4XJKA

Crystal structure of mn(ii) ca(ii) na(i) bound calprotectin
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
88
structure length
88
Chain Sequence
MLTELEKALNSIIDVYHKYSLIKGNFHAVYRDDLKKLLETESPQYIRKKGADVWFKELDINTDGAVNFQEFLILVIKMGVAAHKKSHE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein S100-A8
publication title Manganese Binding Properties of Human Calprotectin under Conditions of High and Low Calcium: X-ray Crystallographic and Advanced Electron Paramagnetic Resonance Spectroscopic Analysis.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal binding protein
total genus 35
structure length 88
sequence length 88
chains with identical sequence C, E, G, I
ec nomenclature
pdb deposition date 2015-01-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4xjkA00
3BYAA 1OMRA 1UP5A 4OCIA 1QVIZ 1CLLA 2KBIA 3BUNB 3GOFA 3I5GB 3MSEB 3NSOA 4DRWA 4MEWA 2ZN8A 3TDUA 1XFYO 4MVFA 1WLMA 1K90D 3O4YA 3VROA 1NCYA 2K7CA 4PE0A 3WXAA 1A4PA 2D8NA 2LP3A 1V1GA 3KHEA 1SCMB 2AUCA 3KO0A 4MN0A 2EGDA 3TDZA 2JTZA 1A75A 1S6CA 1NWDA 2I7AA 1MHOA 2MRDA 4USLA 1TNPA 1UURA 3OP0A 3ZWHA 1F54A 1SPYA 2CBLA 1B4CA 1D1OA 4PDZA 1S26D 2F2PA 2JRFA 1QS7A 1KCYA 4M2PA 3PN7C 5AFPA 4AQIA 2LCPA 4BY5A 2H61C 2WCFA 1B9AA 4GAOA 1PSBA 2BCBA 2MAZA 2LVVA 1NX2A 1Y0VH 2BBNA 2ZKMX 1G4YR 2BL0C 1TNWA 1JBAA 1DJWA 1A29A 1S5GZ 2BKHB 3HX4A 1YURA 2KI4C 1G8IA 4L9MA 1L2OC 1S6JA 1UHHA 3OX6A 3A4UB 1C7VA 2JNXA 1AJ5A 3BOWB 4A4BA 1TCOB 1CDLA 1SR6B 4ICBA 2K7OA 3I5HB 1YTZC 4YI8A 4ORBB 1WLZA 3CWGA 4GUKA 4TNCA 5B8IB 1IG5A 1KK7Y 1KWOC 2L5XB 1SNLA 4PHJA 4U8DA 1NX0A 1SYMA 1YUTA 1EXRA 2L51A 1FBVA 1NP8A 3FS7A 1JFJA 5HYDA 4QJ3B 3PM8A 2L4HA 1B47A 5CSIA 1KSOA 2OS8C 4PE7A 2DOQA 5F6TA 4M2OA 4F0ZB 1NPQA 1R6PA 2L2EA 1S3PA 1C7WA 5HLOA 1F8HA 1YX8A 2OTGB 1XFWO 2CTNA 4OKHA 1S6IA 2K7DA 3AAJA 1IH0A 4XYNA 1SY9A 1DF0B 1KFUL 4ETOA 2LAPA 1J55A 4BY4A 1NYAA 2E6WA 1U5IA 1PSRA 2KYCA 5KU1A 5KSZA 1BT6A 4MRYA 4GPLB 3SG7A 2QPTA 2LUXA 3BUWB 3GK2A 2G2BA 1AK8A 4QJ4B 3EVVA 5JJGA 3I5GC 4YGAA 3OB1B 1SBJA 4IL1A 1BODA 2ISDA 1ALVA 4YGEB 1E8AA 2KOTA 1RK9A 3CLNA 2HPSA 4C0JA 3DVKA 1YX7A 4AQJA 1NCXA 3PATA 4MZKA 1NCZA 1SCMC 2K7BA 4JQ0D 1YUSA 2LVJA 2JT0A 4PHKA 1IRJA 4YBHB 2F3YA 3M0WA 1CFDA 2LLUA 4QJ5B 3EK4A 1TNQA 1H8BA 1RTP1 3EKHA 1WRKA 1B1GA 1LVCD 1NX3A 2JT3A 3D0YA 1LA0A 4HSZA 1QX5B 1ZFSA 1B8LA 1B7TZ 5BPJA 4PCWA 1TTXA 1A75B 5D69A 3QRXA 2JZIA 2M0RA 3LK1A 3JVTB 4CIDA 1QIWA 1PK0D 1M45A 3JTDB 2KYFA 3SIAA 4JWQA 2ZNEA 2OPOA 1Y6WA 1N2DA 1KK8B 2MJWB 2NXQA 2I18A 4OVNF 1KQMB 4YGDB 2GV5A 4A4CA 3IQOA 4DUQA 3CR4X 1FI5A 1AVSA 1AHRA 1OMVA 4ZCUA 1SR6C 2KBMA 1Y1XA 1XK4C 3I5HC 3PALA 5CSFA 5D7FA 3DVJA 2LE9B 2M1UA 4CFRA 4DCKA 1BR1B 4WRIA 1M46A 2JXLA 2F3ZA 3IQQA 4GGFC 4MRXA 3TUYB 3HCMA 5GQQC 5AXIA 1FW4A 4YGCB 4M2QA 1KSMA 1DJIA 1TOPA 2LC5A 1JFKA 3AKAA 5I2QA 1LXFC 3BUXB 2FOTA 3DD4A 2O5GA 1MUXA 1BOCA 3LL8B 3I5IB 2LLTA 2M49B 2JT8A 1IWQA 1TRFA 1EH2A 2OTGC 1YRUB 3SJSA 3H4SE 1YR5A 5ER5A 4UPGA 1CLBA 1UHJA 1YUUA 1QIVA 1JWDA 1OMDA 4MZLA 1B8CA 2TN4A 1B8RA 1NSHA 1GQMA 2AAOA 2L4IA 4PE4A 5DKNA 3VRPA 5HKYA 2KNEA 1Q80A 2WOSA 2WORA 2Y1NA 2BCXA 1WDCB 3CR2A 4PHNA 4P2YB 3AKBA 2M1KB 1YRTB 2G9BA 5KTYA 2CNPA 1OQPA 1XVJA 2JXCA 1JF2A 1JC2A 1RROA 3D10A 2V53A 3NSKA 1KK7Z 1DVIA 4HREE 4MBEA 3TDIA 1CDPA 1IQ5A 3BUMB 1A03A 1U5IB 1ZUZA 1WRZA 2PASA 4HRGA 5DKQA 1IJ6A 3EKJA 5K89A 1XA5A 2JPTA 2LNKA 2CT9A 3FWBA 1CFCA 4AOMA 2HF5A 1SMGA 1K8UA 3OHMB 2PRUA 2R2IA 1K2HA 2BE6A 3KEVA 3LLEA 2NCOA 3BUOB 3PSRA 2LMTA 4YGBB 1RFJA 4N1GA 1K94A 2LP2A 1SRAA 5I2OA 2Y5IA 3AAKA 4ORCB 3KPXA 1DJZA 4PE1A 1RWYA 2SASA 4CLNA 2Y1MA 1YVLA 1IJ5A 2EC6B 4MSPA 2F2OA 2JOJA 2KFHA 1K96A 2LLSA 1UHNA 1AJ4A 3RLZA 4WQ3A 5CSJA 2F8PA 1BR4B 3I5FB 1M63B 1OOJA 4P5OE 4ZCVA 4I5NB 1M39A 1BLQA 1DGVA 1Y1UA 2LUCA 1VRKA 2LVKA 1J7PA 5AEQA 2K2FA 2HETA 3CGAA 3D0YB 4ORAB 3F45A 1DTLA 5HLVA 1J1EA 3LCPC 1KQMC 2LHIA 3ICBA 3VRNA 3PFVA 3SG3A 2K8MB 1BU3A 1KQVA 3A8RA 2K0JA 1J1DA 3EK7A 4DIRA 1SW8A 1F71A 1DJHA 2BE4A 4NDCA 2PVBA 1CLMA 2PSRA 1SL8A 2NZ0A 1TCFA 3DVMA 3O78A 3TUYC 1CB1A 5CSNA 2L98A 2M97A 2P6BB 3CZTX 3K21A 3DVEA 1GGWA 1XFXO 5J3XA 1QV0A 4NDDA 2KAVA 1CFPA 1F55A 4GGNA 3OX5A 2KSPA 4NDBA 1KFXS 1OZOA 1CDNA 1GGZA 2LANA 3I5IC 3E3RA 2WNDA 2WC8A 2LMVA 1IQ3A 1PVBA 1LKJA 1W7IB 4I5LB 1OSAA 1L7ZA 1XO5A 2RGIA 1F4OA 2I2RE 4GFTA 1K9UA 4XJKA 3WNXB 1K93D 1CDMA 1DJXA 1NX1A 2MHHA 2MLFC 2KAXA 2HQ8A 4DS7A 1PULA 1DF0A 1CMGA 2H2KA 2H61A 2LMUA 1WDCC 2OS8B 3VRQA 2M3WA 1PVAA 2BKIB 4D1EA 3SIBA 1J7OA 2M8UA 3GK1A 1TNXA 2M7LA 5HKWA 1WRLA 1WY9A 3DF0A 2Y4QA 4OR9B 3SG4A 1HQVA 1ODBA 1H4BA 5G08A 4FQOA 2I94A 3EVRA 5PALA 2KAYA 3CS1A 4HRHA 2FJUB 3OB2B 1ZACA 1QASA 1LA3A 1QX7A 2KI6C 2MBXA 1CMFA 1UWOA 1MR8A 1MXLC 1XFVO 2JULA 1EL4A 3VRRA 4Q04A 1SKTA 4WQ2A 1W7JB 3NXAA 1JUOA 2EC6C 3PLFB 1UHIA 4N1FA 1XFZO 3GK4X 3TZ1A 2PALA 3EK8A 1SCVA 2KI6D 1HT9A 4R1EA 1QVIY 3SG5A 1GJYA 4PALA 2NLNA 1RJVA 3I5FC 1MQ1A 1MXEA 3SG2A 4C0LA 1C07A 1CKKA 1NIWA 1QATA 1CM4A 1QTXA 2KQYA 1JF0A 1BMOA 5DKRA 1N0YA 2WCBA 2LVIA 3RM1A 2ZN9A 1F4QA 1AUIB 2CCMA 1CNPA 2K2AA 1J7RA 3FIAA 3FWCA 2BECA 2FCDA 4GBAA 3IF7A 3NSIA 2EHBA 3TS5B 1Y1AA 2JQ6A 5TNCA 2Q4UA 4MZJA 1F70A 2HQWA 2L0PA 1QX2A 2B1UA 2Q91A 1UHKA 3BXKA 1FI6A 1SL7A 3C1VA 2SCPA 4I5JA 1UUSA 1SL9A 1S5GY 4NQGA 4YI9A 1ZMZA 1DJYA 4CFQA 2PMYA 4MLWA 1OE9B 2LHLA 3O6BA 2A4JA 1PRWA 2JTTA 2COLB 2LV7A 3ZNIA 3JVTC 4YRUA 1ALWA 1KFXL 2LM5A 2M29A 3JTDC 1FPWA 2BCAA 1EJ3A 3NSLA 1PALA 1K9KA 2GGZA 4C0KA 5I8NA 1R2UA 2CXJA 3BQ3A 1KK8C 2JNFA 4XJKB 1CFFA 1DMOA 3WHUB 1EG4A 1FF1A 2KDHA 5HKZA 2KFGA 1S36A 3VGOA 1NUBA 1QLSA 4E68A 3PN7B 1DT7B 1S1EA 5CPVA 1DJGA 1J7QA 2AMIA 2ZFDA 3CR5X 1BJFA 2M9GA 1N65A 2KGRA 3BOWA 4N5XA 2JWWA 1M31A 1EG3A 2KGBC 2L50A 5AERA 1QJTA 2JU0A 1XK4A 2BL0B 1V1FA 1TIZA 1BG1A 1QXPA 4GGFA 2KI4B 1L2OB 2E30A 2F33A 5FYXA 4CPVA 2GGMA 1A2XA 2IS9A 3DF0B 5IBWA 1IKUA 1RECA 1XFUO 2ZRSA 4FTGA 2VRGA 3O2PA 2K61A 2KHNA 5JOLA 1QV1A 2M7NA 1SK6D 2KQ6A 1KWOB 4I5KA 5AANA 1KFUS 1XYDA 1CTRA 2FCEA 1IGVA 1OZSA 1CM1A 1BF5A 3KF9A 4JPZB 5ER4X 2MA2A 2ZNDA 3WHTB 1DGUA 1K95A 1X02A 1QLKA 2BBMA 2JC2A 3EVUA 1MF8B 1G33A 4OV2A 1MWNA 4PHMA 2WCEA 4GNKB 1YVHA 3LK0A 2O60A 2ZRTA 2KFFA 3CTNA 1TN4A 1AP4A 3SG6A 1ZOTB 1K9PA 3TS5C 5I2LA 1LINA 2QACA 2NCPA 1JSAA 2MLEC 1B7TY
