4XJKA

Crystal structure of mn(ii) ca(ii) na(i) bound calprotectin
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
88
structure length
88
Chain Sequence
b'MLTELEKALNSIIDVYHKYSLIKGNFHAVYRDDLKKLLETESPQYIRKKGADVWFKELDINTDGAVNFQEFLILVIKMGVAAHKKSHE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein S100-A8
publication title Manganese Binding Properties of Human Calprotectin under Conditions of High and Low Calcium: X-ray Crystallographic and Advanced Electron Paramagnetic Resonance Spectroscopic Analysis.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal binding protein
total genus 35
structure length 88
sequence length 88
chains with identical sequence C, E, G, I
ec nomenclature
pdb deposition date 2015-01-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4xjkA00
1YRTB 3BOWB 4HREE 1QTXA 1PSRA 1Y6WA 3ICBA 2L4HA 5AERA 1QLKA 1TNWA 1RECA 3TS5C 1U5IA 3VROA 2HPSA 3BQ3A 1B4CA 2LVVA 2ZNDA 1SR6B 1IJ6A 2ZN9A 1RWYA 5HKWA 4GAOA 4FQOA 1S5GY 1S5GZ 3CLNA 2M1UA 1F4QA 1TCFA 1B8LA 1UHNA 3O4YA 1SBJA 5ER4X 2KFHA 2EGDA 2LMTA 1X02A 1LA0A 2WORA 3PM8A 5I2OA 2Y1NA 1VRKA 2F3YA 3OP0A 3RM1A 1CTRA 3NXAA 1JFJA 2MLFC 2CT9A 1DJXA 1CFPA 4CFQA 1NCXA 1NPQA 1XO5A 1IGVA 1JUOA 3JVTC 1YVLA 1QXPA 2CTNA 4MZLA 4L9MA 2LNKA 1QLSA 3O2PA 4I5LB 1AK8A 1UHIA 2M7NA 1A4PA 4MEWA 4GFTA 2HF5A 5DKRA 2NCOA 1SL7A 5J3XA 2MA2A 3VRRA 1NX3A 2KGRA 1TOPA 3FWBA 1AHRA 1NSHA 2K2AA 1SCMC 3PN7C 2KNEA 1UP5A 1B8RA 2PALA 1BU3A 3NSLA 2ZKMX 2TN4A 3BYAA 2MJWB 1AJ4A 2LLSA 1CNPA 3MSEB 1EH2A 2MLEC 2BKHB 2O60A 2WCFA 1XA5A 1S3PA 4XJKA 1IQ3A 1C07A 3D10A 1YVHA 4MN0A 2E30A 2HQ8A 2KDHA 1UHJA 1OMVA 3WNXB 1DT7B 2LM5A 1NX1A 3DVKA 2JU0A 2OS8B 4YRUA 1QJTA 1S6CA 1XFZO 2MHHA 2ZNEA 3PLFB 1SRAA 4PE4A 3PFVA 3ZNIA 2NLNA 4I5NB 4PE1A 3TUYC 1CLMA 1ZUZA 3LK0A 1NYAA 3LL8B 2EC6B 3OB1B 1HQVA 1B9AA 2FCDA 3KPXA 2KHNA 2D8NA 3GOFA 3JTDC 4NDDA 1GGZA 1J7QA 4NDBA 1KFXS 2BBMA 2KAVA 1M46A 3PSRA 4HRGA 4MZJA 5D7FA 5KSZA 2KYCA 2F2OA 3CGAA 3WXAA 1V1FA 3KEVA 2EHBA 1YUTA 1KK8C 1IQ5A 1UHKA 2CXJA 1Y1AA 5KTYA 1DJIA 2PVBA 5CSNA 1K9PA 3BUOB 1CDLA 1Y0VH 2BE4A 3O6BA 2BCBA 1SY9A 4DIRA 4CLNA 2K7DA 3BUWB 3TDUA 4M2PA 1F4OA 1KFXL 1RFJA 4AOMA 1SR6C 2MAZA 1J1EA 1ODBA 4PE7A 3SG7A 3AKAA 2LVJA 4GBAA 2L50A 4GNKB 2F3ZA 3HCMA 2KQYA 2L0PA 3AAJA 1S6IA 3GK4X 1M45A 4YGBB 1Y1UA 4N1FA 1D1OA 3EVVA 4CFRA 4N5XA 1F70A 1G8IA 2F33A 1MWNA 1DF0B 2ZN8A 1DJWA 1J7OA 1EG4A 1QIVA 1NIWA 1YTZC 2JC2A 2O5GA 2SASA 1CDNA 3FIAA 2R2IA 1CLLA 5K89A 2I94A 5GQQC 1MR8A 2KYFA 2CNPA 2JTZA 2K7CA 1RJVA 2M29A 3QRXA 2QACA 4YGEB 4E68A 2JNXA 4USLA 1WLMA 4I5JA 2KI6C 2H61C 1ZOTB 3EKJA 1DGVA 4OKHA 1G33A 2RGIA 2Y5IA 1CM4A 5D69A 1NWDA 1PULA 3SG5A 2H61A 3SIAA 4BY5A 3RLZA 1CM1A 1GQMA 3EK4A 1WLZA 1BOCA 2JWWA 1AVSA 2E6WA 3M0WA 3TDZA 2NXQA 2LLTA 2FOTA 3CTNA 3DF0B 3I5FB 3CR2A 5PALA 4CIDA 2BCXA 4PHKA 3C1VA 4JWQA 2NZ0A 4JPZB 4PALA 2LUXA 4YBHB 1F71A 1QX2A 3HX4A 2JPTA 1H4BA 2M49B 2PSRA 1DJYA 1F54A 2JQ6A 1OMDA 2M7LA 1LVCD 1IG5A 4OV2A 1DJZA 4ZCUA 1RTP1 2L2EA 2OS8C 1SL8A 1OZOA 1DTLA 2GGMA 3CWGA 1B8CA 1S26D 2KI4B 3H4SE 3GK1A 1QATA 1EXRA 2EC6C 2BCAA 4F0ZB 2M1KB 5FYXA 5JJGA 2OTGB 1CFCA 1M31A 1BR4B 5HKZA 1FBVA 1GGWA 1EG3A 1JBAA 1PRWA 1TIZA 1SW8A 4DCKA 1B1GA 2PRUA 3FS7A 3AKBA 3LCPC 1QX7A 2V53A 2WCBA 1YX7A 3TDIA 2LUCA 4AQJA 1UWOA 1OSAA 4ORBB 2MBXA 1R2UA 2LLUA 1K93D 5BPJA 4DUQA 1SNLA 1A03A 1B47A 3EVRA 1F8HA 2BECA 1KQVA 1MUXA 3LK1A 2CBLA 2Y4QA 1K9UA 2Q91A 1GJYA 5ER5A 4D1EA 2BL0B 3OHMB 4MSPA 5I2QA 1LXFC 3IQOA 1BODA 4MLWA 1SL9A 1XK4A 1QV0A 1CMGA 2ZFDA 1A2XA 4UPGA 1PSBA 3CZTX 1R6PA 1C7VA 5CSIA 2DOQA 1KCYA 4P5OE 1B7TY 2KBIA 1B7TZ 2IS9A 3BUXB 1WRLA 4DS7A 1CFFA 1J55A 1N65A 2COLB 2LHLA 3VRNA 2LANA 2M0RA 1TTXA 2GV5A 1KSMA 1JF2A 2G2BA 1G4YR 1DF0A 3DVMA 2M8UA 1JWDA 1SMGA 2I18A 1H8BA 1J1DA 3I5IB 4M2QA 2WCEA 1FF1A 1TNXA 5IBWA 1TNPA 1NP8A 3VGOA 4GGFC 1NX2A 1SYMA 1K95A 1SK6D 1YUSA 1NCZA 2M97A 3ZWHA 4OR9B 2KFFA 2GGZA 3NSKA 4GGFA 1BJFA 1L2OB 4IL1A 3IQQA 1CLBA 3CR4X 4BY4A 1N2DA 2I7AA 4YGAA 1XFXO 3I5GB 1RK9A 2LCPA 1WRZA 1TNQA 3I5FC 4C0JA 2PMYA 1AJ5A 1WY9A 5AXIA 2KSPA 1MF8B 3EK8A 1FW4A 5F6TA 3DF0A 1IRJA 3A8RA 4R1EA 3DVEA 4XYNA 1NX0A 1OQPA 1F55A 1KQMB 1C7WA 1ZACA 2NCPA 2LHIA 2SCPA 1M39A 1PVAA 3O78A 2JULA 1J7RA 1XFVO 3KF9A 2KI4C 1QASA 4JQ0D 1JFKA 1TRFA 3EKHA 3I5HB 4TNCA 5HKYA 1IH0A 2OTGC 3PALA 1YURA 1AP4A 3CR5X 4PHMA 1S36A 1WDCB 3PATA 1K96A 1KSOA 2F2PA 2L98A 5AANA 1LINA 4MZKA 4DRWA 3KHEA 1CDMA 1K94A 3SG3A 1E8AA 1SPYA 5TNCA 4PCWA 1UHHA 4WQ2A 1UURA 1ALVA 2K61A 1LA3A 1YRUB 1BLQA 4QJ3B 1MXLC 3VRQA 1CMFA 2K7BA 1KWOB 4N1GA 4CPVA 3FWCA 2K7OA 2KFGA 1BF5A 4YI9A 3BUMB 3BUNB 2BKIB 4YI8A 2K2FA 1HT9A 2BL0C 2ZRTA 3VRPA 4WQ3A 1QIWA 2JT0A 3OX6A 2KAYA 1A29A 1QVIY 4PDZA 1QVIZ 2JOJA 1OOJA 2JRFA 1IWQA 1XVJA 4YGCB 1WRKA 2OPOA 1N0YA 4ORAB 1PALA 4I5KA 2L4IA 3CS1A 4ETOA 1TCOB 3LLEA 1XYDA 3NSOA 4NQGA 1Y1XA 1MXEA 4HSZA 3GK2A 5G08A 2JNFA 2G9BA 2KGBC 4A4CA 2LE9B 5HLVA 1JC2A 3A4UB 3WHTB 4HRHA 3SG2A 1DGUA 1U5IB 5DKNA 3EK7A 3I5IC 1ZMZA 3NSIA 4U8DA 1ALWA 2FCEA 4ORCB 5B8IB 1KK7Y 2PASA 5I8NA 1KK7Z 4FTGA 1DMOA 3EVUA 2L51A 1BT6A 1A75A 4GPLB 1QV1A 1XK4C 3TS5B 2KI6D 2AMIA 3AAKA 1S1EA 2HETA 3BXKA 5JOLA 1PVBA 4ICBA 2L5XB 1JSAA 1YUUA 1L2OC 4ZCVA 5HYDA 1K2HA 3I5GC 1FI5A 2FJUB 5AEQA 5AFPA 1FI6A 1FPWA 1CB1A 1KFUS 2ZRSA 4MRYA 2LP3A 5DKQA 2BE6A 4C0LA 1MQ1A 2JXLA 3D0YA 4MRXA 2AUCA 2KOTA 4NDCA 1KQMC 3KO0A 3K21A 3TZ1A 1NCYA 2M9GA 1EL4A 1A75B 2CCMA 1CFDA 1BMOA 1OZSA 2K8MB 3JVTB 2B1UA 4A4BA 1JF0A 1KFUL 2H2KA 2JT8A 1K8UA 1SCVA 3I5HC 4OCIA 2F8PA 1BR1B 3OB2B 2LMUA 2JTTA 4PHJA 1WDCC 1CDPA 1MHOA 2WC8A 2LC5A 2WOSA 3DD4A 4GUKA 3WHUB 1PK0D 4QJ5B 4OVNF 1OMRA 1XFUO 2BBNA 4GGNA 4PE0A 1SKTA 1K9KA 1IKUA 1M63B 1S6JA 1YR5A 3OX5A 3IF7A 1W7JB 3D0YB 3PN7B 1SCMB 5I2LA 5HLOA 4XJKB 2WNDA 2LMVA 4Q04A 1KWOC 1UUSA 3SG6A 1CKKA 1XFWO 2LVKA 2Y1MA 2Q4UA 5CSFA 2LVIA 2LV7A 3SIBA 3F45A 4P2YB 1TN4A 1W7IB 5CPVA 3E3RA 1QX5B 2JXCA 3BOWA 1DVIA 2M3WA 2KBMA 2KQ6A 3SJSA 1NUBA 1BG1A 1IJ5A 1DJHA 1K90D 1RROA 3DVJA 5KU1A 1DJGA 1V1GA 4M2OA 5CSJA 2A4JA 2KAXA 4MVFA 3TUYB 2AAOA 2QPTA 2LAPA 4C0KA 4AQIA 4MBEA 4YGDB 4WRIA 2P6BB 1QS7A 1OE9B 3JTDB 1EJ3A 2MRDA 1LKJA 2HQWA 2LP2A 2JZIA 1XFYO 2K0JA 2ISDA 1YX8A 1J7PA 4PHNA 1L7ZA 1Q80A 1KK8B 1ZFSA 4QJ4B 3SG4A 2JT3A 2VRGA 1AUIB 2I2RE
