2M9GA

Solution structure of calcium-bound human s100a12
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
92
structure length
92
Chain Sequence
MTKLEEHLEGIVNIFHQYSVRKGHFDTLSKGELKQLLTKELANTIKNIKDKAVIDEIFQGLDANQDEQVDFQEFISLVAIALKAAHYHTHKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords Protein S100-A12
publication title Solution structure of human Ca(2+)-bound S100A12
pubmed doi rcsb
source organism Homo sapiens
total genus 27
structure length 92
sequence length 92
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-06-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2m9gA00
2SASA 1YVLA 4XYNA 2L0PA 1JUOA 1M31A 4CFRA 1KK8C 1SPYA 5D7FA 1TIZA 1AVSA 4ORBB 2F2PA 1U5IA 1UUSA 2JT3A 1UURA 2CTNA 2E6WA 1CTRA 1QLSA 1UHKA 5K89A 2KGRA 3VROA 2K2FA 2JU0A 2MAZA 1SR6C 2ZN8A 1SNLA 2LE9B 1K9UA 2K8MB 2KI6D 2G2BA 1GGWA 4YBHB 1TNQA 4MZJA 2LP2A 1QV1A 4PDZA 2FCEA 2WORA 2HQWA 3FWCA 4JQ0D 4P2YB 4Q04A 3LK0A 1RROA 3SG3A 3IF7A 3SG5A 2LUCA 1J7QA 3GK2A 1J1DA 5CSJA 2JQ6A 4A4BA 1L2OC 1IKUA 1KCYA 4YI9A 3EVRA 4FTGA 5AXIA 1JFJA 1GGZA 2FOTA 1TOPA 2H61A 3WHTB 1DGVA 4CLNA 4YGEB 1QV0A 2KBIA 4HRGA 1KK7Z 1EJ3A 3ICBA 2ZN9A 2L51A 3BUXB 2ZRSA 1OZSA 1S6IA 3JVTC 2ZRTA 1SYMA 3DVJA 1YRUB 1CDMA 1R6PA 1LKJA 1PULA 2WCFA 2LUXA 5TNCA 3TUYC 5GQQC 1FW4A 2M8UA 2JT0A 3O4YA 3I5IC 1KK7Y 3E3RA 2LHIA 2LMVA 2I2RE 3AAKA 4HRHA 1YUUA 3OP0A 1WY9A 1N0YA 1RJVA 3PSRA 1B8CA 1AJ5A 1ALWA 1TNXA 4ORCB 1CLMA 1XVJA 1YRTB 1GJYA 1PSRA 2KI4B 1OMRA 2GV5A 2FJUB 2CT9A 2WC8A 2JTTA 2LMTA 3DVKA 3KF9A 4N1GA 2KSPA 2OS8C 1CFPA 2M7LA 1MUXA 1CLBA 1IG5A 4XJKA 1CFCA 2KOTA 3M0WA 3I5HB 5DKRA 1N2DA 2G9BA 1CM4A 2CCMA 1W7JB 2EC6B 4PE0A 4YI8A 2K7DA 1SRAA 2JT8A 1YUTA 1A2XA 1WLZA 2KDHA 2H61C 2MA2A 1R2UA 2VRGA 1NIWA 4MSPA 1WRZA 2NCOA 3BUMB 4CIDA 3AKBA 1D1OA 1YUSA 2LLSA 2LVKA 3CR2A 5CPVA 1LA0A 1OZOA 1M46A 5B8IB 1SY9A 