4XJKA

Crystal structure of mn(ii) ca(ii) na(i) bound calprotectin
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
88
structure length
88
Chain Sequence
MLTELEKALNSIIDVYHKYSLIKGNFHAVYRDDLKKLLETESPQYIRKKGADVWFKELDINTDGAVNFQEFLILVIKMGVAAHKKSHE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords Protein S100-A8
publication title Manganese Binding Properties of Human Calprotectin under Conditions of High and Low Calcium: X-ray Crystallographic and Advanced Electron Paramagnetic Resonance Spectroscopic Analysis.
pubmed doi rcsb
source organism Homo sapiens
total genus 35
structure length 88
sequence length 88
chains with identical sequence C, E, G, I
ec nomenclature
pdb deposition date 2015-01-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4xjkA00
2L50A 1FI6A 2LE9B 5CSNA 2AAOA 1PVAA 1NX0A 2KSPA 3BUNB 4IL1A 1Q80A 1NCYA 3GK4X 4MBEA 1DGVA 2LP2A 2O60A 4HREE 2BECA 4P5OE 2K8MB 1R6PA 1K93D 4GNKB 2K7OA 3WHTB 3IQOA 3KO0A 2M9GA 4GGFC 3DVJA 4PHNA 1YR5A 4NDDA 5I2LA 4ORAB 3FS7A 2KI6C 5HKZA 2AUCA 1XFXO 2VRGA 2F2PA 3EVUA 4GGNA 1DJWA 1QASA 2I7AA 4OVNF 2M7NA 1CFCA 2JC2A 1J1DA 2HQ8A 4ETOA 2MHHA 4YI9A 2FCEA 1CDLA 2OS8C 1JUOA 3CZTX 2Y4QA 1ZACA 1S3PA 4JQ0D 2HF5A 3TUYC 4OR9B 2HPSA 2JU0A 2NCPA 3LCPC 1EJ3A 4JPZB 2L98A 1AP4A 1W7IB 3CR2A 3EK8A 4A4CA 2O5GA 1X02A 4MSPA 1B7TZ 5DKQA 3ZNIA 1ALVA 4P2YB 1W7JB 1XFVO 1QTXA 1B4CA 3PALA 1S1EA 2TN4A 2K7DA 5PALA 2BL0C 2L5XB 4I5KA 2GGZA 3ZWHA 1CFFA 2KOTA 1KSOA 2KBMA 2KI6D 2GGMA 1ZOTB 1FI5A 1RK9A 4MZKA 3DF0A 1MHOA 2KBIA 3E3RA 3I5GB 1DMOA 2ZN9A 3SG3A 2PASA 5I2OA 1K9KA 2LUXA 1MXLC 2KDHA 1PULA 1IJ6A 4DCKA 1PSRA 4L9MA 1YX7A 4GUKA 4YRUA 5AFPA 1AHRA 1SL9A 1DVIA 2B1UA 4MZJA 3BXKA 4MEWA 1WDCC 1ZMZA 3OP0A 4YI8A 1PALA 1WLMA 3VRQA 4XJKB 1C7VA 3I5FC 1RECA 5B8IB 2ZN8A 1JWDA 4R1EA 3EK7A 2JOJA 1UHNA 1VRKA 1CMGA 1L2OB 1WRKA 2M8UA 3SG4A 4MLWA 1DTLA 3NXAA 1DT7B 1KFXS 1BG1A 1Y1XA 5BPJA 3EKJA 5FYXA 4GPLB 2JXLA 1CM1A 5D7FA 2JZIA 2MBXA 3TDUA 4N5XA 2BCAA 3JTDC 5AANA 2LAPA 2F3YA 1QATA 1WRLA 1S6IA 1J7PA 2I94A 2JT3A 3HX4A 3LK1A 3TDIA 1CFDA 1S36A 1OMVA 1KFUL 4WQ3A 4ZCVA 4FQOA 1KWOC 1YRTB 1CKKA 1IQ3A 3BQ3A 2NZ0A 3BUWB 5HLOA 1B8LA 3TS5B 1GQMA 2MA2A 1IKUA 4N1GA 2BKIB 2LHLA 2KAYA 3A8RA 4OCIA 1SK6D 1SRAA 1GGZA 1C07A 1UWOA 1XYDA 1TIZA 2K2AA 1WLZA 3BUMB 3GOFA 3TZ1A 4CPVA 2LVVA 3PN7C 1E8AA 3ICBA 1LVCD 1B8RA 1DGUA 1QLKA 2PRUA 2ZNDA 3FIAA 3SG7A 1B1GA 5I2QA 4C0LA 1QVIY 1SL8A 2I18A 3WXAA 2G2BA 1NWDA 1J55A 3EK4A 3O2PA 2KYCA 3OX5A 4I5LB 1S26D 4BY5A 3OHMB 2LM5A 1DJIA 3AKBA 4GFTA 4MN0A 4PHKA 4GAOA 4BY4A 2ISDA 1QJTA 4USLA 3DVMA 1ODBA 1DJZA 1XA5A 1SCMC 1F54A 2WCFA 1QX5B 4HRGA 1CLMA 1JFKA 1TNXA 2LMUA 4MZLA 4DUQA 4OV2A 1EG3A 3DVKA 3EVRA 5AXIA 1U5IB 1BOCA 2F33A 1TNQA 1QXPA 1N0YA 4ICBA 1YVHA 5HLVA 1SL7A 2F8PA 5KU1A 1TNWA 5D69A 1XFYO 3VROA 1F55A 3M0WA 4WQ2A 1QLSA 1JC2A 2MAZA 3PLFB 4XJKA 4C0JA 1YX8A 1S6JA 2E6WA 1KK7Y 2ZNEA 3IF7A 3KHEA 1F71A 1KQMB 1H4BA 4PE1A 2JRFA 3C1VA 5IBWA 2LVIA 5DKRA 1S5GY 2WCBA 1MR8A 4U8DA 3RM1A 2NXQA 3WHUB 3AAJA 2L4IA 2RGIA 1M39A 1B47A 1JSAA 1FBVA 2PALA 2M0RA 3RLZA 1G8IA 3LL8B 1TCOB 2K7CA 2KNEA 2LVKA 1IQ5A 3PM8A 1IG5A 3CGAA 1Y1AA 4ORBB 3VRPA 4Q04A 2EC6B 2JT0A 2OTGB 2A4JA 4TNCA 3LK0A 1C7WA 5CPVA 3VRRA 2KFFA 2PSRA 1LINA 1OSAA 1CLBA 1TOPA 1GJYA 2LMVA 1Y1UA 1IJ5A 2H2KA 1RTP1 1KFXL 4CIDA 2LHIA 5G08A 1A03A 1BT6A 1K2HA 2KYFA 1SW8A 1NUBA 1M31A 1QIVA 1M45A 3D10A 5CSIA 4A4BA 4HSZA 1K96A 1TN4A 4PE7A 3D0YB 1UURA 2KI4C 1V1FA 1GGWA 2K0JA 1MF8B 1OQPA 1F4QA 1KSMA 2WC8A 3AKAA 4PE4A 5JJGA 2HQWA 1CDMA 1EXRA 1K90D 1QVIZ 2MLFC 1DJHA 1EG4A 1UHIA 1A2XA 1FW4A 2LLSA 3JVTB 4M2PA 4PALA 5J3XA 1R2UA 4I5JA 1AK8A 3IQQA 3GK1A 1XFZO 2JXCA 3BOWB 5CSJA 1U5IA 4MRXA 4PHMA 2DOQA 2COLB 1PSBA 1ZFSA 1FF1A 1EL4A 1V1GA 5TNCA 3I5IC 2JQ6A 2QPTA 3I5GC 4D1EA 1JBAA 2CNPA 1NSHA 2JWWA 1XVJA 1CDNA 3CLNA 3I5HB 5AERA 2Y1MA 1RFJA 2JNXA 2QACA 2HETA 1QX7A 3HCMA 5F6TA 3H4SE 1YUUA 1YRUB 1H8BA 2M7LA 3NSKA 3PATA 3O6BA 1TCFA 3EVVA 1BLQA 5HKYA 3CR4X 3PSRA 4M2QA 1B7TY 3NSIA 5ER5A 2LNKA 2WORA 2L0PA 1QX2A 1J1EA 1A75B 1L2OC 4C0KA 1UHHA 3FWBA 4PE0A 3OB2B 2M49B 1XK4A 1IGVA 2LV7A 2KGRA 2LP3A 3MSEB 1CTRA 2KFGA 1CMFA 1LXFC 1K8UA 2F2OA 2LLUA 3KPXA 1KK8B 2LVJA 1UUSA 1KCYA 2KQYA 1WRZA 1DF0B 1NYAA 1YURA 2LANA 1SMGA 2CCMA 2M29A 2MJWB 1BF5A 1OMRA 1CB1A 1M46A 2BE4A 1SPYA 3TS5C 4NQGA 4DRWA 4PDZA 4XYNA 1OZSA 1QV0A 3D0YA 1XO5A 2BKHB 2Y5IA 4YGDB 3BUOB 4MRYA 1SR6C 2EHBA 1UHKA 1IRJA 2H61A 2JPTA 4AQIA 1RJVA 3K21A 2M3WA 2AMIA 2OS8B 1NCZA 2WCEA 4F0ZB 4CFRA 1BJFA 3TUYB 4N1FA 2PVBA 1G4YR 2KAXA 1CM4A 2CBLA 1PRWA 3O4YA 1RWYA 1F70A 4GBAA 3F45A 2E30A 2ZRTA 2NLNA 4UPGA 1MXEA 1BR1B 3AAKA 1D1OA 2BCXA 2R2IA 1N65A 4PCWA 4YBHB 1YTZC 2KQ6A 3WNXB 5KTYA 2BL0B 1BR4B 1OOJA 1IH0A 1BMOA 1B9AA 3KEVA 2L2EA 2PMYA 5I8NA 1K94A 1KQVA 2FOTA 1Y0VH 4MVFA 1CLLA 2L4HA 4DIRA 1KQMC 2NCOA 1A75A 2FCDA 1HQVA 1UHJA 1NX1A 5DKNA 3SG6A 3SG5A 2Q4UA 1EH2A 2I2RE 2LLTA 4NDBA 1OMDA 2KI4B 4WRIA 5K89A 1J7QA 3GK2A 2KHNA 1TRFA 2M97A 1WDCB 3VRNA 1NIWA 2LUCA 2WNDA 3I5FB 1JFJA 3OB1B 4ZCUA 1Y6WA 1DF0A 3CR5X 2KFHA 1XK4C 5CSFA 2ZRSA 3SJSA 1N2DA 1CDPA 1SNLA 1NPQA 1ZUZA 2EC6C 1YVLA 2F3ZA 2OTGC 1SBJA 2K7BA 4GGFA 1LKJA 4E68A 4YGEB 3FWCA 3JTDB 1TTXA 2CTNA 1AUIB 1A29A 1QV1A 3I5IB 3CWGA 3NSLA 1DJGA 3BYAA 2D8NA 2BBMA 1LA0A 3CTNA 2FJUB 3DD4A 2EGDA 1KWOB 4HRHA 1HT9A 3SIBA 1OE9B 1SCVA 2WOSA 1SKTA 4AQJA 4I5NB 4CFQA 1ALWA 1B8CA 2K61A 4NDCA 4QJ3B 3CS1A 3VGOA 1CNPA 1SY9A 3KF9A 1AVSA 1JF0A 2OPOA 5GQQC 1YUSA 1UP5A 1DJYA 2BCBA 1SYMA 2K2FA 1BODA 1NX3A 1MWNA 3PN7B 2H61C 1MQ1A 2P6BB 4PHJA 4DS7A 1KK7Z 1QS7A 2CXJA 4AOMA 1G33A 3JVTC 1F8HA 1YUTA 5JOLA 1RROA 3LLEA 5AEQA 1S5GZ 2IS9A 2L51A 2BE6A 1IWQA 1LA3A 1AJ5A 1PVBA 1K9UA 2ZFDA 3A4UB 1XFWO 2BBNA 2JNFA 2M1UA 3PFVA 4OKHA 3DVEA 2G9BA 1TNPA 3NSOA 3QRXA 1M63B 3EKHA 3OX6A 2MLEC 1AJ4A 1J7RA 2JULA 1CFPA 4YGBB 3I5HC 1SCMB 2JT8A 1L7ZA 3BUXB 4JWQA 1FPWA 2LCPA 5KSZA 1OZOA 2M1KB 1PK0D 4ORCB 4YGCB 3O78A 4YGAA 2Q91A 1SR6B 2KGBC 2LMTA 3DF0B 5HKWA 2MRDA 5ER4X 3SIAA 2Y1NA 2JTZA 2V53A 1WY9A 2GV5A 4QJ4B 1A4PA 4M2OA 1F4OA 3TDZA 2SCPA 4FTGA 1S6CA 1K95A 1MUXA 1KFUS 1DJXA 2CT9A 1BU3A 5HYDA 4QJ5B 1NP8A 1XFUO 1NX2A 1QIWA 2ZKMX 2JTTA 1JF2A 1NCXA 2LC5A 3SG2A 4CLNA 2SASA 1J7OA 1KK8C 3BOWA 1K9PA 2KAVA
