;  1VRK A;  4GAO A;  2I2R E;  4CPV A;  3PM2 A;  4I5K A;  1UWO A;  2JU0 A;  3I5H C;  2Q4U A;  4IJ7 A;  1FI5 A;  3V2L A;  4WRI A;  3CZ1 A;  1SK6 D;  3PM8 A;  1DJH A;  3Q8I A;  1JBA A;  3CR4 X;  5JOL A;  2H61 A;  1DEL A;  1NP8 A;  4MEW A;  3CLN A;  1S6J A;  1F4Q A;  1WLZ A;  1CDP A;  2H2K A;  2L0P A;  1SYM A;  2BL0 B;  5AAN A;  4AQI A;  3ZWH A;  1DJI A;  3MSE B;  3IF7 A;  1JF2 A;  3ZNI A;  1B1G A;  1CKK A;  1UHH A;  1FBV A;  1Y0V H;  2ISD A;  1XYD A;  3M0W A;  4P5O E;  2WCE A;  3S0E A;  3UNW A;  1SCV A;  1KCY A;  2LHL A;  2PMY A;  1UHJ A;  2F2O A;  2K60 A;  1AK8 A;  1KSM A;  2WND A;  1GM0 A;  3DZT A;  5DKQ A;  1AJ5 A;  1IGV A;  1SMG A;  2F3Y A;  4DIR A;  1S5G Z;  3FIA A;  4MZK A;  1B8R A;  1SCM C;  4GGF A;  2CTN A;  4PE7 A;  2RGI A;  2JT0 A;  3K21 A;  2KYF A;  2COL B;  4HRH A;  1EL4 A;  1OOH A;  4YI8 A;  3WHU B;  1JSA A;  1L2O B;  1NPQ A;  1KWO B;  2WC6 A;  1ALW A;  1EG4 A;  2F3Z A;  4OR9 B;  1YUU A;  4C0J A;  2BBM A;  2P70 A;  1DC1 A;  1K94 A;  3BUX B;  4OV2 A;  3N7H A;  1KSO A;  3EG5 B;  3D75 A;  3JTD B;  3NSK A;  2M7N A;  1XVJ A;  2O5G A;  3IVT A;  1NX0 A;  1M39 A;  3TS5 B;  1Y1U A;  1DMO A;  1SSE B;  2LCP A;  3EKH A;  3C1V A;  1C7V A;  1GJY A;  4INW A;  3WHT B;  1F70 A;  2BE4 A;  1F71 A;  5HLV A;  3QRX A;  1K9P A;  1PUL A;  4N5X A;  4ORC B;  5HLO A;  3R1O A;  3SS3 A;  1AVS A;  1CB1 A;  2JZI A;  1NX1 A;  1LVC D;  2LMT A;  3AAK A;  3FE6 A;  3RM1 A;  1DJW A;  2L2C A;  3B86 A;  4MSP A;  3A4U B;  2LMV A;  3DVE A;  4PE1 A;  1AUI B;  2K0J A;  4JWQ A;  2JUL A;  1DF0 A;  2KOT A;  3B6X A;  2MJW B;  5CSF A;  5AER A;  1IRJ A;  1DF0 B;  3O6B A;  2L5Y A;  2BNX A;  1SKT A;  4L9M A;  5FYX A;  1LIN A;  2KLD A;  3OX6 A;  3K1E A;  1MWN A;  4E68 A;  5B8I B;  1XFR A;  2O60 A;  2TN4 A;  1SR6 B;  1XO5 A;  3JVT C;  3O78 A;  3SG2 A;  1S6I A;  2KBI A;  3DD4 A;  5DKR A;  2AAO A;  2KQ6 A;  4FQT A;  3PN7 C;  1KFU S;  2L4H A;  2LLT A;  2KGB C;  5D69 A;  3CYZ A;  1AHR A;  1J1E A;  5KSZ A;  2BAP A;  3GK4 X;  4ZCU A;  2K8M B;  2M1K B;  1NCY A;  1YRU B;  3I5F C;  2QEV A;  1UUR A;  1XK4 C;  1QX5 B;  2KI4 B;  1TN4 A;  3GK2 A;  2K2F A;  1YUS A;  2AUC A;  2KNE A;  1KFX L;  3CAB A;  1OOI X;  2FCD A;  1IQ5 A;  1TOP A;  3SG6 A;  1HQV A;  3H4S E;  4MN0 A;  4WQ3 A;  1J7R A;  1KFU L;  1BOD A;  1KK8 B;  2A4J A;  3CGA A;  2L4I A;  2JRF A;  3B7A A;  1C07 A;  2WC5 A;  4QJ5 B;  2H61 C;  3NSL A;  2ZN9 A;  5GQQ C;  4PCW A;  2BKI B;  2LHI A;  1YX7 A;  2CT9 A;  4FQO A;  1Z4H A;  1MF8 B;  3L4L A;  1J7O A;  2BL0 C;  5F6T A;  1QLS A;  2JXL A;  2KHN A;  2OS8 C;  2Y1M A;  4MVF A;  1QV1 A;  2E30 A;  3KEV A;  4PHM A;  1ORG A;  3E3R A;  3CR2 A;  2EGD