2LMUA 4OKHA 1OOJA 2HETA 2ZFDA 1CDLA 2M97A 1XFWO 2H2KA 1SCMB 1IQ5A 4A4CA 3KO0A 1SW8A 2ISDA 4MRXA 1X02A 1KSMA 2KNEA 4ZCVA 1BT6A 2LVVA 2BCXA 1Y1UA 4HREE 1UHJA 5DKQA 3EKJA 2LCPA 1LA3A 4F0ZB 1YVHA 1KK8B 1CMGA 2O5GA 1QX5B 1S3PA 1A4PA 1K93D 2LVIA 1HQVA 1BR4B 2K2AA 1ODBA 5J3XA 1HT9A 2RGIA 1NYAA 1PRWA 2MLEC 1SR6B 1CLLA 3SIAA 1WLMA 2MRDA 3PM8A 1QXPA 4YGBB 3DF0B 1SCMC 4N1FA 3OX5A 2Y1MA 1L2OB 2AAOA 2MLFC 3ZNIA 2BECA 2CXJA 4JWQA 3BUWB 4CFQA 2PALA 5HKYA 2WOSA 4IL1A 4DIRA 2V53A 1K2HA 4NDCA 1MR8A 1QVIY 4DRWA 1IQ3A 5HKZA 2GGMA 4PE7A 1NUBA 2I94A 1QTXA 2Y4QA 3LLEA 4PHNA 5AEQA 4WRIA 3JVTB 1ZFSA 1DVIA 2KGBC 4MEWA 4OCIA 1BR1B 3D0YA 3CTNA 1B8LA 1PVBA 1DMOA 2BCAA 1E8AA 3KPXA 1SMGA 1TCFA 1QS7A 2NZ0A 1UWOA 1FBVA 3TUYB 2LAPA 1JFKA 1RFJA 2QACA 3I5GC 1OMVA 3I5IB 1EXRA 2LC5A 1QX7A 1IRJA 2NCPA 1QIVA 1NSHA 1MQ1A 1OSAA 1U5IB 1F54A 2F2OA 1NP8A 1QASA 3LL8B 5CSNA 1FI6A 2JRFA 2KQYA 2LP3A 1CFDA 1PVAA 3BOWA 2K7CA 2OS8B 3ZWHA 2KI6C 1DJZA 1A29A 3QRXA 1NWDA 1DJIA 1B47A 4I5JA 3LK1A 2K7OA 3D10A 5ER4X 1XA5A 1KQMC 1M39A 2L5XB 1KFXL 1TNPA 3CS1A 2KYCA 3TS5C 2NXQA 1DT7B 3CWGA 3CR4X 1PSBA 4WQ2A 3AAJA 4AOMA 1EH2A 2JXLA 4L9MA 5I2OA 3IQQA 1C07A 3PLFB 2F8PA 1SCVA 1DF0A 1KFUS 1MXEA 1IWQA 2JPTA 1SL7A 3TDUA 1KSOA 3I5FC 3MSEB 2KBMA 1YURA 3CLNA 1FPWA 4ORAB 4BY5A 4MZKA 1NCZA 1SK6D 2KAVA 3PATA 1K8UA 4TNCA 4C0JA 1F70A 4PALA 2FCDA 2IS9A 2L98A 1DJHA 4DS7A 1KWOB 1OQPA 1XFZO 3DVMA 4DCKA 2O60A 1JWDA 4XJKB 3PN7C 1S6CA 1XO5A 4BY4A 2HF5A 1L7ZA 2KFHA 1XK4A 1KFXS 4USLA 4JPZB 3O78A 1LXFC 5CSIA 2LM5A 3EK7A 1CDNA 1DJYA 3HX4A 4MN0A 1NX0A 3SG6A 1CDPA 2BKHB 1EG4A 3K21A 3FWBA 4GPLB 1QIWA 2WCEA 3KHEA 3TZ1A 1UHNA 1J7OA 2Y5IA 3WNXB 4PE4A 4OV2A 2CBLA 4GUKA 4YGCB 2TN4A 1RECA 4M2PA 3SG4A 3BXKA 1JSAA 2Y1NA 5DKNA 2BE6A 2E30A 1DJXA 5HLVA 1RWYA 2K7BA 2M9GA 1BF5A 5F6TA 1KWOC 1G8IA 3TDIA 1BOCA 2JXCA 1WDCB 1ZACA 3DVEA 3NSOA 