chains in the Genus database with same CATH superfamily
2L50A 1FI6A 2LE9B 5CSNA 1TUJA 2AAOA 1PVAA 1C3YA 1NX0A 2KSPA 3BUNB 4FQTA 4IL1A 1Q80A 1NCYA 3GK4X 4MBEA 1DGVA 2LP2A 2O60A 4HREE 2BECA 5EL2A 4P5OE 2K8MB 3D75A 1R6PA 1K93D 4GNKB 2K7OA 2P71A 3WHTB 3IQOA 3S0AA 3KO0A 2M9GA 4GGFC 3DVJA 4PHNA 1YR5A 4NDDA 5I2LA 3SS4A 4ORAB 3FS7A 2KI6C 1DELA 5HKZA 2K60A 1IIOA 2AUCA 1XFXO 2VRGA 2F2PA 3R1PA 3EVUA 4GGNA 1DJWA 1QASA 2I7AA 4OVNF 2M7NA 1CFCA 2JC2A 2KLEA 1J1DA 2HQ8A 4ETOA 2MHHA 4YI9A 2FCEA 1CDLA 2OS8C 1JUOA 3CZTX 2Y4QA 1ZACA 2L5YA 1S3PA 3DXLA 4JQ0D 2HF5A 3TUYC 4OR9B 2HPSA 3D77A 2JU0A 2NCPA 3LCPC 1EJ3A 3CZ1A 4JPZB 2L98A 1AP4A 1W7IB 3CR2A 3EK8A 3S0DA 3CDNA 4A4CA 2O5GA 1TUZA 1X02A 4MSPA 1B7TZ 5DKQA 3ZNIA 1ALVA 4P2YB 1W7JB 1XFVO 1QTXA 1B4CA 3PALA 1S1EA 2TN4A 2K7DA 5PALA 2BL0C 2PYQA 2L5XB 4I5KA 2GGZA 3BJHA 3ZWHA 1CFFA 2KOTA 3CYZA 1KSOA 2KBMA 1P28A 2KI6D 2GGMA 1ZOTB 1FI5A 1T14A 1RK9A 4MZKA 3DF0A 1MHOA 2KBIA 3DY9A 2GTEA 3E3RA 3I5GB 1DMOA 2ZN9A 1OOHA 3SG3A 2PASA 5I2OA 1K9KA 2LUXA 1MXLC 2KDHA 2WC6A 1PULA 1IJ6A 4DCKA 1PSRA 2QEBA 1YX7A 4L9MA 4GUKA 4YRUA 5AFPA 1AHRA 1SL9A 1DVIA 2B1UA 4MZJA 3UO9A 3BXKA 4MEWA 1WDCC 1ZMZA 3OP0A 4YI8A 1PALA 1WLMA 3VRQA 4XJKB 1C7VA 1GM0A 3I5FC 1RECA 5B8IB 2ZN8A 1JWDA 4R1EA 3EK7A 2JOJA 1UHNA 1VRKA 1CMGA 1L2OB 1WRKA 2M8UA 3SG4A 1OOIX 1DTLA 3NXAA 4MLWA 1KFXS 1DT7B 1BG1A 1Y1XA 5BPJA 3EKJA 5FYXA 4GPLB 2JXLA 1CM1A 5D7FA 2JZIA 2MBXA 3TDUA 4N5XA 2BCAA 1LS8A 3JTDC 5AANA 2LAPA 1DQEA 2YGUA 3R1VA 2F3YA 1QATA 1WRLA 1S6IA 3D76A 1J7PA 2I94A 2JT3A 3HX4A 3LK1A 3TDIA 3EG5B 1CFDA 1S36A 1OMVA 1KFUL 4WQ3A 4ZCVA 4FQOA 3VB1A 1KWOC 1YRTB 1CKKA 1IQ3A 3BQ3A 2NZ0A 3BUWB 5HLOA 1B8LA 3TS5B 1GQMA 2MA2A 1IKUA 4N1GA 2BKIB 2LHLA 2KAYA 3A8RA 4OCIA 1SK6D 3R72A 1DC1A 1SRAA 1GGZA 1C07A 1UWOA 1XYDA 1TIZA 2K2AA 1ORGA 2WCJA 1WLZA 3BUMB 3GOFA 3TZ1A 1C3ZA 4CPVA 2LVVA 3PN7C 1E8AA 3ICBA 1LVCD 1B8RA 1DGUA 1QLKA 2PRUA 2ZNDA 3FIAA 3SG7A 3SS3A 5I2QA 4C0LA 1B1GA 1QVIY 1SL8A 2I18A 2H8VA 3WXAA 2G2BA 1NWDA 5I94A 3SS5A 2P70A 1J55A 3EK4A 2PQLA 3O2PA 2KYCA 3OX5A 4I5LB 1S26D 4BY5A 3OHMB 2LM5A 1DJIA 3AKBA 4GFTA 4MN0A 4PHKA 4IJ7A 4GAOA 4BY4A 2ISDA 1QJTA 4USLA 2WCLA 3DVMA 1ODBA 1DJZA 1XA5A 1SCMC 1F54A 2WCFA 1QX5B 4HRGA 1CLMA 1JFKA 1TNXA 2LMUA 4MZLA 4DUQA 4OV2A 1EG3A 3DVKA 3EVRA 3O4XA 5AXIA 1U5IB 3S0GA 1BOCA 2F33A 1TNQA 3S0EA 1QXPA 1N0YA 3N7HA 1SSEB 4ICBA 1YVHA 5HLVA 1SL7A 2F8PA 5KU1A 1TNWA 5D69A 1XFYO 3VROA 1F55A 3M0WA 4WQ2A 1QLSA 1JC2A 2MAZA 3RZSA 3PLFB 4XJKA 4C0JA 1YX8A 1S6JA 2E6WA 1KK7Y 2ZNEA 3IF7A 3KHEA 1F71A 1KQMB 1H4BA 4PE1A 2JRFA 3C1VA 5IBWA 2LVIA 5DKRA 1S5GY 2WCBA 1MR8A 4OZDA 4U8DA 2NXQA 3RM1A 3WHUB 3AAJA 2L4IA 2RGIA 1M39A 1B47A 1JSAA 1FBVA 2PALA 2M0RA 3RLZA 1G8IA 1OOFA 3LL8B 1TCOB 2K7CA 2KNEA 2LVKA 1IQ5A 3PM8A 1IG5A 3CGAA 1Y1AA 4ORBB 3VRPA 4Q04A 2EC6B 2JT0A 2OTGB 2A4JA 2WC5A 4TNCA 5FI2A 3LK0A 1C7WA 5CPVA 3VRRA 2KFFA 2PSRA 1LINA 1OSAA 1CLBA 1TOPA 1GJYA 2LMVA 1Y1UA 1IJ5A 2H2KA 1RTP1 1Z2CB 1KFXL 4CIDA 2LHIA 5G08A 3B86A 1A03A 1BT6A 3R1OA 2KYFA 1K2HA 1SW8A 1NUBA 1M31A 3S0FA 1QIVA 1M45A 3D10A 4INXA 5CSIA 2KLDA 4A4BA 4HSZA 1K96A 1TN4A 3B88A 4PE7A 3D0YB 1UURA 2KI4C 1V1FA 1GGWA 2K0JA 1MF8B 1OQPA 1F4QA 1KSMA 2WC8A 3AKAA 4PE4A 3L47A 5JJGA 3NHIA 2HQWA 1CDMA 1EXRA 1K90D 1QVIZ 2QDIA 2MLFC 1DJHA 3BFHA 1EG4A 1UHIA 1A2XA 1FW4A 2LLSA 3DYEA 3JVTB 4M2PA 4PALA 5J3XA 1R2UA 4I5JA 1AK8A 3IQQA 3GK1A 3BFBA 1XFZO 2JXCA 3BOWB 5CSJA 1U5IA 4MRXA 4PHMA 2DOQA 2COLB 1PSBA 1ZFSA 3B6XA 1FF1A 1EL4A 3OBVA 1V1GA 5TNCA 3I5IC 2JQ6A 2QPTA 3I5GC 4D1EA 1JBAA 2CNPA 1NSHA 2JWWA 1XVJA 1CDNA 3CLNA 3I5HB 5AERA 2QEVA 2Y1MA 1RFJA 2JNXA 2QACA 2HETA 1QX7A 3HCMA 5F6TA 3H4SE 1YUUA 1YRUB 1H8BA 2M7LA 2FJYA 3NSKA 1OOGA 3PATA 3O6BA 1TCFA 2WCKA 3EVVA 1BLQA 5HKYA 3CR4X 3PSRA 4INWA 4M2QA 1B7TY 3NSIA 5ER5A 2LNKA 2WORA 2L0PA 1QX2A 1J1EA 1A75B 1L2OC 4C0KA 1UHHA 3FWBA 4PE0A 3OB2B 2M49B 1XK4A 1IGVA 2LV7A 2KGRA 2LP3A 3MSEB 1CTRA 2KFGA 1CMFA 1LXFC 1K8UA 2F2OA 2LLUA 3KPXA 1KK8B 2LVJA 1UUSA 1KCYA 2KQYA 1WRZA 1DF0B 1NYAA 1YURA 2LANA 1SMGA 2BNXA 2CCMA 2M29A 2MJWB 1BF5A 1OMRA 1CB1A 1M46A 2BE4A 1SPYA 3TS5C 4NQGA 4DRWA 4PDZA 4XYNA 1OZSA 1QV0A 3QMEA 3D0YA 3CZ0A 1XO5A 3OGNA 2KPHA 2BKHB 3NGVA 2Y5IA 5HL1A 5FI6A 4YGDB 3BUOB 4MRYA 1SR6C 2EHBA 1UHKA 1IRJA 3DZTA 2H61A 2JPTA 4AQIA 1RJVA 3K21A 5FI7A 2M3WA 2AMIA 2OS8B 1NCZA 2WCEA 4F0ZB 4CFRA 1BJFA 3TUYB 4N1FA 2PVBA 1G4YR 2KAXA 3B7AA 1CM4A 2CBLA 1PRWA 3O4YA 1RWYA 1F70A 1XFRA 3F45A 4GBAA 2E30A 2ZRTA 2NLNA 4UPGA 3V2LA 1MXEA 1BR1B 3AAKA 1D1OA 2BCXA 2JPOA 2R2IA 1N65A 4PCWA 4YBHB 1YTZC 2KQ6A 1DEKA 3WNXB 5KTYA 2BL0B 1BR4B 1OOJA 1IH0A 1BMOA 1B9AA 3KEVA 2L2EA 2L2CA 2PMYA 5I8NA 1K94A 3Q8IA 2FOTA 1Y0VH 4MVFA 1KQVA 3L4AA 1CLLA 2L4HA 3D73A 4DIRA 1KQMC 1TWOA 2NCOA 1A75A 2FCDA 1HQVA 