2M9GA

Solution structure of calcium-bound human s100a12
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
92
structure length
92
Chain Sequence
MTKLEEHLEGIVNIFHQYSVRKGHFDTLSKGELKQLLTKELANTIKNIKDKAVIDEIFQGLDANQDEQVDFQEFISLVAIALKAAHYHTHKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein S100-A12
publication title Solution structure of human Ca(2+)-bound S100A12
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal binding protein
total genus 27
structure length 92
sequence length 92
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-06-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2m9gA00
3OB2B 1SKTA 1JSAA 2KGBC 1CLLA 1C07A 1TOPA 4GGFC 1EL4A 2K7CA 1J1EA 3BQ3A 3LK0A 4MRXA 1L2OB 1RK9A 2M97A 1BLQA 1SY9A 3IQQA 4WQ3A 1AK8A 1ZOTB 2SASA 2LP3A 1QATA 1KFXL 1VRKA 1K2HA 2OTGC 3I5IB 3A4UB 1OQPA 2PASA 4YI9A 3KPXA 5F6TA 2M7NA 3NSLA 5AERA 2WORA 3VRQA 1XA5A 1K94A 1JF2A 4CLNA 1DJXA 1V1GA 4YBHB 3GK1A 1IRJA 3EKHA 4N5XA 1YTZC 5AANA 4GBAA 4PHJA 2M1UA 1YURA 4AQIA 2PSRA 2LUCA 1CNPA 2HQWA 3H4SE 1PRWA 1B8RA 3O6BA 4DCKA 4MLWA 4YGBB 4ZCVA 2K2FA 1QIWA 2LLSA 1UHKA 5I8NA 1CDNA 1KK7Z 2L4IA 1S36A 1X02A 1XK4C 2JTZA 2O60A 4A4BA 3AAKA 4C0KA 1PK0D 1YVLA 1V1FA 1N2DA 1RJVA 1Y0VH 1YUSA 2JZIA 1G4YR 2Q4UA 1HQVA 2QPTA 1R2UA 1XYDA 2LP2A 2L0PA 1TIZA 1GQMA 3DVKA 4AOMA 1S5GY 2DOQA 5J3XA 4YI8A 3TUYC 1J55A 1AJ4A 1EG4A 1XO5A 5HLVA 1FF1A 3BOWA 1XFWO 1KFUS 2F3YA 3JVTB 5D69A 3SG5A 1TCOB 2EGDA 5GQQC 1LKJA 1QVIZ 1TTXA 2BCAA 5HYDA 1U5IA 1J7QA 2BL0C 1Y1UA 2JQ6A 3LL8B 2Y1MA 1J7PA 1AHRA 2L5XB 3SG3A 1R6PA 3VGOA 1C7VA 3BXKA 1NSHA 3M0WA 5HKZA 5G08A 1DTLA 1K9PA 2P6BB 2IS9A 1SYMA 1OOJA 2LAPA 2WCBA 1F54A 1QLSA 1Y6WA 2BE4A 3BUNB 2LANA 2JXLA 2K2AA 1AP4A 2E6WA 3PN7B 4IL1A 1KQVA 1IGVA 1MUXA 1L7ZA 2E30A 2KI4C 2OTGB 4QJ3B 2CTNA 3TDIA 4NDCA 1J7RA 1YRTB 3SIBA 1BOCA 1TNWA 1CM4A 4HRHA 4D1EA 2G9BA 1GJYA 2LCPA 1W7IB 1K90D 3FIAA 5JOLA 1CDMA 1CM1A 1M45A 4TNCA 1ALWA 2O5GA 1ZFSA 4PHNA 1OE9B 2EC6C 1LVCD 3K21A 2GGMA 1BMOA 1WRKA 1CLMA 2M0RA 2HPSA 1QX2A 2BECA 1NCZA 1S1EA 1TRFA 1PVBA 1A75B 2BCBA 5I2QA 1QXPA 3CWGA 2PVBA 5DKRA 3EKJA 1RROA 3SG7A 1CKKA 1SK6D 4XJKA 1IQ3A 1B7TZ 3RM1A 1XFZO 2JXCA 2GV5A 3OB1B 2PMYA 4YGAA 1TCFA 2ZFDA 4PALA 1NPQA 3MSEB 3WHUB 2CCMA 1YUUA 2JNFA 1IG5A 3TUYB 1C7WA 2KQ6A 2MHHA 3FWBA 1F8HA 1JWDA 2FJUB 1AVSA 3LLEA 3TS5C 1SL8A 1KSMA 4M2PA 2M7LA 1NCXA 2LV7A 1SR6C 1XFUO 2COLB 3FWCA 3OP0A 1KQMC 1PSRA 2JTTA 1QS7A 4M2OA 4YRUA 1M46A 3SG2A 1ZACA 4NDDA 2V53A 3KO0A 2BL0B 3CS1A 2KFFA 2HETA 2LMUA 2NCPA 4JQ0D 4L9MA 5CSJA 1SMGA 1LA3A 1WLZA 1B1GA 2JRFA 3F45A 1K96A 1XVJA 2M49B 1CMFA 2BBMA 2MLFC 1JUOA 1MQ1A 1OSAA 2NXQA 4PHMA 4BY4A 1WLMA 2GGZA 1RWYA 1K93D 2ZRSA 3SG4A 1KFUL 4PE1A 5CSIA 3DD4A 1BJFA 2JOJA 1F70A 5KU1A 5TNCA 2NZ0A 3EVRA 3FS7A 1NX0A 2CT9A 1E8AA 5CPVA 1QJTA 1PALA 4F0ZB 5ER4X 2KI4B 2KBIA 1M39A 2LVKA 2MRDA 2OPOA 2JU0A 2KSPA 3VRRA 3WHTB 4YGDB 2AAOA 1SBJA 3PSRA 2LM5A 3KEVA 1GGZA 1B47A 1F71A 3O78A 1MXEA 2LLTA 1CFPA 2F3ZA 1J7OA 3CZTX 4DRWA 1K9UA 2R2IA 4ORCB 1IKUA 1NYAA 2FOTA 1J1DA 2EC6B 3KF9A 2JT8A 2JWWA 3GOFA 1DJIA 2HF5A 2KAXA 1KWOC 4MZKA 1YX7A 3DF0B 3NXAA 1QV1A 1WRLA 3PM8A 4YGCB 3WXAA 2L98A 5AEQA 2LVVA 3CR4X 2CNPA 1A03A 3WNXB 4P5OE 1Y1XA 2BE6A 5DKNA 1TNQA 3D0YA 4GNKB 4JWQA 2KBMA 2LC5A 1RTP1 1PVAA 1IH0A 1W7JB 1DJYA 3TS5B 1CMGA 4ETOA 1DJWA 1F4OA 1PSBA 1SR6B 1SW8A 5AFPA 2M9GA 1XFXO 1KQMB 2K61A 1CFFA 1QLKA 3EK7A 3NSIA 1A29A 2D8NA 2K7BA 3CTNA 2LLUA 3VROA 4GUKA 4N1GA 2RGIA 1Q80A 1WY9A 4ORBB 3ZWHA 5K89A 2EHBA 1UHHA 2K8MB 1DF0A 1LA0A 2OS8C 5KSZA 1N65A 4MN0A 3OX5A 2WOSA 2KFHA 3GK4X 1NX2A 1OZSA 1CDLA 1S6CA 3D10A 2M1KB 3NSKA 1B9AA 1KK8C 1QTXA 4HSZA 1K9KA 4MSPA 1OZOA 3SJSA 4N1FA 2I18A 1SL9A 1JFJA 2BKIB 4CPVA 1BT6A 2A4JA 1Y1AA 2FCDA 4OR9B 2L4HA 4XYNA 3ZNIA 1LXFC 1UUSA 2JT0A 1EJ3A 1H8BA 1IJ6A 1XFYO 3CR5X 1TN4A 1CDPA 2I2RE 3GK2A 2VRGA 5B8IB 1BF5A 2KOTA 1CLBA 1HT9A 2ZRTA 4E68A 3IF7A 4HREE 5PALA 1KSOA 1IWQA 1EH2A 1SRAA 1UHIA 1QVIY 3A8RA 2ZNDA 3BOWB 3LK1A 5D7FA 1IQ5A 1FPWA 4NQGA 4M2QA 3BYAA 1OMDA 1MXLC 2NLNA 2MA2A 1KWOB 2H61A 1JBAA 2F33A 1AUIB 2JC2A 4UPGA 2LVIA 2M8UA 1U5IB 3HCMA 4WQ2A 1CFCA 5IBWA 3NSOA 4GPLB 2PRUA 2I7AA 4PCWA 1QX7A 2KFGA 2F2OA 2BKHB 2LNKA 4HRGA 1A4PA 4QJ5B 2K7OA 3DVJA 2BCXA 1NIWA 4PE0A 2MAZA 4I5KA 1K95A 1ALVA 5BPJA 3EVVA 4A4CA 2L51A 3CGAA 3PFVA 1UHJA 3EK8A 1CFDA 2Y4QA 4MRYA 5HLOA 3C1VA 1BG1A 2KGRA 4ORAB 3SIAA 3I5GC 4FTGA 2ZKMX 2K0JA 2ISDA 1NX1A 1TNXA 2KI6D 1UP5A 2HQ8A 1H4BA 1DGUA 2OS8B 2LE9B 3I5FC 1NWDA 1UHNA 1S5GZ 2LUXA 5CSNA 3I5HC 1NUBA 2M3WA 4C0JA 1N0YA 1BU3A 2NCOA 1KK8B 1MWNA 1B7TY 2BBNA 2KYFA 3HX4A 1DJGA 1G33A 3AKAA 2TN4A 3TDZA 1RFJA 3PN7C 3E3RA 3JTDC 4GGFA 1SCMC 3O2PA 1BR1B 4I5NB 2AUCA 4OVNF 4XJKB 5CSFA 4PDZA 3DVMA 4OKHA 2ZN8A 1OMVA 1QASA 3AKBA 5FYXA 2AMIA 1YVHA 2L2EA 1DJZA 1LINA 3TDUA 2JT3A 3PLFB 1AJ5A 1PULA 1S6IA 4PHKA 4CIDA 1DJHA 2K7DA 2KYCA 4MVFA 1EXRA 1ODBA 2FCEA 1NX3A 2KHNA 1SPYA 4ZCUA 1G8IA 2LHLA 3PATA 1FI5A 4Q04A 4MZLA 1GGWA 2QACA 4OCIA 2F8PA 1QX5B 4BY5A 2WCFA 2Y5IA 1WDCC 1M63B 4FQOA 3AAJA 4U8DA 1SL7A 1JFKA 2LMVA 3IQOA 1A75A 1KFXS 1OMRA 2MLEC 3LCPC 4QJ4B 1XK4A 4DS7A 2WNDA 2G2BA 2LMTA 1DT7B 3CR2A 5HKWA 2WC8A 1NCYA 4GFTA 4CFRA 3BUWB 3BUOB 1F4QA 4JPZB 2KQYA 3EVUA 1KK7Y 2I94A 5I2OA 4YGEB 1XFVO 4MEWA 3I5GB 3BUMB 1L2OC 1DGVA 4NDBA 4GGNA 4ICBA 1QIVA 4PE7A 1MF8B 3I5FB 3DVEA 5AXIA 2CXJA 4USLA 3I5HB 2KI6C 3I5IC 2M29A 4GAOA 1ZMZA 3TZ1A 1JF0A 1B8CA 2L50A 5KTYA 1S3PA 2KAVA 2WCEA 2H61C 5JJGA 4P2YB 1YR5A 1DMOA 2H2KA 3O4YA 2JULA 4DIRA 1A2XA 2Q91A 3JTDB 1SCMB 5I2LA 3EK4A 1NP8A 1S6JA 1YUTA 2SCPA 3D0YB 4AQJA 1FI6A 3SG6A 4DUQA 1SNLA 2ZNEA 1K8UA 3OX6A 2MJWB 1MHOA 2LHIA 2KDHA 2Y1NA 3ICBA 1BR4B 2CBLA 5DKQA 2LVJA 4C0LA 1SCVA 1DVIA 2F2PA 2JPTA 3QRXA 1D1OA 2KNEA 1KCYA 1BODA 1YRUB 3CLNA 1B4CA 1IJ5A 2JNXA 1JC2A 4CFQA 1MR8A 3BUXB 4MBEA 1B8LA 4I5JA 2KAYA 1S26D 2PALA 2MBXA 1CTRA 5ER5A 1FBVA 4OV2A 1WDCB 1WRZA 3OHMB 1DF0B 3KHEA 3RLZA 1F55A 3VRPA 3PALA 3JVTC 4WRIA 3VRNA 1UURA 1M31A 1ZUZA 1CB1A 4I5LB 4PE4A 4R1EA 2ZN9A 1EG3A 3DF0A 5HKYA 1TNPA 1YX8A 4MZJA 1FW4A 1RECA 1UWOA 2B1UA 1QV0A