chains in the Genus database with same CATH superfamily
3BYAA 1OMRA 1UP5A 1Z2CB 1QVIZ 4INWA 1CLLA 2KBIA 3BUNB 4OCIA 3GOFA 3I5GB 3MSEB 3NSOA 4DRWA 4MEWA 2ZN8A 3TDUA 1XFYO 3Q8IA 4MVFA 1WLMA 1K90D 3O4YA 3VROA 1DC1A 1NCYA 2K7CA 4PE0A 3CABA 3WXAA 1A4PA 2D8NA 2LP3A 3N7HA 1V1GA 3KHEA 1SCMB 2AUCA 3KO0A 4MN0A 2WCMA 3FE6A 2EGDA 1OW4A 3TDZA 2JTZA 3L47A 1A75A 4IJ7A 1S6CA 1NWDA 2I7AA 1MHOA 2MRDA 4USLA 1TNPA 1UURA 3OP0A 3ZWHA 1F54A 1SPYA 2CBLA 1B4CA 1D1OA 4PDZA 1S26D 2F2PA 2JRFA 1QS7A 1KCYA 4M2PA 3PN7C 5AFPA 1T14A 2LCPA 4AQIA 4BY5A 2H61C 2WCFA 1B9AA 4GAOA 1PSBA 2BCBA 2MAZA 2LVVA 1NX2A 1Y0VH 2BBNA 2ZKMX 3UNWA 1G4YR 2BL0C 1TNWA 1JBAA 1DJWA 1A29A 1S5GZ 2BKHB 3HX4A 1YURA 2KI4C 1G8IA 4L9MA 1L2OC 1S6JA 1UHHA 3OX6A 3A4UB 1C7VA 2JNXA 1AJ5A 2H8VA 3BOWB 4A4BA 1TCOB 1CDLA 1SR6B 2P71A 4ICBA 3S0DA 2K7OA 3I5HB 1TUZA 1YTZC 3NHIA 4INXA 4YI8A 4ORBB 3B7AA 1WLZA 3CWGA 4GUKA 4TNCA 5B8IB 1OOIX 1IG5A 1KK7Y 1KWOC 2L5XB 1SNLA 4PHJA 4U8DA 1NX0A 1SYMA 1YUTA 1EXRA 2L51A 1FBVA 1NP8A 3FS7A 1JFJA 5HYDA 4QJ3B 3PM8A 2L4HA 1B47A 5CSIA 1KSOA 2OS8C 4PE7A 4OZDA 2DOQA 3D78A 2PYQA 4M2OA 5F6TA 4F0ZB 1NPQA 2GTEA 1R6PA 2L2EA 3D75A 3S0EA 1S3PA 1C7WA 5HLOA 1F8HA 1YX8A 2OTGB 1XFWO 2CTNA 3L4LA 4OKHA 1S6IA 2K7DA 3AAJA 1IH0A 4XYNA 1SY9A 1DF0B 1KFUL 4ETOA 2LAPA 3V2LA 1J55A 4BY4A 1NYAA 2E6WA 1U5IA 1PSRA 2KYCA 5KU1A 5KSZA 1BT6A 4MRYA 4GPLB 3SG7A 2WCJA 2QPTA 2LUXA 3BUWB 3GK2A 2G2BA 1AK8A 4QJ4B 3EVVA 5JJGA 3I5GC 4YGAA 3OB1B 1SBJA 4IL1A 3DZTA 2ISDA 1BODA 1LS8A 1ALVA 4YGEB 3SS4A 2K60A 1E8AA 2KOTA 1RK9A 3CLNA 2HPSA 4C0JA 3DVKA 1YX7A 4AQJA 1NCXA 3PATA 4MZKA 1NCZA 1SCMC 1TUJA 2K7BA 4JQ0D 1YUSA 2LVJA 5FI2A 2JT0A 4PHKA 1IRJA 4YBHB 2F3YA 3M0WA 1CFDA 2LLUA 4QJ5B 3EK4A 1DQEA 1TNQA 1RTP1 2P70A 3EKHA 1H8BA 1WRKA 1B1GA 1LVCD 1NX3A 2JT3A 3D0YA 1LA0A 4HSZA 1QX5B 1ZFSA 1B8LA 2BNXA 1B7TZ 5BPJA 4PCWA 1TTXA 1A75B 5D69A 3QRXA 2JZIA 3FE8A 2M0RA 3LK1A 2QEHA 3JVTB 4CIDA 1QIWA 5HL1A 1PK0D 1Z4HA 1M45A 3JTDB 2KYFA 3SIAA 4JWQA 2ZNEA 2OPOA 1Y6WA 1N2DA 1KK8B 2MJWB 2NXQA 2I18A 4OVNF 3DXLA 1KQMB 4YGDB 2GV5A 4A4CA 3IQOA 4DUQA 3CR4X 1FI5A 1AVSA 1AHRA 1OMVA 4ZCUA 1SR6C 2KBMA 1Y1XA 1XK4C 3I5HC 3PALA 5CSFA 5D7FA 3DVJA 2LE9B 2M1UA 4CFRA 4DCKA 1BR1B 2L2CA 4WRIA 1M46A 2JXLA 2F3ZA 3IQQA 4GGFC 4MRXA 3TUYB 3HCMA 5I94A 5GQQC 5AXIA 1FW4A 4YGCB 4M2QA 1KSMA 1DJIA 5FI7A 1TOPA 2LC5A 1JFKA 3AKAA 5I2QA 1LXFC 3BUXB 2FOTA 3DD4A 2O5GA 1MUXA 3NHTA 3LL8B 1BOCA 3EG5B 3I5IB 1QWVA 2FJYA 2LLTA 1P28A 2M49B 2JT8A 1IWQA 1TRFA 3B6XA 1EH2A 2OTGC 1YRUB 3SJSA 1C3ZA 3H4SE 1YR5A 1SSEB 5ER5A 4UPGA 1CLBA 1UHJA 1YUUA 1QIVA 1JWDA 1OMDA 4MZLA 1B8CA 2TN4A 1B8RA 1NSHA 1GQMA 2AAOA 2L4IA 3CDNA 4PE4A 3D77A 5DKNA 3VRPA 2KNEA 5HKYA 1IIOA 1Q80A 2WOSA 2WORA 2Y1NA 2BCXA 1WDCB 4JKTA 3CR2A 4PHNA 4P2YB 3AKBA 2M1KB 1YRTB 2G9BA 5KTYA 2CNPA 1OQPA 1XVJA 2JXCA 1JF2A 1JC2A 1RROA 3D10A 2V53A 3NSKA 1KK7Z 1DVIA 4HREE 4MBEA 3TDIA 1CDPA 1IQ5A 3BUMB 3VB1A 1A03A 1U5IB 1ZUZA 1WRZA 2PASA 4HRGA 5DKQA 1IJ6A 3EKJA 5K89A 1XA5A 2JPTA 2LNKA 2CT9A 3FWBA 1CFCA 4AOMA 2HF5A 1SMGA 1K8UA 3OHMB 2KPHA 2PRUA 2R2IA 1K2HA 2BE6A 3KEVA 3LLEA 2NCOA 3BUOB 3PSRA 3UO9A 2LMTA 4YGBB 3B88A 1RFJA 2PQLA 4N1GA 1K94A 2LP2A 1SRAA 5I2OA 2Y5IA 3AAKA 4ORCB 3KPXA 1DJZA 4PE1A 1RWYA 2SASA 4CLNA 2Y1MA 3IVTA 3SS3A 1YVLA 1IJ5A 2EC6B 4MSPA 2F2OA 2JOJA 3S0FA 3CZ1A 2KFHA 1K96A 2LLSA 1UHNA 1AJ4A 3RLZA 3L4AA 4WQ3A 5CSJA 2F8PA 1BR4B 3NGVA 3I5FB 1M63B 1OOJA 1OOFA 4P5OE 3R1PA 4ZCVA 4I5NB 1M39A 2WC5A 1BLQA 1DGVA 1Y1UA 2LUCA 1VRKA 2LVKA 1J7PA 5AEQA 2K2FA 2HETA 3CGAA 3D0YB 3PJIA 4PT1A 4ORAB 3BJHA 3F45A 1DTLA 5HLVA 1J1EA 3LCPC 1KQMC 2LHIA 3ICBA 3VRNA 3PFVA 3SG3A 2K8MB 1BU3A 4JD9A 1KQVA 3A8RA 2K0JA 1J1DA 3EK7A 4DIRA 1SW8A 5EL2A 1DJHA 1F71A 2BE4A 4NDCA 2PVBA 1CLMA 2PSRA 1SL8A 3R1OA 2NZ0A 2ERBA 1TCFA 3DVMA 3O78A 3TUYC 1CB1A 5CSNA 2L98A 2M97A 2P6BB 3CZTX 3K21A 3DVEA 1GGWA 1XFXO 5J3XA 1QV0A 4NDDA 2KAVA 1CFPA 1F55A 5D3OA 5DICA 4GGNA 3OX5A 2KSPA 3DY9A 3S0GA 2MLEC 1KFXS 4NDBA 1OOGA 1OZOA 1CDNA 1ORGA 1GGZA 2LANA 3I5IC 3E3RA 2WNDA 2WC8A 2LMVA 1IQ3A 1PVBA 1LKJA 3BFHA 1W7IB 4I5LB 1OSAA 1L7ZA 1XO5A 2RGIA 1F4OA 2I2RE 4GFTA 1K9UA 4XJKA 3WNXB 1K93D 1CDMA 1DJXA 2BAPA 1NX1A 2MHHA 2MLFC 3O4XA 2KAXA 2HQ8A 4DS7A 1TWOA 1PULA 1DF0A 1CMGA 2H2KA 2H61A 2LMUA 1WDCC 2OS8B 3VRQA 2M3WA 1PVAA 2BKIB 4D1EA 3SIBA 1J7OA 2M8UA 3GK1A 1TNXA 2M7LA 5HKWA 1WRLA 1WY9A 3DF0A 2Y4QA 4OR9B 3SG4A 1HQVA 1ODBA 1H4BA 5G08A 4FQOA 2I94A 3EVRA 5PALA 2KAYA 3CS1A 4HRHA 2FJUB 3OB2B 1ZACA 1QASA 1LA3A 1QX7A 2JPOA 2KI6C 3CZ2A 2MBXA 1CMFA 1UWOA 1MR8A 1MXLC 1XFVO 2JULA 1EL4A 3VRRA 4Q04A 4KYNA 1SKTA 4WQ2A 1GM0A 3OGNA 1W7JB 3NXAA 1JUOA 2EC6C 3PLFB 1UHIA 4N1FA 1XFZO 3GK4X 3TZ1A 1DELA 2PALA 1SCVA 3EK8A 2KI6D 1HT9A 4R1EA 1QVIY 3SG5A 1GJYA 4PALA 2NLNA 1RJVA 