1UHJA 1NX1A 5DKNA 3SG6A 3SG5A 2Q4UA 1EH2A 2I2RE 3S0BA 3FE8A 2LLTA 4NDBA 1OMDA 2KI4B 4WRIA 5K89A 1J7QA 3GK2A 2KHNA 1TRFA 3K1EA 2M97A 1WDCB 3VRNA 1NIWA 3D78A 2LUCA 2WNDA 3CZ2A 3I5FB 1JFJA 3OB1B 4ZCUA 1Y6WA 2WCHA 1DF0A 3CR5X 2KFHA 1XK4C 5CSFA 5D3OA 2ZRSA 3SJSA 1N2DA 1CDPA 1SNLA 1NPQA 3B87A 1ZUZA 2EC6C 1YVLA 2F3ZA 2OTGC 4F7FA 1SBJA 2K7BA 4GGFA 1LKJA 3L4LA 4YGEB 3FWCA 3JTDB 4E68A 1TTXA 2CTNA 1Z4HA 1AUIB 1A29A 1QV1A 3I5IB 1OW4A 2BAPA 3CWGA 3NSLA 1DJGA 3BYAA 2D8NA 2BBMA 1LA0A 3CTNA 2FJUB 3DD4A 2EGDA 1KWOB 4HRHA 1HT9A 3SIBA 1OE9B 1SCVA 2WOSA 1SKTA 4AQJA 4I5NB 4CFQA 1ALWA 1B8CA 2K61A 4NDCA 2QEOA 4QJ3B 3CS1A 3VGOA 1CNPA 1SY9A 3KF9A 3UNWA 1AVSA 1JF0A 2OPOA 5GQQC 1YUSA 3PJIA 1UP5A 1DJYA 2BCBA 1SYMA 2K2FA 1BODA 1NX3A 1MWNA 3PN7B 2H61C 1MQ1A 2P6BB 4PHJA 4PT1A 1KK7Z 4DS7A 1QS7A 2CXJA 4AOMA 1G33A 3JVTC 1F8HA 1YUTA 1QWVA 5JOLA 1RROA 3LLEA 5AEQA 1S5GZ 2IS9A 2L51A 2BE6A 1IWQA 1LA3A 3FE9A 1AJ5A 1PVBA 5DICA 4JD9A 1K9UA 2ZFDA 3A4UB 2QEHA 1XFWO 3FE6A 2BBNA 2JNFA 2M1UA 3PFVA 4OKHA 3DVEA 2G9BA 1TNPA 3NSOA 3QRXA 1M63B 3EKHA 3OX6A 2MLEC 1AJ4A 1J7RA 2JULA 3CABA 1CFPA 3NHTA 4YGBB 3I5HC 1SCMB 2JT8A 1L7ZA 2WCMA 3BUXB 4JWQA 1FPWA 2LCPA 5KSZA 1OZOA 2M1KB 1PK0D 2ERBA 4ORCB 4YGCB 3O78A 3BFAA 4YGAA 2Q91A 1SR6B 1W9ZA 2KGBC 2LMTA 3DF0B 2MRDA 5ER4X 5HKWA 3SIAA 4KYNA 3IVTA 2Y1NA 2JTZA 3PM2A 2V53A 1WY9A 2GV5A 4QJ4B 1A4PA 4M2OA 1F4OA 3TDZA 2SCPA 4JKTA 4FTGA 1S6CA 3D74A 1K95A 1MUXA 1KFUS 1DJXA 2CT9A 1BU3A 5HYDA 4QJ5B 1NP8A 1XFUO 1NX2A 1QIWA 2ZKMX 2JTTA 1JF2A 1NCXA 2LC5A 3SG2A 4CLNA 2SASA 1J7OA 1KK8C 3BOWA 1K9PA 2KAVA
chains in the Genus database with same CATH topology
2L50A 1FI6A 2LE9B 5CSNA 2AAOA 1PVAA 1NX0A 2KSPA 3BUNB 4IL1A 1Q80A 1NCYA 3GK4X 4MBEA 1DGVA 2LP2A 2O60A 4HREE 2BECA 4P5OE 2K8MB 1R6PA 1K93D 4GNKB 2K7OA 3WHTB 3IQOA 3KO0A 2M9GA 4GGFC 3DVJA 4PHNA 1YR5A 4NDDA 5I2LA 4ORAB 3FS7A 2KI6C 5HKZA 2AUCA 1XFXO 2VRGA 2F2PA 3EVUA 4GGNA 1DJWA 1QASA 2I7AA 4OVNF 2M7NA 1CFCA 2JC2A 1J1DA 2HQ8A 4ETOA 2MHHA 4YI9A 2FCEA 1CDLA 2OS8C 1JUOA 3CZTX 2Y4QA 1ZACA 1S3PA 4JQ0D 2HF5A 3TUYC 4OR9B 2HPSA 2JU0A 2NCPA 3LCPC 1EJ3A 4JPZB 2L98A 1AP4A 1W7IB 3CR2A 3EK8A 4A4CA 2O5GA 1X02A 4MSPA 1B7TZ 5DKQA 3ZNIA 1ALVA 4P2YB 1W7JB 1XFVO 1QTXA 1B4CA 3PALA 1S1EA 2TN4A 2K7DA 5PALA 2BL0C 2L5XB 4I5KA 2GGZA 3ZWHA 1CFFA 2KOTA 1KSOA 2KBMA 2KI6D 2GGMA 1ZOTB 1FI5A 1RK9A 4MZKA 3DF0A 1MHOA 2KBIA 3E3RA 3I5GB 1DMOA 2ZN9A 3SG3A 2PASA 5I2OA 1K9KA 2LUXA 1MXLC 2KDHA 1PULA 1IJ6A 4DCKA 1PSRA 4L9MA 1YX7A 4GUKA 4YRUA 5AFPA 1AHRA 1SL9A 1DVIA 2B1UA 4MZJA 3BXKA 4MEWA 1WDCC 1ZMZA 3OP0A 4YI8A 1PALA 1WLMA 3VRQA 4XJKB 1C7VA 3I5FC 1RECA 5B8IB 2ZN8A 1JWDA 4R1EA 3EK7A 2JOJA 1UHNA 1VRKA 1CMGA 1L2OB 1WRKA 2M8UA 3SG4A 4MLWA 1DTLA 3NXAA 1DT7B 1KFXS 1BG1A 1Y1XA 5BPJA 3EKJA 5FYXA 4GPLB 2JXLA 1CM1A 5D7FA 2JZIA 2MBXA 3TDUA 4N5XA 2BCAA 3JTDC 5AANA 2LAPA 2F3YA 1QATA 1WRLA 1S6IA 1J7PA 2I94A 2JT3A 3HX4A 3LK1A 3TDIA 1CFDA 1S36A 1OMVA 1KFUL 4WQ3A 4ZCVA 4FQOA 1KWOC 1YRTB 1CKKA 1IQ3A 3BQ3A 2NZ0A 3BUWB 5HLOA 1B8LA 3TS5B 1GQMA 2MA2A 1IKUA 4N1GA 2BKIB 2LHLA 2KAYA 3A8RA 4OCIA 1SK6D 1SRAA 1GGZA 1C07A 1UWOA 1XYDA 1TIZA 2K2AA 1WLZA 3BUMB 3GOFA 3TZ1A 4CPVA 2LVVA 3PN7C 1E8AA 3ICBA 1LVCD 1B8RA 1DGUA 1QLKA 2PRUA 2ZNDA 3FIAA 3SG7A 1B1GA 5I2QA 4C0LA 1QVIY 1SL8A 2I18A 3WXAA 2G2BA 1NWDA 1J55A 3EK4A 3O2PA 2KYCA 3OX5A 4I5LB 1S26D 4BY5A 3OHMB 2LM5A 1DJIA 3AKBA 4GFTA 4MN0A 4PHKA 4GAOA 4BY4A 2ISDA 1QJTA 4USLA 3DVMA 1ODBA 1DJZA 1XA5A 1SCMC 1F54A 2WCFA 1QX5B 4HRGA 1CLMA 1JFKA 1TNXA 2LMUA 4MZLA 4DUQA 4OV2A 1EG3A 3DVKA 3EVRA 5AXIA 1U5IB 1BOCA 2F33A 1TNQA 1QXPA 1N0YA 4ICBA 1YVHA 5HLVA 1SL7A 2F8PA 5KU1A 1TNWA 5D69A 1XFYO 3VROA 1F55A 3M0WA 4WQ2A 1QLSA 1JC2A 2MAZA 3PLFB 4XJKA 4C0JA 1YX8A 1S6JA 2E6WA 1KK7Y 2ZNEA 3IF7A 3KHEA 1F71A 1KQMB 1H4BA 4PE1A 2JRFA 3C1VA 5IBWA 2LVIA 5DKRA 1S5GY 2WCBA 1MR8A 4U8DA 3RM1A 2NXQA 3WHUB 3AAJA 2L4IA 2RGIA 1M39A 1B47A 1JSAA 1FBVA 2PALA 2M0RA 3RLZA 1G8IA 3LL8B 1TCOB 2K7CA 2KNEA 2LVKA 1IQ5A 3PM8A 1IG5A 3CGAA 1Y1AA 4ORBB 3VRPA 4Q04A 2EC6B 2JT0A 2OTGB 2A4JA 4TNCA 3LK0A 1C7WA 5CPVA 3VRRA 2KFFA 2PSRA 1LINA 1OSAA 1CLBA 1TOPA 1GJYA 2LMVA 1Y1UA 1IJ5A 2H2KA 1RTP1 1KFXL 4CIDA 2LHIA 5G08A 1A03A 1BT6A 1K2HA 2KYFA 1SW8A 1NUBA 1M31A 1QIVA 1M45A 3D10A 5CSIA 4A4BA 4HSZA 1K96A 1TN4A 4PE7A 3D0YB 1UURA 2KI4C 1V1FA 1GGWA 2K0JA 1MF8B 1OQPA 1F4QA 1KSMA 2WC8A 3AKAA 4PE4A 5JJGA 2HQWA 1CDMA 1EXRA 1K90D 1QVIZ 2MLFC 1DJHA 1EG4A 1UHIA 1A2XA 1FW4A 2LLSA 3JVTB 4M2PA 4PALA 5J3XA 1R2UA 4I5JA 1AK8A 3IQQA 3GK1A 1XFZO 2JXCA 3BOWB 5CSJA 1U5IA 4MRXA 4PHMA 2DOQA 2COLB 1PSBA 1ZFSA 1FF1A 1EL4A 1V1GA 5TNCA 3I5IC 2JQ6A 2QPTA 3I5GC 4D1EA 1JBAA 2CNPA 1NSHA 2JWWA 1XVJA 1CDNA 3CLNA 3I5HB 5AERA 2Y1MA 1RFJA 2JNXA 2QACA 2HETA 1QX7A 3HCMA 5F6TA 3H4SE 1YUUA 1YRUB 1H8BA 2M7LA 3NSKA 3PATA 3O6BA 1TCFA 3EVVA 1BLQA 5HKYA 3CR4X 3PSRA 4M2QA 1B7TY 3NSIA 5ER5A 2LNKA 2WORA 2L0PA 1QX2A 1J1EA 1A75B 1L2OC 4C0KA 1UHHA 3FWBA 4PE0A 3OB2B 2M49B 1XK4A 1IGVA 2LV7A 2KGRA 2LP3A 3MSEB 1CTRA 2KFGA 1CMFA 1LXFC 1K8UA 2F2OA 2LLUA 3KPXA 1KK8B 2LVJA 1UUSA 1KCYA 2KQYA 1WRZA 1DF0B 1NYAA 1YURA 2LANA 1SMGA 2CCMA 2M29A 2MJWB 1BF5A 1OMRA 1CB1A 1M46A 2BE4A 1SPYA 3TS5C 4NQGA 4DRWA 4PDZA 4XYNA 1OZSA 1QV0A 3D0YA 1XO5A 2BKHB 2Y5IA 4YGDB 3BUOB 4MRYA 1SR6C 2EHBA 1UHKA 1IRJA 2H61A 2JPTA 4AQIA 1RJVA 3K21A 2M3WA 2AMIA 2OS8B 1NCZA 2WCEA 4F0ZB 4CFRA 1BJFA 3TUYB 4N1FA 2PVBA 1G4YR 2KAXA 1CM4A 2CBLA 1PRWA 3O4YA 1RWYA 1F70A 4GBAA 3F45A 2E30A 2ZRTA 2NLNA 4UPGA 1MXEA 1BR1B 3AAKA 1D1OA 2BCXA 2R2IA 