chains in the Genus database with same CATH superfamily
3OB2B 1SKTA 1JSAA 2KGBC 1CLLA 1C07A 1TOPA 3O4XA 4GGFC 1EL4A 2K7CA 2QDIA 1J1EA 3BQ3A 2KLEA 3LK0A 4MRXA 1L2OB 1RK9A 2M97A 5FI2A 1BLQA 2WCJA 1SY9A 3IQQA 3B6XA 4WQ3A 1AK8A 1ZOTB 2SASA 2LP3A 1QATA 1KFXL 1VRKA 1K2HA 2OTGC 3I5IB 3A4UB 1OQPA 2PASA 4YI9A 3KPXA 5F6TA 3IVTA 2M7NA 3NSLA 5AERA 2WORA 3VRQA 1XA5A 1K94A 3CZ2A 1JF2A 4CLNA 1DJXA 1Z4HA 1V1GA 4YBHB 3GK1A 1IRJA 3EKHA 4N5XA 1YTZC 3UNWA 5AANA 4GBAA 4PHJA 2M1UA 1YURA 4AQIA 2PSRA 3DZTA 1Z2CB 2WCHA 2LUCA 1CNPA 2HQWA 3H4SE 1PRWA 1B8RA 3O6BA 4DCKA 4MLWA 4YGBB 4ZCVA 2K2FA 1QIWA 2LLSA 1UHKA 4KYNA 5I8NA 1OOGA 1CDNA 1KK7Z 2L4IA 1S36A 1X02A 1XK4C 2JTZA 2O60A 4A4BA 3AAKA 4C0KA 1PK0D 1YVLA 3UO9A 1V1FA 3R72A 1N2DA 1RJVA 3BFBA 1Y0VH 1YUSA 2JZIA 1G4YR 2Q4UA 1HQVA 2QPTA 1R2UA 1XYDA 2LP2A 1QWVA 2L0PA 1TIZA 1GQMA 3DVKA 4AOMA 1S5GY 2DOQA 5J3XA 4YI8A 3TUYC 1J55A 1AJ4A 1EG4A 1XO5A 5HLVA 1FF1A 3BOWA 3D75A 1XFWO 1KFUS 2F3YA 3JVTB 5D69A 3SG5A 3VB1A 1TCOB 3L4AA 2EGDA 5GQQC 1LKJA 1QVIZ 1TTXA 2BCAA 5HYDA 1U5IA 2H8VA 1J7QA 2BL0C 1Y1UA 2JQ6A 3LL8B 2Y1MA 1J7PA 1AHRA 2L5XB 3SG3A 1R6PA 3VGOA 4FQTA 1C7VA 2WCMA 3BXKA 1NSHA 3M0WA 5HKZA 1DC1A 5G08A 3NHTA 1DTLA 3V2LA 1K9PA 2P6BB 2IS9A 1SYMA 1OOJA 2LAPA 2KLDA 2WCBA 1F54A 3OGNA 1QLSA 1Y6WA 2BE4A 3BUNB 2LANA 2JXLA 1DELA 1LS8A 2K2AA 1AP4A 2E6WA 3PN7B 4IL1A 1KQVA 1IGVA 1MUXA 1L7ZA 2E30A 2KI4C 2OTGB 2WC6A 2CTNA 4QJ3B 3TDIA 4NDCA 1J7RA 1YRTB 3SIBA 1BOCA 1TNWA 1CM4A 4HRHA 4D1EA 2G9BA 1GJYA 2LCPA 1W7IB 1K90D 3FIAA 5JOLA 1CDMA 1CM1A 1M45A 4TNCA 1ALWA 2O5GA 1ZFSA 3L47A 4PHNA 3PJIA 1OE9B 2EC6C 1LVCD 3K21A 2GGMA 1BMOA 1WRKA 1CLMA 1ORGA 2M0RA 2L5YA 2HPSA 1QX2A 2BECA 1NCZA 1S1EA 1TRFA 1PVBA 1A75B 2BCBA 5I2QA 1QXPA 3CWGA 2PVBA 5DKRA 3EKJA 1C3YA 1RROA 3SG7A 1CKKA 1SK6D 3D77A 4XJKA 1IQ3A 1B7TZ 2QEVA 1XFZO 3RM1A 2JXCA 2GV5A 3OB1B 2PMYA 4YGAA 1TCFA 2ZFDA 4PALA 1NPQA 3MSEB 3WHUB 2CCMA 1YUUA 2JNFA 1IG5A 3TUYB 2WCLA 1C7WA 2KQ6A 2MHHA 3FWBA 1F8HA 1JWDA 2FJUB 1AVSA 2P70A 3LLEA 3TS5C 1SL8A 1KSMA 4M2PA 2M7LA 1NCXA 2LV7A 3D73A 1SR6C 1XFUO 2COLB 2L2CA 3FWCA 3OP0A 1KQMC 1PSRA 2KPHA 2JTTA 1QS7A 4M2OA 4YRUA 1M46A 3SG2A 5EL2A 1ZACA 4NDDA 2V53A 3KO0A 2BL0B 3CS1A 2KFFA 2HETA 2LMUA 2NCPA 4JQ0D 4L9MA 5CSJA 1SMGA 1LA3A 1WLZA 4OZDA 1B1GA 2JRFA 3F45A 1K96A 1XVJA 2M49B 5HL1A 2BBMA 1CMFA 2MLFC 1JUOA 1MQ1A 1OSAA 2NXQA 4PHMA 3B86A 4BY4A 1WLMA 2GGZA 1RWYA 1K93D 2ZRSA 3SG4A 1KFUL 4PE1A 3D78A 5CSIA 3DD4A 2QEBA 1BJFA 2JOJA 1F70A 5KU1A 5TNCA 2NZ0A 3EVRA 3FS7A 1NX0A 2CT9A 1E8AA 5CPVA 1QJTA 1PALA 4F0ZB 5ER4X 3QMEA 2KI4B 2KBIA 5D3OA 1XFRA 1M39A 2LVKA 2MRDA 2OPOA 1OOIX 2JU0A 2KSPA 3VRRA 3WHTB 4YGDB 3DYEA 2AAOA 1SBJA 3PSRA 2LM5A 3KEVA 2P71A 1GGZA 1B47A 1DQEA 1F71A 3O78A 1MXEA 2LLTA 1CFPA 2F3ZA 3D76A 1J7OA 3BJHA 3CZTX 3B7AA 4DRWA 1K9UA 2R2IA 4ORCB 1IKUA 1NYAA 2FOTA 1J1DA 2EC6B 3KF9A 2JT8A 2JWWA 3GOFA 1DJIA 2HF5A 2KAXA 1KWOC 3RZSA 4MZKA 1YX7A 3DF0B 3NXAA 1QV1A 1WRLA 3PM8A 4YGCB 3WXAA 2L98A 5AEQA 2LVVA 3CR4X 1C3ZA 2CNPA 1A03A 3WNXB 4P5OE 1Y1XA 2BE6A 5DKNA 1TNQA 3D0YA 4GNKB 4JWQA 2KBMA 2LC5A 3NGVA 1RTP1 1PVAA 2QEHA 1IH0A 1W7JB 3R1OA 1DJYA 3TS5B 1CMGA 4ETOA 1DJWA 1F4OA 1PSBA 1SR6B 1SW8A 5AFPA 1P28A 3SS5A 2M9GA 1XFXO 1KQMB 2K61A 3CDNA 1CFFA 1QLKA 2YGUA 3EK7A 3NSIA 1A29A 2D8NA 2K7BA 3CTNA 2LLUA 1SSEB 3VROA 4GUKA 4N1GA 2RGIA 1Q80A 1WY9A 4ORBB 3ZWHA 5K89A 2EHBA 1UHHA 2K8MB 1DF0A 1LA0A 2OS8C 5KSZA 2GTEA 1N65A 4MN0A 3OX5A 2WOSA 2KFHA 3DY9A 4IJ7A 3GK4X 1NX2A 1OZSA 1CDLA 1S6CA 3D10A 4INXA 2M1KB 3NSKA 1B9AA 1KK8C 1QTXA 4HSZA 1K9KA 4MSPA 1OZOA 3SJSA 4N1FA 2I18A 1SL9A 1JFJA 2BKIB 4CPVA 1BT6A 2A4JA 1Y1AA 2FCDA 4OR9B 2L4HA 4XYNA 3ZNIA 1LXFC 1OOFA 1UUSA 2JT0A 1EJ3A 1H8BA 1IJ6A 1XFYO 3CR5X 3S0BA 1TN4A 1CDPA 2I2RE 3GK2A 2ERBA 2VRGA 5B8IB 1BF5A 2KOTA 1CLBA 1HT9A 2ZRTA 4E68A 3IF7A 4HREE 5PALA 1KSOA 1IWQA 1EH2A 1SRAA 1UHIA 1QVIY 2BAPA 3A8RA 3S0FA 2ZNDA 3BOWB 3LK1A 5D7FA 1TWOA 1IQ5A 1FPWA 4NQGA 1OOHA 4M2QA 3BYAA 3DXLA 1OMDA 1MXLC 2NLNA 2MA2A 1KWOB 2H61A 2WC5A 2F33A 1AUIB 1JBAA 2JC2A 4UPGA 2LVIA 2M8UA 1U5IB 3HCMA 4WQ2A 1CFCA 2PQLA 5IBWA 3NSOA 4GPLB 2PRUA 3B87A 2I7AA 4F7FA 4PCWA 1QX7A 2KFGA 2F2OA 2BKHB 2BNXA 3FE9A 2LNKA 4HRGA 3SS3A 1A4PA 4QJ5B 2K7OA 3DVJA 3CZ0A 2BCXA 1NIWA 4PE0A 2MAZA 5DICA 4I5KA 1K95A 1ALVA 5BPJA 3EVVA 4A4CA 2L51A 3CGAA 4JD9A 3PFVA 1UHJA 3EK8A 3S0AA 1CFDA 2Y4QA 3D74A 4MRYA 3C1VA 5HLOA 1BG1A 2KGRA 4ORAB 3SIAA 3I5GC 4FTGA 2ZKMX 2K0JA 3R1VA 2ISDA 1NX1A 1TNXA 2KI6D 1UP5A 2HQ8A 1H4BA 1DGUA 2OS8B 2LE9B 3I5FC 1NWDA 1UHNA 1S5GZ 2LUXA 3N7HA 5CSNA 3I5HC 1NUBA 2M3WA 4C0JA 1N0YA 1BU3A 2NCOA 3CZ1A 1KK8B 1MWNA 1B7TY 1DEKA 2BBNA 2KYFA 3HX4A 1DJGA 1G33A 3AKAA 2TN4A 3TDZA 1RFJA 3PN7C 3E3RA 1T14A 3JTDC 4GGFA 1SCMC 3O2PA 1BR1B 4I5NB 2AUCA 4OVNF 4XJKB 3OBVA 3BFHA 5CSFA 4PDZA 3DVMA 4OKHA 2ZN8A 1OMVA 1QASA 3AKBA 5FYXA 2AMIA 5I94A 1YVHA 2L2EA 4INWA 1DJZA 1LINA 3TDUA 2JT3A 