3I5FC 1MQ1A 1MXEA 3SG2A 4C0LA 1C07A 1CKKA 1NIWA 1QATA 1CM4A 1QTXA 2KQYA 1JF0A 1BMOA 3CZ0A 5DKRA 1N0YA 2WCBA 2LVIA 3FE9A 2ZN9A 3RM1A 1F4QA 3QMEA 1AUIB 2CCMA 1CNPA 2K2AA 1J7RA 3FIAA 3FWCA 2BECA 2FCDA 4GBAA 1OOHA 3BFAA 3IF7A 3NSIA 2YGUA 2EHBA 2WC6A 3TS5B 1Y1AA 3S0AA 2JQ6A 5TNCA 2Q4UA 4MZJA 3CYZA 1F70A 2HQWA 2L0PA 1QX2A 3B87A 2B1UA 2Q91A 3DYEA 1UHKA 3BXKA 1FI6A 1SL7A 3C1VA 2SCPA 4I5JA 1UUSA 1SL9A 1S5GY 4NQGA 4YI9A 1ZMZA 1DJYA 4CFQA 2PMYA 4MLWA 1OE9B 2LHLA 3K1EA 3O6BA 2A4JA 1PRWA 3R1VA 3D73A 2JTTA 2COLB 2LV7A 2WCHA 3ZNIA 3JVTC 3RZSA 4YRUA 1ALWA 1KFXL 2LM5A 2M29A 3JTDC 1FPWA 2BCAA 1EJ3A 3NSLA 1PALA 1K9KA 2GGZA 4C0KA 1W9ZA 5I8NA 1R2UA 2CXJA 3BQ3A 1KK8C 2JNFA 3PM2A 4XJKB 1CFFA 1DMOA 3WHUB 1EG4A 1FF1A 2KDHA 5HKZA 2KFGA 2WCLA 1S36A 3VGOA 1NUBA 1QLSA 4E68A 3PN7B 1DT7B 1S1EA 5CPVA 1DJGA 1C3YA 1J7QA 2AMIA 2ZFDA 3CR5X 1BJFA 2M9GA 1N65A 2KGRA 3BOWA 4N5XA 2JWWA 1M31A 1EG3A 2KGBC 2L50A 5FI6A 5AERA 2L5YA 1QJTA 2JU0A 1XK4A 2BL0B 1V1FA 1TIZA 4FQTA 3BFBA 1BG1A 1QXPA 4GGFA 2KI4B 1L2OB 2E30A 2F33A 5FYXA 4CPVA 2GGMA 1A2XA 2IS9A 3DF0B 2WCKA 5IBWA 1IKUA 1RECA 1XFUO 2QEOA 2ZRSA 3R72A 4FTGA 2VRGA 3O2PA 2K61A 2QEVA 2KHNA 5JOLA 4F7FA 1QV1A 2M7NA 3D74A 1SK6D 2KQ6A 1KWOB 3OBVA 4I5KA 5AANA 1KFUS 1XYDA 1CTRA 2FCEA 1IGVA 3S0BA 1OZSA 2QDIA 1CM1A 1BF5A 3KF9A 2KLEA 4JPZB 5ER4X 2MA2A 2QEBA 2ZNDA 3SS5A 3WHTB 1DGUA 1K95A 1X02A 1QLKA 2BBMA 2JC2A 3EVUA 1MF8B 1G33A 4OV2A 1MWNA 4PHMA 2WCEA 4GNKB 1DEKA 1YVHA 3LK0A 2O60A 2ZRTA 1XFRA 2KFFA 3CTNA 1TN4A 1AP4A 3SG6A 1ZOTB 1K9PA 3TS5C 3B86A 1LINA 5I2LA 2QACA 2NCPA 3D76A 1JSAA 2KLDA 1B7TY
chains in the Genus database with same CATH topology
3BYAA 1OMRA 1UP5A 4OCIA 1QVIZ 1CLLA 2KBIA 3BUNB 3GOFA 3I5GB 3MSEB 3NSOA 4DRWA 4MEWA 2ZN8A 3TDUA 1XFYO 4MVFA 1WLMA 1K90D 3O4YA 3VROA 1NCYA 2K7CA 4PE0A 3WXAA 1A4PA 2D8NA 2LP3A 1V1GA 3KHEA 1SCMB 2AUCA 3KO0A 4MN0A 2EGDA 3TDZA 2JTZA 1A75A 1S6CA 1NWDA 2I7AA 1MHOA 2MRDA 4USLA 1TNPA 1UURA 3OP0A 3ZWHA 1F54A 1SPYA 2CBLA 1B4CA 1D1OA 4PDZA 1S26D 2F2PA 2JRFA 1QS7A 1KCYA 4M2PA 3PN7C 5AFPA 4AQIA 2LCPA 4BY5A 2H61C 2WCFA 1B9AA 4GAOA 1PSBA 2BCBA 2MAZA 2LVVA 1NX2A 1Y0VH 2BBNA 2ZKMX 1G4YR 2BL0C 1TNWA 1JBAA 1DJWA 1A29A 1S5GZ 2BKHB 3HX4A 1YURA 2KI4C 1G8IA 4L9MA 1L2OC 1S6JA 1UHHA 3OX6A 3A4UB 1C7VA 2JNXA 1AJ5A 3BOWB 4A4BA 1TCOB 1CDLA 1SR6B 4ICBA 2K7OA 3I5HB 1YTZC 4YI8A 4ORBB 1WLZA 3CWGA 4GUKA 4TNCA 5B8IB 1IG5A 1KK7Y 1KWOC 2L5XB 1SNLA 4PHJA 4U8DA 1NX0A 1SYMA 1YUTA 1EXRA 2L51A 1FBVA 1NP8A 3FS7A 1JFJA 5HYDA 4QJ3B 3PM8A 2L4HA 1B47A 5CSIA 1KSOA 2OS8C 4PE7A 2DOQA 5F6TA 4M2OA 4F0ZB 1NPQA 1R6PA 2L2EA 1S3PA 1C7WA 5HLOA 1F8HA 1YX8A 2OTGB 1XFWO 2CTNA 4OKHA 1S6IA 2K7DA 3AAJA 1IH0A 4XYNA 1SY9A 1DF0B 1KFUL 4ETOA 2LAPA 1J55A 4BY4A 1NYAA 2E6WA 1U5IA 1PSRA 2KYCA 5KU1A 5KSZA 1BT6A 4MRYA 4GPLB 3SG7A 2QPTA 2LUXA 3BUWB 3GK2A 2G2BA 1AK8A 4QJ4B 3EVVA 5JJGA 3I5GC 4YGAA 3OB1B 1SBJA 4IL1A 1BODA 2ISDA 1ALVA 4YGEB 1E8AA 2KOTA 1RK9A 3CLNA 2HPSA 4C0JA 3DVKA 1YX7A 4AQJA 1NCXA 3PATA 4MZKA 1NCZA 1SCMC 2K7BA 4JQ0D 1YUSA 2LVJA 2JT0A 4PHKA 1IRJA 4YBHB 2F3YA 3M0WA 1CFDA 2LLUA 4QJ5B 3EK4A 1TNQA 1H8BA 1RTP1 3EKHA 1WRKA 1B1GA 1LVCD 1NX3A 2JT3A 3D0YA 1LA0A 4HSZA 1QX5B 1ZFSA 1B8LA 1B7TZ 5BPJA 4PCWA 1TTXA 1A75B 5D69A 3QRXA 2JZIA 2M0RA 3LK1A 3JVTB 4CIDA 1QIWA 1PK0D 1M45A 3JTDB 2KYFA 3SIAA 4JWQA 2ZNEA 2OPOA 1Y6WA 1N2DA 1KK8B 2MJWB 2NXQA 2I18A 4OVNF 1KQMB 4YGDB 2GV5A 4A4CA 3IQOA 4DUQA 3CR4X 1FI5A 1AVSA 1AHRA 1OMVA 4ZCUA 1SR6C 2KBMA 1Y1XA 1XK4C 3I5HC 3PALA 5CSFA 5D7FA 3DVJA 2LE9B 2M1UA 4CFRA 4DCKA 1BR1B 4WRIA 1M46A 2JXLA 2F3ZA 3IQQA 4GGFC 4MRXA 3TUYB 3HCMA 5GQQC 5AXIA 1FW4A 4YGCB 4M2QA 1KSMA 1DJIA 1TOPA 2LC5A 1JFKA 3AKAA 5I2QA 1LXFC 3BUXB 2FOTA 3DD4A 2O5GA 1MUXA 1BOCA 3LL8B 3I5IB 2LLTA 2M49B 2JT8A 1IWQA 1TRFA 1EH2A 2OTGC 1YRUB 3SJSA 3H4SE 1YR5A 5ER5A 4UPGA 1CLBA 1UHJA 1YUUA 1QIVA 1JWDA 1OMDA 4MZLA 1B8CA 2TN4A 1B8RA 1NSHA 1GQMA 2AAOA 2L4IA 4PE4A 5DKNA 3VRPA 5HKYA 2KNEA 1Q80A 2WOSA 2WORA 2Y1NA 2BCXA 1WDCB 3CR2A 4PHNA 4P2YB 3AKBA 2M1KB 1YRTB 2G9BA 5KTYA 2CNPA 1OQPA 1XVJA 2JXCA 1JF2A 1JC2A 1RROA 3D10A 2V53A 3NSKA 1KK7Z 1DVIA 4HREE 4MBEA 3TDIA 1CDPA 1IQ5A 3BUMB 1A03A 1U5IB 1ZUZA 1WRZA 2PASA 4HRGA 5DKQA 1IJ6A 3EKJA 5K89A 1XA5A 2JPTA 2LNKA 2CT9A 3FWBA 1CFCA 4AOMA 2HF5A 1SMGA 1K8UA 3OHMB 2PRUA 2R2IA 1K2HA 2BE6A 3KEVA 3LLEA 2NCOA 3BUOB 3PSRA 2LMTA 4YGBB 1RFJA 4N1GA 1K94A 2LP2A 1SRAA 5I2OA 2Y5IA 3AAKA 4ORCB 3KPXA 1DJZA 4PE1A 1RWYA 2SASA 4CLNA 2Y1MA 1YVLA 1IJ5A 2EC6B 4MSPA 2F2OA 2JOJA 2KFHA 1K96A 2LLSA 1UHNA 1AJ4A 3RLZA 4WQ3A 5CSJA 2F8PA 1BR4B 3I5FB 1M63B 1OOJA 4P5OE 4ZCVA 4I5NB 1M39A 1BLQA 1DGVA 1Y1UA 2LUCA 1VRKA 2LVKA 1J7PA 5AEQA 2K2FA 2HETA 3CGAA 3D0YB 4ORAB 3F45A 1DTLA 5HLVA 1J1EA 3LCPC 1KQMC 2LHIA 3ICBA 3VRNA 3PFVA 3SG3A 2K8MB 1BU3A 1KQVA 3A8RA 2K0JA 1J1DA 3EK7A 4DIRA 1SW8A 1F71A 1DJHA 2BE4A 4NDCA 2PVBA 1CLMA 2PSRA 1SL8A 2NZ0A 1TCFA 3DVMA 3O78A 3TUYC 1CB1A 5CSNA 2L98A 2M97A 2P6BB 3CZTX 3K21A 3DVEA 1GGWA 1XFXO 5J3XA 1QV0A 4NDDA 2KAVA 1CFPA 1F55A 4GGNA 3OX5A 2KSPA 4NDBA 1KFXS 1OZOA 1CDNA 1GGZA 2LANA 3I5IC 3E3RA 2WNDA 2WC8A 2LMVA 1IQ3A 1PVBA 1LKJA 1W7IB 4I5LB 1OSAA 1L7ZA 1XO5A 2RGIA 1F4OA 2I2RE 4GFTA 1K9UA 4XJKA 3WNXB 1K93D 1CDMA 1DJXA 1NX1A 2MHHA 2MLFC 2KAXA 2HQ8A 4DS7A 1PULA 1DF0A 1CMGA 2H2KA 2H61A 2LMUA 1WDCC 2OS8B 3VRQA 2M3WA 1PVAA 2BKIB 4D1EA 3SIBA 1J7OA 2M8UA 3GK1A 1TNXA 2M7LA 5HKWA 1WRLA 1WY9A 3DF0A 2Y4QA 4OR9B 3SG4A 1HQVA 1ODBA 1H4BA 5G08A 4FQOA 2I94A 3EVRA 5PALA 2KAYA 3CS1A 4HRHA 2FJUB 3OB2B 1ZACA 1QASA 1LA3A 