3KEVA 5I8NA 1G33A 1NX1A 4OVNF 3BUNB 1AK8A 3I5GB 4PHJA 1ALVA 2OPOA 1QVIZ 1F8HA 4C0LA 5AERA 1IGVA 2A4JA 2BBNA 1VRKA 3FS7A 1YR5A 4QJ5B 2K61A 2BBMA 1B8RA 1MHOA 1XFXO 2M0RA 4AQJA 3RM1A 5KU1A 1Y1XA 2ZNEA 1XFUO 1PALA 4N5XA 4QJ4B 2K0JA 3OB2B 1XK4C 1IH0A 2Q91A 2BE4A 2SCPA 2MHHA 1RK9A 1MF8B 2PVBA 3BQ3A 2KFGA 1J55A 1JF0A 3SG2A 1F4QA 4MVFA 4P5OE 5HKWA 4I5LB 4PCWA 1S5GY 3SJSA 2JULA 5I2QA 1AJ4A 1UHIA 1QJTA 2HPSA 1RTP1 1KQMB 1WDCC 3HCMA 5HYDA 3EKHA 5JOLA 3TS5B 3VGOA 3SIBA 2EHBA 1Y6WA 1KFUL 2JTZA 3IQOA 3DD4A 3PFVA 3SG7A 3VRRA 2ZNDA 1OE9B 1YX8A 2QPTA 3D0YB 3GOFA 2LV7A 4HSZA 1DJGA 5FYXA 2JNXA 3JTDC 3NSKA 1A03A 2OTGC 1WRLA 4DUQA 3I5FB 2CNPA 3A8RA 2NLNA 1Y1AA 5AFPA 5KSZA 2BL0C 1XFVO 3NSIA 1K90D 5I2LA 1NCYA 3PALA 3EK8A 2L4HA 4GGNA 1SL9A 3GK1A 3OB1B 3CGAA 4ETOA 1SKTA 3CR5X 1Q80A 4GAOA 2PMYA 3CZTX 4MLWA 3BYAA 1AHRA 5BPJA 1B4CA 1UP5A 3BOWB 2WNDA 2R2IA 2KQ6A 1V1FA 2PRUA 4M2QA 5JJGA 1CKKA 1F55A 1V1GA 1K95A 1J1EA 2L2EA 3PN7B 3EVUA 1BG1A 4C0KA 2EGDA 2JOJA 1S26D 1G4YR 4U8DA 4CPVA 2LLTA 2GGZA 1EL4A 1W7IB 2JZIA 2WCBA 2PASA 4YGAA 4GFTA 4YRUA 1K9PA 1NCXA 3F45A 1TCOB 3BUOB 3EK4A 4AQIA 4PE1A 4PHMA 3H4SE 3C1VA 4OR9B 2B1UA 4FQOA 3FIAA 5D69A 1XFYO 1DF0B 1NX3A 1ZOTB 2M7NA 4R1EA 1J7RA 1M45A 4YGDB 2M1UA 1WRKA 2BKIB 4E68A 2AUCA 4MZLA 1Y0VH 1NPQA 1LVCD 2MJWB 4M2OA 2JC2A 4GNKB 1TNWA 3OX6A 4ICBA 1TRFA 4GGFA 1N65A 2MBXA 2M3WA 1OMDA 4NQGA 2KYFA 1DGUA 1SBJA 2Q4UA 1DTLA 5HLOA 2AMIA 1K94A 1F71A 4NDBA 1JC2A 1KQVA 2L4IA 5ER5A 3RLZA 1BLQA 4PHKA 1PK0D 1B7TZ 1B9AA 2LVJA 1ZUZA 1H8BA 3VRQA 1LINA 1EG3A 2HQ8A 3AKAA 2D8NA 2BCBA 1M63B 4I5NB 4MBEA 1BJFA 1MXLC 1C7WA 1GQMA 4I5KA 3VRPA 1CM1A 1QX2A 1TTXA 3EVVA 1A75A 2PSRA 3GK4X 1YX7A 1AUIB 1CMFA 1QLKA 2COLB 1ZMZA 1JBAA 1B7TY 1CFFA 2KHNA 2KAXA 4WQ3A 1BU3A 2LNKA 3WXAA 2KI4C 1JF2A 5CSFA 2P6BB 1A75B 1TN4A 3LCPC 3VRNA 3O6BA 5AANA 2ZKMX 2I18A 2M1KB 2LHLA 1S6JA 