3PLFB 3EG5B 1AJ5A 1PULA 1S6IA 3L4LA 4PHKA 4CIDA 1DJHA 2K7DA 2KYCA 4MVFA 1EXRA 1ODBA 2FCEA 1NX3A 2KHNA 1SPYA 4ZCUA 1G8IA 2LHLA 3PATA 1FI5A 4Q04A 4MZLA 1GGWA 2QACA 3R1PA 1OW4A 4OCIA 3S0DA 2F8PA 1QX5B 4BY5A 2WCFA 2Y5IA 1WDCC 1M63B 3FE6A 4FQOA 3AAJA 4U8DA 1SL7A 1JFKA 2LMVA 3IQOA 3Q8IA 1A75A 1KFXS 1OMRA 2MLEC 2WCKA 3LCPC 4QJ4B 1XK4A 4DS7A 2JPOA 2WNDA 2G2BA 2LMTA 3BFAA 3SS4A 1DT7B 3CR2A 5HKWA 2WC8A 1NCYA 4GFTA 4CFRA 3BUWB 3BUOB 1F4QA 3K1EA 4JPZB 2KQYA 3EVUA 1KK7Y 3FE8A 2I94A 5I2OA 4YGEB 1XFVO 4MEWA 3I5GB 3BUMB 2K60A 1L2OC 5FI6A 1DGVA 4NDBA 4GGNA 4ICBA 1QIVA 4PE7A 1MF8B 3I5FB 3DVEA 5AXIA 2CXJA 4USLA 3I5HB 3B88A 2KI6C 3I5IC 2M29A 4GAOA 1ZMZA 3TZ1A 1JF0A 1B8CA 2L50A 5KTYA 1S3PA 2KAVA 2QEOA 2WCEA 2H61C 4JKTA 4P2YB 5JJGA 1YR5A 1DMOA 2H2KA 3O4YA 2JULA 4DIRA 1A2XA 2Q91A 3JTDB 1SCMB 5I2LA 3EK4A 1NP8A 1S6JA 1YUTA 2SCPA 3D0YB 4AQJA 1FI6A 3SG6A 4DUQA 1SNLA 2ZNEA 1K8UA 3OX6A 2MJWB 1MHOA 2LHIA 2KDHA 2Y1NA 4PT1A 3ICBA 1BR4B 1W9ZA 2CBLA 5DKQA 2LVJA 4C0LA 1SCVA 1DVIA 2F2PA 2JPTA 3CABA 3QRXA 3PM2A 3NHIA 1D1OA 1TUJA 2KNEA 1KCYA 1BODA 1YRUB 3CLNA 1B4CA 1IJ5A 2JNXA 1JC2A 4CFQA 1MR8A 3BUXB 4MBEA 1B8LA 4I5JA 2KAYA 1S26D 2PALA 2MBXA 1CTRA 5ER5A 1FBVA 4OV2A 1WDCB 1WRZA 3OHMB 1DF0B 3KHEA 1IIOA 3RLZA 1F55A 3VRPA 3PALA 3JVTC 4WRIA 5FI7A 3CYZA 1TUZA 1UURA 3VRNA 1M31A 1ZUZA 2PYQA 1CB1A 4I5LB 4PE4A 4R1EA 2ZN9A 1EG3A 3DF0A 2FJYA 1TNPA 1YX8A 3S0GA 3S0EA 5HKYA 1GM0A 4MZJA 1FW4A 1RECA 1UWOA 2B1UA 1QV0A
chains in the Genus database with same CATH topology
3OB2B 1SKTA 1JSAA 2KGBC 1CLLA 1C07A 1TOPA 4GGFC 1EL4A 2K7CA 1J1EA 3BQ3A 3LK0A 4MRXA 1L2OB 1RK9A 2M97A 1BLQA 1SY9A 3IQQA 4WQ3A 1AK8A 1ZOTB 2SASA 2LP3A 1QATA 1KFXL 1VRKA 1K2HA 2OTGC 3I5IB 3A4UB 1OQPA 2PASA 4YI9A 3KPXA 5F6TA 2M7NA 3NSLA 5AERA 2WORA 3VRQA 1XA5A 1K94A 1JF2A 4CLNA 1DJXA 1V1GA 4YBHB 3GK1A 1IRJA 3EKHA 4N5XA 1YTZC 5AANA 4GBAA 4PHJA 2M1UA 1YURA 4AQIA 2PSRA 2LUCA 1CNPA 2HQWA 3H4SE 1PRWA 1B8RA 3O6BA 4DCKA 4MLWA 4YGBB 4ZCVA 2K2FA 1QIWA 2LLSA 1UHKA 5I8NA 1CDNA 1KK7Z 2L4IA 1S36A 1X02A 1XK4C 2JTZA 2O60A 4A4BA 3AAKA 4C0KA 1PK0D 1YVLA 1V1FA 1N2DA 1RJVA 1Y0VH 1YUSA 2JZIA 1G4YR 2Q4UA 1HQVA 2QPTA 1R2UA 1XYDA 2LP2A 2L0PA 1TIZA 1GQMA 3DVKA 4AOMA 1S5GY 2DOQA 5J3XA 4YI8A 3TUYC 1J55A 1AJ4A 1EG4A 1XO5A 5HLVA 1FF1A 3BOWA 1XFWO 1KFUS 2F3YA 3JVTB 5D69A 3SG5A 1TCOB 2EGDA 5GQQC 1LKJA 1QVIZ 1TTXA 2BCAA 5HYDA 1U5IA 1J7QA 2BL0C 1Y1UA 2JQ6A 3LL8B 2Y1MA 1J7PA 1AHRA 2L5XB 3SG3A 1R6PA 3VGOA 1C7VA 3BXKA 1NSHA 3M0WA 5HKZA 5G08A 1DTLA 1K9PA 2P6BB 2IS9A 1SYMA 1OOJA 2LAPA 2WCBA 1F54A 1QLSA 1Y6WA 2BE4A 3BUNB 2LANA 2JXLA 2K2AA 1AP4A 2E6WA 3PN7B 4IL1A 1KQVA 1IGVA 1MUXA 1L7ZA 2E30A 2KI4C 2OTGB 4QJ3B 2CTNA 3TDIA 4NDCA 1J7RA 1YRTB 3SIBA 1BOCA 1TNWA 1CM4A 4HRHA 4D1EA 2G9BA 1GJYA 2LCPA 1W7IB 1K90D 3FIAA 5JOLA 1CDMA 1CM1A 1M45A 4TNCA 1ALWA 2O5GA 1ZFSA 4PHNA 1OE9B 2EC6C 1LVCD 3K21A 2GGMA 1BMOA 1WRKA 1CLMA 2M0RA 2HPSA 1QX2A 2BECA 1NCZA 1S1EA 1TRFA 1PVBA 1A75B 2BCBA 5I2QA 1QXPA 3CWGA 2PVBA 5DKRA 3EKJA 1RROA 3SG7A 1CKKA 1SK6D 4XJKA 1IQ3A 1B7TZ 3RM1A 1XFZO 2JXCA 2GV5A 3OB1B 2PMYA 4YGAA 1TCFA 2ZFDA 4PALA 1NPQA 3MSEB 3WHUB 2CCMA 1YUUA 2JNFA 1IG5A 3TUYB 1C7WA 2KQ6A 2MHHA 3FWBA 1F8HA 1JWDA 2FJUB 1AVSA 3LLEA 3TS5C 1SL8A 1KSMA 4M2PA 2M7LA 1NCXA 2LV7A 1SR6C 1XFUO 2COLB 3FWCA 3OP0A 1KQMC 1PSRA 2JTTA 1QS7A 4M2OA 4YRUA 1M46A 3SG2A 1ZACA 4NDDA 2V53A 3KO0A 2BL0B 3CS1A 2KFFA 2HETA 2LMUA 2NCPA 4JQ0D 4L9MA 5CSJA 1SMGA 1LA3A 1WLZA 1B1GA 2JRFA 3F45A 1K96A 1XVJA 2M49B 1CMFA 2BBMA 2MLFC 1JUOA 1MQ1A 1OSAA 2NXQA 4PHMA 4BY4A 1WLMA 2GGZA 1RWYA 1K93D 2ZRSA 3SG4A 1KFUL 4PE1A 5CSIA 3DD4A 1BJFA 2JOJA 1F70A 5KU1A 5TNCA 2NZ0A 3EVRA 3FS7A 1NX0A 2CT9A 1E8AA 5CPVA 1QJTA 1PALA 4F0ZB 5ER4X 2KI4B 2KBIA 1M39A 2LVKA 2MRDA 2OPOA 2JU0A 2KSPA 3VRRA 3WHTB 4YGDB 2AAOA 1SBJA 3PSRA 2LM5A 3KEVA 1GGZA 1B47A 1F71A 3O78A 1MXEA 2LLTA 1CFPA 2F3ZA 1J7OA 3CZTX 4DRWA 1K9UA 2R2IA 4ORCB 1IKUA 1NYAA 2FOTA 1J1DA 2EC6B 3KF9A 2JT8A 2JWWA 3GOFA 1DJIA 2HF5A 2KAXA 1KWOC 4MZKA 1YX7A 3DF0B 3NXAA 1QV1A 1WRLA 3PM8A 4YGCB 3WXAA 2L98A 5AEQA 2LVVA 3CR4X 2CNPA 1A03A 3WNXB 4P5OE 1Y1XA 2BE6A 5DKNA 1TNQA 3D0YA 4GNKB 4JWQA 2KBMA 2LC5A 1RTP1 1PVAA 1IH0A 1W7JB 1DJYA 3TS5B 1CMGA 4ETOA 1DJWA 1F4OA 1PSBA 1SR6B 1SW8A 5AFPA 2M9GA 1XFXO 1KQMB 2K61A 1CFFA 1QLKA 3EK7A 3NSIA 1A29A 2D8NA 2K7BA 3CTNA 2LLUA 3VROA 4GUKA 4N1GA 2RGIA 1Q80A 1WY9A 4ORBB 3ZWHA 5K89A 2EHBA 1UHHA 2K8MB 1DF0A 1LA0A 2OS8C 5KSZA 1N65A 4MN0A 3OX5A 2WOSA 2KFHA 3GK4X 1NX2A 1OZSA 1CDLA 1S6CA 3D10A 2M1KB 3NSKA 1B9AA 1KK8C 1QTXA 4HSZA 1K9KA 4MSPA 1OZOA 3SJSA 4N1FA 2I18A 1SL9A 1JFJA 2BKIB 4CPVA 1BT6A 2A4JA 1Y1AA 2FCDA 4OR9B 2L4HA 4XYNA 3ZNIA 1LXFC 1UUSA 2JT0A 1EJ3A 1H8BA 1IJ6A 1XFYO 3CR5X 1TN4A 1CDPA 2I2RE 3GK2A 2VRGA 5B8IB 1BF5A 2KOTA 1CLBA 1HT9A 2ZRTA 4E68A 3IF7A 4HREE 5PALA 1KSOA 1IWQA 1EH2A 1SRAA 1UHIA 1QVIY 3A8RA 2ZNDA 3BOWB 3LK1A 5D7FA 1IQ5A 1FPWA 4NQGA 4M2QA 3BYAA 1OMDA 1MXLC 2NLNA 2MA2A 1KWOB 2H61A 1JBAA 2F33A 1AUIB 2JC2A 4UPGA 2LVIA 2M8UA 1U5IB 3HCMA 4WQ2A 1CFCA 5IBWA 3NSOA 4GPLB 2PRUA 2I7AA 4PCWA 1QX7A 2KFGA 2F2OA 2BKHB 2LNKA 4HRGA 1A4PA 4QJ5B 2K7OA 3DVJA 2BCXA 1NIWA 4PE0A 2MAZA 4I5KA 1K95A 1ALVA 5BPJA 3EVVA 4A4CA 2L51A 3CGAA 3PFVA 1UHJA 3EK8A 1CFDA 2Y4QA 4MRYA 5HLOA 3C1VA 1BG1A 2KGRA 4ORAB 3SIAA 3I5GC 4FTGA 2ZKMX 2K0JA 2ISDA 1NX1A 1TNXA 2KI6D 1UP5A 2HQ8A 1H4BA 1DGUA 2OS8B 2LE9B 3I5FC 1NWDA 1UHNA 1S5GZ 2LUXA 5CSNA 3I5HC 1NUBA 2M3WA 4C0JA 1N0YA 1BU3A 2NCOA 1KK8B 1MWNA 1B7TY 2BBNA 2KYFA 3HX4A 1DJGA 