chains in the Genus database with same CATH superfamily
3EG5B 1YRTB 3BOWB 1C3ZA 4HREE 1QTXA 1PSRA 1Y6WA 3ICBA 2L4HA 5AERA 1QLKA 1TNWA 1RECA 3TS5C 1U5IA 3VROA 2HPSA 3BQ3A 1DC1A 1B4CA 2LVVA 2ZNDA 1SR6B 3BJHA 3S0BA 1IJ6A 2ZN9A 1RWYA 2H8VA 5HKWA 4GAOA 4FQOA 1S5GY 1S5GZ 3CLNA 2M1UA 1F4QA 1TCFA 1B8LA 1UHNA 3O4YA 1SBJA 5ER4X 2KFHA 2EGDA 2LMTA 1X02A 3R72A 1LA0A 3SS3A 2WORA 3PM8A 5I2OA 2Y1NA 3UO9A 1VRKA 2F3YA 3OP0A 3RM1A 1CTRA 3NXAA 1JFJA 2MLFC 2CT9A 1DJXA 1CFPA 4CFQA 2KPHA 1NCXA 1NPQA 1XO5A 3D75A 1IGVA 1JUOA 3JVTC 1YVLA 1QXPA 2CTNA 2L2CA 1OOHA 4MZLA 4L9MA 2LNKA 3D76A 3Q8IA 1QLSA 1TWOA 3NHTA 3O2PA 1OW4A 4I5LB 1UHIA 1AK8A 2M7NA 1A4PA 4MEWA 3S0DA 4GFTA 2HF5A 3B86A 2NCOA 5DKRA 1SL7A 5J3XA 2MA2A 3VRRA 1NX3A 2KGRA 1TOPA 3FWBA 1AHRA 1NSHA 2K2AA 1SCMC 1DEKA 2K60A 1UP5A 2KNEA 1B8RA 1LS8A 2PALA 1BU3A 3NSLA 2ZKMX 2TN4A 3BYAA 2MJWB 1AJ4A 2LLSA 1CNPA 3MSEB 1EH2A 2MLEC 2BKHB 2O60A 2WCFA 1XA5A 1S3PA 3FE6A 4XJKA 1IQ3A 1C07A 3D10A 1YVHA 4MN0A 2E30A 2HQ8A 2KDHA 1UHJA 1OMVA 3WNXB 1DT7B 2LM5A 1NX1A 3DVKA 2JU0A 2OS8B 4YRUA 1QJTA 1S6CA 1XFZO 2MHHA 2ZNEA 3PLFB 1SRAA 4PE4A 3PFVA 3ZNIA 2NLNA 4I5NB 4PE1A 3TUYC 1CLMA 1ZUZA 3LK0A 1NYAA 3LL8B 2EC6B 3OB1B 1HQVA 3UNWA 1B9AA 2FCDA 3KPXA 2KHNA 2D8NA 3GOFA 3JTDC 4NDDA 1GGZA 5FI6A 1J7QA 1OOFA 4NDBA 1KFXS 2BBMA 2KAVA 1M46A 3PSRA 4HRGA 4MZJA 5D7FA 5KSZA 2KYCA 2F2OA 3CGAA 3WXAA 1V1FA 3KEVA 2EHBA 3S0GA 1YUTA 1KK8C 1IQ5A 1UHKA 2CXJA 1Y1AA 5KTYA 1DJIA 2PVBA 3PN7C 5CSNA 1K9PA 3BUOB 1CDLA 1Y0VH 2BE4A 3O6BA 2BCBA 4OZDA 1SY9A 4DIRA 4CLNA 1TUJA 1W9ZA 2K7DA 3BUWB 3TDUA 4M2PA 1F4OA 3RZSA 1KFXL 1RFJA 4AOMA 1SR6C 2BNXA 2MAZA 1IIOA 1J1EA 1ODBA 4PE7A 3SG7A 3AKAA 2LVJA 3VB1A 4GBAA 2L50A 2P71A 4GNKB 4F7FA 2F3ZA 3HCMA 2KQYA 2L0PA 3AAJA 1S6IA 3GK4X 1M45A 3S0AA 4YGBB 1Y1UA 3FE9A 4N1FA 1D1OA 3EVVA 4CFRA 4N5XA 1F70A 1G8IA 3B7AA 2F33A 1MWNA 1DF0B 2ZN8A 1DJWA 1J7OA 1EG4A 1QIVA 1NIWA 1YTZC 2JC2A 2O5GA 2QEVA 2SASA 1CDNA 3FIAA 2R2IA 1CLLA 5K89A 2I94A 5GQQC 1MR8A 2KYFA 2CNPA 2JTZA 2K7CA 2GTEA 1RJVA 2M29A 3QRXA 3R1OA 2QACA 4YGEB 4E68A 4INXA 2JNXA 4USLA 1WLMA 3CZ0A 2KI6C 4I5JA 2H61C 1ZOTB 3EKJA 1DGVA 4OKHA 1G33A 2RGIA 3PJIA 2Y5IA 1CM4A 5D69A 1NWDA 1PULA 3SG5A 2H61A 2JPOA 3SIAA 4BY5A 3RLZA 1CM1A 4JKTA 1GQMA 3EK4A 1WLZA 1BOCA 2JWWA 1AVSA 2E6WA 3M0WA 3TDZA 2NXQA 2LLTA 2FOTA 3CTNA 3DF0B 3I5FB 3CR2A 5PALA 4CIDA 2BCXA 4PHKA 3C1VA 4JWQA 2NZ0A 4JPZB 4PALA 2LUXA 4YBHB 1F71A 1QX2A 3HX4A 2JPTA 1H4BA 2M49B 2PSRA 1DJYA 3R1PA 1F54A 2JQ6A 1OMDA 2M7LA 1LVCD 1IG5A 4OV2A 1DJZA 4ZCUA 1RTP1 2L2EA 2OS8C 1SL8A 3NHIA 1OZOA 1DTLA 2GGMA 3CWGA 1B8CA 1S26D 2KI4B 3H4SE 2P70A 3GK1A 1QATA 1EXRA 2EC6C 2BCAA 4F0ZB 2M1KB 5FYXA 5JJGA 2OTGB 1CFCA 1M31A 1BR4B 5HKZA 1FBVA 1GGWA 1EG3A 1JBAA 1PRWA 1TIZA 1SW8A 4DCKA 1B1GA 2PRUA 1Z4HA 3FS7A 3AKBA 3LCPC 1QX7A 2V53A 2WCBA 1YX7A 3TDIA 1OOGA 2LUCA 4AQJA 1UWOA 1OSAA 4ORBB 2MBXA 1R2UA 2LLUA 3B88A 1K93D 5BPJA 4DUQA 2PQLA 3FE8A 1SNLA 1A03A 1B47A 3EVRA 1F8HA 2BECA 1KQVA 1MUXA 3LK1A 3PM2A 2CBLA 2Y4QA 1K9UA 2Q91A 3OGNA 1GJYA 5ER5A 4D1EA 2BL0B 3OHMB 4MSPA 5I2QA 3OBVA 4JD9A 1LXFC 3IQOA 3DZTA 1BODA 4MLWA 1SL9A 1XK4A 1QV0A 1CMGA 2ZFDA 1A2XA 3BFHA 4UPGA 1PSBA 3CZTX 1R6PA 3D73A 1C7VA 5CSIA 2DOQA 1KCYA 4P5OE 1B7TY 2KBIA 1B7TZ 2IS9A 3CZ2A 3BUXB 1WRLA 4DS7A 1CFFA 1J55A 1N65A 2COLB 2LHLA 3VRNA 2LANA 2M0RA 2WCHA 1TTXA 1SSEB 2GV5A 1KSMA 3QMEA 2YGUA 1JF2A 2G2BA 3L47A 1G4YR 1DF0A 3DVMA 3IVTA 2M8UA 1JWDA 1SMGA 4KYNA 3DY9A 2I18A 1H8BA 1J1DA 3I5IB 1P28A 4M2QA 2WCEA 1FF1A 1TNXA 5IBWA 1TNPA 1NP8A 3VGOA 4GGFC 1NX2A 1SYMA 1K95A 1SK6D 1YUSA 1NCZA 2M97A 3ZWHA 5I94A 4OR9B 2KFFA 3R1VA 2GGZA 3NSKA 4GGFA 1BJFA 1L2OB 4IL1A 3IQQA 2QDIA 1CLBA 3CR4X 4BY4A 1N2DA 2I7AA 4YGAA 1XFXO 3I5GB 1RK9A 2LCPA 1WRZA 1TNQA 3I5FC 5FI7A 4C0JA 2WC5A 1DQEA 2PMYA 2WCMA 1AJ5A 1WY9A 5HL1A 5AXIA 3NGVA 2KSPA 1MF8B 3EK8A 1C3YA 1FW4A 5F6TA 3D78A 1IRJA 3A8RA 3DF0A 4R1EA 3DVEA 4XYNA 1NX0A 1OQPA 3V2LA 1F55A 1KQMB 1C7WA 1DELA 1ZACA 2NCPA 2LHIA 2SCPA 1M39A 1PVAA 3O78A 2JULA 1J7RA 1XFVO 3B6XA 3KF9A 2KI4C 3BFBA 3DXLA 1QASA 4JQ0D 1JFKA 5DICA 1TRFA 3EKHA 3I5HB 4TNCA 3CZ1A 5HKYA 1IH0A 2OTGC 3PALA 1YURA 1AP4A 3CR5X 4PHMA 1S36A 1WDCB 3PATA 1K96A 3BFAA 1KSOA 2F2PA 2L98A 5AANA 1LINA 4MZKA 4DRWA 3KHEA 1CDMA 1K94A 3SG3A 1E8AA 1SPYA 5TNCA 4PCWA 3S0EA 1UHHA 5EL2A 1ORGA 1UURA 1ALVA 4WQ2A 2K61A 1LA3A 1YRUB 1BLQA 4QJ3B 1MXLC 2QEHA 3VRQA 2K7BA 1CMFA 1KWOB 4N1GA 4CPVA 3FWCA 2K7OA 2KFGA 1BF5A 2ERBA 4YI9A 3BUMB 3BUNB 2BKIB 4YI8A 2K2FA 1HT9A 2BL0C 2ZRTA 3VRPA 1OOIX 1QIWA 4WQ3A 2WCLA 2JT0A 3OX6A 2KAYA 1A29A 1QVIY 4PDZA 1QVIZ 2JOJA 2QEOA 1OOJA 2JRFA 1IWQA 1XVJA 3DYEA 4YGCB 1WRKA 2OPOA 1N0YA 4ORAB 1PALA 2L5YA 4I5KA 2L4IA 3CS1A 4ETOA 1TCOB 3LLEA 1XYDA 2WC6A 3NSOA 4NQGA 1Y1XA 4FQTA 1MXEA 