3NXAA 4GGFC 3I5HC 1DJWA 1IJ5A 1S5GZ 2DOQA 3JTDB 1F4OA 2EC6C 2OTGB 4MRYA 1CB1A 2KFFA 1CNPA 1XYDA 1AP4A 2F33A 2BL0B 3DF0A 1C7VA 3A4UB 1UHHA 1FF1A 2KAYA 2F3YA 4QJ3B 2I7AA 2JWWA 2LLUA 5IBWA 1K9KA 2L50A 2M49B 5PALA 1MWNA 2M29A 3O2PA 1FI5A 4GBAA 1S1EA 3OHMB 1J7PA 1S36A 1SL8A 1BMOA 1QATA 4NDDA 3TDZA 1K96A 4D1EA 1YTZC 3WHUB 5KTYA 1BODA 2F3ZA 1IJ6A 2JNFA 4ZCUA 1B1GA 2LANA 4UPGA 1NX2A 3NSLA 5G08A 1H4BA
chains in the Genus database with same CATH superfamily
3OBVA 2SASA 1YVLA 4XYNA 2L0PA 1JUOA 1M31A 4CFRA 1KK8C 1SPYA 4F7FA 5D7FA 1TIZA 2JPOA 1AVSA 4ORBB 2F2PA 3SS5A 1U5IA 1UUSA 2QEOA 2JT3A 1UURA 2CTNA 2E6WA 1CTRA 1QLSA 1UHKA 5K89A 2KGRA 3VROA 2K60A 2K2FA 2JU0A 2MAZA 1SR6C 2ZN8A 1SNLA 2LE9B 1K9UA 2K8MB 2KI6D 1W9ZA 2G2BA 1GGWA 4YBHB 1TNQA 4MZJA 2LP2A 1QV1A 4PDZA 2FCEA 2WORA 2HQWA 3FWCA 4JQ0D 4P2YB 4Q04A 3LK0A 1RROA 3SG3A 3IF7A 3D73A 2LUCA 3SG5A 1J7QA 3GK2A 1J1DA 5CSJA 2JQ6A 4A4BA 2WC5A 1L2OC 1IKUA 1KCYA 4YI9A 3EVRA 4FTGA 5AXIA 1JFJA 1GGZA 1TUZA 2FOTA 1TOPA 2H61A 3WHTB 1DGVA 4CLNA 4YGEB 1QV0A 2KBIA 4HRGA 1KK7Z 1EJ3A 1ORGA 3ICBA 4FQTA 2ZN9A 2L51A 3BUXB 3EG5B 2ZRSA 1OZSA 1S6IA 3JVTC 2ZRTA 2H8VA 1SYMA 3DVJA 1YRUB 1CDMA 4KYNA 3R1VA 1R6PA 1LKJA 2KLEA 5HL1A 1PULA 2WCFA 2LUXA 5TNCA 3TUYC 5GQQC 1FW4A 2M8UA 2JT0A 3O4YA 3I5IC 1KK7Y 3E3RA 2LHIA 2LMVA 2I2RE 3AAKA 4HRHA 1YUUA 1SSEB 3OP0A 1WY9A 1N0YA 1RJVA 3PSRA 1B8CA 1AJ5A 1ALWA 1TNXA 4ORCB 1CLMA 1XVJA 1YRTB 1GJYA 1PSRA 2KI4B 1OMRA 2GV5A 2FJUB 2CT9A 4INWA 2FJYA 2WC8A 2JTTA 2LMTA 3DVKA 3KF9A 4N1GA 2KSPA 2OS8C 1CFPA 2M7LA 1MUXA 1CLBA 1IG5A 4XJKA 1CFCA 2KOTA 3M0WA 3I5HB 5DKRA 1N2DA 2G9BA 1CM4A 3D78A 2CCMA 1W7JB 2EC6B 4PE0A 4YI8A 2K7DA 1SRAA 2JT8A 1YUTA 1A2XA 1WLZA 2KDHA 2H61C 2MA2A 1R2UA 2VRGA 1NIWA 4MSPA 1WRZA 2NCOA 2KPHA 3BUMB 1TWOA 4CIDA 3AKBA 1D1OA 1YUSA 2LLSA 2LVKA 3CR2A 5CPVA 1LA0A 1OZOA 1M46A 2YGUA 5B8IB 