1G33A 3AKAA 2TN4A 3TDZA 1RFJA 3PN7C 3E3RA 3JTDC 4GGFA 1SCMC 3O2PA 1BR1B 4I5NB 2AUCA 4OVNF 4XJKB 5CSFA 4PDZA 3DVMA 4OKHA 2ZN8A 1OMVA 1QASA 3AKBA 5FYXA 2AMIA 1YVHA 2L2EA 1DJZA 1LINA 3TDUA 2JT3A 3PLFB 1AJ5A 1PULA 1S6IA 4PHKA 4CIDA 1DJHA 2K7DA 2KYCA 4MVFA 1EXRA 1ODBA 2FCEA 1NX3A 2KHNA 1SPYA 4ZCUA 1G8IA 2LHLA 3PATA 1FI5A 4Q04A 4MZLA 1GGWA 2QACA 4OCIA 2F8PA 1QX5B 4BY5A 2WCFA 2Y5IA 1WDCC 1M63B 4FQOA 3AAJA 4U8DA 1SL7A 1JFKA 2LMVA 3IQOA 1A75A 1KFXS 1OMRA 2MLEC 3LCPC 4QJ4B 1XK4A 4DS7A 2WNDA 2G2BA 2LMTA 1DT7B 3CR2A 5HKWA 2WC8A 1NCYA 4GFTA 4CFRA 3BUWB 3BUOB 1F4QA 4JPZB 2KQYA 3EVUA 1KK7Y 2I94A 5I2OA 4YGEB 1XFVO 4MEWA 3I5GB 3BUMB 1L2OC 1DGVA 4NDBA 4GGNA 4ICBA 1QIVA 4PE7A 1MF8B 3I5FB 3DVEA 5AXIA 2CXJA 4USLA 3I5HB 2KI6C 3I5IC 2M29A 4GAOA 1ZMZA 3TZ1A 1JF0A 1B8CA 2L50A 5KTYA 1S3PA 2KAVA 2WCEA 2H61C 5JJGA 4P2YB 1YR5A 1DMOA 2H2KA 3O4YA 2JULA 4DIRA 1A2XA 2Q91A 3JTDB 1SCMB 5I2LA 3EK4A 1NP8A 1S6JA 1YUTA 2SCPA 3D0YB 4AQJA 1FI6A 3SG6A 4DUQA 1SNLA 2ZNEA 1K8UA 3OX6A 2MJWB 1MHOA 2LHIA 2KDHA 2Y1NA 3ICBA 1BR4B 2CBLA 5DKQA 2LVJA 4C0LA 1SCVA 1DVIA 2F2PA 2JPTA 3QRXA 1D1OA 2KNEA 1KCYA 1BODA 1YRUB 3CLNA 1B4CA 1IJ5A 2JNXA 1JC2A 4CFQA 1MR8A 3BUXB 4MBEA 1B8LA 4I5JA 2KAYA 1S26D 2PALA 2MBXA 1CTRA 5ER5A 1FBVA 4OV2A 1WDCB 1WRZA 3OHMB 1DF0B 3KHEA 3RLZA 1F55A 3VRPA 3PALA 3JVTC 4WRIA 3VRNA 1UURA 1M31A 1ZUZA 1CB1A 4I5LB 4PE4A 4R1EA 2ZN9A 1EG3A 3DF0A 5HKYA 1TNPA 1YX8A 4MZJA 1FW4A 1RECA 1UWOA 2B1UA 1QV0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OB2 B;  1SKT A;  1JSA A;  2KGB C;  1CLL A;  1C07 A;  1TOP A;  4GGF C;  1EL4 A;  2K7C A;  1J1E A;  3BQ3 A;  3LK0 A;  4MRX A;  1L2O B;  1RK9 A;  2M97 A;  1BLQ A;  1SY9 A;  3IQQ A;  4WQ3 A;  1AK8 A;  1ZOT B;  2SAS A;  2LP3 A;  1QAT A;  1KFX L;  1VRK A;  1K2H A;  2OTG C;  3I5I B;  3A4U B;  1OQP A;  2PAS A;  4YI9 A;  3KPX A;  5F6T A;  2M7N A;  3NSL A;  5AER A;  2WOR A;  3VRQ A;  1XA5 A;  1K94 A;  1JF2 A;  4CLN A;  1DJX A;  1V1G A;  4YBH B;  3GK1 A;  1IRJ A;  3EKH A;  4N5X A;  1YTZ C;  5AAN A;  4GBA A;  4PHJ A;  2M1U A;  1YUR A;  4AQI A;  2PSR A;  2LUC A;  1CNP A;  2HQW A;  3H4S E;  1PRW A;  1B8R A;  3O6B A;  4DCK A;  4MLW A;  4YGB B;  4ZCV A;  2K2F A;  1QIW A;  2LLS A;  1UHK A;  5I8N A;  1CDN A;  1KK7 Z;  2L4I A;  1S36 A;  1X02 A;  1XK4 C;  2JTZ A;  2O60 A;  4A4B A;  3AAK A;  4C0K A;  1PK0 D;  1YVL A;  1V1F A;  1N2D A;  1RJV A;  1Y0V H;  1YUS A;  2JZI A;  1G4Y R;  2Q4U A;  1HQV A;  2QPT A;  1R2U A;  1XYD A;  2LP2 A;  2L0P A;  1TIZ A;  1GQM A;  3DVK A;  4AOM A;  1S5G Y;  2DOQ A;  5J3X A;  4YI8 A;  3TUY C;  1J55 A;  1AJ4 A;  1EG4 A;  1XO5 A;  5HLV A;  1FF1 A;  3BOW A;  1XFW O;  1KFU S;  2F3Y A;  3JVT B;  5D69 A;  3SG5 A;  1TCO B;  2EGD A;  5GQQ C;  1LKJ A;  1QVI Z;  1TTX A;  2BCA A;  5HYD A;  1U5I A;  1J7Q A;  2BL0 C;  1Y1U A;  2JQ6 A;  3LL8 B;  2Y1M A;  1J7P A;  1AHR A;  2L5X B;  3SG3 A;  1R6P A;  3VGO A;  1C7V A;  3BXK A;  1NSH A;  3M0W A;  5HKZ A;  5G08 A;  1DTL A;  1K9P A;  2P6B B;  2IS9 A;  1SYM A;  1OOJ A;  2LAP A;  2WCB A;  1F54 A;  1QLS A;  1Y6W A;  2BE4 A;  3BUN B;  2LAN A;  2JXL A;  2K2A A;  1AP4 A;  2E6W A;  3PN7 B;  4IL1 A;  1KQV A;  1IGV A;  1MUX A;  1L7Z A;  2E30 A;  2KI4 C;  2OTG B;  4QJ3 B;  2CTN A;  3TDI A;  4NDC A;  1J7R A;  1YRT B;  3SIB A;  1BOC A;  1TNW A;  1CM4 A;  4HRH A;  4D1E A;  2G9B A;  1GJY A;  2LCP A;  1W7I B;  1K90 D;  3FIA A;  5JOL A;  1CDM A;  1CM1 A;  1M45 A;  4TNC A;  1ALW A;  2O5G A;  1ZFS A;  4PHN A;  1OE9 B;  2EC6 C;  1LVC D;  3K21 A;  2GGM A;  1BMO A;  1WRK A;  1CLM A;  2M0R A;  2HPS A;  1QX2 A;  2BEC A;  1NCZ A;  1S1E A;  1TRF A;  1PVB A;  1A75 B;  2BCB A;  5I2Q A;  1QXP A;  3CWG A;  2PVB A;  5DKR A;  3EKJ A;  1RRO A;  3SG7 A;  1CKK A;  1SK6 D;  4XJK A;  1IQ3 A;  1B7T Z;  3RM1 A;  1XFZ O;  2JXC A;  2GV5 A;  3OB1 B;  2PMY A;  4YGA A;  1TCF A;  2ZFD A;  4PAL A;  1NPQ A;  3MSE B;  3WHU B;  2CCM A;  1YUU A;  2JNF A;  1IG5 A;  3TUY B;  1C7W A;  2KQ6 A;  2MHH A;  3FWB A;  1F8H A;  1JWD A;  2FJU B;  1AVS A;  3LLE A;  3TS5 C;  1SL8 A;  1KSM A;  4M2P A;  2M7L A;  1NCX A;  2LV7 A;  1SR6 C;  1XFU O;  2COL B;  3FWC A;  3OP0 A;  1KQM C;  1PSR A;  2JTT A;  1QS7 A;  4M2O A;  4YRU A;  1M46 A;  3SG2 A;  1ZAC A;  4NDD A;  2V53 A;  3KO0 A;  2BL0 B;  3CS1 A;  2KFF A;  2HET A;  2LMU A;  2NCP A;  4JQ0 D;  4L9M A;  5CSJ A;  1SMG A;  1LA3 A;  1WLZ A;  1B1G A;  2JRF A;  3F45 A;  1K96 A;  1XVJ A;  2M49 B;  1CMF A;  2BBM A;  2MLF C;  1JUO A;  1MQ1 A;  1OSA A;  2NXQ A;  4PHM A;  4BY4 A;  1WLM A;  2GGZ A;  1RWY A;  1K93 D;  2ZRS A;  3SG4 A;  1KFU L;  4PE1 A;  5CSI A;  3DD4 A;  1BJF A;  2JOJ A;  1F70 A;  5KU1 A;  5TNC A;  2NZ0 A;  3EVR A;  3FS7 A;  1NX0 A;  2CT9 A;  1E8A A;  5CPV A;  1QJT A;  1PAL A;  4F0Z B;  5ER4 X;  2KI4 B;  2KBI A;  1M39 A;  2LVK A;  2MRD A;  2OPO A;  2JU0 A;  2KSP A;  3VRR A;  3WHT B;  4YGD B;  2AAO A;  1SBJ A;  3PSR A;  2LM5 A;  3KEV A;  1GGZ A;  1B47 A;  1F71 A;  3O78 A;  1MXE A;  2LLT A;  1CFP A;  2F3Z A;  1J7O A;  3CZT X;  4DRW A;  1K9U A;  2R2I A;  4ORC B;  1IKU A;  1NYA A;  2FOT A;  1J1D A;  2EC6 B;  3KF9 A;  2JT8 A;  2JWW A;  3GOF A;  1DJI A;  2HF5 A;  2KAX A;  1KWO C;  4MZK A;  1YX7 A;  3DF0 B;  3NXA A;  1QV1 A;  1WRL A;  3PM8 A;  4YGC B;  3WXA A;  2L98 A;  5AEQ A;  2LVV A;  3CR4 X;  2CNP A;  1A03 A;  3WNX B;  4P5O E;  1Y1X A;  2BE6 A;  5DKN A;  1TNQ A;  3D0Y A;  4GNK B;  4JWQ A;  2KBM A;  2LC5 A;  1RTP 1;  1PVA A;  