4HSZA 3GK2A 5G08A 2JNFA 2G9BA 2KGBC 4A4CA 2LE9B 3K1EA 5HLVA 1JC2A 3A4UB 3WHTB 4HRHA 3SG2A 1DGUA 1U5IB 5DKNA 3EK7A 3I5IC 1ZMZA 3NSIA 4U8DA 1ALWA 2FCEA 4ORCB 3O4XA 5B8IB 1KK7Y 2PASA 4INWA 1KK7Z 2PYQA 4FTGA 3EVUA 2L51A 5I8NA 1BT6A 1DMOA 1A75A 4GPLB 1QV1A 1XK4C 3TS5B 2KI6D 2AMIA 3AAKA 1S1EA 2HETA 3BXKA 5JOLA 1PVBA 4ICBA 2L5XB 1JSAA 3L4LA 1YUUA 1L2OC 4ZCVA 5HYDA 1K2HA 3I5GC 2FJYA 3N7HA 1FI5A 2FJUB 5AEQA 5AFPA 1FI6A 1FPWA 1CB1A 1KFUS 5FI2A 2ZRSA 3SS5A 4MRYA 2WCKA 2LP3A 5DKQA 2BE6A 4C0LA 2KLDA 1MQ1A 2JXLA 3D0YA 4MRXA 2AUCA 2KOTA 4NDCA 1KQMC 3KO0A 3K21A 3TZ1A 1NCYA 4PT1A 2M9GA 1EL4A 1A75B 5D3OA 2CCMA 2QEBA 1CFDA 1BMOA 1OZSA 1T14A 2K8MB 3JVTB 2B1UA 4A4BA 1JF0A 1KFUL 2H2KA 3CDNA 2JT8A 1K8UA 1SCVA 2BAPA 3I5HC 2F8PA 1BR1B 3OB2B 2LMUA 4OCIA 2JTTA 4PHJA 1QWVA 1WDCC 1CDPA 1MHOA 2WC8A 2LC5A 2WOSA 3DD4A 4GUKA 3WHUB 1PK0D 3B87A 4OVNF 1OMRA 1XFUO 2BBNA 4GGNA 4PE0A 1SKTA 1Z2CB 1K9KA 1IKUA 1M63B 1S6JA 1YR5A 3OX5A 3IF7A 1W7JB 3D0YB 3PN7B 1SCMB 1TUZA 5I2LA 5HLOA 4XJKB 2WNDA 2LMVA 4Q04A 1KWOC 1UUSA 3SG6A 1CKKA 1XFWO 2LVKA 2KLEA 2Y1MA 3L4AA 2Q4UA 5CSFA 2LVIA 2LV7A 3SIBA 4QJ5B 3F45A 4P2YB 1TN4A 1W7IB 5CPVA 3E3RA 1QX5B 2JXCA 3D74A 3BOWA 1DVIA 2M3WA 1GM0A 2KBMA 2KQ6A 3SJSA 1XFRA 1NUBA 1BG1A 1IJ5A 1DJHA 1K90D 1RROA 3D77A 3CYZA 3DVJA 5KU1A 1DJGA 1V1GA 4M2OA 5CSJA 2A4JA 2KAXA 4MVFA 3TUYB 2AAOA 3S0FA 2QPTA 2LAPA 3SS4A 4C0KA 4AQIA 4IJ7A 4MBEA 4YGDB 4WRIA 2P6BB 1QS7A 1OE9B 3JTDB 1EJ3A 2MRDA 1LKJA 2HQWA 2LP2A 2JZIA 1XFYO 2K0JA 2ISDA 1YX8A 1J7PA 2WCJA 4PHNA 1L7ZA 1Q80A 1KK8B 1ZFSA 4QJ4B 3CABA 3SG4A 2JT3A 2VRGA 1AUIB 2I2RE
chains in the Genus database with same CATH topology
1YRTB 3BOWB 4HREE 1QTXA 1PSRA 1Y6WA 3ICBA 2L4HA 5AERA 1QLKA 1TNWA 1RECA 3TS5C 1U5IA 3VROA 2HPSA 3BQ3A 1B4CA 2LVVA 2ZNDA 1SR6B 1IJ6A 2ZN9A 1RWYA 5HKWA 4GAOA 4FQOA 1S5GY 1S5GZ 3CLNA 2M1UA 1F4QA 1TCFA 1B8LA 1UHNA 3O4YA 1SBJA 5ER4X 2KFHA 2EGDA 2LMTA 1X02A 1LA0A 2WORA 3PM8A 5I2OA 2Y1NA 1VRKA 2F3YA 3OP0A 3RM1A 1CTRA 3NXAA 1JFJA 2MLFC 2CT9A 1DJXA 1CFPA 4CFQA 1NCXA 1NPQA 1XO5A 1IGVA 1JUOA 3JVTC 1YVLA 1QXPA 2CTNA 4MZLA 4L9MA 2LNKA 1QLSA 3O2PA 4I5LB 1AK8A 1UHIA 2M7NA 1A4PA 4MEWA 4GFTA 2HF5A 5DKRA 2NCOA 1SL7A 5J3XA 2MA2A 3VRRA 1NX3A 2KGRA 1TOPA 3FWBA 1AHRA 1NSHA 2K2AA 1SCMC 3PN7C 2KNEA 1UP5A 1B8RA 2PALA 1BU3A 3NSLA 2ZKMX 2TN4A 3BYAA 2MJWB 1AJ4A 2LLSA 1CNPA 3MSEB 1EH2A 2MLEC 2BKHB 2O60A 2WCFA 1XA5A 1S3PA 4XJKA 1IQ3A 1C07A 3D10A 1YVHA 4MN0A 2E30A 2HQ8A 2KDHA 1UHJA 1OMVA 3WNXB 1DT7B 2LM5A 1NX1A 3DVKA 2JU0A 2OS8B 4YRUA 1QJTA 1S6CA 1XFZO 2MHHA 2ZNEA 3PLFB 1SRAA 4PE4A 3PFVA 3ZNIA 2NLNA 4I5NB 4PE1A 3TUYC 1CLMA 1ZUZA 3LK0A 1NYAA 3LL8B 2EC6B 3OB1B 1HQVA 1B9AA 2FCDA 3KPXA 2KHNA 2D8NA 3GOFA 3JTDC 4NDDA 1GGZA 1J7QA 4NDBA 1KFXS 2BBMA 2KAVA 1M46A 3PSRA 4HRGA 4MZJA 5D7FA 5KSZA 2KYCA 2F2OA 3CGAA 3WXAA 1V1FA 3KEVA 2EHBA 1YUTA 1KK8C 1IQ5A 1UHKA 2CXJA 1Y1AA 5KTYA 1DJIA 2PVBA 5CSNA 1K9PA 3BUOB 1CDLA 1Y0VH 2BE4A 3O6BA 2BCBA 1SY9A 4DIRA 4CLNA 2K7DA 3BUWB 3TDUA 4M2PA 1F4OA 1KFXL 1RFJA 4AOMA 1SR6C 2MAZA 1J1EA 1ODBA 4PE7A 3SG7A 3AKAA 2LVJA 4GBAA 2L50A 4GNKB 2F3ZA 3HCMA 2KQYA 2L0PA 3AAJA 1S6IA 3GK4X 1M45A 4YGBB 1Y1UA 4N1FA 1D1OA 3EVVA 4CFRA 4N5XA 1F70A 1G8IA 2F33A 1MWNA 1DF0B 2ZN8A 1DJWA 1J7OA 1EG4A 1QIVA 1NIWA 1YTZC 2JC2A 2O5GA 2SASA 1CDNA 3FIAA 2R2IA 1CLLA 5K89A 2I94A 5GQQC 1MR8A 2KYFA 2CNPA 2JTZA 2K7CA 1RJVA 2M29A 3QRXA 2QACA 4YGEB 4E68A 2JNXA 4USLA 1WLMA 4I5JA 2KI6C 2H61C 1ZOTB 3EKJA 1DGVA 4OKHA 1G33A 2RGIA 2Y5IA 1CM4A 5D69A 1NWDA 1PULA 3SG5A 2H61A 3SIAA 4BY5A 3RLZA 1CM1A 1GQMA 3EK4A 1WLZA 1BOCA 2JWWA 1AVSA 2E6WA 3M0WA 3TDZA 2NXQA 2LLTA 2FOTA 3CTNA 3DF0B 3I5FB 3CR2A 5PALA 4CIDA 2BCXA 4PHKA 3C1VA 4JWQA 2NZ0A 4JPZB 4PALA 2LUXA 4YBHB 1F71A 1QX2A 3HX4A 2JPTA 1H4BA 2M49B 2PSRA 1DJYA 1F54A 2JQ6A 1OMDA 2M7LA 1LVCD 1IG5A 4OV2A 1DJZA 4ZCUA 1RTP1 2L2EA 2OS8C 1SL8A 1OZOA 1DTLA 2GGMA 3CWGA 1B8CA 1S26D 2KI4B 3H4SE 3GK1A 1QATA 1EXRA 2EC6C 2BCAA 4F0ZB 2M1KB 5FYXA 5JJGA 2OTGB 1CFCA 1M31A 1BR4B 5HKZA 1FBVA 1GGWA 1EG3A 1JBAA 1PRWA 1TIZA 1SW8A 4DCKA 1B1GA 2PRUA 3FS7A 3AKBA 3LCPC 1QX7A 2V53A 2WCBA 1YX7A 3TDIA 2LUCA 4AQJA 1UWOA 1OSAA 4ORBB 2MBXA 1R2UA 2LLUA 1K93D 5BPJA 4DUQA 1SNLA 1A03A 1B47A 3EVRA 1F8HA 2BECA 1KQVA 1MUXA 3LK1A 2CBLA 2Y4QA 1K9UA 2Q91A 1GJYA 5ER5A 4D1EA 2BL0B 3OHMB 4MSPA 5I2QA 1LXFC 3IQOA 1BODA 4MLWA 1SL9A 1XK4A 1QV0A 1CMGA 2ZFDA 1A2XA 4UPGA 1PSBA 3CZTX 1R6PA 1C7VA 5CSIA 2DOQA 1KCYA 4P5OE 1B7TY 2KBIA 1B7TZ 2IS9A 3BUXB 1WRLA 4DS7A 1CFFA 1J55A 1N65A 2COLB 2LHLA 3VRNA 2LANA 2M0RA 1TTXA 2GV5A 1KSMA 1JF2A 2G2BA 1G4YR 1DF0A 3DVMA 2M8UA 1JWDA 1SMGA 2I18A 1H8BA 1J1DA 3I5IB 4M2QA 2WCEA 1FF1A 1TNXA 5IBWA 1TNPA 1NP8A 3VGOA 4GGFC 1NX2A 1SYMA 1K95A 1SK6D 1YUSA 1NCZA 2M97A 3ZWHA 4OR9B 2KFFA 2GGZA 3NSKA 4GGFA 1BJFA 1L2OB 4IL1A 3IQQA 1CLBA 3CR4X 4BY4A 1N2DA 2I7AA 4YGAA 1XFXO 3I5GB 1RK9A 2LCPA 1WRZA 1TNQA 3I5FC 4C0JA 2PMYA 1AJ5A 1WY9A 5AXIA 2KSPA 1MF8B 3EK8A 1FW4A 5F6TA 3DF0A 1IRJA 3A8RA 4R1EA 3DVEA 4XYNA 1NX0A 1OQPA 1F55A 1KQMB 1C7WA 1ZACA 2NCPA 2LHIA 2SCPA 1M39A 1PVAA 3O78A 2JULA 1J7RA 1XFVO 3KF9A 2KI4C 1QASA 4JQ0D 1JFKA 1TRFA 3EKHA 3I5HB 4TNCA 5HKYA 1IH0A 2OTGC 3PALA 1YURA 1AP4A 3CR5X 4PHMA 1S36A 1WDCB 3PATA 1K96A 1KSOA 2F2PA 2L98A 5AANA 1LINA 4MZKA 4DRWA 3KHEA 1CDMA 1K94A 3SG3A 1E8AA 1SPYA 5TNCA 4PCWA 1UHHA 4WQ2A 1UURA 1ALVA 2K61A 1LA3A 1YRUB 1BLQA 4QJ3B 1MXLC 3VRQA 1CMFA 2K7BA 1KWOB 4N1GA 4CPVA 3FWCA 2K7OA 2KFGA 1BF5A 4YI9A 3BUMB 3BUNB 2BKIB 4YI8A 2K2FA 1HT9A 2BL0C 2ZRTA 3VRPA 4WQ3A 1QIWA 