1N65A 4PCWA 4YBHB 1YTZC 2KQ6A 3WNXB 5KTYA 2BL0B 1BR4B 1OOJA 1IH0A 1BMOA 1B9AA 3KEVA 2L2EA 2PMYA 5I8NA 1K94A 1KQVA 2FOTA 1Y0VH 4MVFA 1CLLA 2L4HA 4DIRA 1KQMC 2NCOA 1A75A 2FCDA 1HQVA 1UHJA 1NX1A 5DKNA 3SG6A 3SG5A 2Q4UA 1EH2A 2I2RE 2LLTA 4NDBA 1OMDA 2KI4B 4WRIA 5K89A 1J7QA 3GK2A 2KHNA 1TRFA 2M97A 1WDCB 3VRNA 1NIWA 2LUCA 2WNDA 3I5FB 1JFJA 3OB1B 4ZCUA 1Y6WA 1DF0A 3CR5X 2KFHA 1XK4C 5CSFA 2ZRSA 3SJSA 1N2DA 1CDPA 1SNLA 1NPQA 1ZUZA 2EC6C 1YVLA 2F3ZA 2OTGC 1SBJA 2K7BA 4GGFA 1LKJA 4E68A 4YGEB 3FWCA 3JTDB 1TTXA 2CTNA 1AUIB 1A29A 1QV1A 3I5IB 3CWGA 3NSLA 1DJGA 3BYAA 2D8NA 2BBMA 1LA0A 3CTNA 2FJUB 3DD4A 2EGDA 1KWOB 4HRHA 1HT9A 3SIBA 1OE9B 1SCVA 2WOSA 1SKTA 4AQJA 4I5NB 4CFQA 1ALWA 1B8CA 2K61A 4NDCA 4QJ3B 3CS1A 3VGOA 1CNPA 1SY9A 3KF9A 1AVSA 1JF0A 2OPOA 5GQQC 1YUSA 1UP5A 1DJYA 2BCBA 1SYMA 2K2FA 1BODA 1NX3A 1MWNA 3PN7B 2H61C 1MQ1A 2P6BB 4PHJA 4DS7A 1KK7Z 1QS7A 2CXJA 4AOMA 1G33A 3JVTC 1F8HA 1YUTA 5JOLA 1RROA 3LLEA 5AEQA 1S5GZ 2IS9A 2L51A 2BE6A 1IWQA 1LA3A 1AJ5A 1PVBA 1K9UA 2ZFDA 3A4UB 1XFWO 2BBNA 2JNFA 2M1UA 3PFVA 4OKHA 3DVEA 2G9BA 1TNPA 3NSOA 3QRXA 1M63B 3EKHA 3OX6A 2MLEC 1AJ4A 1J7RA 2JULA 1CFPA 4YGBB 3I5HC 1SCMB 2JT8A 1L7ZA 3BUXB 4JWQA 1FPWA 2LCPA 5KSZA 1OZOA 2M1KB 1PK0D 4ORCB 4YGCB 3O78A 4YGAA 2Q91A 1SR6B 2KGBC 2LMTA 3DF0B 5HKWA 2MRDA 5ER4X 3SIAA 2Y1NA 2JTZA 2V53A 1WY9A 2GV5A 4QJ4B 1A4PA 4M2OA 1F4OA 3TDZA 2SCPA 4FTGA 1S6CA 1K95A 1MUXA 1KFUS 1DJXA 2CT9A 1BU3A 5HYDA 4QJ5B 1NP8A 1XFUO 1NX2A 1QIWA 2ZKMX 2JTTA 1JF2A 1NCXA 2LC5A 3SG2A 4CLNA 2SASA 1J7OA 1KK8C 3BOWA 1K9PA 2KAVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2L50 A;  1FI6 A;  2LE9 B;  5CSN A;  2AAO A;  1PVA A;  1NX0 A;  2KSP A;  3BUN B;  4IL1 A;  1Q80 A;  1NCY A;  3GK4 X;  4MBE A;  1DGV A;  2LP2 A;  2O60 A;  4HRE E;  2BEC A;  4P5O E;  2K8M B;  1R6P A;  1K93 D;  4GNK B;  2K7O A;  3WHT B;  3IQO A;  3KO0 A;  2M9G A;  4GGF C;  3DVJ A;  4PHN A;  1YR5 A;  4NDD A;  5I2L A;  4ORA B;  3FS7 A;  2KI6 C;  5HKZ A;  2AUC A;  1XFX O;  2VRG A;  2F2P A;  3EVU A;  4GGN A;  1DJW A;  1QAS A;  2I7A A;  4OVN F;  2M7N A;  1CFC A;  2JC2 A;  1J1D A;  2HQ8 A;  4ETO A;  2MHH A;  4YI9 A;  2FCE A;  1CDL A;  2OS8 C;  1JUO A;  3CZT X;  2Y4Q A;  1ZAC A;  1S3P A;  4JQ0 D;  2HF5 A;  3TUY C;  4OR9 B;  2HPS A;  2JU0 A;  2NCP A;  3LCP C;  1EJ3 A;  4JPZ B;  2L98 A;  1AP4 A;  1W7I B;  3CR2 A;  3EK8 A;  4A4C A;  2O5G A;  1X02 A;  4MSP A;  1B7T Z;  5DKQ A;  3ZNI A;  1ALV A;  4P2Y B;  1W7J B;  1XFV O;  1QTX A;  1B4C A;  3PAL A;  1S1E A;  2TN4 A;  2K7D A;  5PAL A;  2BL0 C;  2L5X B;  4I5K A;  2GGZ A;  3ZWH A;  1CFF A;  2KOT A;  1KSO A;  2KBM A;  2KI6 D;  2GGM A;  1ZOT B;  1FI5 A;  1RK9 A;  4MZK A;  3DF0 A;  1MHO A;  2KBI A;  3E3R A;  3I5G B;  1DMO A;  2ZN9 A;  3SG3 A;  2PAS A;  5I2O A;  1K9K A;  2LUX A;  1MXL C;  2KDH A;  1PUL A;  1IJ6 A;  4DCK A;  1PSR A;  4L9M A;  1YX7 A;  4GUK A;  4YRU A;  5AFP A;  1AHR A;  1SL9 A;  1DVI A;  2B1U A;  4MZJ A;  3BXK A;  4MEW A;  1WDC C;  1ZMZ A;  3OP0 A;  4YI8 A;  1PAL A;  1WLM A;  3VRQ A;  4XJK B;  1C7V A;  3I5F C;  1REC A;  5B8I B;  2ZN8 A;  1JWD A;  4R1E A;  3EK7 A;  2JOJ A;  1UHN A;  1VRK A;  1CMG A;  1L2O B;  1WRK A;  2M8U A;  3SG4 A;  4MLW A;  1DTL A;  3NXA A;  1DT7 B;  1KFX S;  1BG1 A;  1Y1X A;  5BPJ A;  3EKJ A;  5FYX A;  4GPL B;  2JXL A;  1CM1 A;  5D7F A;  2JZI A;  2MBX A;  3TDU A;  4N5X A;  2BCA A;  3JTD C;  5AAN A;  2LAP A;  2F3Y A;  1QAT A;  1WRL A;  1S6I A;  1J7P A;  2I94 A;  2JT3 A;  3HX4 A;  3LK1 A;  3TDI A;  1CFD A;  1S36 A;  1OMV A;  1KFU L;  4WQ3 A;  4ZCV A;  4FQO A;  1KWO C;  1YRT B;  1CKK A;  1IQ3 A;  3BQ3 A;  2NZ0 A;  3BUW B;  5HLO A;  1B8L A;  3TS5 B;  1GQM A;  2MA2 A;  1IKU A;  4N1G A;  2BKI B;  2LHL A;  2KAY A;  3A8R A;  4OCI A;  1SK6 D;  1SRA A;  1GGZ A;  1C07 A;  1UWO A;  1XYD A;  1TIZ A;  2K2A A;  1WLZ A;  3BUM B;  3GOF A;  3TZ1 A;  4CPV A;  2LVV A;  3PN7 C;  1E8A A;  3ICB A;  1LVC D;  1B8R A;  1DGU A;  1QLK A;  2PRU A;  2ZND A;  3FIA A;  3SG7 A;  1B1G A;  5I2Q A;  4C0L A;  1QVI Y;  1SL8 A;  2I18 A;  3WXA A;  2G2B A;  1NWD A;  1J55 A;  3EK4 A;  3O2P A;  2KYC A;  3OX5 A;  4I5L B;  1S26 D;  4BY5 A;  3OHM B;  2LM5 A;  1DJI A;  3AKB A;  4GFT A;  4MN0 A;  4PHK A;  4GAO A;  4BY4 A;  2ISD A;  1QJT A;  4USL A;  3DVM A;  1ODB A;  1DJZ A;  1XA5 A;  1SCM C;  1F54 A;  2WCF A;  1QX5 B;  4HRG A;  1CLM A;  1JFK A;  1TNX A;  2LMU A;  4MZL A;  4DUQ A;  4OV2 A;  1EG3 A;  3DVK A;  3EVR A;  5AXI A;  1U5I B;  1BOC A;  2F33 A;  1TNQ A;  1QXP A;  1N0Y A;  4ICB A;  1YVH A;  5HLV A;  1SL7 A;  2F8P A;  5KU1 A;  1TNW A;  5D69 A;  1XFY O;  3VRO A;  1F55 A;  3M0W A;  4WQ2 A;  1QLS A;  1JC2 A;  2MAZ A;  3PLF B;  4XJK A;  4C0J A;  1YX8 A;  1S6J A;  2E6W A;  1KK7 Y;  2ZNE A;  3IF7 A;  3KHE A;  1F71 A;  1KQM B;  1H4B A;  4PE1 A;  2JRF A;  3C1V A;  5IBW A;  2LVI A;  5DKR A;  1S5G Y;  2WCB A;  1MR8 A;  4U8D A;  3RM1 A;  2NXQ A;  3WHU B;  3AAJ A;  2L4I A;  2RGI A;  1M39 A;  1B47 A;  1JSA A;  1FBV A;  2PAL A;  2M0R A;  3RLZ A;  1G8I A;  3LL8 B;  1TCO B;  2K7C A;  2KNE A;  2LVK A;  1IQ5 A;  3PM8 A;  1IG5 A;  3CGA A;  1Y1A A;  4ORB B;  3VRP A;  4Q04 A;  2EC6 B;  2JT0 A;  2OTG B;  2A4J A;  4TNC A;  3LK0 A;  1C7W A;  5CPV A;  3VRR A;  2KFF A;  2PSR A;  1LIN A;  1OSA A;  1CLB A;  1TOP A;  1GJY A;  2LMV A;  1Y1U A;  1IJ5 A;  2H2K A;  1RTP 1;  1KFX L;  4CID A;  2LHI A;  5G08 A;  1A03 A;  1BT6 A;  1K2H A;  2KYF A;  1SW8 A;  1NUB A;  1M31 A;  1QIV A;  1M45 