1SY9A 2LMUA 4OKHA 1OOJA 3NHTA 2HETA 2ZFDA 1CDLA 2M97A 1XFWO 2H2KA 1SCMB 4IJ7A 1IQ5A 4A4CA 3KO0A 1SW8A 3CZ0A 2ISDA 4MRXA 3B87A 1X02A 1KSMA 2KNEA 4ZCVA 3S0AA 1BT6A 3BFAA 2LVVA 2BCXA 1Y1UA 3D75A 4HREE 1UHJA 5DKQA 3EKJA 2LCPA 1LA3A 4F0ZB 1YVHA 1KK8B 1CMGA 2O5GA 1QX5B 1S3PA 1A4PA 1K93D 2LVIA 3S0EA 1HQVA 1BR4B 2K2AA 1ODBA 5J3XA 3N7HA 1HT9A 2RGIA 1T14A 1NYAA 5DICA 1PRWA 2MLEC 1SR6B 1CLLA 3Q8IA 3SIAA 1WLMA 2MRDA 3PM8A 1XFRA 1QXPA 4YGBB 3DF0B 1SCMC 4N1FA 3OX5A 2Y1MA 1L2OB 2AAOA 2MLFC 3ZNIA 2BECA 2CXJA 4JWQA 3SS3A 3BUWB 4CFQA 2PALA 5HKYA 2WOSA 4IL1A 4DIRA 2V53A 1K2HA 4NDCA 1MR8A 1QVIY 4DRWA 2GTEA 1IQ3A 5HKZA 2GGMA 3CYZA 4PE7A 3R1OA 1NUBA 3BJHA 2I94A 1QTXA 2Y4QA 3LLEA 4PHNA 5AEQA 3B7AA 4WRIA 3JVTB 1ZFSA 1DVIA 2KGBC 2KLDA 4MEWA 1BR1B 4OCIA 3D0YA 3CTNA 1B8LA 1PVBA 1DMOA 2BCAA 1E8AA 3KPXA 1OOGA 1SMGA 1TCFA 1QS7A 2NZ0A 1UWOA 1FBVA 3TUYB 2LAPA 4INXA 1JFKA 1RFJA 2QACA 3I5GC 1OMVA 3I5IB 5FI6A 1EXRA 2LC5A 1QX7A 3VB1A 1IRJA 2NCPA 1QIVA 1NSHA 1MQ1A 1OSAA 1U5IB 3SS4A 1F54A 2F2OA 1NP8A 1QASA 3LL8B 1QWVA 3L47A 5CSNA 2P70A 1FI6A 2JRFA 2KQYA 2LP3A 3L4AA 1CFDA 1PVAA 3BOWA 5I94A 2K7CA 2OS8B 3ZWHA 2KI6C 1DJZA 1A29A 3O4XA 3QRXA 1NWDA 3FE9A 1DJIA 1B47A 1DQEA 4I5JA 3LK1A 2K7OA 3UNWA 3D10A 5ER4X 1XA5A 1KQMC 1M39A 2L5XB 1KFXL 1TNPA 3CS1A 2KYCA 3TS5C 2NXQA 1DT7B 3BFBA 3CWGA 3CR4X 1PSBA 4WQ2A 1C3ZA 3AAJA 3L4LA 4AOMA 2JXLA 4L9MA 5I2OA 1EH2A 3IQQA 1C07A 3PLFB 2F8PA 1SCVA 1DF0A 1KFUS 2WCKA 1MXEA 1IWQA 2JPTA 1SL7A 3TDUA 1KSOA 3I5FC 3MSEB 2KBMA 1YURA 3CLNA 4JD9A 1FPWA 3IVTA 4ORAB 4BY5A 2WCHA 4MZKA 1NCZA 1SK6D 2KAVA 3PATA 1K8UA 4TNCA 4C0JA 1F70A 4PALA 2FCDA 2IS9A 2L98A 1DJHA 3CZ1A 4DS7A 1KWOB 1OQPA 1XFZO 1OOHA 2QEBA 3DVMA 4DCKA 2O60A 1JWDA 4XJKB 3PN7C 1S6CA 3D74A 1XO5A 4BY4A 2HF5A 1L7ZA 2KFHA 1XK4A 1KFXS 4USLA 4JPZB 3O78A 1LXFC 5CSIA 2LM5A 3S0FA 3BFHA 3EK7A 1CDNA 1DJYA 3HX4A 4MN0A 