1IH0 A;  1W7J B;  1DJY A;  3TS5 B;  1CMG A;  4ETO A;  1DJW A;  1F4O A;  1PSB A;  1SR6 B;  1SW8 A;  5AFP A;  2M9G A;  1XFX O;  1KQM B;  2K61 A;  1CFF A;  1QLK A;  3EK7 A;  3NSI A;  1A29 A;  2D8N A;  2K7B A;  3CTN A;  2LLU A;  3VRO A;  4GUK A;  4N1G A;  2RGI A;  1Q80 A;  1WY9 A;  4ORB B;  3ZWH A;  5K89 A;  2EHB A;  1UHH A;  2K8M B;  1DF0 A;  1LA0 A;  2OS8 C;  5KSZ A;  1N65 A;  4MN0 A;  3OX5 A;  2WOS A;  2KFH A;  3GK4 X;  1NX2 A;  1OZS A;  1CDL A;  1S6C A;  3D10 A;  2M1K B;  3NSK A;  1B9A A;  1KK8 C;  1QTX A;  4HSZ A;  1K9K A;  4MSP A;  1OZO A;  3SJS A;  4N1F A;  2I18 A;  1SL9 A;  1JFJ A;  2BKI B;  4CPV A;  1BT6 A;  2A4J A;  1Y1A A;  2FCD A;  4OR9 B;  2L4H A;  4XYN A;  3ZNI A;  1LXF C;  1UUS A;  2JT0 A;  1EJ3 A;  1H8B A;  1IJ6 A;  1XFY O;  3CR5 X;  1TN4 A;  1CDP A;  2I2R E;  3GK2 A;  2VRG A;  5B8I B;  1BF5 A;  2KOT A;  1CLB A;  1HT9 A;  2ZRT A;  4E68 A;  3IF7 A;  4HRE E;  5PAL A;  1KSO A;  1IWQ A;  1EH2 A;  1SRA A;  1UHI A;  1QVI Y;  3A8R A;  2ZND A;  3BOW B;  3LK1 A;  5D7F A;  1IQ5 A;  1FPW A;  4NQG A;  4M2Q A;  3BYA A;  1OMD A;  1MXL C;  2NLN A;  2MA2 A;  1KWO B;  2H61 A;  1JBA A;  2F33 A;  1AUI B;  2JC2 A;  4UPG A;  2LVI A;  2M8U A;  1U5I B;  3HCM A;  4WQ2 A;  1CFC A;  5IBW A;  3NSO A;  4GPL B;  2PRU A;  2I7A A;  4PCW A;  1QX7 A;  2KFG A;  2F2O A;  2BKH B;  2LNK A;  4HRG A;  1A4P A;  4QJ5 B;  2K7O A;  3DVJ A;  2BCX A;  1NIW A;  4PE0 A;  2MAZ A;  4I5K A;  1K95 A;  1ALV A;  5BPJ A;  3EVV A;  4A4C A;  2L51 A;  3CGA A;  3PFV A;  1UHJ A;  3EK8 A;  1CFD A;  2Y4Q A;  4MRY A;  5HLO A;  3C1V A;  1BG1 A;  2KGR A;  4ORA B;  3SIA A;  3I5G C;  4FTG A;  2ZKM X;  2K0J A;  2ISD A;  1NX1 A;  1TNX A;  2KI6 D;  1UP5 A;  2HQ8 A;  1H4B A;  1DGU A;  2OS8 B;  2LE9 B;  3I5F C;  1NWD A;  1UHN A;  1S5G Z;  2LUX A;  5CSN A;  3I5H C;  1NUB A;  2M3W A;  4C0J A;  1N0Y A;  1BU3 A;  2NCO A;  1KK8 B;  1MWN A;  1B7T Y;  2BBN A;  2KYF A;  3HX4 A;  1DJG A;  1G33 A;  3AKA A;  2TN4 A;  3TDZ A;  1RFJ A;  3PN7 C;  3E3R A;  3JTD C;  4GGF A;  1SCM C;  3O2P A;  1BR1 B;  4I5N B;  2AUC A;  4OVN F;  4XJK B;  5CSF A;  4PDZ A;  3DVM A;  4OKH A;  2ZN8 A;  1OMV A;  1QAS A;  3AKB A;  5FYX A;  2AMI A;  1YVH A;  2L2E A;  1DJZ A;  1LIN A;  3TDU A;  2JT3 A;  3PLF B;  1AJ5 A;  1PUL A;  1S6I A;  4PHK A;  4CID A;  1DJH A;  2K7D A;  2KYC A;  4MVF A;  1EXR A;  1ODB A;  2FCE A;  1NX3 A;  2KHN A;  1SPY A;  4ZCU A;  1G8I A;  2LHL A;  3PAT A;  1FI5 A;  4Q04 A;  4MZL A;  1GGW A;  2QAC A;  4OCI A;  2F8P A;  1QX5 B;  4BY5 A;  2WCF A;  2Y5I A;  1WDC C;  1M63 B;  4FQO A;  3AAJ A;  4U8D A;  1SL7 A;  1JFK A;  2LMV A;  3IQO A;  1A75 A;  1KFX S;  1OMR A;  2MLE C;  3LCP C;  4QJ4 B;  1XK4 A;  4DS7 A;  2WND A;  2G2B A;  2LMT A;  1DT7 B;  3CR2 A;  5HKW A;  2WC8 A;  1NCY A;  4GFT A;  4CFR A;  3BUW B;  3BUO B;  1F4Q A;  4JPZ B;  2KQY A;  3EVU A;  1KK7 Y;  2I94 A;  5I2O A;  4YGE B;  1XFV O;  4MEW A;  3I5G B;  3BUM B;  1L2O C;  1DGV A;  4NDB A;  4GGN A;  4ICB A;  1QIV A;  4PE7 A;  1MF8 B;  3I5F B;  3DVE A;  5AXI A;  2CXJ A;  4USL A;  3I5H B;  2KI6 C;  3I5I C;  2M29 A;  4GAO A;  1ZMZ A;  3TZ1 A;  1JF0 A;  1B8C A;  2L50 A;  5KTY A;  1S3P A;  2KAV A;  2WCE A;  2H61 C;  5JJG A;  4P2Y B;  1YR5 A;  1DMO A;  2H2K A;  3O4Y A;  2JUL A;  4DIR A;  1A2X A;  2Q91 A;  3JTD B;  1SCM B;  5I2L A;  3EK4 A;  1NP8 A;  1S6J A;  1YUT A;  2SCP A;  3D0Y B;  4AQJ A;  1FI6 A;  3SG6 A;  4DUQ A;  1SNL A;  2ZNE A;  1K8U A;  3OX6 A;  2MJW B;  1MHO A;  2LHI A;  2KDH A;  2Y1N A;  3ICB A;  1BR4 B;  2CBL A;  5DKQ A;  2LVJ A;  4C0L A;  1SCV A;  1DVI A;  2F2P A;  2JPT A;  3QRX A;  1D1O A;  2KNE A;  1KCY A;  1BOD A;  1YRU B;  3CLN A;  1B4C A;  1IJ5 A;  2JNX A;  1JC2 A;  4CFQ A;  1MR8 A;  3BUX B;  4MBE A;  1B8L A;  4I5J A;  2KAY A;  1S26 D;  2PAL A;  2MBX A;  1CTR A;  5ER5 A;  1FBV A;  4OV2 A;  1WDC B;  1WRZ A;  3OHM B;  1DF0 B;  3KHE A;  3RLZ A;  1F55 A;  3VRP A;  3PAL A;  3JVT C;  4WRI A;  3VRN A;  1UUR A;  1M31 A;  1ZUZ A;  1CB1 A;  4I5L B;  4PE4 A;  4R1E A;  2ZN9 A;  1EG3 A;  3DF0 A;  5HKY A;  1TNP A;  1YX8 A;  4MZJ A;  1FW4 A;  1REC A;  1UWO A;  2B1U A;  1QV0 A; 
#chains in the Genus database with same CATH topology
 3OB2 B;  1SKT A;  1JSA A;  2KGB C;  1CLL A;  1C07 A;  1TOP A;  3O4X A;  4GGF C;  1EL4 A;  2K7C A;  2QDI A;  1J1E A;  3BQ3 A;  2KLE A;  3LK0 A;  4MRX A;  1L2O B;  1RK9 A;  2M97 A;  5FI2 A;  1BLQ A;  2WCJ A;  1SY9 A;  3IQQ A;  3B6X A;  4WQ3 A;  1AK8 A;  1ZOT B;  2SAS A;  2LP3 A;  1QAT A;  1KFX L;  1VRK A;  1K2H A;  2OTG C;  3I5I B;  3A4U B;  1OQP A;  2PAS A;  4YI9 A;  3KPX A;  5F6T A;  3IVT A;  2M7N A;  3NSL A;  5AER A;  2WOR A;  3VRQ A;  1XA5 A;  1K94 A;  3CZ2 A;  1JF2 A;  4CLN A;  1DJX A;  1Z4H A;  1V1G A;  4YBH B;  3GK1 A;  1IRJ A;  3EKH A;  4N5X A;  1YTZ C;  3UNW A;  5AAN A;  4GBA A;  4PHJ A;  2M1U A;  1YUR A;  4AQI A;  2PSR A;  3DZT A;  1Z2C B;  2WCH A;  2LUC A;  1CNP A;  2HQW A;  3H4S E;  1PRW A;  1B8R A;  3O6B A;  4DCK A;  4MLW A;  4YGB B;  4ZCV A;  2K2F A;  1QIW A;  2LLS A;  1UHK A;  4KYN A;  5I8N A;  1OOG A;  1CDN A;  1KK7 Z;  2L4I A;  1S36 A;  1X02 A;  1XK4 C;  2JTZ A;  2O60 A;  4A4B A;  3AAK A;  4C0K A;  1PK0 D;  1YVL A;  3UO9 A;  1V1F A;  3R72 A;  1N2D A;  1RJV A;  3BFB A;  1Y0V H;  1YUS A;  2JZI A;  1G4Y R;  2Q4U A;  1HQV A;  2QPT A;  1R2U A;  1XYD A;  2LP2 A;  1QWV A;  2L0P A;  1TIZ A;  1GQM A;  3DVK A;  4AOM A;  1S5G Y;  2DOQ A;  5J3X A;  