A;  3D10 A;  5CSI A;  4A4B A;  4HSZ A;  1K96 A;  1TN4 A;  4PE7 A;  3D0Y B;  1UUR A;  2KI4 C;  1V1F A;  1GGW A;  2K0J A;  1MF8 B;  1OQP A;  1F4Q A;  1KSM A;  2WC8 A;  3AKA A;  4PE4 A;  5JJG A;  2HQW A;  1CDM A;  1EXR A;  1K90 D;  1QVI Z;  2MLF C;  1DJH A;  1EG4 A;  1UHI A;  1A2X A;  1FW4 A;  2LLS A;  3JVT B;  4M2P A;  4PAL A;  5J3X A;  1R2U A;  4I5J A;  1AK8 A;  3IQQ A;  3GK1 A;  1XFZ O;  2JXC A;  3BOW B;  5CSJ A;  1U5I A;  4MRX A;  4PHM A;  2DOQ A;  2COL B;  1PSB A;  1ZFS A;  1FF1 A;  1EL4 A;  1V1G A;  5TNC A;  3I5I C;  2JQ6 A;  2QPT A;  3I5G C;  4D1E A;  1JBA A;  2CNP A;  1NSH A;  2JWW A;  1XVJ A;  1CDN A;  3CLN A;  3I5H B;  5AER A;  2Y1M A;  1RFJ A;  2JNX A;  2QAC A;  2HET A;  1QX7 A;  3HCM A;  5F6T A;  3H4S E;  1YUU A;  1YRU B;  1H8B A;  2M7L A;  3NSK A;  3PAT A;  3O6B A;  1TCF A;  3EVV A;  1BLQ A;  5HKY A;  3CR4 X;  3PSR A;  4M2Q A;  1B7T Y;  3NSI A;  5ER5 A;  2LNK A;  2WOR A;  2L0P A;  1QX2 A;  1J1E A;  1A75 B;  1L2O C;  4C0K A;  1UHH A;  3FWB A;  4PE0 A;  3OB2 B;  2M49 B;  1XK4 A;  1IGV A;  2LV7 A;  2KGR A;  2LP3 A;  3MSE B;  1CTR A;  2KFG A;  1CMF A;  1LXF C;  1K8U A;  2F2O A;  2LLU A;  3KPX A;  1KK8 B;  2LVJ A;  1UUS A;  1KCY A;  2KQY A;  1WRZ A;  1DF0 B;  1NYA A;  1YUR A;  2LAN A;  1SMG A;  2CCM A;  2M29 A;  2MJW B;  1BF5 A;  1OMR A;  1CB1 A;  1M46 A;  2BE4 A;  1SPY A;  3TS5 C;  4NQG A;  4DRW A;  4PDZ A;  4XYN A;  1OZS A;  1QV0 A;  3D0Y A;  1XO5 A;  2BKH B;  2Y5I A;  4YGD B;  3BUO B;  4MRY A;  1SR6 C;  2EHB A;  1UHK A;  1IRJ A;  2H61 A;  2JPT A;  4AQI A;  1RJV A;  3K21 A;  2M3W A;  2AMI A;  2OS8 B;  1NCZ A;  2WCE A;  4F0Z B;  4CFR A;  1BJF A;  3TUY B;  4N1F A;  2PVB A;  1G4Y R;  2KAX A;  1CM4 A;  2CBL A;  1PRW A;  3O4Y A;  1RWY A;  1F70 A;  4GBA A;  3F45 A;  2E30 A;  2ZRT A;  2NLN A;  4UPG A;  1MXE A;  1BR1 B;  3AAK A;  1D1O A;  2BCX A;  2R2I A;  1N65 A;  4PCW A;  4YBH B;  1YTZ C;  2KQ6 A;  3WNX B;  5KTY A;  2BL0 B;  1BR4 B;  1OOJ A;  1IH0 A;  1BMO A;  1B9A A;  3KEV A;  2L2E A;  2PMY A;  5I8N A;  1K94 A;  1KQV A;  2FOT A;  1Y0V H;  4MVF A;  1CLL A;  2L4H A;  4DIR A;  1KQM C;  2NCO A;  1A75 A;  2FCD A;  1HQV A;  1UHJ A;  1NX1 A;  5DKN A;  3SG6 A;  3SG5 A;  2Q4U A;  1EH2 A;  2I2R E;  2LLT A;  4NDB A;  1OMD A;  2KI4 B;  4WRI A;  5K89 A;  1J7Q A;  3GK2 A;  2KHN A;  1TRF A;  2M97 A;  1WDC B;  3VRN A;  1NIW A;  2LUC A;  2WND A;  3I5F B;  1JFJ A;  3OB1 B;  4ZCU A;  1Y6W A;  1DF0 A;  3CR5 X;  2KFH A;  1XK4 C;  5CSF A;  2ZRS A;  3SJS A;  1N2D A;  1CDP A;  1SNL A;  1NPQ A;  1ZUZ A;  2EC6 C;  1YVL A;  2F3Z A;  2OTG C;  1SBJ A;  2K7B A;  4GGF A;  1LKJ A;  4E68 A;  4YGE B;  3FWC A;  3JTD B;  1TTX A;  2CTN A;  1AUI B;  1A29 A;  1QV1 A;  3I5I B;  3CWG A;  3NSL A;  1DJG A;  3BYA A;  2D8N A;  2BBM A;  1LA0 A;  3CTN A;  2FJU B;  3DD4 A;  2EGD A;  1KWO B;  4HRH A;  1HT9 A;  3SIB A;  1OE9 B;  1SCV A;  2WOS A;  1SKT A;  4AQJ A;  4I5N B;  4CFQ A;  1ALW A;  1B8C A;  2K61 A;  4NDC A;  4QJ3 B;  3CS1 A;  3VGO A;  1CNP A;  1SY9 A;  3KF9 A;  1AVS A;  1JF0 A;  2OPO A;  5GQQ C;  1YUS A;  1UP5 A;  1DJY A;  2BCB A;  1SYM A;  2K2F A;  1BOD A;  1NX3 A;  1MWN A;  3PN7 B;  2H61 C;  1MQ1 A;  2P6B B;  4PHJ A;  4DS7 A;  1KK7 Z;  1QS7 A;  2CXJ A;  4AOM A;  1G33 A;  3JVT C;  1F8H A;  1YUT A;  5JOL A;  1RRO A;  3LLE A;  5AEQ A;  1S5G Z;  2IS9 A;  2L51 A;  2BE6 A;  1IWQ A;  1LA3 A;  1AJ5 A;  1PVB A;  1K9U A;  2ZFD A;  3A4U B;  1XFW O;  2BBN A;  2JNF A;  2M1U A;  3PFV A;  4OKH A;  3DVE A;  2G9B A;  1TNP A;  3NSO A;  3QRX A;  1M63 B;  3EKH A;  3OX6 A;  2MLE C;  1AJ4 A;  1J7R A;  2JUL A;  1CFP A;  4YGB B;  3I5H C;  1SCM B;  2JT8 A;  1L7Z A;  3BUX B;  4JWQ A;  1FPW A;  2LCP A;  5KSZ A;  1OZO A;  2M1K B;  1PK0 D;  4ORC B;  4YGC B;  3O78 A;  4YGA A;  2Q91 A;  1SR6 B;  2KGB C;  2LMT A;  3DF0 B;  5HKW A;  2MRD A;  5ER4 X;  3SIA A;  2Y1N A;  2JTZ A;  2V53 A;  1WY9 A;  2GV5 A;  4QJ4 B;  1A4P A;  4M2O A;  1F4O A;  3TDZ A;  2SCP A;  4FTG A;  1S6C A;  1K95 A;  1MUX A;  1KFU S;  1DJX A;  2CT9 A;  1BU3 A;  5HYD A;  4QJ5 B;  1NP8 A;  1XFU O;  1NX2 A;  1QIW A;  2ZKM X;  2JTT A;  1JF2 A;  1NCX A;  2LC5 A;  3SG2 A;  4CLN A;  2SAS A;  1J7O A;  1KK8 C;  3BOW A;  1K9P A;  2KAV A; 
#chains in the Genus database with same CATH topology
 2L50 A;  1FI6 A;  2LE9 B;  5CSN A;  1TUJ A;  2AAO A;  1PVA A;  1C3Y A;  1NX0 A;  2KSP A;  3BUN B;  4FQT A;  4IL1 A;  1Q80 A;  1NCY A;  3GK4 X;  4MBE A;  1DGV A;  2LP2 A;  2O60 A;  4HRE E;  2BEC A;  5EL2 A;  4P5O E;  2K8M B;  3D75 A;  1R6P A;  1K93 D;  4GNK B;  2K7O A;  2P71 A;  3WHT B;  3IQO A;  3S0A A;  3KO0 A;  2M9G A;  4GGF C;  3DVJ A;  4PHN A;  1YR5 A;  4NDD A;  5I2L A;  3SS4 A;  4ORA B;  3FS7 A;  2KI6 C;  1DEL A;  5HKZ A;  2K60 A;  1IIO A;  2AUC A;  1XFX O;  2VRG A;  2F2P A;  3R1P A;  3EVU A;  4GGN A;  1DJW A;  1QAS A;  2I7A A;  4OVN F;  2M7N A;  1CFC A;  2JC2 A;  2KLE A;  1J1D A;  2HQ8 A;  4ETO A;  2MHH A;  4YI9 A;  2FCE A;  1CDL A;  2OS8 C;  1JUO A;  3CZT X;  2Y4Q A;  1ZAC A;  2L5Y A;  1S3P A;  3DXL A;  4JQ0 D;  2HF5 A;  3TUY C;  4OR9 B;  2HPS A;  3D77 A;  2JU0 A;  2NCP A;  3LCP C;  1EJ3 A;  3CZ1 A;  4JPZ B;  2L98 A;  1AP4 A;  1W7I B;  3CR2 A;  3EK8 A;  3S0D A;  3CDN A;  4A4C A;  2O5G A;  1TUZ A;  1X02 A;  4MSP A;  1B7T Z;  5DKQ A;  3ZNI A;  1ALV A;  4P2Y B;  1W7J B;  1XFV O;  1QTX A;  1B4C A;  3PAL A;  1S1E A;  2TN4 A;  2K7D A;  5PAL A;  2BL0 C;  2PYQ A;  2L5X B;  4I5K A;  2GGZ A;  3BJH A;  