A;  3FS7 A;  4AOM A;  1BF5 A;  2Y1N A;  2PRU A;  4PE4 A;  1IQ3 A;  3KO0 A;  1Y1X A;  2P6B B;  4M2Q A;  1PRW A;  1TNQ A;  1TNX A;  1X02 A;  3SG4 A;  1SL7 A;  1BMO A;  3OX5 A;  3B87 A;  2LE9 B;  3VRR A;  3O4X A;  2FCE A;  3OGN A;  1NYA A;  1QVI Y;  3SG3 A;  2KDH A;  1OZS A;  5D7F A;  4ORB B;  2EC6 B;  3VGO A;  2OTG B;  2QEB A;  4GGF C;  4YGE B;  2MRD A;  1CLB A;  2NCP A;  2L98 A;  3NGV A;  4NDC A;  3LK1 A;  1OOG A;  1MXE A;  2GTE A;  1L2O C;  1KWO C;  1LA0 A;  3EKJ A;  1DJZ A;  3LLE A;  1NUB A;  3FE8 A;  4ETO A;  2K61 A;  1G8I A;  2WCF A;  4OKH A;  1UUS A;  1SL8 A;  2F2P A;  1BJF A;  1P28 A;  2LUC A;  1G4Y R;  1OQP A;  1TNW A;  1NCZ A;  2QEH A;  4HRG A;  2LVJ A;  1CFD A;  3JTD C;  4AQJ A;  1S26 D;  2FJY A;  3D78 A;  1B7T Z;  5J3X A;  5HKZ A;  2B1U A;  3NXA A;  1IIO A;  3TS5 C;  2KYC A;  1DJY A;  2LAP A;  4R1E A;  1TCF A;  3I5I B;  1IJ5 A;  2WOS A;  2LM5 A;  1DJG A;  2LNK A;  2K7D A;  3D0Y B;  1WDC B;  1OE9 B;  2DOQ A;  1K93 D;  2WC8 A;  1KQM C;  4INX A;  1U5I A;  1MXL C;  1QXP A;  2K2A A;  1U5I B;  2LVI A;  2K7B A;  1FPW A;  3R1V A;  1CLM A;  3CZT X;  1B9A A;  1C7W A;  2LAN A;  1UP5 A;  2MA2 A;  2PAL A;  4JPZ B;  1KK7 Y;  2HQ8 A;  3TUY B;  5ER4 X;  4YRU A;  2MLE C;  3VRP A;  1B47 A;  2CXJ A;  4F0Z B;  2QAC A;  1GGW A;  3RLZ A;  1CM1 A;  4NDB A;  1DTL A;  1SR6 C;  1OMV A;  1LKJ A;  2P71 A;  2R2I A;  3D76 A;  1DGU A;  1N2D A;  1RJV A;  5JJG A;  3D10 A;  4PT1 A;  4CID A;  1SRA A;  3A8R A;  1REC A;  3VRN A;  1CFP A;  4I5J A;  2L5X B;  1K2H A;  2HF5 A;  1B4C A;  2BBN A;  1Q80 A;  3D73 A;  1MHO A;  1NCX A;  3TDI A;  4MRY A;  2HPS A;  2M49 B;  1OSA A;  2F8P A;  2KI4 C;  1QLK A;  3BFB A;  3SIA A;  4C0L A;  2EHB A;  2MHH A;  1V1F A;  3S0D A;  4ORA B;  1WRL A;  2QEO A;  4Q04 A;  1S36 A;  3RZS A;  5TNC A;  3SS4 A;  1DEK A;  2JC2 A;  3EVV A;  3I5G C;  2NLN A;  1CMG A;  1S1E A;  1PSB A;  1UHI A;  1A2X A;  1QJT A;  3KHE A;  4PHK A;  1KK8 C;  3VRO A;  2IS9 A;  1A03 A;  1Y1A A;  1XA5 A;  4QJ3 B;  1KFX S;  1ZAC A;  4HSZ A;  1BLQ A;  2KFF A;  1LA3 A;  1RFJ A;  4A4C A;  2PSR A;  3EK8 A;  3PAT A;  1J7P A;  1SNL A;  3AAJ A;  1BR4 B;  3BUO B;  3SG7 A;  3CS1 A;  3O4Y A;  3DYE A;  3SIB A;  3BJH A;  4P2Y B;  5IBW A;  3GOF A;  2L50 A;  2BKH B;  1RRO A;  2L51 A;  1QAS A;  1QIW A;  2HQW A;  2KAY A;  2K7C A;  3DF0 A;  5I2O A;  3OHM B;  3DF0 B;  1BOC A;  1NIW A;  4UPG A;  5DIC A;  1M63 B;  3KPX A;  2KI6 C;  1IJ6 A;  2JNF A;  2CBL A;  2M9G A;  2KBM A;  3DVK A;  2HET A;  3BQ3 A;  2G9B A;  2WCK A;  2JXC A;  2I18 A;  1JFK A;  2M3W A;  2LC5 A;  2BE6 A;  3IQQ A;  5DKN A;  1YUR A;  1WLM A;  2KPH A;  2E6W A;  4YGD B;  4XJK A;  