4YI8 A;  3TUY C;  1J55 A;  1AJ4 A;  1EG4 A;  1XO5 A;  5HLV A;  1FF1 A;  3BOW A;  3D75 A;  1XFW O;  1KFU S;  2F3Y A;  3JVT B;  5D69 A;  3SG5 A;  3VB1 A;  1TCO B;  3L4A A;  2EGD A;  5GQQ C;  1LKJ A;  1QVI Z;  1TTX A;  2BCA A;  5HYD A;  1U5I A;  2H8V A;  1J7Q A;  2BL0 C;  1Y1U A;  2JQ6 A;  3LL8 B;  2Y1M A;  1J7P A;  1AHR A;  2L5X B;  3SG3 A;  1R6P A;  3VGO A;  4FQT A;  1C7V A;  2WCM A;  3BXK A;  1NSH A;  3M0W A;  5HKZ A;  1DC1 A;  5G08 A;  3NHT A;  1DTL A;  3V2L A;  1K9P A;  2P6B B;  2IS9 A;  1SYM A;  1OOJ A;  2LAP A;  2KLD A;  2WCB A;  1F54 A;  3OGN A;  1QLS A;  1Y6W A;  2BE4 A;  3BUN B;  2LAN A;  2JXL A;  1DEL A;  1LS8 A;  2K2A A;  1AP4 A;  2E6W A;  3PN7 B;  4IL1 A;  1KQV A;  1IGV A;  1MUX A;  1L7Z A;  2E30 A;  2KI4 C;  2OTG B;  2WC6 A;  2CTN A;  4QJ3 B;  3TDI A;  4NDC A;  1J7R A;  1YRT B;  3SIB A;  1BOC A;  1TNW A;  1CM4 A;  4HRH A;  4D1E A;  2G9B A;  1GJY A;  2LCP A;  1W7I B;  1K90 D;  3FIA A;  5JOL A;  1CDM A;  1CM1 A;  1M45 A;  4TNC A;  1ALW A;  2O5G A;  1ZFS A;  3L47 A;  4PHN A;  3PJI A;  1OE9 B;  2EC6 C;  1LVC D;  3K21 A;  2GGM A;  1BMO A;  1WRK A;  1CLM A;  1ORG A;  2M0R A;  2L5Y A;  2HPS A;  1QX2 A;  2BEC A;  1NCZ A;  1S1E A;  1TRF A;  1PVB A;  1A75 B;  2BCB A;  5I2Q A;  1QXP A;  3CWG A;  2PVB A;  5DKR A;  3EKJ A;  1C3Y A;  1RRO A;  3SG7 A;  1CKK A;  1SK6 D;  3D77 A;  4XJK A;  1IQ3 A;  1B7T Z;  2QEV A;  1XFZ O;  3RM1 A;  2JXC A;  2GV5 A;  3OB1 B;  2PMY A;  4YGA A;  1TCF A;  2ZFD A;  4PAL A;  1NPQ A;  3MSE B;  3WHU B;  2CCM A;  1YUU A;  2JNF A;  1IG5 A;  3TUY B;  2WCL A;  1C7W A;  2KQ6 A;  2MHH A;  3FWB A;  1F8H A;  1JWD A;  2FJU B;  1AVS A;  2P70 A;  3LLE A;  3TS5 C;  1SL8 A;  1KSM A;  4M2P A;  2M7L A;  1NCX A;  2LV7 A;  3D73 A;  1SR6 C;  1XFU O;  2COL B;  2L2C A;  3FWC A;  3OP0 A;  1KQM C;  1PSR A;  2KPH A;  2JTT A;  1QS7 A;  4M2O A;  4YRU A;  1M46 A;  3SG2 A;  5EL2 A;  1ZAC A;  4NDD A;  2V53 A;  3KO0 A;  2BL0 B;  3CS1 A;  2KFF A;  2HET A;  2LMU A;  2NCP A;  4JQ0 D;  4L9M A;  5CSJ A;  1SMG A;  1LA3 A;  1WLZ A;  4OZD A;  1B1G A;  2JRF A;  3F45 A;  1K96 A;  1XVJ A;  2M49 B;  5HL1 A;  2BBM A;  1CMF A;  2MLF C;  1JUO A;  1MQ1 A;  1OSA A;  2NXQ A;  4PHM A;  3B86 A;  4BY4 A;  1WLM A;  2GGZ A;  1RWY A;  1K93 D;  2ZRS A;  3SG4 A;  1KFU L;  4PE1 A;  3D78 A;  5CSI A;  3DD4 A;  2QEB A;  1BJF A;  2JOJ A;  1F70 A;  5KU1 A;  5TNC A;  2NZ0 A;  3EVR A;  3FS7 A;  1NX0 A;  2CT9 A;  1E8A A;  5CPV A;  1QJT A;  1PAL A;  4F0Z B;  5ER4 X;  3QME A;  2KI4 B;  2KBI A;  5D3O A;  1XFR A;  1M39 A;  2LVK A;  2MRD A;  2OPO A;  1OOI X;  2JU0 A;  2KSP A;  3VRR A;  3WHT B;  4YGD B;  3DYE A;  2AAO A;  1SBJ A;  3PSR A;  2LM5 A;  3KEV A;  2P71 A;  1GGZ A;  1B47 A;  1DQE A;  1F71 A;  3O78 A;  1MXE A;  2LLT A;  1CFP A;  2F3Z A;  3D76 A;  1J7O A;  3BJH A;  3CZT X;  3B7A A;  4DRW A;  1K9U A;  2R2I A;  4ORC B;  1IKU A;  1NYA A;  2FOT A;  1J1D A;  2EC6 B;  3KF9 A;  2JT8 A;  2JWW A;  3GOF A;  1DJI A;  2HF5 A;  2KAX A;  1KWO C;  3RZS A;  4MZK A;  1YX7 A;  3DF0 B;  3NXA A;  1QV1 A;  1WRL A;  3PM8 A;  4YGC B;  3WXA A;  2L98 A;  5AEQ A;  2LVV A;  3CR4 X;  1C3Z A;  2CNP A;  1A03 A;  3WNX B;  4P5O E;  1Y1X A;  2BE6 A;  5DKN A;  1TNQ A;  3D0Y A;  4GNK B;  4JWQ A;  2KBM A;  2LC5 A;  3NGV A;  1RTP 1;  1PVA A;  2QEH A;  1IH0 A;  1W7J B;  3R1O A;  1DJY A;  3TS5 B;  1CMG A;  4ETO A;  1DJW A;  1F4O A;  1PSB A;  1SR6 B;  1SW8 A;  5AFP A;  1P28 A;  3SS5 A;  2M9G A;  1XFX O;  1KQM B;  2K61 A;  3CDN A;  1CFF A;  1QLK A;  2YGU A;  3EK7 A;  3NSI A;  1A29 A;  2D8N A;  2K7B A;  3CTN A;  2LLU A;  1SSE B;  3VRO A;  4GUK A;  4N1G A;  2RGI A;  1Q80 A;  1WY9 A;  4ORB B;  3ZWH A;  5K89 A;  2EHB A;  1UHH A;  2K8M B;  1DF0 A;  1LA0 A;  2OS8 C;  5KSZ A;  2GTE A;  1N65 A;  4MN0 A;  3OX5 A;  2WOS A;  2KFH A;  3DY9 A;  4IJ7 A;  3GK4 X;  1NX2 A;  1OZS A;  1CDL A;  1S6C A;  3D10 A;  4INX A;  2M1K B;  3NSK A;  1B9A A;  1KK8 C;  1QTX A;  4HSZ A;  1K9K A;  4MSP A;  1OZO A;  3SJS A;  4N1F A;  2I18 A;  1SL9 A;  1JFJ A;  2BKI B;  4CPV A;  1BT6 A;  2A4J A;  1Y1A A;  2FCD A;  4OR9 B;  2L4H A;  4XYN A;  3ZNI A;  1LXF C;  1OOF A;  1UUS A;  2JT0 A;  1EJ3 A;  1H8B A;  1IJ6 A;  1XFY O;  3CR5 X;  3S0B A;  1TN4 A;  1CDP A;  2I2R E;  3GK2 A;  2ERB A;  2VRG A;  5B8I B;  1BF5 A;  2KOT A;  1CLB A;  1HT9 A;  2ZRT A;  4E68 A;  3IF7 A;  4HRE E;  5PAL A;  1KSO A;  1IWQ A;  1EH2 A;  1SRA A;  1UHI A;  1QVI Y;  2BAP A;  3A8R A;  3S0F A;  2ZND A;  3BOW B;  3LK1 A;  5D7F A;  1TWO A;  1IQ5 A;  1FPW A;  4NQG A;  1OOH A;  4M2Q A;  3BYA A;  3DXL A;  1OMD A;  1MXL C;  2NLN A;  2MA2 A;  1KWO B;  2H61 A;  2WC5 A;  2F33 A;  1AUI B;  1JBA A;  2JC2 A;  4UPG A;  2LVI A;  2M8U A;  1U5I B;  3HCM A;  4WQ2 A;  1CFC A;  2PQL A;  5IBW A;  3NSO A;  4GPL B;  2PRU A;  3B87 A;  2I7A A;  4F7F A;  4PCW A;  1QX7 A;  2KFG A;  2F2O A;  2BKH B;  2BNX A;  3FE9 A;  2LNK A;  4HRG A;  3SS3 A;  1A4P A;  4QJ5 B;  2K7O A;  3DVJ A;  3CZ0 A;  2BCX A;  1NIW A;  4PE0 A;  2MAZ A;  5DIC A;  4I5K A;  1K95 A;  1ALV A;  5BPJ A;  3EVV A;  4A4C A;  2L51 A;  3CGA A;  4JD9 A;  3PFV A;  1UHJ A;  3EK8 A;  3S0A A;  1CFD A;  2Y4Q A;  3D74 A;  4MRY A;  3C1V A;  5HLO A;  1BG1 A;  2KGR A;  4ORA B;  3SIA A;  3I5G C;  4FTG A;  2ZKM X;  2K0J A;  3R1V A;  2ISD A;  1NX1 A;  1TNX A;  2KI6 D;  1UP5 A;  2HQ8 A;  1H4B A;  1DGU A;  2OS8 B;  2LE9 B;  3I5F C;  1NWD A;  1UHN A;  1S5G Z;  2LUX A;  3N7H A;  5CSN A;  3I5H