1QX7A 2KI6C 2MBXA 1CMFA 1UWOA 1MR8A 1MXLC 1XFVO 2JULA 1EL4A 3VRRA 4Q04A 1SKTA 4WQ2A 1W7JB 3NXAA 1JUOA 2EC6C 3PLFB 1UHIA 4N1FA 1XFZO 3GK4X 3TZ1A 2PALA 3EK8A 1SCVA 2KI6D 1HT9A 4R1EA 1QVIY 3SG5A 1GJYA 4PALA 2NLNA 1RJVA 3I5FC 1MQ1A 1MXEA 3SG2A 4C0LA 1C07A 1CKKA 1NIWA 1QATA 1CM4A 1QTXA 2KQYA 1JF0A 1BMOA 5DKRA 1N0YA 2WCBA 2LVIA 3RM1A 2ZN9A 1F4QA 1AUIB 2CCMA 1CNPA 2K2AA 1J7RA 3FIAA 3FWCA 2BECA 2FCDA 4GBAA 3IF7A 3NSIA 2EHBA 3TS5B 1Y1AA 2JQ6A 5TNCA 2Q4UA 4MZJA 1F70A 2HQWA 2L0PA 1QX2A 2B1UA 2Q91A 1UHKA 3BXKA 1FI6A 1SL7A 3C1VA 2SCPA 4I5JA 1UUSA 1SL9A 1S5GY 4NQGA 4YI9A 1ZMZA 1DJYA 4CFQA 2PMYA 4MLWA 1OE9B 2LHLA 3O6BA 2A4JA 1PRWA 2JTTA 2COLB 2LV7A 3ZNIA 3JVTC 4YRUA 1ALWA 1KFXL 2LM5A 2M29A 3JTDC 1FPWA 2BCAA 1EJ3A 3NSLA 1PALA 1K9KA 2GGZA 4C0KA 5I8NA 1R2UA 2CXJA 3BQ3A 1KK8C 2JNFA 4XJKB 1CFFA 1DMOA 3WHUB 1EG4A 1FF1A 2KDHA 5HKZA 2KFGA 1S36A 3VGOA 1NUBA 1QLSA 4E68A 3PN7B 1DT7B 1S1EA 5CPVA 1DJGA 1J7QA 2AMIA 2ZFDA 3CR5X 1BJFA 2M9GA 1N65A 2KGRA 3BOWA 4N5XA 2JWWA 1M31A 1EG3A 2KGBC 2L50A 5AERA 1QJTA 2JU0A 1XK4A 2BL0B 1V1FA 1TIZA 1BG1A 1QXPA 4GGFA 2KI4B 1L2OB 2E30A 2F33A 5FYXA 4CPVA 2GGMA 1A2XA 2IS9A 3DF0B 5IBWA 1IKUA 1RECA 1XFUO 2ZRSA 4FTGA 2VRGA 3O2PA 2K61A 2KHNA 5JOLA 1QV1A 2M7NA 1SK6D 2KQ6A 1KWOB 4I5KA 5AANA 1KFUS 1XYDA 1CTRA 2FCEA 1IGVA 1OZSA 1CM1A 1BF5A 3KF9A 4JPZB 5ER4X 2MA2A 2ZNDA 3WHTB 1DGUA 1K95A 1X02A 1QLKA 2BBMA 2JC2A 3EVUA 1MF8B 1G33A 4OV2A 1MWNA 4PHMA 2WCEA 4GNKB 1YVHA 3LK0A 2O60A 2ZRTA 2KFFA 3CTNA 1TN4A 1AP4A 3SG6A 1ZOTB 1K9PA 3TS5C 5I2LA 1LINA 2QACA 2NCPA 1JSAA 2MLEC 1B7TY
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BYA A;  1OMR A;  1UP5 A;  4OCI A;  1QVI Z;  1CLL A;  2KBI A;  3BUN B;  3GOF A;  3I5G B;  3MSE B;  3NSO A;  4DRW A;  4MEW A;  2ZN8 A;  3TDU A;  1XFY O;  4MVF A;  1WLM A;  1K90 D;  3O4Y A;  3VRO A;  1NCY A;  2K7C A;  4PE0 A;  3WXA A;  1A4P A;  2D8N A;  2LP3 A;  1V1G A;  3KHE A;  1SCM B;  2AUC A;  3KO0 A;  4MN0 A;  2EGD A;  3TDZ A;  2JTZ A;  1A75 A;  1S6C A;  1NWD A;  2I7A A;  1MHO A;  2MRD A;  4USL A;  1TNP A;  1UUR A;  3OP0 A;  3ZWH A;  1F54 A;  1SPY A;  2CBL A;  1B4C A;  1D1O A;  4PDZ A;  1S26 D;  2F2P A;  2JRF A;  1QS7 A;  1KCY A;  4M2P A;  3PN7 C;  5AFP A;  4AQI A;  2LCP A;  4BY5 A;  2H61 C;  2WCF A;  1B9A A;  4GAO A;  1PSB A;  2BCB A;  2MAZ A;  2LVV A;  1NX2 A;  1Y0V H;  2BBN A;  2ZKM X;  1G4Y R;  2BL0 C;  1TNW A;  1JBA A;  1DJW A;  1A29 A;  1S5G Z;  2BKH B;  3HX4 A;  1YUR A;  2KI4 C;  1G8I A;  4L9M A;  1L2O C;  1S6J A;  1UHH A;  3OX6 A;  3A4U B;  1C7V A;  2JNX A;  1AJ5 A;  3BOW B;  4A4B A;  1TCO B;  1CDL A;  1SR6 B;  4ICB A;  2K7O A;  3I5H B;  1YTZ C;  4YI8 A;  4ORB B;  1WLZ A;  3CWG A;  4GUK A;  4TNC A;  5B8I B;  1IG5 A;  1KK7 Y;  1KWO C;  2L5X B;  1SNL A;  4PHJ A;  4U8D A;  1NX0 A;  1SYM A;  1YUT A;  1EXR A;  2L51 A;  1FBV A;  1NP8 A;  3FS7 A;  1JFJ A;  5HYD A;  4QJ3 B;  3PM8 A;  2L4H A;  1B47 A;  5CSI A;  1KSO A;  2OS8 C;  4PE7 A;  2DOQ A;  5F6T A;  4M2O A;  4F0Z B;  1NPQ A;  1R6P A;  2L2E A;  1S3P A;  1C7W A;  5HLO A;  1F8H A;  1YX8 A;  2OTG B;  1XFW O;  2CTN A;  4OKH A;  1S6I A;  2K7D A;  3AAJ A;  1IH0 A;  4XYN A;  1SY9 A;  1DF0 B;  1KFU L;  4ETO A;  2LAP A;  1J55 A;  4BY4 A;  1NYA A;  2E6W A;  1U5I A;  1PSR A;  2KYC A;  5KU1 A;  5KSZ A;  1BT6 A;  4MRY A;  4GPL B;  3SG7 A;  2QPT A;  2LUX A;  3BUW B;  3GK2 A;  2G2B A;  1AK8 A;  4QJ4 B;  3EVV A;  5JJG A;  3I5G C;  4YGA A;  3OB1 B;  1SBJ A;  4IL1 A;  1BOD A;  2ISD A;  1ALV A;  4YGE B;  1E8A A;  2KOT A;  1RK9 A;  3CLN A;  2HPS A;  4C0J A;  3DVK A;  1YX7 A;  4AQJ A;  1NCX A;  3PAT A;  4MZK A;  1NCZ A;  1SCM C;  2K7B A;  4JQ0 D;  1YUS A;  2LVJ A;  2JT0 A;  4PHK A;  1IRJ A;  4YBH B;  2F3Y A;  3M0W A;  1CFD A;  2LLU A;  4QJ5 B;  3EK4 A;  1TNQ A;  1H8B A;  1RTP 1;  3EKH A;  1WRK A;  1B1G A;  1LVC D;  1NX3 A;  2JT3 A;  3D0Y A;  1LA0 A;  4HSZ A;  1QX5 B;  1ZFS A;  1B8L A;  1B7T Z;  5BPJ A;  4PCW A;  1TTX A;  1A75 B;  5D69 A;  3QRX A;  2JZI A;  2M0R A;  3LK1 A;  3JVT B;  4CID A;  1QIW A;  1PK0 D;  1M45 A;  3JTD B;  2KYF A;  3SIA A;  4JWQ A;  2ZNE A;  2OPO A;  1Y6W A;  1N2D A;  1KK8 B;  2MJW B;  2NXQ A;  2I18 A;  4OVN F;  1KQM B;  4YGD B;  2GV5 A;  4A4C A;  3IQO A;  4DUQ A;  3CR4 X;  1FI5 A;  1AVS A;  1AHR A;  1OMV A;  4ZCU A;  1SR6 C;  2KBM A;  1Y1X A;  1XK4 C;  3I5H C;  3PAL A;  5CSF A;  5D7F A;  3DVJ A;  2LE9 B;  2M1U A;  4CFR A;  4DCK A;  1BR1 B;  4WRI A;  1M46 A;  2JXL A;  2F3Z A;  3IQQ A;  4GGF C;  4MRX A;  3TUY B;  3HCM A;  5GQQ C;  5AXI A;  1FW4 A;  4YGC B;  4M2Q A;  1KSM A;  1DJI A;  1TOP A;  2LC5 A;  1JFK A;  3AKA A;  5I2Q A;  1LXF C;  3BUX B;  2FOT A;  3DD4 A;  2O5G A;  1MUX A;  1BOC A;  3LL8 B;  3I5I B;  2LLT A;  2M49 B;  2JT8 A;  1IWQ A;  1TRF A;  1EH2 A;  2OTG C;  1YRU B;  3SJS A;  3H4S E;  1YR5 A;  5ER5 A;  4UPG A;  1CLB A;  1UHJ A;  1YUU A;  1QIV A;  1JWD A;  1OMD A;  4MZL A;  1B8C A;  2TN4 A;  1B8R A;  1NSH A;  1GQM A;  2AAO A;  2L4I A;  4PE4 A;  5DKN A;  3VRP A;  5HKY A;  2KNE A;  1Q80 A;  2WOS A;  2WOR A;  2Y1N A;  2BCX A;  1WDC B;  3CR2 A;  4PHN A;  4P2Y B;  3AKB A;  2M1K B;  1YRT B;  2G9B A;  5KTY A;  2CNP A;  1OQP A;  1XVJ A;  2JXC A;  1JF2 A;  1JC2 A;  1RRO A;  3D10 A;  2V53 A;  3NSK A;  1KK7 Z;  1DVI A;  4HRE E;  4MBE A;  3TDI A;  1CDP A;  1IQ5 A;  3BUM B;  1A03 A;  1U5I B;  1ZUZ A;  1WRZ A;  2PAS A;  4HRG A;  5DKQ A;  1IJ6 A;  3EKJ A;  5K89 A;  1XA5 A;  2JPT A;  2LNK A;  2CT9 A;  3FWB A;  1CFC