2JT0A 3OX6A 2KAYA 1A29A 1QVIY 4PDZA 1QVIZ 2JOJA 1OOJA 2JRFA 1IWQA 1XVJA 4YGCB 1WRKA 2OPOA 1N0YA 4ORAB 1PALA 4I5KA 2L4IA 3CS1A 4ETOA 1TCOB 3LLEA 1XYDA 3NSOA 4NQGA 1Y1XA 1MXEA 4HSZA 3GK2A 5G08A 2JNFA 2G9BA 2KGBC 4A4CA 2LE9B 5HLVA 1JC2A 3A4UB 3WHTB 4HRHA 3SG2A 1DGUA 1U5IB 5DKNA 3EK7A 3I5IC 1ZMZA 3NSIA 4U8DA 1ALWA 2FCEA 4ORCB 5B8IB 1KK7Y 2PASA 5I8NA 1KK7Z 4FTGA 1DMOA 3EVUA 2L51A 1BT6A 1A75A 4GPLB 1QV1A 1XK4C 3TS5B 2KI6D 2AMIA 3AAKA 1S1EA 2HETA 3BXKA 5JOLA 1PVBA 4ICBA 2L5XB 1JSAA 1YUUA 1L2OC 4ZCVA 5HYDA 1K2HA 3I5GC 1FI5A 2FJUB 5AEQA 5AFPA 1FI6A 1FPWA 1CB1A 1KFUS 2ZRSA 4MRYA 2LP3A 5DKQA 2BE6A 4C0LA 1MQ1A 2JXLA 3D0YA 4MRXA 2AUCA 2KOTA 4NDCA 1KQMC 3KO0A 3K21A 3TZ1A 1NCYA 2M9GA 1EL4A 1A75B 2CCMA 1CFDA 1BMOA 1OZSA 2K8MB 3JVTB 2B1UA 4A4BA 1JF0A 1KFUL 2H2KA 2JT8A 1K8UA 1SCVA 3I5HC 4OCIA 2F8PA 1BR1B 3OB2B 2LMUA 2JTTA 4PHJA 1WDCC 1CDPA 1MHOA 2WC8A 2LC5A 2WOSA 3DD4A 4GUKA 3WHUB 1PK0D 4QJ5B 4OVNF 1OMRA 1XFUO 2BBNA 4GGNA 4PE0A 1SKTA 1K9KA 1IKUA 1M63B 1S6JA 1YR5A 3OX5A 3IF7A 1W7JB 3D0YB 3PN7B 1SCMB 5I2LA 5HLOA 4XJKB 2WNDA 2LMVA 4Q04A 1KWOC 1UUSA 3SG6A 1CKKA 1XFWO 2LVKA 2Y1MA 2Q4UA 5CSFA 2LVIA 2LV7A 3SIBA 3F45A 4P2YB 1TN4A 1W7IB 5CPVA 3E3RA 1QX5B 2JXCA 3BOWA 1DVIA 2M3WA 2KBMA 2KQ6A 3SJSA 1NUBA 1BG1A 1IJ5A 1DJHA 1K90D 1RROA 3DVJA 5KU1A 1DJGA 1V1GA 4M2OA 5CSJA 2A4JA 2KAXA 4MVFA 3TUYB 2AAOA 2QPTA 2LAPA 4C0KA 4AQIA 4MBEA 4YGDB 4WRIA 2P6BB 1QS7A 1OE9B 3JTDB 1EJ3A 2MRDA 1LKJA 2HQWA 2LP2A 2JZIA 1XFYO 2K0JA 2ISDA 1YX8A 1J7PA 4PHNA 1L7ZA 1Q80A 1KK8B 1ZFSA 4QJ4B 3SG4A 2JT3A 2VRGA 1AUIB 2I2RE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YRT B;  3BOW B;  4HRE E;  1QTX A;  1PSR A;  1Y6W A;  3ICB A;  2L4H A;  5AER A;  1QLK A;  1TNW A;  1REC A;  3TS5 C;  1U5I A;  3VRO A;  2HPS A;  3BQ3 A;  1B4C A;  2LVV A;  2ZND A;  1SR6 B;  1IJ6 A;  2ZN9 A;  1RWY A;  5HKW A;  4GAO A;  4FQO A;  1S5G Y;  1S5G Z;  3CLN A;  2M1U A;  1F4Q A;  1TCF A;  1B8L A;  1UHN A;  3O4Y A;  1SBJ A;  5ER4 X;  2KFH A;  2EGD A;  2LMT A;  1X02 A;  1LA0 A;  2WOR A;  3PM8 A;  5I2O A;  2Y1N A;  1VRK A;  2F3Y A;  3OP0 A;  3RM1 A;  1CTR A;  3NXA A;  1JFJ A;  2MLF C;  2CT9 A;  1DJX A;  1CFP A;  4CFQ A;  1NCX A;  1NPQ A;  1XO5 A;  1IGV A;  1JUO A;  3JVT C;  1YVL A;  1QXP A;  2CTN A;  4MZL A;  4L9M A;  2LNK A;  1QLS A;  3O2P A;  4I5L B;  1AK8 A;  1UHI A;  2M7N A;  1A4P A;  4MEW A;  4GFT A;  2HF5 A;  5DKR A;  2NCO A;  1SL7 A;  5J3X A;  2MA2 A;  3VRR A;  1NX3 A;  2KGR A;  1TOP A;  3FWB A;  1AHR A;  1NSH A;  2K2A A;  1SCM C;  3PN7 C;  2KNE A;  1UP5 A;  1B8R A;  2PAL A;  1BU3 A;  3NSL A;  2ZKM X;  2TN4 A;  3BYA A;  2MJW B;  1AJ4 A;  2LLS A;  1CNP A;  3MSE B;  1EH2 A;  2MLE C;  2BKH B;  2O60 A;  2WCF A;  1XA5 A;  1S3P A;  4XJK A;  1IQ3 A;  1C07 A;  3D10 A;  1YVH A;  4MN0 A;  2E30 A;  2HQ8 A;  2KDH A;  1UHJ A;  1OMV A;  3WNX B;  1DT7 B;  2LM5 A;  1NX1 A;  3DVK A;  2JU0 A;  2OS8 B;  4YRU A;  1QJT A;  1S6C A;  1XFZ O;  2MHH A;  2ZNE A;  3PLF B;  1SRA A;  4PE4 A;  3PFV A;  3ZNI A;  2NLN A;  4I5N B;  4PE1 A;  3TUY C;  1CLM A;  1ZUZ A;  3LK0 A;  1NYA A;  3LL8 B;  2EC6 B;  3OB1 B;  1HQV A;  1B9A A;  2FCD A;  3KPX A;  2KHN A;  2D8N A;  3GOF A;  3JTD C;  4NDD A;  1GGZ A;  1J7Q A;  4NDB A;  1KFX S;  2BBM A;  2KAV A;  1M46 A;  3PSR A;  4HRG A;  4MZJ A;  5D7F A;  5KSZ A;  2KYC A;  2F2O A;  3CGA A;  3WXA A;  1V1F A;  3KEV A;  2EHB A;  1YUT A;  1KK8 C;  1IQ5 A;  1UHK A;  2CXJ A;  1Y1A A;  5KTY A;  1DJI A;  2PVB A;  5CSN A;  1K9P A;  3BUO B;  1CDL A;  1Y0V H;  2BE4 A;  3O6B A;  2BCB A;  1SY9 A;  4DIR A;  4CLN A;  2K7D A;  3BUW B;  3TDU A;  4M2P A;  1F4O A;  1KFX L;  1RFJ A;  4AOM A;  1SR6 C;  2MAZ A;  1J1E A;  1ODB A;  4PE7 A;  3SG7 A;  3AKA A;  2LVJ A;  4GBA A;  2L50 A;  4GNK B;  2F3Z A;  3HCM A;  2KQY A;  2L0P A;  3AAJ A;  1S6I A;  3GK4 X;  1M45 A;  4YGB B;  1Y1U A;  4N1F A;  1D1O A;  3EVV A;  4CFR A;  4N5X A;  1F70 A;  1G8I A;  2F33 A;  1MWN A;  1DF0 B;  2ZN8 A;  1DJW A;  1J7O A;  1EG4 A;  1QIV A;  1NIW A;  1YTZ C;  2JC2 A;  2O5G A;  2SAS A;  1CDN A;  3FIA A;  2R2I A;  1CLL A;  5K89 A;  2I94 A;  5GQQ C;  1MR8 A;  2KYF A;  2CNP A;  2JTZ A;  2K7C A;  1RJV A;  2M29 A;  3QRX A;  2QAC A;  4YGE B;  4E68 A;  2JNX A;  4USL A;  1WLM A;  4I5J A;  2KI6 C;  2H61 C;  1ZOT B;  3EKJ A;  1DGV A;  4OKH A;  1G33 A;  2RGI A;  2Y5I A;  1CM4 A;  5D69 A;  1NWD A;  1PUL A;  3SG5 A;  2H61 A;  3SIA A;  4BY5 A;  3RLZ A;  1CM1 A;  1GQM A;  3EK4 A;  1WLZ A;  1BOC A;  2JWW A;  1AVS A;  2E6W A;  3M0W A;  3TDZ A;  2NXQ A;  2LLT A;  2FOT A;  3CTN A;  3DF0 B;  3I5F B;  3CR2 A;  5PAL A;  4CID A;  2BCX A;  4PHK A;  3C1V A;  4JWQ A;  2NZ0 A;  4JPZ B;  4PAL A;  2LUX A;  4YBH B;  1F71 A;  1QX2 A;  3HX4 A;  2JPT A;  1H4B A;  2M49 B;  2PSR A;  1DJY A;  1F54 A;  2JQ6 A;  1OMD A;  2M7L A;  1LVC D;  1IG5 A;  4OV2 A;  1DJZ A;  4ZCU A;  1RTP 1;  2L2E A;  2OS8 C;  1SL8 A;  1OZO A;  1DTL A;  2GGM A;  3CWG A;  1B8C A;  1S26 D;  2KI4 B;  3H4S E;  3GK1 A;  1QAT A;  1EXR A;  2EC6 C;  2BCA A;  4F0Z B;  2M1K B;  5FYX A;  5JJG A;  2OTG B;  1CFC A;  1M31 A;  1BR4 B;  5HKZ A;  1FBV A;  1GGW A;  1EG3 A;  1JBA A;  1PRW A;  1TIZ A;  1SW8 A;  4DCK A;  1B1G A;  2PRU A;  3FS7 A;  3AKB A;  3LCP C;  1QX7 A;  2V53 A;  2WCB A;  1YX7 A;  3TDI A;  2LUC A;  4AQJ A;  1UWO A;  1OSA A;  4ORB B;  2MBX A;  1R2U A;  2LLU A;  1K93 D;  5BPJ A;  4DUQ A;  1SNL A;  1A03 A;  1B47 A;  3EVR A;  1F8H A;  2BEC A;  1KQV A;  1MUX A;  3LK1 A;  2CBL