C;  1NUB A;  2M3W A;  4C0J A;  1N0Y A;  1BU3 A;  2NCO A;  3CZ1 A;  1KK8 B;  1MWN A;  1B7T Y;  1DEK A;  2BBN A;  2KYF A;  3HX4 A;  1DJG A;  1G33 A;  3AKA A;  2TN4 A;  3TDZ A;  1RFJ A;  3PN7 C;  3E3R A;  1T14 A;  3JTD C;  4GGF A;  1SCM C;  3O2P A;  1BR1 B;  4I5N B;  2AUC A;  4OVN F;  4XJK B;  3OBV A;  3BFH A;  5CSF A;  4PDZ A;  3DVM A;  4OKH A;  2ZN8 A;  1OMV A;  1QAS A;  3AKB A;  5FYX A;  2AMI A;  5I94 A;  1YVH A;  2L2E A;  4INW A;  1DJZ A;  1LIN A;  3TDU A;  2JT3 A;  3PLF B;  3EG5 B;  1AJ5 A;  1PUL A;  1S6I A;  3L4L A;  4PHK A;  4CID A;  1DJH A;  2K7D A;  2KYC A;  4MVF A;  1EXR A;  1ODB A;  2FCE A;  1NX3 A;  2KHN A;  1SPY A;  4ZCU A;  1G8I A;  2LHL A;  3PAT A;  1FI5 A;  4Q04 A;  4MZL A;  1GGW A;  2QAC A;  3R1P A;  1OW4 A;  4OCI A;  3S0D A;  2F8P A;  1QX5 B;  4BY5 A;  2WCF A;  2Y5I A;  1WDC C;  1M63 B;  3FE6 A;  4FQO A;  3AAJ A;  4U8D A;  1SL7 A;  1JFK A;  2LMV A;  3IQO A;  3Q8I A;  1A75 A;  1KFX S;  1OMR A;  2MLE C;  2WCK A;  3LCP C;  4QJ4 B;  1XK4 A;  4DS7 A;  2JPO A;  2WND A;  2G2B A;  2LMT A;  3BFA A;  3SS4 A;  1DT7 B;  3CR2 A;  5HKW A;  2WC8 A;  1NCY A;  4GFT A;  4CFR A;  3BUW B;  3BUO B;  1F4Q A;  3K1E A;  4JPZ B;  2KQY A;  3EVU A;  1KK7 Y;  3FE8 A;  2I94 A;  5I2O A;  4YGE B;  1XFV O;  4MEW A;  3I5G B;  3BUM B;  2K60 A;  1L2O C;  5FI6 A;  1DGV A;  4NDB A;  4GGN A;  4ICB A;  1QIV A;  4PE7 A;  1MF8 B;  3I5F B;  3DVE A;  5AXI A;  2CXJ A;  4USL A;  3I5H B;  3B88 A;  2KI6 C;  3I5I C;  2M29 A;  4GAO A;  1ZMZ A;  3TZ1 A;  1JF0 A;  1B8C A;  2L50 A;  5KTY A;  1S3P A;  2KAV A;  2QEO A;  2WCE A;  2H61 C;  4JKT A;  4P2Y B;  5JJG A;  1YR5 A;  1DMO A;  2H2K A;  3O4Y A;  2JUL A;  4DIR A;  1A2X A;  2Q91 A;  3JTD B;  1SCM B;  5I2L A;  3EK4 A;  1NP8 A;  1S6J A;  1YUT A;  2SCP A;  3D0Y B;  4AQJ A;  1FI6 A;  3SG6 A;  4DUQ A;  1SNL A;  2ZNE A;  1K8U A;  3OX6 A;  2MJW B;  1MHO A;  2LHI A;  2KDH A;  2Y1N A;  4PT1 A;  3ICB A;  1BR4 B;  1W9Z A;  2CBL A;  5DKQ A;  2LVJ A;  4C0L A;  1SCV A;  1DVI A;  2F2P A;  2JPT A;  3CAB A;  3QRX A;  3PM2 A;  3NHI A;  1D1O A;  1TUJ A;  2KNE A;  1KCY A;  1BOD A;  1YRU B;  3CLN A;  1B4C A;  1IJ5 A;  2JNX A;  1JC2 A;  4CFQ A;  1MR8 A;  3BUX B;  4MBE A;  1B8L A;  4I5J A;  2KAY A;  1S26 D;  2PAL A;  2MBX A;  1CTR A;  5ER5 A;  1FBV A;  4OV2 A;  1WDC B;  1WRZ A;  3OHM B;  1DF0 B;  3KHE A;  1IIO A;  3RLZ A;  1F55 A;  3VRP A;  3PAL A;  3JVT C;  4WRI A;  5FI7 A;  3CYZ A;  1TUZ A;  1UUR A;  3VRN A;  1M31 A;  1ZUZ A;  2PYQ A;  1CB1 A;  4I5L B;  4PE4 A;  4R1E A;  2ZN9 A;  1EG3 A;  3DF0 A;  2FJY A;  1TNP A;  1YX8 A;  3S0G A;  3S0E A;  5HKY A;  1GM0 A;  4MZJ A;  1FW4 A;  1REC A;  1UWO A;  2B1U A;  1QV0 A; 
#chains in the Genus database with same CATH homology
 3OB2 B;  1SKT A;  1JSA A;  2KGB C;  1CLL A;  1C07 A;  1TOP A;  4GGF C;  1EL4 A;  2K7C A;  1J1E A;  3BQ3 A;  3LK0 A;  4MRX A;  1L2O B;  1RK9 A;  2M97 A;  1BLQ A;  1SY9 A;  3IQQ A;  4WQ3 A;  1AK8 A;  1ZOT B;  2SAS A;  2LP3 A;  1QAT A;  1KFX L;  1VRK A;  1K2H A;  2OTG C;  3I5I B;  3A4U B;  1OQP A;  2PAS A;  4YI9 A;  3KPX A;  5F6T A;  2M7N A;  3NSL A;  5AER A;  2WOR A;  3VRQ A;  1XA5 A;  1K94 A;  1JF2 A;  4CLN A;  1DJX A;  1V1G A;  4YBH B;  3GK1 A;  1IRJ A;  3EKH A;  4N5X A;  1YTZ C;  5AAN A;  4GBA A;  4PHJ A;  2M1U A;  1YUR A;  4AQI A;  2PSR A;  2LUC A;  1CNP A;  2HQW A;  3H4S E;  1PRW A;  1B8R A;  3O6B A;  4DCK A;  4MLW A;  4YGB B;  4ZCV A;  2K2F A;  1QIW A;  2LLS A;  1UHK A;  5I8N A;  1CDN A;  1KK7 Z;  2L4I A;  1S36 A;  1X02 A;  1XK4 C;  2JTZ A;  2O60 A;  4A4B A;  3AAK A;  4C0K A;  1PK0 D;  1YVL A;  1V1F A;  1N2D A;  1RJV A;  1Y0V H;  1YUS A;  2JZI A;  1G4Y R;  2Q4U A;  1HQV A;  2QPT A;  1R2U A;  1XYD A;  2LP2 A;  2L0P A;  1TIZ A;  1GQM A;  3DVK A;  4AOM A;  1S5G Y;  2DOQ A;  5J3X A;  4YI8 A;  3TUY C;  1J55 A;  1AJ4 A;  1EG4 A;  1XO5 A;  5HLV A;  1FF1 A;  3BOW A;  1XFW O;  1KFU S;  2F3Y A;  3JVT B;  5D69 A;  3SG5 A;  1TCO B;  2EGD A;  5GQQ C;  1LKJ A;  1QVI Z;  1TTX A;  2BCA A;  5HYD A;  1U5I A;  1J7Q A;  2BL0 C;  1Y1U A;  2JQ6 A;  3LL8 B;  2Y1M A;  1J7P A;  1AHR A;  2L5X B;  3SG3 A;  1R6P A;  3VGO A;  1C7V A;  3BXK A;  1NSH A;  3M0W A;  5HKZ A;  5G08 A;  1DTL A;  1K9P A;  2P6B B;  2IS9 A;  1SYM A;  1OOJ A;  2LAP A;  2WCB A;  1F54 A;  1QLS A;  1Y6W A;  2BE4 A;  3BUN B;  2LAN A;  2JXL A;  2K2A A;  1AP4 A;  2E6W A;  3PN7 B;  4IL1 A;  1KQV A;  1IGV A;  1MUX A;  1L7Z A;  2E30 A;  2KI4 C;  2OTG B;  4QJ3 B;  2CTN A;  3TDI A;  4NDC A;  1J7R A;  1YRT B;  3SIB A;  1BOC A;  1TNW A;  1CM4 A;  4HRH A;  4D1E A;  2G9B A;  1GJY A;  2LCP A;  1W7I B;  1K90 D;  3FIA A;  5JOL A;  1CDM A;  1CM1 A;  1M45 A;  4TNC A;  1ALW A;  2O5G A;  1ZFS A;  4PHN A;  1OE9 B;  2EC6 C;  1LVC D;  3K21 A;  2GGM A;  1BMO A;  1WRK A;  1CLM A;  2M0R A;  2HPS A;  1QX2 A;  2BEC A;  1NCZ A;  1S1E A;  1TRF A;  1PVB A;  1A75 B;  2BCB A;  5I2Q A;  1QXP A;  3CWG A;  2PVB A;  5DKR A;  3EKJ A;  1RRO A;  3SG7 A;  1CKK A;  1SK6 D;  4XJK A;  1IQ3 A;  1B7T Z;  3RM1 A;  1XFZ O;  2JXC A;  2GV5 A;  3OB1 B;  2PMY A;  4YGA A;  1TCF A;  2ZFD A;  4PAL A;  1NPQ A;  3MSE B;  3WHU B;  2CCM A;  1YUU A;  2JNF A;  1IG5 A;  3TUY B;  1C7W A;  2KQ6 A;  2MHH A;  3FWB A;  1F8H A;  1JWD A;  2FJU B;  1AVS A;  3LLE A;  3TS5 C;  1SL8 A;  1KSM A;  4M2P A;  2M7L A;  1NCX A;  2LV7 A;  1SR6 C;  1XFU O;  2COL B;  3FWC A;  3OP0 A;  1KQM C;  1PSR A;  2JTT A;  1QS7 A;  4M2O A;  4YRU