3ZWH A;  1CFF A;  2KOT A;  3CYZ A;  1KSO A;  2KBM A;  1P28 A;  2KI6 D;  2GGM A;  1ZOT B;  1FI5 A;  1T14 A;  1RK9 A;  4MZK A;  3DF0 A;  1MHO A;  2KBI A;  3DY9 A;  2GTE A;  3E3R A;  3I5G B;  1DMO A;  2ZN9 A;  1OOH A;  3SG3 A;  2PAS A;  5I2O A;  1K9K A;  2LUX A;  1MXL C;  2KDH A;  2WC6 A;  1PUL A;  1IJ6 A;  4DCK A;  1PSR A;  2QEB A;  1YX7 A;  4L9M A;  4GUK A;  4YRU A;  5AFP A;  1AHR A;  1SL9 A;  1DVI A;  2B1U A;  4MZJ A;  3UO9 A;  3BXK A;  4MEW A;  1WDC C;  1ZMZ A;  3OP0 A;  4YI8 A;  1PAL A;  1WLM A;  3VRQ A;  4XJK B;  1C7V A;  1GM0 A;  3I5F C;  1REC A;  5B8I B;  2ZN8 A;  1JWD A;  4R1E A;  3EK7 A;  2JOJ A;  1UHN A;  1VRK A;  1CMG A;  1L2O B;  1WRK A;  2M8U A;  3SG4 A;  1OOI X;  1DTL A;  3NXA A;  4MLW A;  1KFX S;  1DT7 B;  1BG1 A;  1Y1X A;  5BPJ A;  3EKJ A;  5FYX A;  4GPL B;  2JXL A;  1CM1 A;  5D7F A;  2JZI A;  2MBX A;  3TDU A;  4N5X A;  2BCA A;  1LS8 A;  3JTD C;  5AAN A;  2LAP A;  1DQE A;  2YGU A;  3R1V A;  2F3Y A;  1QAT A;  1WRL A;  1S6I A;  3D76 A;  1J7P A;  2I94 A;  2JT3 A;  3HX4 A;  3LK1 A;  3TDI A;  3EG5 B;  1CFD A;  1S36 A;  1OMV A;  1KFU L;  4WQ3 A;  4ZCV A;  4FQO A;  3VB1 A;  1KWO C;  1YRT B;  1CKK A;  1IQ3 A;  3BQ3 A;  2NZ0 A;  3BUW B;  5HLO A;  1B8L A;  3TS5 B;  1GQM A;  2MA2 A;  1IKU A;  4N1G A;  2BKI B;  2LHL A;  2KAY A;  3A8R A;  4OCI A;  1SK6 D;  3R72 A;  1DC1 A;  1SRA A;  1GGZ A;  1C07 A;  1UWO A;  1XYD A;  1TIZ A;  2K2A A;  1ORG A;  2WCJ A;  1WLZ A;  3BUM B;  3GOF A;  3TZ1 A;  1C3Z A;  4CPV A;  2LVV A;  3PN7 C;  1E8A A;  3ICB A;  1LVC D;  1B8R A;  1DGU A;  1QLK A;  2PRU A;  2ZND A;  3FIA A;  3SG7 A;  3SS3 A;  5I2Q A;  4C0L A;  1B1G A;  1QVI Y;  1SL8 A;  2I18 A;  2H8V A;  3WXA A;  2G2B A;  1NWD A;  5I94 A;  3SS5 A;  2P70 A;  1J55 A;  3EK4 A;  2PQL A;  3O2P A;  2KYC A;  3OX5 A;  4I5L B;  1S26 D;  4BY5 A;  3OHM B;  2LM5 A;  1DJI A;  3AKB A;  4GFT A;  4MN0 A;  4PHK A;  4IJ7 A;  4GAO A;  4BY4 A;  2ISD A;  1QJT A;  4USL A;  2WCL A;  3DVM A;  1ODB A;  1DJZ A;  1XA5 A;  1SCM C;  1F54 A;  2WCF A;  1QX5 B;  4HRG A;  1CLM A;  1JFK A;  1TNX A;  2LMU A;  4MZL A;  4DUQ A;  4OV2 A;  1EG3 A;  3DVK A;  3EVR A;  3O4X A;  5AXI A;  1U5I B;  3S0G A;  1BOC A;  2F33 A;  1TNQ A;  3S0E A;  1QXP A;  1N0Y A;  3N7H A;  1SSE B;  4ICB A;  1YVH A;  5HLV A;  1SL7 A;  2F8P A;  5KU1 A;  1TNW A;  5D69 A;  1XFY O;  3VRO A;  1F55 A;  3M0W A;  4WQ2 A;  1QLS A;  1JC2 A;  2MAZ A;  3RZS A;  3PLF B;  4XJK A;  4C0J A;  1YX8 A;  1S6J A;  2E6W A;  1KK7 Y;  2ZNE A;  3IF7 A;  3KHE A;  1F71 A;  1KQM B;  1H4B A;  4PE1 A;  2JRF A;  3C1V A;  5IBW A;  2LVI A;  5DKR A;  1S5G Y;  2WCB A;  1MR8 A;  4OZD A;  4U8D A;  2NXQ A;  3RM1 A;  3WHU B;  3AAJ A;  2L4I A;  2RGI A;  1M39 A;  1B47 A;  1JSA A;  1FBV A;  2PAL A;  2M0R A;  3RLZ A;  1G8I A;  1OOF A;  3LL8 B;  1TCO B;  2K7C A;  2KNE A;  2LVK A;  1IQ5 A;  3PM8 A;  1IG5 A;  3CGA A;  1Y1A A;  4ORB B;  3VRP A;  4Q04 A;  2EC6 B;  2JT0 A;  2OTG B;  2A4J A;  2WC5 A;  4TNC A;  5FI2 A;  3LK0 A;  1C7W A;  5CPV A;  3VRR A;  2KFF A;  2PSR A;  1LIN A;  1OSA A;  1CLB A;  1TOP A;  1GJY A;  2LMV A;  1Y1U A;  1IJ5 A;  2H2K A;  1RTP 1;  1Z2C B;  1KFX L;  4CID A;  2LHI A;  5G08 A;  3B86 A;  1A03 A;  1BT6 A;  3R1O A;  2KYF A;  1K2H A;  1SW8 A;  1NUB A;  1M31 A;  3S0F A;  1QIV A;  1M45 A;  3D10 A;  4INX A;  5CSI A;  2KLD A;  4A4B A;  4HSZ A;  1K96 A;  1TN4 A;  3B88 A;  4PE7 A;  3D0Y B;  1UUR A;  2KI4 C;  1V1F A;  1GGW A;  2K0J A;  1MF8 B;  1OQP A;  1F4Q A;  1KSM A;  2WC8 A;  3AKA A;  4PE4 A;  3L47 A;  5JJG A;  3NHI A;  2HQW A;  1CDM A;  1EXR A;  1K90 D;  1QVI Z;  2QDI A;  2MLF C;  1DJH A;  3BFH A;  1EG4 A;  1UHI A;  1A2X A;  1FW4 A;  2LLS A;  3DYE A;  3JVT B;  4M2P A;  4PAL A;  5J3X A;  1R2U A;  4I5J A;  1AK8 A;  3IQQ A;  3GK1 A;  3BFB A;  1XFZ O;  2JXC A;  3BOW B;  5CSJ A;  1U5I A;  4MRX A;  4PHM A;  2DOQ A;  2COL B;  1PSB A;  1ZFS A;  3B6X A;  1FF1 A;  1EL4 A;  3OBV A;  1V1G A;  5TNC A;  3I5I C;  2JQ6 A;  2QPT A;  3I5G C;  4D1E A;  1JBA A;  2CNP A;  1NSH A;  2JWW A;  1XVJ A;  1CDN A;  3CLN A;  3I5H B;  5AER A;  2QEV A;  2Y1M A;  1RFJ A;  2JNX A;  2QAC A;  2HET A;  1QX7 A;  3HCM A;  5F6T A;  3H4S E;  1YUU A;  1YRU B;  1H8B A;  2M7L A;  2FJY A;  3NSK A;  1OOG A;  3PAT A;  3O6B A;  1TCF A;  2WCK A;  3EVV A;  1BLQ A;  5HKY A;  3CR4 X;  3PSR A;  4INW A;  4M2Q A;  1B7T Y;  3NSI A;  5ER5 A;  2LNK A;  2WOR A;  2L0P A;  1QX2 A;  1J1E A;  1A75 B;  1L2O C;  4C0K A;  1UHH A;  3FWB A;  4PE0 A;  3OB2 B;  2M49 B;  1XK4 A;  1IGV A;  2LV7 A;  2KGR A;  2LP3 A;  3MSE B;  1CTR A;  2KFG A;  1CMF A;  1LXF C;  1K8U A;  2F2O A;  2LLU A;  3KPX A;  1KK8 B;  2LVJ A;  1UUS A;  1KCY A;  2KQY A;  1WRZ A;  1DF0 B;  1NYA A;  1YUR A;  2LAN A;  1SMG A;  2BNX A;  2CCM A;  2M29 A;  2MJW B;  1BF5 A;  1OMR A;  1CB1 A;  1M46 A;  2BE4 A;  1SPY A;  3TS5 C;  4NQG A;  4DRW A;  4PDZ A;  4XYN A;  1OZS A;  1QV0 A;  3QME A;  3D0Y A;  3CZ0 A;  1XO5 A;  3OGN A;  2KPH A;  2BKH B;  3NGV A;  2Y5I A;  5HL1 A;  5FI6 A;  4YGD B;  3BUO B;  4MRY A;  1SR6 C;  2EHB A;  1UHK A;  1IRJ A;  3DZT A;  2H61 A;  2JPT A;  4AQI A;  1RJV A;  3K21 A;  5FI7 A;  2M3W A;  2AMI A;  2OS8 B;  1NCZ A;  2WCE A;  4F0Z B;  4CFR A;  1BJF A;  3TUY B;  4N1F A;  2PVB A;  1G4Y R;  2KAX A;  3B7A A;  1CM4 A;  2CBL A;  1PRW A;  3O4Y A;  1RWY A;  1F70 A;  1XFR A;  3F45 A;  4GBA A;  2E30 A;  2ZRT A;  2NLN A;  4UPG A;  3V2L A;  1MXE A;  1BR1 B;  3AAK A;  1D1O A;  2BCX A;  