A;  4AOM A;  2HF5 A;  1SMG A;  1K8U A;  3OHM B;  2PRU A;  2R2I A;  1K2H A;  2BE6 A;  3KEV A;  3LLE A;  2NCO A;  3BUO B;  3PSR A;  2LMT A;  4YGB B;  1RFJ A;  4N1G A;  1K94 A;  2LP2 A;  1SRA A;  5I2O A;  2Y5I A;  3AAK A;  4ORC B;  3KPX A;  1DJZ A;  4PE1 A;  1RWY A;  2SAS A;  4CLN A;  2Y1M A;  1YVL A;  1IJ5 A;  2EC6 B;  4MSP A;  2F2O A;  2JOJ A;  2KFH A;  1K96 A;  2LLS A;  1UHN A;  1AJ4 A;  3RLZ A;  4WQ3 A;  5CSJ A;  2F8P A;  1BR4 B;  3I5F B;  1M63 B;  1OOJ A;  4P5O E;  4ZCV A;  4I5N B;  1M39 A;  1BLQ A;  1DGV A;  1Y1U A;  2LUC A;  1VRK A;  2LVK A;  1J7P A;  5AEQ A;  2K2F A;  2HET A;  3CGA A;  3D0Y B;  4ORA B;  3F45 A;  1DTL A;  5HLV A;  1J1E A;  3LCP C;  1KQM C;  2LHI A;  3ICB A;  3VRN A;  3PFV A;  3SG3 A;  2K8M B;  1BU3 A;  1KQV A;  3A8R A;  2K0J A;  1J1D A;  3EK7 A;  4DIR A;  1SW8 A;  1F71 A;  1DJH A;  2BE4 A;  4NDC A;  2PVB A;  1CLM A;  2PSR A;  1SL8 A;  2NZ0 A;  1TCF A;  3DVM A;  3O78 A;  3TUY C;  1CB1 A;  5CSN A;  2L98 A;  2M97 A;  2P6B B;  3CZT X;  3K21 A;  3DVE A;  1GGW A;  1XFX O;  5J3X A;  1QV0 A;  4NDD A;  2KAV A;  1CFP A;  1F55 A;  4GGN A;  3OX5 A;  2KSP A;  4NDB A;  1KFX S;  1OZO A;  1CDN A;  1GGZ A;  2LAN A;  3I5I C;  3E3R A;  2WND A;  2WC8 A;  2LMV A;  1IQ3 A;  1PVB A;  1LKJ A;  1W7I B;  4I5L B;  1OSA A;  1L7Z A;  1XO5 A;  2RGI A;  1F4O A;  2I2R E;  4GFT A;  1K9U A;  4XJK A;  3WNX B;  1K93 D;  1CDM A;  1DJX A;  1NX1 A;  2MHH A;  2MLF C;  2KAX A;  2HQ8 A;  4DS7 A;  1PUL A;  1DF0 A;  1CMG A;  2H2K A;  2H61 A;  2LMU A;  1WDC C;  2OS8 B;  3VRQ A;  2M3W A;  1PVA A;  2BKI B;  4D1E A;  3SIB A;  1J7O A;  2M8U A;  3GK1 A;  1TNX A;  2M7L A;  5HKW A;  1WRL A;  1WY9 A;  3DF0 A;  2Y4Q A;  4OR9 B;  3SG4 A;  1HQV A;  1ODB A;  1H4B A;  5G08 A;  4FQO A;  2I94 A;  3EVR A;  5PAL A;  2KAY A;  3CS1 A;  4HRH A;  2FJU B;  3OB2 B;  1ZAC A;  1QAS A;  1LA3 A;  1QX7 A;  2KI6 C;  2MBX A;  1CMF A;  1UWO A;  1MR8 A;  1MXL C;  1XFV O;  2JUL A;  1EL4 A;  3VRR A;  4Q04 A;  1SKT A;  4WQ2 A;  1W7J B;  3NXA A;  1JUO A;  2EC6 C;  3PLF B;  1UHI A;  4N1F A;  1XFZ O;  3GK4 X;  3TZ1 A;  2PAL A;  3EK8 A;  1SCV A;  2KI6 D;  1HT9 A;  4R1E A;  1QVI Y;  3SG5 A;  1GJY A;  4PAL A;  2NLN A;  1RJV A;  3I5F C;  1MQ1 A;  1MXE A;  3SG2 A;  4C0L A;  1C07 A;  1CKK A;  1NIW A;  1QAT A;  1CM4 A;  1QTX A;  2KQY A;  1JF0 A;  1BMO A;  5DKR A;  1N0Y A;  2WCB A;  2LVI A;  3RM1 A;  2ZN9 A;  1F4Q A;  1AUI B;  2CCM A;  1CNP A;  2K2A A;  1J7R A;  3FIA A;  3FWC A;  2BEC A;  2FCD A;  4GBA A;  3IF7 A;  3NSI A;  2EHB A;  3TS5 B;  1Y1A A;  2JQ6 A;  5TNC A;  2Q4U A;  4MZJ A;  1F70 A;  2HQW A;  2L0P A;  1QX2 A;  2B1U A;  2Q91 A;  1UHK A;  3BXK A;  1FI6 A;  1SL7 A;  3C1V A;  2SCP A;  4I5J A;  1UUS A;  1SL9 A;  1S5G Y;  4NQG A;  4YI9 A;  1ZMZ A;  1DJY A;  4CFQ A;  2PMY A;  4MLW A;  1OE9 B;  2LHL A;  3O6B A;  2A4J A;  1PRW A;  2JTT A;  2COL B;  2LV7 A;  3ZNI A;  3JVT C;  4YRU A;  1ALW A;  1KFX L;  2LM5 A;  2M29 A;  3JTD C;  1FPW A;  2BCA A;  1EJ3 A;  3NSL A;  1PAL A;  1K9K A;  2GGZ A;  4C0K A;  5I8N A;  1R2U A;  2CXJ A;  3BQ3 A;  1KK8 C;  2JNF A;  4XJK B;  1CFF A;  1DMO A;  3WHU B;  1EG4 A;  1FF1 A;  2KDH A;  5HKZ A;  2KFG A;  1S36 A;  3VGO A;  1NUB A;  1QLS A;  4E68 A;  3PN7 B;  1DT7 B;  1S1E A;  5CPV A;  1DJG A;  1J7Q A;  2AMI A;  2ZFD A;  3CR5 X;  1BJF A;  2M9G A;  1N65 A;  2KGR A;  3BOW A;  4N5X A;  2JWW A;  1M31 A;  1EG3 A;  2KGB C;  2L50 A;  5AER A;  1QJT A;  2JU0 A;  1XK4 A;  2BL0 B;  1V1F A;  1TIZ A;  1BG1 A;  1QXP A;  4GGF A;  2KI4 B;  1L2O B;  2E30 A;  2F33 A;  5FYX A;  4CPV A;  2GGM A;  1A2X A;  2IS9 A;  3DF0 B;  5IBW A;  1IKU A;  1REC A;  1XFU O;  2ZRS A;  4FTG A;  2VRG A;  3O2P A;  2K61 A;  2KHN A;  5JOL A;  1QV1 A;  2M7N A;  1SK6 D;  2KQ6 A;  1KWO B;  4I5K A;  5AAN A;  1KFU S;  1XYD A;  1CTR A;  2FCE A;  1IGV A;  1OZS A;  1CM1 A;  1BF5 A;  3KF9 A;  4JPZ B;  5ER4 X;  2MA2 A;  2ZND A;  3WHT B;  1DGU A;  1K95 A;  1X02 A;  1QLK A;  2BBM A;  2JC2 A;  3EVU A;  1MF8 B;  1G33 A;  4OV2 A;  1MWN A;  4PHM A;  2WCE A;  4GNK B;  1YVH A;  3LK0 A;  2O60 A;  2ZRT A;  2KFF A;  3CTN A;  1TN4 A;  1AP4 A;  3SG6 A;  1ZOT B;  1K9P A;  3TS5 C;  5I2L A;  1LIN A;  2QAC A;  2NCP A;  1JSA A;  2MLE C;  1B7T Y; 
#chains in the Genus database with same CATH topology
 3BYA A;  1OMR A;  1UP5 A;  1Z2C B;  1QVI Z;  4INW A;  1CLL A;  2KBI A;  3BUN B;  4OCI A;  3GOF A;  3I5G B;  3MSE B;  3NSO A;  4DRW A;  4MEW A;  2ZN8 A;  3TDU A;  1XFY O;  3Q8I A;  4MVF A;  1WLM A;  1K90 D;  3O4Y A;  3VRO A;  1DC1 A;  1NCY A;  2K7C A;  4PE0 A;  3CAB A;  3WXA A;  1A4P A;  2D8N A;  2LP3 A;  3N7H A;  1V1G A;  3KHE A;  1SCM B;  2AUC A;  3KO0 A;  4MN0 A;  2WCM A;  3FE6 A;  2EGD A;  1OW4 A;  3TDZ A;  2JTZ A;  3L47 A;  1A75 A;  4IJ7 A;  1S6C A;  1NWD A;  2I7A A;  1MHO A;  2MRD A;  4USL A;  1TNP A;  1UUR A;  3OP0 A;  3ZWH A;  1F54 A;  1SPY A;  2CBL A;  1B4C A;  1D1O A;  4PDZ A;  1S26 D;  2F2P A;  2JRF A;  1QS7 A;  1KCY A;  4M2P A;  3PN7 C;  5AFP A;  1T14 A;  2LCP A;  4AQI A;  4BY5 A;  2H61 C;  2WCF A;  1B9A A;  4GAO A;  1PSB A;  2BCB A;  2MAZ A;  2LVV A;  1NX2 A;  1Y0V H;  2BBN A;  2ZKM X;  3UNW A;  1G4Y R;  2BL0 C;  1TNW A;  1JBA A;  1DJW A;  1A29 A;  1S5G Z;  2BKH B;  3HX4 A;  1YUR A;  2KI4 C;  1G8I A;  4L9M A;  1L2O C;  1S6J A;  1UHH A;  3OX6 A;  3A4U B;  1C7V A;  2JNX A;  1AJ5 A;  2H8V A;  3BOW B;  4A4B A;  1TCO B;  1CDL A;  1SR6 B;  2P71 A;  4ICB A;  3S0D A;  2K7O A;  3I5H B;  