A;  2Y4Q A;  1K9U A;  2Q91 A;  1GJY A;  5ER5 A;  4D1E A;  2BL0 B;  3OHM B;  4MSP A;  5I2Q A;  1LXF C;  3IQO A;  1BOD A;  4MLW A;  1SL9 A;  1XK4 A;  1QV0 A;  1CMG A;  2ZFD A;  1A2X A;  4UPG A;  1PSB A;  3CZT X;  1R6P A;  1C7V A;  5CSI A;  2DOQ A;  1KCY A;  4P5O E;  1B7T Y;  2KBI A;  1B7T Z;  2IS9 A;  3BUX B;  1WRL A;  4DS7 A;  1CFF A;  1J55 A;  1N65 A;  2COL B;  2LHL A;  3VRN A;  2LAN A;  2M0R A;  1TTX A;  2GV5 A;  1KSM A;  1JF2 A;  2G2B A;  1G4Y R;  1DF0 A;  3DVM A;  2M8U A;  1JWD A;  1SMG A;  2I18 A;  1H8B A;  1J1D A;  3I5I B;  4M2Q A;  2WCE A;  1FF1 A;  1TNX A;  5IBW A;  1TNP A;  1NP8 A;  3VGO A;  4GGF C;  1NX2 A;  1SYM A;  1K95 A;  1SK6 D;  1YUS A;  1NCZ A;  2M97 A;  3ZWH A;  4OR9 B;  2KFF A;  2GGZ A;  3NSK A;  4GGF A;  1BJF A;  1L2O B;  4IL1 A;  3IQQ A;  1CLB A;  3CR4 X;  4BY4 A;  1N2D A;  2I7A A;  4YGA A;  1XFX O;  3I5G B;  1RK9 A;  2LCP A;  1WRZ A;  1TNQ A;  3I5F C;  4C0J A;  2PMY A;  1AJ5 A;  1WY9 A;  5AXI A;  2KSP A;  1MF8 B;  3EK8 A;  1FW4 A;  5F6T A;  3DF0 A;  1IRJ A;  3A8R A;  4R1E A;  3DVE A;  4XYN A;  1NX0 A;  1OQP A;  1F55 A;  1KQM B;  1C7W A;  1ZAC A;  2NCP A;  2LHI A;  2SCP A;  1M39 A;  1PVA A;  3O78 A;  2JUL A;  1J7R A;  1XFV O;  3KF9 A;  2KI4 C;  1QAS A;  4JQ0 D;  1JFK A;  1TRF A;  3EKH A;  3I5H B;  4TNC A;  5HKY A;  1IH0 A;  2OTG C;  3PAL A;  1YUR A;  1AP4 A;  3CR5 X;  4PHM A;  1S36 A;  1WDC B;  3PAT A;  1K96 A;  1KSO A;  2F2P A;  2L98 A;  5AAN A;  1LIN A;  4MZK A;  4DRW A;  3KHE A;  1CDM A;  1K94 A;  3SG3 A;  1E8A A;  1SPY A;  5TNC A;  4PCW A;  1UHH A;  4WQ2 A;  1UUR A;  1ALV A;  2K61 A;  1LA3 A;  1YRU B;  1BLQ A;  4QJ3 B;  1MXL C;  3VRQ A;  1CMF A;  2K7B A;  1KWO B;  4N1G A;  4CPV A;  3FWC A;  2K7O A;  2KFG A;  1BF5 A;  4YI9 A;  3BUM B;  3BUN B;  2BKI B;  4YI8 A;  2K2F A;  1HT9 A;  2BL0 C;  2ZRT A;  3VRP A;  4WQ3 A;  1QIW A;  2JT0 A;  3OX6 A;  2KAY A;  1A29 A;  1QVI Y;  4PDZ A;  1QVI Z;  2JOJ A;  1OOJ A;  2JRF A;  1IWQ A;  1XVJ A;  4YGC B;  1WRK A;  2OPO A;  1N0Y A;  4ORA B;  1PAL A;  4I5K A;  2L4I A;  3CS1 A;  4ETO A;  1TCO B;  3LLE A;  1XYD A;  3NSO A;  4NQG A;  1Y1X A;  1MXE A;  4HSZ A;  3GK2 A;  5G08 A;  2JNF A;  2G9B A;  2KGB C;  4A4C A;  2LE9 B;  5HLV A;  1JC2 A;  3A4U B;  3WHT B;  4HRH A;  3SG2 A;  1DGU A;  1U5I B;  5DKN A;  3EK7 A;  3I5I C;  1ZMZ A;  3NSI A;  4U8D A;  1ALW A;  2FCE A;  4ORC B;  5B8I B;  1KK7 Y;  2PAS A;  5I8N A;  1KK7 Z;  4FTG A;  1DMO A;  3EVU A;  2L51 A;  1BT6 A;  1A75 A;  4GPL B;  1QV1 A;  1XK4 C;  3TS5 B;  2KI6 D;  2AMI A;  3AAK A;  1S1E A;  2HET A;  3BXK A;  5JOL A;  1PVB A;  4ICB A;  2L5X B;  1JSA A;  1YUU A;  1L2O C;  4ZCV A;  5HYD A;  1K2H A;  3I5G C;  1FI5 A;  2FJU B;  5AEQ A;  5AFP A;  1FI6 A;  1FPW A;  1CB1 A;  1KFU S;  2ZRS A;  4MRY A;  2LP3 A;  5DKQ A;  2BE6 A;  4C0L A;  1MQ1 A;  2JXL A;  3D0Y A;  4MRX A;  2AUC A;  2KOT A;  4NDC A;  1KQM C;  3KO0 A;  3K21 A;  3TZ1 A;  1NCY A;  2M9G A;  1EL4 A;  1A75 B;  2CCM A;  1CFD A;  1BMO A;  1OZS A;  2K8M B;  3JVT B;  2B1U A;  4A4B A;  1JF0 A;  1KFU L;  2H2K A;  2JT8 A;  1K8U A;  1SCV A;  3I5H C;  4OCI A;  2F8P A;  1BR1 B;  3OB2 B;  2LMU A;  2JTT A;  4PHJ A;  1WDC C;  1CDP A;  1MHO A;  2WC8 A;  2LC5 A;  2WOS A;  3DD4 A;  4GUK A;  3WHU B;  1PK0 D;  4QJ5 B;  4OVN F;  1OMR A;  1XFU O;  2BBN A;  4GGN A;  4PE0 A;  1SKT A;  1K9K A;  1IKU A;  1M63 B;  1S6J A;  1YR5 A;  3OX5 A;  3IF7 A;  1W7J B;  3D0Y B;  3PN7 B;  1SCM B;  5I2L A;  5HLO A;  4XJK B;  2WND A;  2LMV A;  4Q04 A;  1KWO C;  1UUS A;  3SG6 A;  1CKK A;  1XFW O;  2LVK A;  2Y1M A;  2Q4U A;  5CSF A;  2LVI A;  2LV7 A;  3SIB A;  3F45 A;  4P2Y B;  1TN4 A;  1W7I B;  5CPV A;  3E3R A;  1QX5 B;  2JXC A;  3BOW A;  1DVI A;  2M3W A;  2KBM A;  2KQ6 A;  3SJS A;  1NUB A;  1BG1 A;  1IJ5 A;  1DJH A;  1K90 D;  1RRO A;  3DVJ A;  5KU1 A;  1DJG A;  1V1G A;  4M2O A;  5CSJ A;  2A4J A;  2KAX A;  4MVF A;  3TUY B;  2AAO A;  2QPT A;  2LAP A;  4C0K A;  4AQI A;  4MBE A;  4YGD B;  4WRI A;  2P6B B;  1QS7 A;  1OE9 B;  3JTD B;  1EJ3 A;  2MRD A;  1LKJ A;  2HQW A;  2LP2 A;  2JZI A;  1XFY O;  2K0J A;  2ISD A;  1YX8 A;  1J7P A;  4PHN A;  1L7Z A;  1Q80 A;  1KK8 B;  1ZFS A;  4QJ4 B;  3SG4 A;  2JT3 A;  2VRG A;  1AUI B;  2I2R E; 
#chains in the Genus database with same CATH topology
 3EG5 B;  1YRT B;  3BOW B;  1C3Z A;  4HRE E;  1QTX A;  1PSR A;  1Y6W A;  3ICB A;  2L4H A;  5AER A;  1QLK A;  1TNW A;  1REC A;  3TS5 C;  1U5I A;  3VRO A;  2HPS A;  3BQ3 A;  1DC1 A;  1B4C A;  2LVV A;  2ZND A;  1SR6 B;  3BJH A;  3S0B A;  1IJ6 A;  2ZN9 A;  1RWY A;  2H8V A;  5HKW A;  4GAO A;  4FQO A;  1S5G Y;  1S5G Z;  3CLN A;  2M1U A;  1F4Q A;  1TCF A;  1B8L A;  1UHN A;  3O4Y A;  1SBJ A;  5ER4 X;  2KFH A;  2EGD A;  2LMT A;  1X02 A;  3R72 A;  1LA0 A;  3SS3 A;  2WOR A;  3PM8 A;  5I2O A;  2Y1N A;  3UO9 A;  1VRK A;  2F3Y A;  3OP0 A;  3RM1 A;  1CTR A;  3NXA A;  1JFJ A;  2MLF C;  2CT9 A;  1DJX A;  1CFP A;  4CFQ A;  2KPH A;  1NCX A;  1NPQ A;  1XO5 A;  3D75 A;  1IGV A;  1JUO A;  3JVT C;  1YVL A;  1QXP A;  2CTN A;  2L2C A;  1OOH A;  4MZL A;  4L9M A;  2LNK A;  3D76 A;  3Q8I A;  1QLS A;  1TWO A;  3NHT A;  3O2P A;  1OW4 A;  4I5L B;  1UHI A;  1AK8 A;  2M7N A;  1A4P A;  4MEW A;  3S0D A;  4GFT A;  2HF5 A;  3B86 A;  2NCO A;  5DKR A;  1SL7 A;  5J3X A;  2MA2 A;  3VRR A;  1NX3 A;  2KGR A;  1TOP A;  3FWB A;  1AHR A;  1NSH A;  2K2A A;  1SCM C;  1DEK A;  2K60 A;  1UP5 A;  2KNE A;  1B8R A;  1LS8 A;  2PAL A;  1BU3 A;  