A;  1M46 A;  3SG2 A;  1ZAC A;  4NDD A;  2V53 A;  3KO0 A;  2BL0 B;  3CS1 A;  2KFF A;  2HET A;  2LMU A;  2NCP A;  4JQ0 D;  4L9M A;  5CSJ A;  1SMG A;  1LA3 A;  1WLZ A;  1B1G A;  2JRF A;  3F45 A;  1K96 A;  1XVJ A;  2M49 B;  1CMF A;  2BBM A;  2MLF C;  1JUO A;  1MQ1 A;  1OSA A;  2NXQ A;  4PHM A;  4BY4 A;  1WLM A;  2GGZ A;  1RWY A;  1K93 D;  2ZRS A;  3SG4 A;  1KFU L;  4PE1 A;  5CSI A;  3DD4 A;  1BJF A;  2JOJ A;  1F70 A;  5KU1 A;  5TNC A;  2NZ0 A;  3EVR A;  3FS7 A;  1NX0 A;  2CT9 A;  1E8A A;  5CPV A;  1QJT A;  1PAL A;  4F0Z B;  5ER4 X;  2KI4 B;  2KBI A;  1M39 A;  2LVK A;  2MRD A;  2OPO A;  2JU0 A;  2KSP A;  3VRR A;  3WHT B;  4YGD B;  2AAO A;  1SBJ A;  3PSR A;  2LM5 A;  3KEV A;  1GGZ A;  1B47 A;  1F71 A;  3O78 A;  1MXE A;  2LLT A;  1CFP A;  2F3Z A;  1J7O A;  3CZT X;  4DRW A;  1K9U A;  2R2I A;  4ORC B;  1IKU A;  1NYA A;  2FOT A;  1J1D A;  2EC6 B;  3KF9 A;  2JT8 A;  2JWW A;  3GOF A;  1DJI A;  2HF5 A;  2KAX A;  1KWO C;  4MZK A;  1YX7 A;  3DF0 B;  3NXA A;  1QV1 A;  1WRL A;  3PM8 A;  4YGC B;  3WXA A;  2L98 A;  5AEQ A;  2LVV A;  3CR4 X;  2CNP A;  1A03 A;  3WNX B;  4P5O E;  1Y1X A;  2BE6 A;  5DKN A;  1TNQ A;  3D0Y A;  4GNK B;  4JWQ A;  2KBM A;  2LC5 A;  1RTP 1;  1PVA A;  1IH0 A;  1W7J B;  1DJY A;  3TS5 B;  1CMG A;  4ETO A;  1DJW A;  1F4O A;  1PSB A;  1SR6 B;  1SW8 A;  5AFP A;  2M9G A;  1XFX O;  1KQM B;  2K61 A;  1CFF A;  1QLK A;  3EK7 A;  3NSI A;  1A29 A;  2D8N A;  2K7B A;  3CTN A;  2LLU A;  3VRO A;  4GUK A;  4N1G A;  2RGI A;  1Q80 A;  1WY9 A;  4ORB B;  3ZWH A;  5K89 A;  2EHB A;  1UHH A;  2K8M B;  1DF0 A;  1LA0 A;  2OS8 C;  5KSZ A;  1N65 A;  4MN0 A;  3OX5 A;  2WOS A;  2KFH A;  3GK4 X;  1NX2 A;  1OZS A;  1CDL A;  1S6C A;  3D10 A;  2M1K B;  3NSK A;  1B9A A;  1KK8 C;  1QTX A;  4HSZ A;  1K9K A;  4MSP A;  1OZO A;  3SJS A;  4N1F A;  2I18 A;  1SL9 A;  1JFJ A;  2BKI B;  4CPV A;  1BT6 A;  2A4J A;  1Y1A A;  2FCD A;  4OR9 B;  2L4H A;  4XYN A;  3ZNI A;  1LXF C;  1UUS A;  2JT0 A;  1EJ3 A;  1H8B A;  1IJ6 A;  1XFY O;  3CR5 X;  1TN4 A;  1CDP A;  2I2R E;  3GK2 A;  2VRG A;  5B8I B;  1BF5 A;  2KOT A;  1CLB A;  1HT9 A;  2ZRT A;  4E68 A;  3IF7 A;  4HRE E;  5PAL A;  1KSO A;  1IWQ A;  1EH2 A;  1SRA A;  1UHI A;  1QVI Y;  3A8R A;  2ZND A;  3BOW B;  3LK1 A;  5D7F A;  1IQ5 A;  1FPW A;  4NQG A;  4M2Q A;  3BYA A;  1OMD A;  1MXL C;  2NLN A;  2MA2 A;  1KWO B;  2H61 A;  1JBA A;  2F33 A;  1AUI B;  2JC2 A;  4UPG A;  2LVI A;  2M8U A;  1U5I B;  3HCM A;  4WQ2 A;  1CFC A;  5IBW A;  3NSO A;  4GPL B;  2PRU A;  2I7A A;  4PCW A;  1QX7 A;  2KFG A;  2F2O A;  2BKH B;  2LNK A;  4HRG A;  1A4P A;  4QJ5 B;  2K7O A;  3DVJ A;  2BCX A;  1NIW A;  4PE0 A;  2MAZ A;  4I5K A;  1K95 A;  1ALV A;  5BPJ A;  3EVV A;  4A4C A;  2L51 A;  3CGA A;  3PFV A;  1UHJ A;  3EK8 A;  1CFD A;  2Y4Q A;  4MRY A;  5HLO A;  3C1V A;  1BG1 A;  2KGR A;  4ORA B;  3SIA A;  3I5G C;  4FTG A;  2ZKM X;  2K0J A;  2ISD A;  1NX1 A;  1TNX A;  2KI6 D;  1UP5 A;  2HQ8 A;  1H4B A;  1DGU A;  2OS8 B;  2LE9 B;  3I5F C;  1NWD A;  1UHN A;  1S5G Z;  2LUX A;  5CSN A;  3I5H C;  1NUB A;  2M3W A;  4C0J A;  1N0Y A;  1BU3 A;  2NCO A;  1KK8 B;  1MWN A;  1B7T Y;  2BBN A;  2KYF A;  3HX4 A;  1DJG A;  1G33 A;  3AKA A;  2TN4 A;  3TDZ A;  1RFJ A;  3PN7 C;  3E3R A;  3JTD C;  4GGF A;  1SCM C;  3O2P A;  1BR1 B;  4I5N B;  2AUC A;  4OVN F;  4XJK B;  5CSF A;  4PDZ A;  3DVM A;  4OKH A;  2ZN8 A;  1OMV A;  1QAS A;  3AKB A;  5FYX A;  2AMI A;  1YVH A;  2L2E A;  1DJZ A;  1LIN A;  3TDU A;  2JT3 A;  3PLF B;  1AJ5 A;  1PUL A;  1S6I A;  4PHK A;  4CID A;  1DJH A;  2K7D A;  2KYC A;  4MVF A;  1EXR A;  1ODB A;  2FCE A;  1NX3 A;  2KHN A;  1SPY A;  4ZCU A;  1G8I A;  2LHL A;  3PAT A;  1FI5 A;  4Q04 A;  4MZL A;  1GGW A;  2QAC A;  4OCI A;  2F8P A;  1QX5 B;  4BY5 A;  2WCF A;  2Y5I A;  1WDC C;  1M63 B;  4FQO A;  3AAJ A;  4U8D A;  1SL7 A;  1JFK A;  2LMV A;  3IQO A;  1A75 A;  1KFX S;  1OMR A;  2MLE C;  3LCP C;  4QJ4 B;  1XK4 A;  4DS7 A;  2WND A;  2G2B A;  2LMT A;  1DT7 B;  3CR2 A;  5HKW A;  2WC8 A;  1NCY A;  4GFT A;  4CFR A;  3BUW B;  3BUO B;  1F4Q A;  4JPZ B;  2KQY A;  3EVU A;  1KK7 Y;  2I94 A;  5I2O A;  4YGE B;  1XFV O;  4MEW A;  3I5G B;  3BUM B;  1L2O C;  1DGV A;  4NDB A;  4GGN A;  4ICB A;  1QIV A;  4PE7 A;  1MF8 B;  3I5F B;  3DVE A;  5AXI A;  2CXJ A;  4USL A;  3I5H B;  2KI6 C;  3I5I C;  2M29 A;  4GAO A;  1ZMZ A;  3TZ1 A;  1JF0 A;  1B8C A;  2L50 A;  5KTY A;  1S3P A;  2KAV A;  2WCE A;  2H61 C;  5JJG A;  4P2Y B;  1YR5 A;  1DMO A;  2H2K A;  3O4Y A;  2JUL A;  4DIR A;  1A2X A;  2Q91 A;  3JTD B;  1SCM B;  5I2L A;  3EK4 A;  1NP8 A;  1S6J A;  1YUT A;  2SCP A;  3D0Y B;  4AQJ A;  1FI6 A;  3SG6 A;  4DUQ A;  1SNL A;  2ZNE A;  1K8U A;  3OX6 A;  2MJW B;  1MHO A;  2LHI A;  2KDH A;  2Y1N A;  3ICB A;  1BR4 B;  2CBL A;  5DKQ A;  2LVJ A;  4C0L A;  1SCV A;  1DVI A;  2F2P A;  2JPT A;  3QRX A;  1D1O A;  2KNE A;  1KCY A;  1BOD A;  1YRU B;  3CLN A;  1B4C A;  1IJ5 A;  2JNX A;  1JC2 A;  4CFQ A;  1MR8 A;  3BUX B;  4MBE A;  1B8L A;  4I5J A;  2KAY A;  1S26 D;  2PAL A;  2MBX A;  1CTR A;  5ER5 A;  1FBV A;  4OV2 A;  1WDC B;  1WRZ A;  3OHM B;  1DF0 B;  3KHE A;  3RLZ A;  1F55 A;  3VRP A;  3PAL A;  3JVT C;  4WRI A;  3VRN A;  1UUR A;  1M31 A;  1ZUZ A;  1CB1 A;  4I5L B;  4PE4 A;  4R1E A;  2ZN9 A;  1EG3 A;  3DF0 A;  5HKY A;  1TNP A;  1YX8 A;  4MZJ A;  1FW4 A;  1REC A;  1UWO A;  2B1U A;  1QV0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...