1TUZ A;  1YTZ C;  3NHI A;  4INX A;  4YI8 A;  4ORB B;  3B7A A;  1WLZ A;  3CWG A;  4GUK A;  4TNC A;  5B8I B;  1OOI X;  1IG5 A;  1KK7 Y;  1KWO C;  2L5X B;  1SNL A;  4PHJ A;  4U8D A;  1NX0 A;  1SYM A;  1YUT A;  1EXR A;  2L51 A;  1FBV A;  1NP8 A;  3FS7 A;  1JFJ A;  5HYD A;  4QJ3 B;  3PM8 A;  2L4H A;  1B47 A;  5CSI A;  1KSO A;  2OS8 C;  4PE7 A;  4OZD A;  2DOQ A;  3D78 A;  2PYQ A;  4M2O A;  5F6T A;  4F0Z B;  1NPQ A;  2GTE A;  1R6P A;  2L2E A;  3D75 A;  3S0E A;  1S3P A;  1C7W A;  5HLO A;  1F8H A;  1YX8 A;  2OTG B;  1XFW O;  2CTN A;  3L4L A;  4OKH A;  1S6I A;  2K7D A;  3AAJ A;  1IH0 A;  4XYN A;  1SY9 A;  1DF0 B;  1KFU L;  4ETO A;  2LAP A;  3V2L A;  1J55 A;  4BY4 A;  1NYA A;  2E6W A;  1U5I A;  1PSR A;  2KYC A;  5KU1 A;  5KSZ A;  1BT6 A;  4MRY A;  4GPL B;  3SG7 A;  2WCJ A;  2QPT A;  2LUX A;  3BUW B;  3GK2 A;  2G2B A;  1AK8 A;  4QJ4 B;  3EVV A;  5JJG A;  3I5G C;  4YGA A;  3OB1 B;  1SBJ A;  4IL1 A;  3DZT A;  2ISD A;  1BOD A;  1LS8 A;  1ALV A;  4YGE B;  3SS4 A;  2K60 A;  1E8A A;  2KOT A;  1RK9 A;  3CLN A;  2HPS A;  4C0J A;  3DVK A;  1YX7 A;  4AQJ A;  1NCX A;  3PAT A;  4MZK A;  1NCZ A;  1SCM C;  1TUJ A;  2K7B A;  4JQ0 D;  1YUS A;  2LVJ A;  5FI2 A;  2JT0 A;  4PHK A;  1IRJ A;  4YBH B;  2F3Y A;  3M0W A;  1CFD A;  2LLU A;  4QJ5 B;  3EK4 A;  1DQE A;  1TNQ A;  1RTP 1;  2P70 A;  3EKH A;  1H8B A;  1WRK A;  1B1G A;  1LVC D;  1NX3 A;  2JT3 A;  3D0Y A;  1LA0 A;  4HSZ A;  1QX5 B;  1ZFS A;  1B8L A;  2BNX A;  1B7T Z;  5BPJ A;  4PCW A;  1TTX A;  1A75 B;  5D69 A;  3QRX A;  2JZI A;  3FE8 A;  2M0R A;  3LK1 A;  2QEH A;  3JVT B;  4CID A;  1QIW A;  5HL1 A;  1PK0 D;  1Z4H A;  1M45 A;  3JTD B;  2KYF A;  3SIA A;  4JWQ A;  2ZNE A;  2OPO A;  1Y6W A;  1N2D A;  1KK8 B;  2MJW B;  2NXQ A;  2I18 A;  4OVN F;  3DXL A;  1KQM B;  4YGD B;  2GV5 A;  4A4C A;  3IQO A;  4DUQ A;  3CR4 X;  1FI5 A;  1AVS A;  1AHR A;  1OMV A;  4ZCU A;  1SR6 C;  2KBM A;  1Y1X A;  1XK4 C;  3I5H C;  3PAL A;  5CSF A;  5D7F A;  3DVJ A;  2LE9 B;  2M1U A;  4CFR A;  4DCK A;  1BR1 B;  2L2C A;  4WRI A;  1M46 A;  2JXL A;  2F3Z A;  3IQQ A;  4GGF C;  4MRX A;  3TUY B;  3HCM A;  5I94 A;  5GQQ C;  5AXI A;  1FW4 A;  4YGC B;  4M2Q A;  1KSM A;  1DJI A;  5FI7 A;  1TOP A;  2LC5 A;  1JFK A;  3AKA A;  5I2Q A;  1LXF C;  3BUX B;  2FOT A;  3DD4 A;  2O5G A;  1MUX A;  3NHT A;  3LL8 B;  1BOC A;  3EG5 B;  3I5I B;  1QWV A;  2FJY A;  2LLT A;  1P28 A;  2M49 B;  2JT8 A;  1IWQ A;  1TRF A;  3B6X A;  1EH2 A;  2OTG C;  1YRU B;  3SJS A;  1C3Z A;  3H4S E;  1YR5 A;  1SSE B;  5ER5 A;  4UPG A;  1CLB A;  1UHJ A;  1YUU A;  1QIV A;  1JWD A;  1OMD A;  4MZL A;  1B8C A;  2TN4 A;  1B8R A;  1NSH A;  1GQM A;  2AAO A;  2L4I A;  3CDN A;  4PE4 A;  3D77 A;  5DKN A;  3VRP A;  2KNE A;  5HKY A;  1IIO A;  1Q80 A;  2WOS A;  2WOR A;  2Y1N A;  2BCX A;  1WDC B;  4JKT A;  3CR2 A;  4PHN A;  4P2Y B;  3AKB A;  2M1K B;  1YRT B;  2G9B A;  5KTY A;  2CNP A;  1OQP A;  1XVJ A;  2JXC A;  1JF2 A;  1JC2 A;  1RRO A;  3D10 A;  2V53 A;  3NSK A;  1KK7 Z;  1DVI A;  4HRE E;  4MBE A;  3TDI A;  1CDP A;  1IQ5 A;  3BUM B;  3VB1 A;  1A03 A;  1U5I B;  1ZUZ A;  1WRZ A;  2PAS A;  4HRG A;  5DKQ A;  1IJ6 A;  3EKJ A;  5K89 A;  1XA5 A;  2JPT A;  2LNK A;  2CT9 A;  3FWB A;  1CFC A;  4AOM A;  2HF5 A;  1SMG A;  1K8U A;  3OHM B;  2KPH A;  2PRU A;  2R2I A;  1K2H A;  2BE6 A;  3KEV A;  3LLE A;  2NCO A;  3BUO B;  3PSR A;  3UO9 A;  2LMT A;  4YGB B;  3B88 A;  1RFJ A;  2PQL A;  4N1G A;  1K94 A;  2LP2 A;  1SRA A;  5I2O A;  2Y5I A;  3AAK A;  4ORC B;  3KPX A;  1DJZ A;  4PE1 A;  1RWY A;  2SAS A;  4CLN A;  2Y1M A;  3IVT A;  3SS3 A;  1YVL A;  1IJ5 A;  2EC6 B;  4MSP A;  2F2O A;  2JOJ A;  3S0F A;  3CZ1 A;  2KFH A;  1K96 A;  2LLS A;  1UHN A;  1AJ4 A;  3RLZ A;  3L4A A;  4WQ3 A;  5CSJ A;  2F8P A;  1BR4 B;  3NGV A;  3I5F B;  1M63 B;  1OOJ A;  1OOF A;  4P5O E;  3R1P A;  4ZCV A;  4I5N B;  1M39 A;  2WC5 A;  1BLQ A;  1DGV A;  1Y1U A;  2LUC A;  1VRK A;  2LVK A;  1J7P A;  5AEQ A;  2K2F A;  2HET A;  3CGA A;  3D0Y B;  3PJI A;  4PT1 A;  4ORA B;  3BJH A;  3F45 A;  1DTL A;  5HLV A;  1J1E A;  3LCP C;  1KQM C;  2LHI A;  3ICB A;  3VRN A;  3PFV A;  3SG3 A;  2K8M B;  1BU3 A;  4JD9 A;  1KQV A;  3A8R A;  2K0J A;  1J1D A;  3EK7 A;  4DIR A;  1SW8 A;  5EL2 A;  1DJH A;  1F71 A;  2BE4 A;  4NDC A;  2PVB A;  1CLM A;  2PSR A;  1SL8 A;  3R1O A;  2NZ0 A;  2ERB A;  1TCF A;  3DVM A;  3O78 A;  3TUY C;  1CB1 A;  5CSN A;  2L98 A;  2M97 A;  2P6B B;  3CZT X;  3K21 A;  3DVE A;  1GGW A;  1XFX O;  5J3X A;  1QV0 A;  4NDD A;  2KAV A;  1CFP A;  1F55 A;  5D3O A;  5DIC A;  4GGN A;  3OX5 A;  2KSP A;  3DY9 A;  3S0G A;  2MLE C;  1KFX S;  4NDB A;  1OOG A;  1OZO A;  1CDN A;  1ORG A;  1GGZ A;  2LAN A;  3I5I C;  3E3R A;  2WND A;  2WC8 A;  2LMV A;  1IQ3 A;  1PVB A;  1LKJ A;  3BFH A;  1W7I B;  4I5L B;  1OSA A;  1L7Z A;  1XO5 A;  2RGI A;  1F4O A;  2I2R E;  4GFT A;  1K9U A;  4XJK A;  3WNX B;  1K93 D;  1CDM A;  1DJX A;  2BAP A;  1NX1 A;  2MHH A;  2MLF C;  3O4X A;  2KAX A;  2HQ8 A;  4DS7 A;  1TWO A;  1PUL A;  1DF0 A;  1CMG A;  2H2K A;  2H61 A;  2LMU A;  1WDC C;  2OS8 B;  3VRQ A;  2M3W A;  1PVA A;  2BKI B;  4D1E A;  3SIB A;  1J7O A;  2M8U A;  3GK1 A;  1TNX A;  2M7L A;  5HKW A;  1WRL A;  1WY9 A;  3DF0 A;  2Y4Q A;  4OR9 B;  3SG4 A;  1HQV A;  1ODB A;  1H4B A;  5G08 A;  4FQO A;  2I94 A;  3EVR A;  5PAL A;  2KAY A;  3CS1 A;  4HRH A;  2FJU B;  3OB2 B;  1ZAC A;  1QAS A;  1LA3 A;  1QX7 A;  2JPO A;  2KI6 C;  3CZ2 A;  2MBX A;  1CMF A;  