2JPO A;  2R2I A;  1N65 A;  4PCW A;  4YBH B;  1YTZ C;  2KQ6 A;  1DEK A;  3WNX B;  5KTY A;  2BL0 B;  1BR4 B;  1OOJ A;  1IH0 A;  1BMO A;  1B9A A;  3KEV A;  2L2E A;  2L2C A;  2PMY A;  5I8N A;  1K94 A;  3Q8I A;  2FOT A;  1Y0V H;  4MVF A;  1KQV A;  3L4A A;  1CLL A;  2L4H A;  3D73 A;  4DIR A;  1KQM C;  1TWO A;  2NCO A;  1A75 A;  2FCD A;  1HQV A;  1UHJ A;  1NX1 A;  5DKN A;  3SG6 A;  3SG5 A;  2Q4U A;  1EH2 A;  2I2R E;  3S0B A;  3FE8 A;  2LLT A;  4NDB A;  1OMD A;  2KI4 B;  4WRI A;  5K89 A;  1J7Q A;  3GK2 A;  2KHN A;  1TRF A;  3K1E A;  2M97 A;  1WDC B;  3VRN A;  1NIW A;  3D78 A;  2LUC A;  2WND A;  3CZ2 A;  3I5F B;  1JFJ A;  3OB1 B;  4ZCU A;  1Y6W A;  2WCH A;  1DF0 A;  3CR5 X;  2KFH A;  1XK4 C;  5CSF A;  5D3O A;  2ZRS A;  3SJS A;  1N2D A;  1CDP A;  1SNL A;  1NPQ A;  3B87 A;  1ZUZ A;  2EC6 C;  1YVL A;  2F3Z A;  2OTG C;  4F7F A;  1SBJ A;  2K7B A;  4GGF A;  1LKJ A;  3L4L A;  4YGE B;  3FWC A;  3JTD B;  4E68 A;  1TTX A;  2CTN A;  1Z4H A;  1AUI B;  1A29 A;  1QV1 A;  3I5I B;  1OW4 A;  2BAP A;  3CWG A;  3NSL A;  1DJG A;  3BYA A;  2D8N A;  2BBM A;  1LA0 A;  3CTN A;  2FJU B;  3DD4 A;  2EGD A;  1KWO B;  4HRH A;  1HT9 A;  3SIB A;  1OE9 B;  1SCV A;  2WOS A;  1SKT A;  4AQJ A;  4I5N B;  4CFQ A;  1ALW A;  1B8C A;  2K61 A;  4NDC A;  2QEO A;  4QJ3 B;  3CS1 A;  3VGO A;  1CNP A;  1SY9 A;  3KF9 A;  3UNW A;  1AVS A;  1JF0 A;  2OPO A;  5GQQ C;  1YUS A;  3PJI A;  1UP5 A;  1DJY A;  2BCB A;  1SYM A;  2K2F A;  1BOD A;  1NX3 A;  1MWN A;  3PN7 B;  2H61 C;  1MQ1 A;  2P6B B;  4PHJ A;  4PT1 A;  1KK7 Z;  4DS7 A;  1QS7 A;  2CXJ A;  4AOM A;  1G33 A;  3JVT C;  1F8H A;  1YUT A;  1QWV A;  5JOL A;  1RRO A;  3LLE A;  5AEQ A;  1S5G Z;  2IS9 A;  2L51 A;  2BE6 A;  1IWQ A;  1LA3 A;  3FE9 A;  1AJ5 A;  1PVB A;  5DIC A;  4JD9 A;  1K9U A;  2ZFD A;  3A4U B;  2QEH A;  1XFW O;  3FE6 A;  2BBN A;  2JNF A;  2M1U A;  3PFV A;  4OKH A;  3DVE A;  2G9B A;  1TNP A;  3NSO A;  3QRX A;  1M63 B;  3EKH A;  3OX6 A;  2MLE C;  1AJ4 A;  1J7R A;  2JUL A;  3CAB A;  1CFP A;  3NHT A;  4YGB B;  3I5H C;  1SCM B;  2JT8 A;  1L7Z A;  2WCM A;  3BUX B;  4JWQ A;  1FPW A;  2LCP A;  5KSZ A;  1OZO A;  2M1K B;  1PK0 D;  2ERB A;  4ORC B;  4YGC B;  3O78 A;  3BFA A;  4YGA A;  2Q91 A;  1SR6 B;  1W9Z A;  2KGB C;  2LMT A;  3DF0 B;  2MRD A;  5ER4 X;  5HKW A;  3SIA A;  4KYN A;  3IVT A;  2Y1N A;  2JTZ A;  3PM2 A;  2V53 A;  1WY9 A;  2GV5 A;  4QJ4 B;  1A4P A;  4M2O A;  1F4O A;  3TDZ A;  2SCP A;  4JKT A;  4FTG A;  1S6C A;  3D74 A;  1K95 A;  1MUX A;  1KFU S;  1DJX A;  2CT9 A;  1BU3 A;  5HYD A;  4QJ5 B;  1NP8 A;  1XFU O;  1NX2 A;  1QIW A;  2ZKM X;  2JTT A;  1JF2 A;  1NCX A;  2LC5 A;  3SG2 A;  4CLN A;  2SAS A;  1J7O A;  1KK8 C;  3BOW A;  1K9P A;  2KAV A; 
#chains in the Genus database with same CATH homology
 2L50 A;  1FI6 A;  2LE9 B;  5CSN A;  2AAO A;  1PVA A;  1NX0 A;  2KSP A;  3BUN B;  4IL1 A;  1Q80 A;  1NCY A;  3GK4 X;  4MBE A;  1DGV A;  2LP2 A;  2O60 A;  4HRE E;  2BEC A;  4P5O E;  2K8M B;  1R6P A;  1K93 D;  4GNK B;  2K7O A;  3WHT B;  3IQO A;  3KO0 A;  2M9G A;  4GGF C;  3DVJ A;  4PHN A;  1YR5 A;  4NDD A;  5I2L A;  4ORA B;  3FS7 A;  2KI6 C;  5HKZ A;  2AUC A;  1XFX O;  2VRG A;  2F2P A;  3EVU A;  4GGN A;  1DJW A;  1QAS A;  2I7A A;  4OVN F;  2M7N A;  1CFC A;  2JC2 A;  1J1D A;  2HQ8 A;  4ETO A;  2MHH A;  4YI9 A;  2FCE A;  1CDL A;  2OS8 C;  1JUO A;  3CZT X;  2Y4Q A;  1ZAC A;  1S3P A;  4JQ0 D;  2HF5 A;  3TUY C;  4OR9 B;  2HPS A;  2JU0 A;  2NCP A;  3LCP C;  1EJ3 A;  4JPZ B;  2L98 A;  1AP4 A;  1W7I B;  3CR2 A;  3EK8 A;  4A4C A;  2O5G A;  1X02 A;  4MSP A;  1B7T Z;  5DKQ A;  3ZNI A;  1ALV A;  4P2Y B;  1W7J B;  1XFV O;  1QTX A;  1B4C A;  3PAL A;  1S1E A;  2TN4 A;  2K7D A;  5PAL A;  2BL0 C;  2L5X B;  4I5K A;  2GGZ A;  3ZWH A;  1CFF A;  2KOT A;  1KSO A;  2KBM A;  2KI6 D;  2GGM A;  1ZOT B;  1FI5 A;  1RK9 A;  4MZK A;  3DF0 A;  1MHO A;  2KBI A;  3E3R A;  3I5G B;  1DMO A;  2ZN9 A;  3SG3 A;  2PAS A;  5I2O A;  1K9K A;  2LUX A;  1MXL C;  2KDH A;  1PUL A;  1IJ6 A;  4DCK A;  1PSR A;  4L9M A;  1YX7 A;  4GUK A;  4YRU A;  5AFP A;  1AHR A;  1SL9 A;  1DVI A;  2B1U A;  4MZJ A;  3BXK A;  4MEW A;  1WDC C;  1ZMZ A;  3OP0 A;  4YI8 A;  1PAL A;  1WLM A;  3VRQ A;  4XJK B;  1C7V A;  3I5F C;  1REC A;  5B8I B;  2ZN8 A;  1JWD A;  4R1E A;  3EK7 A;  2JOJ A;  1UHN A;  1VRK A;  1CMG A;  1L2O B;  1WRK A;  2M8U A;  3SG4 A;  4MLW A;  1DTL A;  3NXA A;  1DT7 B;  1KFX S;  1BG1 A;  1Y1X A;  5BPJ A;  3EKJ A;  5FYX A;  4GPL B;  2JXL A;  1CM1 A;  5D7F A;  2JZI A;  2MBX A;  3TDU A;  4N5X A;  2BCA A;  3JTD C;  5AAN A;  2LAP A;  2F3Y A;  1QAT A;  1WRL A;  1S6I A;  1J7P A;  2I94 A;  2JT3 A;  3HX4 A;  3LK1 A;  3TDI A;  1CFD A;  1S36 A;  1OMV A;  1KFU L;  4WQ3 A;  4ZCV A;  4FQO A;  1KWO C;  1YRT B;  1CKK A;  1IQ3 A;  3BQ3 A;  2NZ0 A;  3BUW B;  5HLO A;  1B8L A;  3TS5 B;  1GQM A;  2MA2 A;  1IKU A;  4N1G A;  2BKI B;  2LHL A;  2KAY A;  3A8R A;  4OCI A;  1SK6 D;  1SRA A;  1GGZ A;  1C07 A;  1UWO A;  1XYD A;  1TIZ A;  2K2A A;  1WLZ A;  3BUM B;  3GOF A;  3TZ1 A;  4CPV A;  2LVV A;  3PN7 C;  1E8A A;  3ICB A;  1LVC D;  1B8R A;  1DGU A;  1QLK A;  2PRU A;  2ZND A;  3FIA A;  3SG7 A;  1B1G A;  5I2Q A;  4C0L A;  1QVI Y;  1SL8 A;  2I18 A;  3WXA A;  2G2B A;  1NWD A;  1J55 A;  3EK4 A;  3O2P A;  2KYC A;  3OX5 A;  4I5L B;  1S26 D;  4BY5 A;  3OHM B;  2LM5 A;  1DJI A;  3AKB A;  4GFT A;  4MN0 A;  4PHK A;  4GAO A;  4BY4 A;  2ISD A;  1QJT A;  4USL A;  3DVM A;  1ODB