3NSL A;  2ZKM X;  2TN4 A;  3BYA A;  2MJW B;  1AJ4 A;  2LLS A;  1CNP A;  3MSE B;  1EH2 A;  2MLE C;  2BKH B;  2O60 A;  2WCF A;  1XA5 A;  1S3P A;  3FE6 A;  4XJK A;  1IQ3 A;  1C07 A;  3D10 A;  1YVH A;  4MN0 A;  2E30 A;  2HQ8 A;  2KDH A;  1UHJ A;  1OMV A;  3WNX B;  1DT7 B;  2LM5 A;  1NX1 A;  3DVK A;  2JU0 A;  2OS8 B;  4YRU A;  1QJT A;  1S6C A;  1XFZ O;  2MHH A;  2ZNE A;  3PLF B;  1SRA A;  4PE4 A;  3PFV A;  3ZNI A;  2NLN A;  4I5N B;  4PE1 A;  3TUY C;  1CLM A;  1ZUZ A;  3LK0 A;  1NYA A;  3LL8 B;  2EC6 B;  3OB1 B;  1HQV A;  3UNW A;  1B9A A;  2FCD A;  3KPX A;  2KHN A;  2D8N A;  3GOF A;  3JTD C;  4NDD A;  1GGZ A;  5FI6 A;  1J7Q A;  1OOF A;  4NDB A;  1KFX S;  2BBM A;  2KAV A;  1M46 A;  3PSR A;  4HRG A;  4MZJ A;  5D7F A;  5KSZ A;  2KYC A;  2F2O A;  3CGA A;  3WXA A;  1V1F A;  3KEV A;  2EHB A;  3S0G A;  1YUT A;  1KK8 C;  1IQ5 A;  1UHK A;  2CXJ A;  1Y1A A;  5KTY A;  1DJI A;  2PVB A;  3PN7 C;  5CSN A;  1K9P A;  3BUO B;  1CDL A;  1Y0V H;  2BE4 A;  3O6B A;  2BCB A;  4OZD A;  1SY9 A;  4DIR A;  4CLN A;  1TUJ A;  1W9Z A;  2K7D A;  3BUW B;  3TDU A;  4M2P A;  1F4O A;  3RZS A;  1KFX L;  1RFJ A;  4AOM A;  1SR6 C;  2BNX A;  2MAZ A;  1IIO A;  1J1E A;  1ODB A;  4PE7 A;  3SG7 A;  3AKA A;  2LVJ A;  3VB1 A;  4GBA A;  2L50 A;  2P71 A;  4GNK B;  4F7F A;  2F3Z A;  3HCM A;  2KQY A;  2L0P A;  3AAJ A;  1S6I A;  3GK4 X;  1M45 A;  3S0A A;  4YGB B;  1Y1U A;  3FE9 A;  4N1F A;  1D1O A;  3EVV A;  4CFR A;  4N5X A;  1F70 A;  1G8I A;  3B7A A;  2F33 A;  1MWN A;  1DF0 B;  2ZN8 A;  1DJW A;  1J7O A;  1EG4 A;  1QIV A;  1NIW A;  1YTZ C;  2JC2 A;  2O5G A;  2QEV A;  2SAS A;  1CDN A;  3FIA A;  2R2I A;  1CLL A;  5K89 A;  2I94 A;  5GQQ C;  1MR8 A;  2KYF A;  2CNP A;  2JTZ A;  2K7C A;  2GTE A;  1RJV A;  2M29 A;  3QRX A;  3R1O A;  2QAC A;  4YGE B;  4E68 A;  4INX A;  2JNX A;  4USL A;  1WLM A;  3CZ0 A;  2KI6 C;  4I5J A;  2H61 C;  1ZOT B;  3EKJ A;  1DGV A;  4OKH A;  1G33 A;  2RGI A;  3PJI A;  2Y5I A;  1CM4 A;  5D69 A;  1NWD A;  1PUL A;  3SG5 A;  2H61 A;  2JPO A;  3SIA A;  4BY5 A;  3RLZ A;  1CM1 A;  4JKT A;  1GQM A;  3EK4 A;  1WLZ A;  1BOC A;  2JWW A;  1AVS A;  2E6W A;  3M0W A;  3TDZ A;  2NXQ A;  2LLT A;  2FOT A;  3CTN A;  3DF0 B;  3I5F B;  3CR2 A;  5PAL A;  4CID A;  2BCX A;  4PHK A;  3C1V A;  4JWQ A;  2NZ0 A;  4JPZ B;  4PAL A;  2LUX A;  4YBH B;  1F71 A;  1QX2 A;  3HX4 A;  2JPT A;  1H4B A;  2M49 B;  2PSR A;  1DJY A;  3R1P A;  1F54 A;  2JQ6 A;  1OMD A;  2M7L A;  1LVC D;  1IG5 A;  4OV2 A;  1DJZ A;  4ZCU A;  1RTP 1;  2L2E A;  2OS8 C;  1SL8 A;  3NHI A;  1OZO A;  1DTL A;  2GGM A;  3CWG A;  1B8C A;  1S26 D;  2KI4 B;  3H4S E;  2P70 A;  3GK1 A;  1QAT A;  1EXR A;  2EC6 C;  2BCA A;  4F0Z B;  2M1K B;  5FYX A;  5JJG A;  2OTG B;  1CFC A;  1M31 A;  1BR4 B;  5HKZ A;  1FBV A;  1GGW A;  1EG3 A;  1JBA A;  1PRW A;  1TIZ A;  1SW8 A;  4DCK A;  1B1G A;  2PRU A;  1Z4H A;  3FS7 A;  3AKB A;  3LCP C;  1QX7 A;  2V53 A;  2WCB A;  1YX7 A;  3TDI A;  1OOG A;  2LUC A;  4AQJ A;  1UWO A;  1OSA A;  4ORB B;  2MBX A;  1R2U A;  2LLU A;  3B88 A;  1K93 D;  5BPJ A;  4DUQ A;  2PQL A;  3FE8 A;  1SNL A;  1A03 A;  1B47 A;  3EVR A;  1F8H A;  2BEC A;  1KQV A;  1MUX A;  3LK1 A;  3PM2 A;  2CBL A;  2Y4Q A;  1K9U A;  2Q91 A;  3OGN A;  1GJY A;  5ER5 A;  4D1E A;  2BL0 B;  3OHM B;  4MSP A;  5I2Q A;  3OBV A;  4JD9 A;  1LXF C;  3IQO A;  3DZT A;  1BOD A;  4MLW A;  1SL9 A;  1XK4 A;  1QV0 A;  1CMG A;  2ZFD A;  1A2X A;  3BFH A;  4UPG A;  1PSB A;  3CZT X;  1R6P A;  3D73 A;  1C7V A;  5CSI A;  2DOQ A;  1KCY A;  4P5O E;  1B7T Y;  2KBI A;  1B7T Z;  2IS9 A;  3CZ2 A;  3BUX B;  1WRL A;  4DS7 A;  1CFF A;  1J55 A;  1N65 A;  2COL B;  2LHL A;  3VRN A;  2LAN A;  2M0R A;  2WCH A;  1TTX A;  1SSE B;  2GV5 A;  1KSM A;  3QME A;  2YGU A;  1JF2 A;  2G2B A;  3L47 A;  1G4Y R;  1DF0 A;  3DVM A;  3IVT A;  2M8U A;  1JWD A;  1SMG A;  4KYN A;  3DY9 A;  2I18 A;  1H8B A;  1J1D A;  3I5I B;  1P28 A;  4M2Q A;  2WCE A;  1FF1 A;  1TNX A;  5IBW A;  1TNP A;  1NP8 A;  3VGO A;  4GGF C;  1NX2 A;  1SYM A;  1K95 A;  1SK6 D;  1YUS A;  1NCZ A;  2M97 A;  3ZWH A;  5I94 A;  4OR9 B;  2KFF A;  3R1V A;  2GGZ A;  3NSK A;  4GGF A;  1BJF A;  1L2O B;  4IL1 A;  3IQQ A;  2QDI A;  1CLB A;  3CR4 X;  4BY4 A;  1N2D A;  2I7A A;  4YGA A;  1XFX O;  3I5G B;  1RK9 A;  2LCP A;  1WRZ A;  1TNQ A;  3I5F C;  5FI7 A;  4C0J A;  2WC5 A;  1DQE A;  2PMY A;  2WCM A;  1AJ5 A;  1WY9 A;  5HL1 A;  5AXI A;  3NGV A;  2KSP A;  1MF8 B;  3EK8 A;  1C3Y A;  1FW4 A;  5F6T A;  3D78 A;  1IRJ A;  3A8R A;  3DF0 A;  4R1E A;  3DVE A;  4XYN A;  1NX0 A;  1OQP A;  3V2L A;  1F55 A;  1KQM B;  1C7W A;  1DEL A;  1ZAC A;  2NCP A;  2LHI A;  2SCP A;  1M39 A;  1PVA A;  3O78 A;  2JUL A;  1J7R A;  1XFV O;  3B6X A;  3KF9 A;  2KI4 C;  3BFB A;  3DXL A;  1QAS A;  4JQ0 D;  1JFK A;  5DIC A;  1TRF A;  3EKH A;  3I5H B;  4TNC A;  3CZ1 A;  5HKY A;  1IH0 A;  2OTG C;  3PAL A;  1YUR A;  1AP4 A;  3CR5 X;  4PHM A;  1S36 A;  1WDC B;  3PAT A;  1K96 A;  3BFA A;  1KSO A;  2F2P A;  2L98 A;  5AAN A;  1LIN A;  4MZK A;  4DRW A;  3KHE A;  1CDM A;  1K94 A;  3SG3 A;  1E8A A;  1SPY A;  5TNC A;  4PCW A;  3S0E A;  1UHH A;  5EL2 A;  1ORG A;  1UUR A;  1ALV A;  4WQ2 A;  2K61 A;  1LA3 A;  1YRU B;  1BLQ A;  4QJ3 B;  1MXL C;  2QEH A;  3VRQ A;  2K7B A;  1CMF A;  1KWO B;  4N1G A;  4CPV A;  3FWC A;  2K7O A;  2KFG A;  1BF5 A;  2ERB A;  4YI9 A;  3BUM B;  3BUN B;  2BKI B;  4YI8 A;  2K2F A;  1HT9 A;  2BL0 C;  2ZRT A;  3VRP A;  1OOI X;  1QIW