1UWO A;  1MR8 A;  1MXL C;  1XFV O;  2JUL A;  1EL4 A;  3VRR A;  4Q04 A;  4KYN A;  1SKT A;  4WQ2 A;  1GM0 A;  3OGN A;  1W7J B;  3NXA A;  1JUO A;  2EC6 C;  3PLF B;  1UHI A;  4N1F A;  1XFZ O;  3GK4 X;  3TZ1 A;  1DEL A;  2PAL A;  1SCV A;  3EK8 A;  2KI6 D;  1HT9 A;  4R1E A;  1QVI Y;  3SG5 A;  1GJY A;  4PAL A;  2NLN A;  1RJV A;  3I5F C;  1MQ1 A;  1MXE A;  3SG2 A;  4C0L A;  1C07 A;  1CKK A;  1NIW A;  1QAT A;  1CM4 A;  1QTX A;  2KQY A;  1JF0 A;  1BMO A;  3CZ0 A;  5DKR A;  1N0Y A;  2WCB A;  2LVI A;  3FE9 A;  2ZN9 A;  3RM1 A;  1F4Q A;  3QME A;  1AUI B;  2CCM A;  1CNP A;  2K2A A;  1J7R A;  3FIA A;  3FWC A;  2BEC A;  2FCD A;  4GBA A;  1OOH A;  3BFA A;  3IF7 A;  3NSI A;  2YGU A;  2EHB A;  2WC6 A;  3TS5 B;  1Y1A A;  3S0A A;  2JQ6 A;  5TNC A;  2Q4U A;  4MZJ A;  3CYZ A;  1F70 A;  2HQW A;  2L0P A;  1QX2 A;  3B87 A;  2B1U A;  2Q91 A;  3DYE A;  1UHK A;  3BXK A;  1FI6 A;  1SL7 A;  3C1V A;  2SCP A;  4I5J A;  1UUS A;  1SL9 A;  1S5G Y;  4NQG A;  4YI9 A;  1ZMZ A;  1DJY A;  4CFQ A;  2PMY A;  4MLW A;  1OE9 B;  2LHL A;  3K1E A;  3O6B A;  2A4J A;  1PRW A;  3R1V A;  3D73 A;  2JTT A;  2COL B;  2LV7 A;  2WCH A;  3ZNI A;  3JVT C;  3RZS A;  4YRU A;  1ALW A;  1KFX L;  2LM5 A;  2M29 A;  3JTD C;  1FPW A;  2BCA A;  1EJ3 A;  3NSL A;  1PAL A;  1K9K A;  2GGZ A;  4C0K A;  1W9Z A;  5I8N A;  1R2U A;  2CXJ A;  3BQ3 A;  1KK8 C;  2JNF A;  3PM2 A;  4XJK B;  1CFF A;  1DMO A;  3WHU B;  1EG4 A;  1FF1 A;  2KDH A;  5HKZ A;  2KFG A;  2WCL A;  1S36 A;  3VGO A;  1NUB A;  1QLS A;  4E68 A;  3PN7 B;  1DT7 B;  1S1E A;  5CPV A;  1DJG A;  1C3Y A;  1J7Q A;  2AMI A;  2ZFD A;  3CR5 X;  1BJF A;  2M9G A;  1N65 A;  2KGR A;  3BOW A;  4N5X A;  2JWW A;  1M31 A;  1EG3 A;  2KGB C;  2L50 A;  5FI6 A;  5AER A;  2L5Y A;  1QJT A;  2JU0 A;  1XK4 A;  2BL0 B;  1V1F A;  1TIZ A;  4FQT A;  3BFB A;  1BG1 A;  1QXP A;  4GGF A;  2KI4 B;  1L2O B;  2E30 A;  2F33 A;  5FYX A;  4CPV A;  2GGM A;  1A2X A;  2IS9 A;  3DF0 B;  2WCK A;  5IBW A;  1IKU A;  1REC A;  1XFU O;  2QEO A;  2ZRS A;  3R72 A;  4FTG A;  2VRG A;  3O2P A;  2K61 A;  2QEV A;  2KHN A;  5JOL A;  4F7F A;  1QV1 A;  2M7N A;  3D74 A;  1SK6 D;  2KQ6 A;  1KWO B;  3OBV A;  4I5K A;  5AAN A;  1KFU S;  1XYD A;  1CTR A;  2FCE A;  1IGV A;  3S0B A;  1OZS A;  2QDI A;  1CM1 A;  1BF5 A;  3KF9 A;  2KLE A;  4JPZ B;  5ER4 X;  2MA2 A;  2QEB A;  2ZND A;  3SS5 A;  3WHT B;  1DGU A;  1K95 A;  1X02 A;  1QLK A;  2BBM A;  2JC2 A;  3EVU A;  1MF8 B;  1G33 A;  4OV2 A;  1MWN A;  4PHM A;  2WCE A;  4GNK B;  1DEK A;  1YVH A;  3LK0 A;  2O60 A;  2ZRT A;  1XFR A;  2KFF A;  3CTN A;  1TN4 A;  1AP4 A;  3SG6 A;  1ZOT B;  1K9P A;  3TS5 C;  3B86 A;  1LIN A;  5I2L A;  2QAC A;  2NCP A;  3D76 A;  1JSA A;  2KLD A;  1B7T Y; 
#chains in the Genus database with same CATH homology
 3BYA A;  1OMR A;  1UP5 A;  4OCI A;  1QVI Z;  1CLL A;  2KBI A;  3BUN B;  3GOF A;  3I5G B;  3MSE B;  3NSO A;  4DRW A;  4MEW A;  2ZN8 A;  3TDU A;  1XFY O;  4MVF A;  1WLM A;  1K90 D;  3O4Y A;  3VRO A;  1NCY A;  2K7C A;  4PE0 A;  3WXA A;  1A4P A;  2D8N A;  2LP3 A;  1V1G A;  3KHE A;  1SCM B;  2AUC A;  3KO0 A;  4MN0 A;  2EGD A;  3TDZ A;  2JTZ A;  1A75 A;  1S6C A;  1NWD A;  2I7A A;  1MHO A;  2MRD A;  4USL A;  1TNP A;  1UUR A;  3OP0 A;  3ZWH A;  1F54 A;  1SPY A;  2CBL A;  1B4C A;  1D1O A;  4PDZ A;  1S26 D;  2F2P A;  2JRF A;  1QS7 A;  1KCY A;  4M2P A;  3PN7 C;  5AFP A;  4AQI A;  2LCP A;  4BY5 A;  2H61 C;  2WCF A;  1B9A A;  4GAO A;  1PSB A;  2BCB A;  2MAZ A;  2LVV A;  1NX2 A;  1Y0V H;  2BBN A;  2ZKM X;  1G4Y R;  2BL0 C;  1TNW A;  1JBA A;  1DJW A;  1A29 A;  1S5G Z;  2BKH B;  3HX4 A;  1YUR A;  2KI4 C;  1G8I A;  4L9M A;  1L2O C;  1S6J A;  1UHH A;  3OX6 A;  3A4U B;  1C7V A;  2JNX A;  1AJ5 A;  3BOW B;  4A4B A;  1TCO B;  1CDL A;  1SR6 B;  4ICB A;  2K7O A;  3I5H B;  1YTZ C;  4YI8 A;  4ORB B;  1WLZ A;  3CWG A;  4GUK A;  4TNC A;  5B8I B;  1IG5 A;  1KK7 Y;  1KWO C;  2L5X B;  1SNL A;  4PHJ A;  4U8D A;  1NX0 A;  1SYM A;  1YUT A;  1EXR A;  2L51 A;  1FBV A;  1NP8 A;  3FS7 A;  1JFJ A;  5HYD A;  4QJ3 B;  3PM8 A;  2L4H A;  1B47 A;  5CSI A;  1KSO A;  2OS8 C;  4PE7 A;  2DOQ A;  5F6T A;  4M2O A;  4F0Z B;  1NPQ A;  1R6P A;  2L2E A;  1S3P A;  1C7W A;  5HLO A;  1F8H A;  1YX8 A;  2OTG B;  1XFW O;  2CTN A;  4OKH A;  1S6I A;  2K7D A;  3AAJ A;  1IH0 A;  4XYN A;  1SY9 A;  1DF0 B;  1KFU L;  4ETO A;  2LAP A;  1J55 A;  4BY4 A;  1NYA A;  2E6W A;  1U5I A;  1PSR A;  2KYC A;  5KU1 A;  5KSZ A;  1BT6 A;  4MRY A;  4GPL B;  3SG7 A;  2QPT A;  2LUX A;  3BUW B;  3GK2 A;  2G2B A;  1AK8 A;  4QJ4 B;  3EVV A;  5JJG A;  3I5G C;  4YGA A;  3OB1 B;  1SBJ A;  4IL1 A;  1BOD A;  2ISD A;  1ALV A;  4YGE B;  1E8A A;  2KOT A;  1RK9 A;  3CLN A;  2HPS A;  4C0J A;  3DVK A;  1YX7 A;  4AQJ A;  1NCX A;  3PAT A;  4MZK A;  1NCZ A;  1SCM C;  2K7B A;  4JQ0 D;  1YUS A;  2LVJ A;  2JT0 A;  4PHK A;  1IRJ A;  4YBH B;  2F3Y A;  3M0W A;  1CFD A;  2LLU A;  4QJ5 B;  3EK4 A;  1TNQ A;  1H8B A;  1RTP 1;  3EKH A;  1WRK A;  1B1G A;  1LVC D;  1NX3 A;  2JT3 A;  3D0Y A;  1LA0 A;  4HSZ A;  1QX5 B;  1ZFS A;  1B8L A;  1B7T Z;  5BPJ A;  4PCW A;  1TTX A;  1A75 B;  5D69 A;  3QRX A;  2JZI A;  2M0R A;  3LK1 A;  3JVT B;  4CID A;  1QIW A;  1PK0 D;  1M45 A;  3JTD B;  2KYF A;  3SIA A;  4JWQ A;  2ZNE A;  2OPO A;  1Y6W A;  1N2D A;  1KK8 B;  2MJW B;  2NXQ A;  2I18 A;  4OVN F;  1KQM B;  4YGD B;  2GV5 A;  4A4C A;  3IQO A;  4DUQ A;  3CR4 X;  1FI5 A;  1AVS A;  1AHR A;  1OMV A;  4ZCU A;  1SR6 