1EJ3 A;  2G2B A;  1TCO B;  2ZRS A;  1YR5 A;  3O2P A;  4XJK B;  4CLN A;  1OW4 A;  2NCO A;  1BR1 B;  4XYN A;  1NSH A;  1K95 A;  4MZJ A;  4BY5 A;  1PAL A;  1W7J B;  1XFW O;  1ZFS A;  2LVV A;  1D1O A;  1OOF A;  3SS5 A;  3DVM A;  4USL A;  1OMR A;  1S5G Y;  1CM4 A;  1CLL A;  1NX2 A;  2VRG A;  4PHN A;  3WXA A;  1QTX A;  1CTR A;  1YVH A;  5HKW A;  1DJX A;  4DRW A;  2JPO A;  1XFU O;  2KAV A;  1EG3 A;  3R72 A;  5AXI A;  4BY4 A;  1TWO A;  3L4A A;  1BT6 A;  1YX8 A;  1QIV A;  1JWD A;  2M7L A;  3S0F A;  1MQ1 A;  1SBJ A;  2WCJ A;  1LS8 A;  5ER5 A;  2WCL A;  1XFY O;  3BYA A;  4PDZ A;  5HL1 A;  3EVU A;  1F4O A;  1OOJ A;  2JTZ A;  2JWW A;  2BCB A;  2ERB A;  3CTN A;  1B8C A;  2WOR A;  2MLF C;  1WDC C;  3HCM A;  4N1G A;  1K9K A;  1CDN A;  1KQV A;  1RTP 1;  1S3P A;  3PN7 B;  2H8V A;  2ZRT A;  3PFV A;  4DUQ A;  4JD9 A;  5I2L A;  2CNP A;  3FWB A;  1CFF A;  2WCM A;  1QX7 A;  3I5F B;  2KFH A;  1A4P A;  4GFT A;  1XK4 A;  3BUW B;  4JKT A;  1T14 A;  2PYQ A;  1JFJ A;  1XFV O;  1DQE A;  4I5N B;  5HKY A;  3TUY C;  1TUJ A;  3PSR A;  3BXK A;  5CPV A;  1ZUZ A;  2SCP A;  4YGB B;  1IG5 A;  1TNP A;  1WY9 A;  2I94 A;  2M97 A;  1TIZ A;  3CWG A;  4I5L B;  4IL1 A;  4NDD A;  2JNX A;  3DVJ A;  3PLF B;  2M8U A;  4WQ2 A;  2BCX A;  1LXF C;  2Q91 A;  2WCH A;  1YTZ C;  4KYN A;  5G08 A;  1IKU A;  1K8U A;  1GQM A;  1XFZ O;  3OB2 B;  5D3O A;  1IH0 A;  2CCM A;  3D0Y A;  2YGU A;  2BCA A;  3NSI A;  2LP2 A;  4M2P A;  1S6C A;  3EK7 A;  4MLW A;  2OS8 B;  4YGA A;  1PSR A;  1M45 A;  5I94 A;  2ZKM X;  4GNK B;  1SPY A;  2LLU A;  3AKB A;  1HT9 A;  2JQ6 A; 
#chains in the Genus database with same CATH homology
 3RZS A;  3CAB A;  1OOI X;  3DXL A;  3R1P A;  3CZ1 A;  3S0B A;  3B7A A;  3Q8I A;  2WC5 A;  3L4L A;  3V2L A;  3DYE A;  3BJH A;  4OZD A;  3CZ2 A;  1ORG A;  3BFH A;  3PJI A;  5DIC A;  3S0E A;  3NHT A;  2WCK A;  3B87 A;  1GM0 A;  3DZT A;  3OGN A;  2QDI A;  2KPH A;  3L47 A;  1OW4 A;  2QEB A;  2PQL A;  3NGV A;  1OOG A;  1C3Z A;  2GTE A;  1OOH A;  3FE8 A;  1OOF A;  2WC6 A;  1P28 A;  2QEH A;  3S0A A;  2JPO A;  2P70 A;  3N7H A;  3R72 A;  1TWO A;  2FJY A;  3L4A A;  3D78 A;  3D75 A;  3S0F A;  2WCJ A;  1LS8 A;  3NHI A;  2WCL A;  3D74 A;  3DY9 A;  3CZ0 A;  2ERB A;  4INW A;  1QWV A;  2H8V A;  4JD9 A;  4INX A;  2WCM A;  3R1O A;  3FE9 A;  3FE6 A;  1T14 A;  2L2C A;  3B86 A;  3R1V A;  5EL2 A;  1DQE A;  3D77 A;  1TUJ A;  3B6X A;  3B88 A;  3BFA A;  3K1E A;  3S0G A;  2P71 A;  3D76 A;  2WCH A;  1XFR A;  3CDN A;  4PT1 A;  3QME A;  4FQT A;  4F7F A;  3D73 A;  3CYZ A;  1C3Y A;  3VB1 A;  3BFB A;  2QEV A;  3S0D A;  2QEO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...