A;  4WQ3 A;  2WCL A;  2JT0 A;  3OX6 A;  2KAY A;  1A29 A;  1QVI Y;  4PDZ A;  1QVI Z;  2JOJ A;  2QEO A;  1OOJ A;  2JRF A;  1IWQ A;  1XVJ A;  3DYE A;  4YGC B;  1WRK A;  2OPO A;  1N0Y A;  4ORA B;  1PAL A;  2L5Y A;  4I5K A;  2L4I A;  3CS1 A;  4ETO A;  1TCO B;  3LLE A;  1XYD A;  2WC6 A;  3NSO A;  4NQG A;  1Y1X A;  4FQT A;  1MXE A;  4HSZ A;  3GK2 A;  5G08 A;  2JNF A;  2G9B A;  2KGB C;  4A4C A;  2LE9 B;  3K1E A;  5HLV A;  1JC2 A;  3A4U B;  3WHT B;  4HRH A;  3SG2 A;  1DGU A;  1U5I B;  5DKN A;  3EK7 A;  3I5I C;  1ZMZ A;  3NSI A;  4U8D A;  1ALW A;  2FCE A;  4ORC B;  3O4X A;  5B8I B;  1KK7 Y;  2PAS A;  4INW A;  1KK7 Z;  2PYQ A;  4FTG A;  3EVU A;  2L51 A;  5I8N A;  1BT6 A;  1DMO A;  1A75 A;  4GPL B;  1QV1 A;  1XK4 C;  3TS5 B;  2KI6 D;  2AMI A;  3AAK A;  1S1E A;  2HET A;  3BXK A;  5JOL A;  1PVB A;  4ICB A;  2L5X B;  1JSA A;  3L4L A;  1YUU A;  1L2O C;  4ZCV A;  5HYD A;  1K2H A;  3I5G C;  2FJY A;  3N7H A;  1FI5 A;  2FJU B;  5AEQ A;  5AFP A;  1FI6 A;  1FPW A;  1CB1 A;  1KFU S;  5FI2 A;  2ZRS A;  3SS5 A;  4MRY A;  2WCK A;  2LP3 A;  5DKQ A;  2BE6 A;  4C0L A;  2KLD A;  1MQ1 A;  2JXL A;  3D0Y A;  4MRX A;  2AUC A;  2KOT A;  4NDC A;  1KQM C;  3KO0 A;  3K21 A;  3TZ1 A;  1NCY A;  4PT1 A;  2M9G A;  1EL4 A;  1A75 B;  5D3O A;  2CCM A;  2QEB A;  1CFD A;  1BMO A;  1OZS A;  1T14 A;  2K8M B;  3JVT B;  2B1U A;  4A4B A;  1JF0 A;  1KFU L;  2H2K A;  3CDN A;  2JT8 A;  1K8U A;  1SCV A;  2BAP A;  3I5H C;  2F8P A;  1BR1 B;  3OB2 B;  2LMU A;  4OCI A;  2JTT A;  4PHJ A;  1QWV A;  1WDC C;  1CDP A;  1MHO A;  2WC8 A;  2LC5 A;  2WOS A;  3DD4 A;  4GUK A;  3WHU B;  1PK0 D;  3B87 A;  4OVN F;  1OMR A;  1XFU O;  2BBN A;  4GGN A;  4PE0 A;  1SKT A;  1Z2C B;  1K9K A;  1IKU A;  1M63 B;  1S6J A;  1YR5 A;  3OX5 A;  3IF7 A;  1W7J B;  3D0Y B;  3PN7 B;  1SCM B;  1TUZ A;  5I2L A;  5HLO A;  4XJK B;  2WND A;  2LMV A;  4Q04 A;  1KWO C;  1UUS A;  3SG6 A;  1CKK A;  1XFW O;  2LVK A;  2KLE A;  2Y1M A;  3L4A A;  2Q4U A;  5CSF A;  2LVI A;  2LV7 A;  3SIB A;  4QJ5 B;  3F45 A;  4P2Y B;  1TN4 A;  1W7I B;  5CPV A;  3E3R A;  1QX5 B;  2JXC A;  3D74 A;  3BOW A;  1DVI A;  2M3W A;  1GM0 A;  2KBM A;  2KQ6 A;  3SJS A;  1XFR A;  1NUB A;  1BG1 A;  1IJ5 A;  1DJH A;  1K90 D;  1RRO A;  3D77 A;  3CYZ A;  3DVJ A;  5KU1 A;  1DJG A;  1V1G A;  4M2O A;  5CSJ A;  2A4J A;  2KAX A;  4MVF A;  3TUY B;  2AAO A;  3S0F A;  2QPT A;  2LAP A;  3SS4 A;  4C0K A;  4AQI A;  4IJ7 A;  4MBE A;  4YGD B;  4WRI A;  2P6B B;  1QS7 A;  1OE9 B;  3JTD B;  1EJ3 A;  2MRD A;  1LKJ A;  2HQW A;  2LP2 A;  2JZI A;  1XFY O;  2K0J A;  2ISD A;  1YX8 A;  1J7P A;  2WCJ A;  4PHN A;  1L7Z A;  1Q80 A;  1KK8 B;  1ZFS A;  4QJ4 B;  3CAB A;  3SG4 A;  2JT3 A;  2VRG A;  1AUI B;  2I2R E; 
#chains in the Genus database with same CATH homology
 1YRT B;  3BOW B;  4HRE E;  1QTX A;  1PSR A;  1Y6W A;  3ICB A;  2L4H A;  5AER A;  1QLK A;  1TNW A;  1REC A;  3TS5 C;  1U5I A;  3VRO A;  2HPS A;  3BQ3 A;  1B4C A;  2LVV A;  2ZND A;  1SR6 B;  1IJ6 A;  2ZN9 A;  1RWY A;  5HKW A;  4GAO A;  4FQO A;  1S5G Y;  1S5G Z;  3CLN A;  2M1U A;  1F4Q A;  1TCF A;  1B8L A;  1UHN A;  3O4Y A;  1SBJ A;  5ER4 X;  2KFH A;  2EGD A;  2LMT A;  1X02 A;  1LA0 A;  2WOR A;  3PM8 A;  5I2O A;  2Y1N A;  1VRK A;  2F3Y A;  3OP0 A;  3RM1 A;  1CTR A;  3NXA A;  1JFJ A;  2MLF C;  2CT9 A;  1DJX A;  1CFP A;  4CFQ A;  1NCX A;  1NPQ A;  1XO5 A;  1IGV A;  1JUO A;  3JVT C;  1YVL A;  1QXP A;  2CTN A;  4MZL A;  4L9M A;  2LNK A;  1QLS A;  3O2P A;  4I5L B;  1AK8 A;  1UHI A;  2M7N A;  1A4P A;  4MEW A;  4GFT A;  2HF5 A;  5DKR A;  2NCO A;  1SL7 A;  5J3X A;  2MA2 A;  3VRR A;  1NX3 A;  2KGR A;  1TOP A;  3FWB A;  1AHR A;  1NSH A;  2K2A A;  1SCM C;  3PN7 C;  2KNE A;  1UP5 A;  1B8R A;  2PAL A;  1BU3 A;  3NSL A;  2ZKM X;  2TN4 A;  3BYA A;  2MJW B;  1AJ4 A;  2LLS A;  1CNP A;  3MSE B;  1EH2 A;  2MLE C;  2BKH B;  2O60 A;  2WCF A;  1XA5 A;  1S3P A;  4XJK A;  1IQ3 A;  1C07 A;  3D10 A;  1YVH A;  4MN0 A;  2E30 A;  2HQ8 A;  2KDH A;  1UHJ A;  1OMV A;  3WNX B;  1DT7 B;  2LM5 A;  1NX1 A;  3DVK A;  2JU0 A;  2OS8 B;  4YRU A;  1QJT A;  1S6C A;  1XFZ O;  2MHH A;  2ZNE A;  3PLF B;  1SRA A;  4PE4 A;  3PFV A;  3ZNI A;  2NLN A;  4I5N B;  4PE1 A;  3TUY C;  1CLM A;  1ZUZ A;  3LK0 A;  1NYA A;  3LL8 B;  2EC6 B;  3OB1 B;  1HQV A;  1B9A A;  2FCD A;  3KPX A;  2KHN A;  2D8N A;  3GOF A;  3JTD C;  4NDD A;  1GGZ A;  1J7Q A;  4NDB A;  1KFX S;  2BBM A;  2KAV A;  1M46 A;  3PSR A;  4HRG A;  4MZJ A;  5D7F A;  5KSZ A;  2KYC A;  2F2O A;  3CGA A;  3WXA A;  1V1F A;  3KEV A;  2EHB A;  1YUT A;  1KK8 C;  1IQ5 A;  1UHK A;  2CXJ A;  1Y1A A;  5KTY A;  1DJI A;  2PVB A;  5CSN A;  1K9P A;  3BUO B;  1CDL A;  1Y0V H;  2BE4 A;  3O6B A;  2BCB A;  1SY9 A;  4DIR A;  4CLN A;  2K7D A;  3BUW B;  3TDU A;  4M2P A;  1F4O A;  1KFX L;  1RFJ A;  4AOM A;  1SR6 C;  2MAZ A;  1J1E A;  1ODB A;  4PE7 A;  3SG7 A;  3AKA A;  2LVJ A;  4GBA A;  2L50 A;  4GNK B;  2F3Z A;  3HCM A;  2KQY A;  2L0P A;  3AAJ A;  1S6I A;  3GK4 X;  1M45 A;  4YGB B;  1Y1U A;  4N1F A;  1D1O A;  3EVV A;  4CFR A;  4N5X A;  1F70 A;  1G8I A;  2F33 A;  1MWN A;  1DF0 B;  2ZN8 A;  1DJW A;  1J7O A;  1EG4 A;  1QIV A;  1NIW A;  1YTZ C;  2JC2 A;  2O5G A;  2SAS A;  1CDN A;  3FIA A;  2R2I A;  1CLL A;  5K89 A;  2I94 A;  5GQQ C;  1MR8 A;  2KYF A;  2CNP A;  2JTZ A;  2K7C A;  1RJV A;  2M29 A;  3QRX A;  2QAC A;  4YGE B;  4E68 A;  2JNX A;  4USL A;  1WLM A;  4I5J A;  2KI6 C;  2H61 C;  1ZOT B;  3EKJ A;  