C;  2KBM A;  1Y1X A;  1XK4 C;  3I5H C;  3PAL A;  5CSF A;  5D7F A;  3DVJ A;  2LE9 B;  2M1U A;  4CFR A;  4DCK A;  1BR1 B;  4WRI A;  1M46 A;  2JXL A;  2F3Z A;  3IQQ A;  4GGF C;  4MRX A;  3TUY B;  3HCM A;  5GQQ C;  5AXI A;  1FW4 A;  4YGC B;  4M2Q A;  1KSM A;  1DJI A;  1TOP A;  2LC5 A;  1JFK A;  3AKA A;  5I2Q A;  1LXF C;  3BUX B;  2FOT A;  3DD4 A;  2O5G A;  1MUX A;  1BOC A;  3LL8 B;  3I5I B;  2LLT A;  2M49 B;  2JT8 A;  1IWQ A;  1TRF A;  1EH2 A;  2OTG C;  1YRU B;  3SJS A;  3H4S E;  1YR5 A;  5ER5 A;  4UPG A;  1CLB A;  1UHJ A;  1YUU A;  1QIV A;  1JWD A;  1OMD A;  4MZL A;  1B8C A;  2TN4 A;  1B8R A;  1NSH A;  1GQM A;  2AAO A;  2L4I A;  4PE4 A;  5DKN A;  3VRP A;  5HKY A;  2KNE A;  1Q80 A;  2WOS A;  2WOR A;  2Y1N A;  2BCX A;  1WDC B;  3CR2 A;  4PHN A;  4P2Y B;  3AKB A;  2M1K B;  1YRT B;  2G9B A;  5KTY A;  2CNP A;  1OQP A;  1XVJ A;  2JXC A;  1JF2 A;  1JC2 A;  1RRO A;  3D10 A;  2V53 A;  3NSK A;  1KK7 Z;  1DVI A;  4HRE E;  4MBE A;  3TDI A;  1CDP A;  1IQ5 A;  3BUM B;  1A03 A;  1U5I B;  1ZUZ A;  1WRZ A;  2PAS A;  4HRG A;  5DKQ A;  1IJ6 A;  3EKJ A;  5K89 A;  1XA5 A;  2JPT A;  2LNK A;  2CT9 A;  3FWB A;  1CFC A;  4AOM A;  2HF5 A;  1SMG A;  1K8U A;  3OHM B;  2PRU A;  2R2I A;  1K2H A;  2BE6 A;  3KEV A;  3LLE A;  2NCO A;  3BUO B;  3PSR A;  2LMT A;  4YGB B;  1RFJ A;  4N1G A;  1K94 A;  2LP2 A;  1SRA A;  5I2O A;  2Y5I A;  3AAK A;  4ORC B;  3KPX A;  1DJZ A;  4PE1 A;  1RWY A;  2SAS A;  4CLN A;  2Y1M A;  1YVL A;  1IJ5 A;  2EC6 B;  4MSP A;  2F2O A;  2JOJ A;  2KFH A;  1K96 A;  2LLS A;  1UHN A;  1AJ4 A;  3RLZ A;  4WQ3 A;  5CSJ A;  2F8P A;  1BR4 B;  3I5F B;  1M63 B;  1OOJ A;  4P5O E;  4ZCV A;  4I5N B;  1M39 A;  1BLQ A;  1DGV A;  1Y1U A;  2LUC A;  1VRK A;  2LVK A;  1J7P A;  5AEQ A;  2K2F A;  2HET A;  3CGA A;  3D0Y B;  4ORA B;  3F45 A;  1DTL A;  5HLV A;  1J1E A;  3LCP C;  1KQM C;  2LHI A;  3ICB A;  3VRN A;  3PFV A;  3SG3 A;  2K8M B;  1BU3 A;  1KQV A;  3A8R A;  2K0J A;  1J1D A;  3EK7 A;  4DIR A;  1SW8 A;  1F71 A;  1DJH A;  2BE4 A;  4NDC A;  2PVB A;  1CLM A;  2PSR A;  1SL8 A;  2NZ0 A;  1TCF A;  3DVM A;  3O78 A;  3TUY C;  1CB1 A;  5CSN A;  2L98 A;  2M97 A;  2P6B B;  3CZT X;  3K21 A;  3DVE A;  1GGW A;  1XFX O;  5J3X A;  1QV0 A;  4NDD A;  2KAV A;  1CFP A;  1F55 A;  4GGN A;  3OX5 A;  2KSP A;  4NDB A;  1KFX S;  1OZO A;  1CDN A;  1GGZ A;  2LAN A;  3I5I C;  3E3R A;  2WND A;  2WC8 A;  2LMV A;  1IQ3 A;  1PVB A;  1LKJ A;  1W7I B;  4I5L B;  1OSA A;  1L7Z A;  1XO5 A;  2RGI A;  1F4O A;  2I2R E;  4GFT A;  1K9U A;  4XJK A;  3WNX B;  1K93 D;  1CDM A;  1DJX A;  1NX1 A;  2MHH A;  2MLF C;  2KAX A;  2HQ8 A;  4DS7 A;  1PUL A;  1DF0 A;  1CMG A;  2H2K A;  2H61 A;  2LMU A;  1WDC C;  2OS8 B;  3VRQ A;  2M3W A;  1PVA A;  2BKI B;  4D1E A;  3SIB A;  1J7O A;  2M8U A;  3GK1 A;  1TNX A;  2M7L A;  5HKW A;  1WRL A;  1WY9 A;  3DF0 A;  2Y4Q A;  4OR9 B;  3SG4 A;  1HQV A;  1ODB A;  1H4B A;  5G08 A;  4FQO A;  2I94 A;  3EVR A;  5PAL A;  2KAY A;  3CS1 A;  4HRH A;  2FJU B;  3OB2 B;  1ZAC A;  1QAS A;  1LA3 A;  1QX7 A;  2KI6 C;  2MBX A;  1CMF A;  1UWO A;  1MR8 A;  1MXL C;  1XFV O;  2JUL A;  1EL4 A;  3VRR A;  4Q04 A;  1SKT A;  4WQ2 A;  1W7J B;  3NXA A;  1JUO A;  2EC6 C;  3PLF B;  1UHI A;  4N1F A;  1XFZ O;  3GK4 X;  3TZ1 A;  2PAL A;  3EK8 A;  1SCV A;  2KI6 D;  1HT9 A;  4R1E A;  1QVI Y;  3SG5 A;  1GJY A;  4PAL A;  2NLN A;  1RJV A;  3I5F C;  1MQ1 A;  1MXE A;  3SG2 A;  4C0L A;  1C07 A;  1CKK A;  1NIW A;  1QAT A;  1CM4 A;  1QTX A;  2KQY A;  1JF0 A;  1BMO A;  5DKR A;  1N0Y A;  2WCB A;  2LVI A;  3RM1 A;  2ZN9 A;  1F4Q A;  1AUI B;  2CCM A;  1CNP A;  2K2A A;  1J7R A;  3FIA A;  3FWC A;  2BEC A;  2FCD A;  4GBA A;  3IF7 A;  3NSI A;  2EHB A;  3TS5 B;  1Y1A A;  2JQ6 A;  5TNC A;  2Q4U A;  4MZJ A;  1F70 A;  2HQW A;  2L0P A;  1QX2 A;  2B1U A;  2Q91 A;  1UHK A;  3BXK A;  1FI6 A;  1SL7 A;  3C1V A;  2SCP A;  4I5J A;  1UUS A;  1SL9 A;  1S5G Y;  4NQG A;  4YI9 A;  1ZMZ A;  1DJY A;  4CFQ A;  2PMY A;  4MLW A;  1OE9 B;  2LHL A;  3O6B A;  2A4J A;  1PRW A;  2JTT A;  2COL B;  2LV7 A;  3ZNI A;  3JVT C;  4YRU A;  1ALW A;  1KFX L;  2LM5 A;  2M29 A;  3JTD C;  1FPW A;  2BCA A;  1EJ3 A;  3NSL A;  1PAL A;  1K9K A;  2GGZ A;  4C0K A;  5I8N A;  1R2U A;  2CXJ A;  3BQ3 A;  1KK8 C;  2JNF A;  4XJK B;  1CFF A;  1DMO A;  3WHU B;  1EG4 A;  1FF1 A;  2KDH A;  5HKZ A;  2KFG A;  1S36 A;  3VGO A;  1NUB A;  1QLS A;  4E68 A;  3PN7 B;  1DT7 B;  1S1E A;  5CPV A;  1DJG A;  1J7Q A;  2AMI A;  2ZFD A;  3CR5 X;  1BJF A;  2M9G A;  1N65 A;  2KGR A;  3BOW A;  4N5X A;  2JWW A;  1M31 A;  1EG3 A;  2KGB C;  2L50 A;  5AER A;  1QJT A;  2JU0 A;  1XK4 A;  2BL0 B;  1V1F A;  1TIZ A;  1BG1 A;  1QXP A;  4GGF A;  2KI4 B;  1L2O B;  2E30 A;  2F33 A;  5FYX A;  4CPV A;  2GGM A;  1A2X A;  2IS9 A;  3DF0 B;  5IBW A;  1IKU A;  1REC A;  1XFU O;  2ZRS A;  4FTG A;  2VRG A;  3O2P A;  2K61 A;  2KHN A;  5JOL A;  1QV1 A;  2M7N A;  1SK6 D;  2KQ6 A;  1KWO B;  4I5K A;  5AAN A;  1KFU S;  1XYD A;  1CTR A;  2FCE A;  1IGV A;  1OZS A;  1CM1 A;  1BF5 A;  3KF9 A;  4JPZ B;  5ER4 X;  2MA2 A;  2ZND A;  3WHT B;  1DGU A;  1K95 A;  1X02 A;  1QLK A;  2BBM A;  2JC2 A;  3EVU A;  1MF8 B;  1G33 A;  4OV2 A;  1MWN A;  4PHM A;  2WCE A;  4GNK B;  1YVH A;  3LK0 A;  2O60 A;  2ZRT A;  2KFF A;  3CTN A;  1TN4 A;  1AP4 A;  3SG6 A;  1ZOT B;  1K9P A;  3TS5 C;  5I2L A;  1LIN A;  2QAC A;  2NCP A;  1JSA A;  2MLE C;  1B7T Y; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...