A;  1DJZ A;  1XA5 A;  1SCM C;  1F54 A;  2WCF A;  1QX5 B;  4HRG A;  1CLM A;  1JFK A;  1TNX A;  2LMU A;  4MZL A;  4DUQ A;  4OV2 A;  1EG3 A;  3DVK A;  3EVR A;  5AXI A;  1U5I B;  1BOC A;  2F33 A;  1TNQ A;  1QXP A;  1N0Y A;  4ICB A;  1YVH A;  5HLV A;  1SL7 A;  2F8P A;  5KU1 A;  1TNW A;  5D69 A;  1XFY O;  3VRO A;  1F55 A;  3M0W A;  4WQ2 A;  1QLS A;  1JC2 A;  2MAZ A;  3PLF B;  4XJK A;  4C0J A;  1YX8 A;  1S6J A;  2E6W A;  1KK7 Y;  2ZNE A;  3IF7 A;  3KHE A;  1F71 A;  1KQM B;  1H4B A;  4PE1 A;  2JRF A;  3C1V A;  5IBW A;  2LVI A;  5DKR A;  1S5G Y;  2WCB A;  1MR8 A;  4U8D A;  3RM1 A;  2NXQ A;  3WHU B;  3AAJ A;  2L4I A;  2RGI A;  1M39 A;  1B47 A;  1JSA A;  1FBV A;  2PAL A;  2M0R A;  3RLZ A;  1G8I A;  3LL8 B;  1TCO B;  2K7C A;  2KNE A;  2LVK A;  1IQ5 A;  3PM8 A;  1IG5 A;  3CGA A;  1Y1A A;  4ORB B;  3VRP A;  4Q04 A;  2EC6 B;  2JT0 A;  2OTG B;  2A4J A;  4TNC A;  3LK0 A;  1C7W A;  5CPV A;  3VRR A;  2KFF A;  2PSR A;  1LIN A;  1OSA A;  1CLB A;  1TOP A;  1GJY A;  2LMV A;  1Y1U A;  1IJ5 A;  2H2K A;  1RTP 1;  1KFX L;  4CID A;  2LHI A;  5G08 A;  1A03 A;  1BT6 A;  1K2H A;  2KYF A;  1SW8 A;  1NUB A;  1M31 A;  1QIV A;  1M45 A;  3D10 A;  5CSI A;  4A4B A;  4HSZ A;  1K96 A;  1TN4 A;  4PE7 A;  3D0Y B;  1UUR A;  2KI4 C;  1V1F A;  1GGW A;  2K0J A;  1MF8 B;  1OQP A;  1F4Q A;  1KSM A;  2WC8 A;  3AKA A;  4PE4 A;  5JJG A;  2HQW A;  1CDM A;  1EXR A;  1K90 D;  1QVI Z;  2MLF C;  1DJH A;  1EG4 A;  1UHI A;  1A2X A;  1FW4 A;  2LLS A;  3JVT B;  4M2P A;  4PAL A;  5J3X A;  1R2U A;  4I5J A;  1AK8 A;  3IQQ A;  3GK1 A;  1XFZ O;  2JXC A;  3BOW B;  5CSJ A;  1U5I A;  4MRX A;  4PHM A;  2DOQ A;  2COL B;  1PSB A;  1ZFS A;  1FF1 A;  1EL4 A;  1V1G A;  5TNC A;  3I5I C;  2JQ6 A;  2QPT A;  3I5G C;  4D1E A;  1JBA A;  2CNP A;  1NSH A;  2JWW A;  1XVJ A;  1CDN A;  3CLN A;  3I5H B;  5AER A;  2Y1M A;  1RFJ A;  2JNX A;  2QAC A;  2HET A;  1QX7 A;  3HCM A;  5F6T A;  3H4S E;  1YUU A;  1YRU B;  1H8B A;  2M7L A;  3NSK A;  3PAT A;  3O6B A;  1TCF A;  3EVV A;  1BLQ A;  5HKY A;  3CR4 X;  3PSR A;  4M2Q A;  1B7T Y;  3NSI A;  5ER5 A;  2LNK A;  2WOR A;  2L0P A;  1QX2 A;  1J1E A;  1A75 B;  1L2O C;  4C0K A;  1UHH A;  3FWB A;  4PE0 A;  3OB2 B;  2M49 B;  1XK4 A;  1IGV A;  2LV7 A;  2KGR A;  2LP3 A;  3MSE B;  1CTR A;  2KFG A;  1CMF A;  1LXF C;  1K8U A;  2F2O A;  2LLU A;  3KPX A;  1KK8 B;  2LVJ A;  1UUS A;  1KCY A;  2KQY A;  1WRZ A;  1DF0 B;  1NYA A;  1YUR A;  2LAN A;  1SMG A;  2CCM A;  2M29 A;  2MJW B;  1BF5 A;  1OMR A;  1CB1 A;  1M46 A;  2BE4 A;  1SPY A;  3TS5 C;  4NQG A;  4DRW A;  4PDZ A;  4XYN A;  1OZS A;  1QV0 A;  3D0Y A;  1XO5 A;  2BKH B;  2Y5I A;  4YGD B;  3BUO B;  4MRY A;  1SR6 C;  2EHB A;  1UHK A;  1IRJ A;  2H61 A;  2JPT A;  4AQI A;  1RJV A;  3K21 A;  2M3W A;  2AMI A;  2OS8 B;  1NCZ A;  2WCE A;  4F0Z B;  4CFR A;  1BJF A;  3TUY B;  4N1F A;  2PVB A;  1G4Y R;  2KAX A;  1CM4 A;  2CBL A;  1PRW A;  3O4Y A;  1RWY A;  1F70 A;  4GBA A;  3F45 A;  2E30 A;  2ZRT A;  2NLN A;  4UPG A;  1MXE A;  1BR1 B;  3AAK A;  1D1O A;  2BCX A;  2R2I A;  1N65 A;  4PCW A;  4YBH B;  1YTZ C;  2KQ6 A;  3WNX B;  5KTY A;  2BL0 B;  1BR4 B;  1OOJ A;  1IH0 A;  1BMO A;  1B9A A;  3KEV A;  2L2E A;  2PMY A;  5I8N A;  1K94 A;  1KQV A;  2FOT A;  1Y0V H;  4MVF A;  1CLL A;  2L4H A;  4DIR A;  1KQM C;  2NCO A;  1A75 A;  2FCD A;  1HQV A;  1UHJ A;  1NX1 A;  5DKN A;  3SG6 A;  3SG5 A;  2Q4U A;  1EH2 A;  2I2R E;  2LLT A;  4NDB A;  1OMD A;  2KI4 B;  4WRI A;  5K89 A;  1J7Q A;  3GK2 A;  2KHN A;  1TRF A;  2M97 A;  1WDC B;  3VRN A;  1NIW A;  2LUC A;  2WND A;  3I5F B;  1JFJ A;  3OB1 B;  4ZCU A;  1Y6W A;  1DF0 A;  3CR5 X;  2KFH A;  1XK4 C;  5CSF A;  2ZRS A;  3SJS A;  1N2D A;  1CDP A;  1SNL A;  1NPQ A;  1ZUZ A;  2EC6 C;  1YVL A;  2F3Z A;  2OTG C;  1SBJ A;  2K7B A;  4GGF A;  1LKJ A;  4E68 A;  4YGE B;  3FWC A;  3JTD B;  1TTX A;  2CTN A;  1AUI B;  1A29 A;  1QV1 A;  3I5I B;  3CWG A;  3NSL A;  1DJG A;  3BYA A;  2D8N A;  2BBM A;  1LA0 A;  3CTN A;  2FJU B;  3DD4 A;  2EGD A;  1KWO B;  4HRH A;  1HT9 A;  3SIB A;  1OE9 B;  1SCV A;  2WOS A;  1SKT A;  4AQJ A;  4I5N B;  4CFQ A;  1ALW A;  1B8C A;  2K61 A;  4NDC A;  4QJ3 B;  3CS1 A;  3VGO A;  1CNP A;  1SY9 A;  3KF9 A;  1AVS A;  1JF0 A;  2OPO A;  5GQQ C;  1YUS A;  1UP5 A;  1DJY A;  2BCB A;  1SYM A;  2K2F A;  1BOD A;  1NX3 A;  1MWN A;  3PN7 B;  2H61 C;  1MQ1 A;  2P6B B;  4PHJ A;  4DS7 A;  1KK7 Z;  1QS7 A;  2CXJ A;  4AOM A;  1G33 A;  3JVT C;  1F8H A;  1YUT A;  5JOL A;  1RRO A;  3LLE A;  5AEQ A;  1S5G Z;  2IS9 A;  2L51 A;  2BE6 A;  1IWQ A;  1LA3 A;  1AJ5 A;  1PVB A;  1K9U A;  2ZFD A;  3A4U B;  1XFW O;  2BBN A;  2JNF A;  2M1U A;  3PFV A;  4OKH A;  3DVE A;  2G9B A;  1TNP A;  3NSO A;  3QRX A;  1M63 B;  3EKH A;  3OX6 A;  2MLE C;  1AJ4 A;  1J7R A;  2JUL A;  1CFP A;  4YGB B;  3I5H C;  1SCM B;  2JT8 A;  1L7Z A;  3BUX B;  4JWQ A;  1FPW A;  2LCP A;  5KSZ A;  1OZO A;  2M1K B;  1PK0 D;  4ORC B;  4YGC B;  3O78 A;  4YGA A;  2Q91 A;  1SR6 B;  2KGB C;  2LMT A;  3DF0 B;  5HKW A;  2MRD A;  5ER4 X;  3SIA A;  2Y1N A;  2JTZ A;  2V53 A;  1WY9 A;  2GV5 A;  4QJ4 B;  1A4P A;  4M2O A;  1F4O A;  3TDZ A;  2SCP A;  4FTG A;  1S6C A;  1K95 A;  1MUX A;  1KFU S;  1DJX A;  2CT9 A;  1BU3 A;  5HYD A;  4QJ5 B;  1NP8 A;  1XFU O;  1NX2 A;  1QIW A;  2ZKM X;  2JTT A;  1JF2 A;  1NCX A;  2LC5 A;  3SG2 A;  4CLN A;  2SAS A;  1J7O A;  1KK8 C;  3BOW A;  1K9P A;  2KAV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...