1DGV A;  4OKH A;  1G33 A;  2RGI A;  2Y5I A;  1CM4 A;  5D69 A;  1NWD A;  1PUL A;  3SG5 A;  2H61 A;  3SIA A;  4BY5 A;  3RLZ A;  1CM1 A;  1GQM A;  3EK4 A;  1WLZ A;  1BOC A;  2JWW A;  1AVS A;  2E6W A;  3M0W A;  3TDZ A;  2NXQ A;  2LLT A;  2FOT A;  3CTN A;  3DF0 B;  3I5F B;  3CR2 A;  5PAL A;  4CID A;  2BCX A;  4PHK A;  3C1V A;  4JWQ A;  2NZ0 A;  4JPZ B;  4PAL A;  2LUX A;  4YBH B;  1F71 A;  1QX2 A;  3HX4 A;  2JPT A;  1H4B A;  2M49 B;  2PSR A;  1DJY A;  1F54 A;  2JQ6 A;  1OMD A;  2M7L A;  1LVC D;  1IG5 A;  4OV2 A;  1DJZ A;  4ZCU A;  1RTP 1;  2L2E A;  2OS8 C;  1SL8 A;  1OZO A;  1DTL A;  2GGM A;  3CWG A;  1B8C A;  1S26 D;  2KI4 B;  3H4S E;  3GK1 A;  1QAT A;  1EXR A;  2EC6 C;  2BCA A;  4F0Z B;  2M1K B;  5FYX A;  5JJG A;  2OTG B;  1CFC A;  1M31 A;  1BR4 B;  5HKZ A;  1FBV A;  1GGW A;  1EG3 A;  1JBA A;  1PRW A;  1TIZ A;  1SW8 A;  4DCK A;  1B1G A;  2PRU A;  3FS7 A;  3AKB A;  3LCP C;  1QX7 A;  2V53 A;  2WCB A;  1YX7 A;  3TDI A;  2LUC A;  4AQJ A;  1UWO A;  1OSA A;  4ORB B;  2MBX A;  1R2U A;  2LLU A;  1K93 D;  5BPJ A;  4DUQ A;  1SNL A;  1A03 A;  1B47 A;  3EVR A;  1F8H A;  2BEC A;  1KQV A;  1MUX A;  3LK1 A;  2CBL A;  2Y4Q A;  1K9U A;  2Q91 A;  1GJY A;  5ER5 A;  4D1E A;  2BL0 B;  3OHM B;  4MSP A;  5I2Q A;  1LXF C;  3IQO A;  1BOD A;  4MLW A;  1SL9 A;  1XK4 A;  1QV0 A;  1CMG A;  2ZFD A;  1A2X A;  4UPG A;  1PSB A;  3CZT X;  1R6P A;  1C7V A;  5CSI A;  2DOQ A;  1KCY A;  4P5O E;  1B7T Y;  2KBI A;  1B7T Z;  2IS9 A;  3BUX B;  1WRL A;  4DS7 A;  1CFF A;  1J55 A;  1N65 A;  2COL B;  2LHL A;  3VRN A;  2LAN A;  2M0R A;  1TTX A;  2GV5 A;  1KSM A;  1JF2 A;  2G2B A;  1G4Y R;  1DF0 A;  3DVM A;  2M8U A;  1JWD A;  1SMG A;  2I18 A;  1H8B A;  1J1D A;  3I5I B;  4M2Q A;  2WCE A;  1FF1 A;  1TNX A;  5IBW A;  1TNP A;  1NP8 A;  3VGO A;  4GGF C;  1NX2 A;  1SYM A;  1K95 A;  1SK6 D;  1YUS A;  1NCZ A;  2M97 A;  3ZWH A;  4OR9 B;  2KFF A;  2GGZ A;  3NSK A;  4GGF A;  1BJF A;  1L2O B;  4IL1 A;  3IQQ A;  1CLB A;  3CR4 X;  4BY4 A;  1N2D A;  2I7A A;  4YGA A;  1XFX O;  3I5G B;  1RK9 A;  2LCP A;  1WRZ A;  1TNQ A;  3I5F C;  4C0J A;  2PMY A;  1AJ5 A;  1WY9 A;  5AXI A;  2KSP A;  1MF8 B;  3EK8 A;  1FW4 A;  5F6T A;  3DF0 A;  1IRJ A;  3A8R A;  4R1E A;  3DVE A;  4XYN A;  1NX0 A;  1OQP A;  1F55 A;  1KQM B;  1C7W A;  1ZAC A;  2NCP A;  2LHI A;  2SCP A;  1M39 A;  1PVA A;  3O78 A;  2JUL A;  1J7R A;  1XFV O;  3KF9 A;  2KI4 C;  1QAS A;  4JQ0 D;  1JFK A;  1TRF A;  3EKH A;  3I5H B;  4TNC A;  5HKY A;  1IH0 A;  2OTG C;  3PAL A;  1YUR A;  1AP4 A;  3CR5 X;  4PHM A;  1S36 A;  1WDC B;  3PAT A;  1K96 A;  1KSO A;  2F2P A;  2L98 A;  5AAN A;  1LIN A;  4MZK A;  4DRW A;  3KHE A;  1CDM A;  1K94 A;  3SG3 A;  1E8A A;  1SPY A;  5TNC A;  4PCW A;  1UHH A;  4WQ2 A;  1UUR A;  1ALV A;  2K61 A;  1LA3 A;  1YRU B;  1BLQ A;  4QJ3 B;  1MXL C;  3VRQ A;  1CMF A;  2K7B A;  1KWO B;  4N1G A;  4CPV A;  3FWC A;  2K7O A;  2KFG A;  1BF5 A;  4YI9 A;  3BUM B;  3BUN B;  2BKI B;  4YI8 A;  2K2F A;  1HT9 A;  2BL0 C;  2ZRT A;  3VRP A;  4WQ3 A;  1QIW A;  2JT0 A;  3OX6 A;  2KAY A;  1A29 A;  1QVI Y;  4PDZ A;  1QVI Z;  2JOJ A;  1OOJ A;  2JRF A;  1IWQ A;  1XVJ A;  4YGC B;  1WRK A;  2OPO A;  1N0Y A;  4ORA B;  1PAL A;  4I5K A;  2L4I A;  3CS1 A;  4ETO A;  1TCO B;  3LLE A;  1XYD A;  3NSO A;  4NQG A;  1Y1X A;  1MXE A;  4HSZ A;  3GK2 A;  5G08 A;  2JNF A;  2G9B A;  2KGB C;  4A4C A;  2LE9 B;  5HLV A;  1JC2 A;  3A4U B;  3WHT B;  4HRH A;  3SG2 A;  1DGU A;  1U5I B;  5DKN A;  3EK7 A;  3I5I C;  1ZMZ A;  3NSI A;  4U8D A;  1ALW A;  2FCE A;  4ORC B;  5B8I B;  1KK7 Y;  2PAS A;  5I8N A;  1KK7 Z;  4FTG A;  1DMO A;  3EVU A;  2L51 A;  1BT6 A;  1A75 A;  4GPL B;  1QV1 A;  1XK4 C;  3TS5 B;  2KI6 D;  2AMI A;  3AAK A;  1S1E A;  2HET A;  3BXK A;  5JOL A;  1PVB A;  4ICB A;  2L5X B;  1JSA A;  1YUU A;  1L2O C;  4ZCV A;  5HYD A;  1K2H A;  3I5G C;  1FI5 A;  2FJU B;  5AEQ A;  5AFP A;  1FI6 A;  1FPW A;  1CB1 A;  1KFU S;  2ZRS A;  4MRY A;  2LP3 A;  5DKQ A;  2BE6 A;  4C0L A;  1MQ1 A;  2JXL A;  3D0Y A;  4MRX A;  2AUC A;  2KOT A;  4NDC A;  1KQM C;  3KO0 A;  3K21 A;  3TZ1 A;  1NCY A;  2M9G A;  1EL4 A;  1A75 B;  2CCM A;  1CFD A;  1BMO A;  1OZS A;  2K8M B;  3JVT B;  2B1U A;  4A4B A;  1JF0 A;  1KFU L;  2H2K A;  2JT8 A;  1K8U A;  1SCV A;  3I5H C;  4OCI A;  2F8P A;  1BR1 B;  3OB2 B;  2LMU A;  2JTT A;  4PHJ A;  1WDC C;  1CDP A;  1MHO A;  2WC8 A;  2LC5 A;  2WOS A;  3DD4 A;  4GUK A;  3WHU B;  1PK0 D;  4QJ5 B;  4OVN F;  1OMR A;  1XFU O;  2BBN A;  4GGN A;  4PE0 A;  1SKT A;  1K9K A;  1IKU A;  1M63 B;  1S6J A;  1YR5 A;  3OX5 A;  3IF7 A;  1W7J B;  3D0Y B;  3PN7 B;  1SCM B;  5I2L A;  5HLO A;  4XJK B;  2WND A;  2LMV A;  4Q04 A;  1KWO C;  1UUS A;  3SG6 A;  1CKK A;  1XFW O;  2LVK A;  2Y1M A;  2Q4U A;  5CSF A;  2LVI A;  2LV7 A;  3SIB A;  3F45 A;  4P2Y B;  1TN4 A;  1W7I B;  5CPV A;  3E3R A;  1QX5 B;  2JXC A;  3BOW A;  1DVI A;  2M3W A;  2KBM A;  2KQ6 A;  3SJS A;  1NUB A;  1BG1 A;  1IJ5 A;  1DJH A;  1K90 D;  1RRO A;  3DVJ A;  5KU1 A;  1DJG A;  1V1G A;  4M2O A;  5CSJ A;  2A4J A;  2KAX A;  4MVF A;  3TUY B;  2AAO A;  2QPT A;  2LAP A;  4C0K A;  4AQI A;  4MBE A;  4YGD B;  4WRI A;  2P6B B;  1QS7 A;  1OE9 B;  3JTD B;  1EJ3 A;  2MRD A;  1LKJ A;  2HQW A;  2LP2 A;  2JZI A;  1XFY O;  2K0J A;  2ISD A;  1YX8 A;  1J7P A;  4PHN A;  1L7Z A;  1Q80 A;  1KK8 B;  1ZFS A;  4QJ4 B;  3SG4 A;  2JT3 A;  2VRG A;  1AUI B;  2I2R E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...