1NX0A 3SG6A 1CDPA 2BKHB 1EG4A 3K21A 3FWBA 4GPLB 1DEKA 1QIWA 2WCEA 3KHEA 3TZ1A 1UHNA 1J7OA 2Y5IA 3WNXB 4PE4A 4OV2A 2CBLA 4GUKA 4YGCB 2TN4A 1RECA 4M2PA 3SG4A 3BXKA 1JSAA 2Y1NA 5DKNA 2BE6A 2E30A 1DJXA 5HLVA 1RWYA 2K7BA 2M9GA 1BF5A 3DYEA 2PYQA 5F6TA 1KWOC 1G8IA 3TDIA 1BOCA 2JXCA 1WDCB 1ZACA 3DVEA 3NSOA 3K1EA 3KEVA 5I8NA 1G33A 1NX1A 4OVNF 3BUNB 1AK8A 3I5GB 3FE8A 1ALVA 4JKTA 2OPOA 1QVIZ 4PHJA 1F8HA 3B88A 3S0BA 4C0LA 5AERA 3S0DA 1IGVA 2A4JA 2BBNA 1VRKA 3FS7A 1YR5A 4QJ5B 2K61A 2BBMA 1B8RA 1MHOA 1XFXO 2M0RA 4AQJA 3RM1A 5KU1A 1Y1XA 2ZNEA 1XFUO 1PALA 2WCJA 4N5XA 4QJ4B 2K0JA 3OB2B 1XK4C 1IH0A 2ERBA 2BE4A 2Q91A 2MHHA 2SCPA 1RK9A 1MF8B 2PVBA 3BQ3A 2KFGA 1J55A 1JF0A 5EL2A 3SG2A 1F4QA 3PJIA 4MVFA 4P5OE 5HKWA 4I5LB 4PCWA 1S5GY 3SJSA 2JULA 5I2QA 1AJ4A 1UHIA 1QJTA 5FI7A 2HPSA 1RTP1 1KQMB 1WDCC 3HCMA 5HYDA 3RZSA 3EKHA 1OOFA 5JOLA 3TS5B 3SIBA 3VGOA 2EHBA 3FE6A 1Y6WA 1KFUL 2JTZA 3IQOA 3DD4A 3PFVA 2P71A 3SG7A 3VRRA 2ZNDA 1OE9B 1YX8A 2QPTA 3D0YB 3GOFA 2LV7A 3CDNA 4HSZA 1DJGA 5FYXA 2JNXA 3JTDC 3NSKA 1A03A 2OTGC 1WRLA 4DUQA 1C3YA 3V2LA 3I5FB 2CNPA 3A8RA 2NLNA 5FI2A 1Y1AA 5AFPA 5KSZA 2BL0C 1XFVO 3NSIA 1K90D 5I2LA 1NCYA 3PALA 3EK8A 2L4HA 4GGNA 1SL9A 3GK1A 3OB1B 3CGAA 4ETOA 1SKTA 3CR5X 1Q80A 4GAOA 2PMYA 3CZTX 4MLWA 3BYAA 1AHRA 5BPJA 3CZ2A 1B4CA 1UP5A 3BOWB 2WNDA 2R2IA 4PT1A 2KQ6A 3QMEA 5D3OA 1V1FA 2PRUA 4M2QA 5JJGA 1CKKA 1TUJA 2WC6A 1V1GA 1K95A 1J1EA 2L2EA 3PN7B 3EVUA 1BG1A 1F55A 4C0KA 1OW4A 2EGDA 1S26D 2JOJA 1G4YR 1GM0A 4U8DA 4CPVA 2LLTA 2GGZA 1EL4A 1W7IB 2JZIA 2WCBA 1DC1A 2PASA 4YGAA 4GFTA 4YRUA 1K9PA 1NCXA 3F45A 1TCOB 3BUOB 3EK4A 4AQIA 3B86A 4PHMA 3H4SE 3C1VA 4OR9B 4PE1A 2B1UA 3DY9A 4FQOA 3FIAA 5D69A 1XFYO 1Z4HA 3NHIA 1DF0B 1NX3A 1ZOTB 2M7NA 2QDIA 1J7RA 1M45A 4R1EA 4YGDB 2M1UA 1WRKA 2BKIB 4E68A 3DXLA 2AUCA 2PQLA 2WCMA 4MZLA 1Y0VH 1NPQA 3NGVA 1LVCD 2MJWB 4M2OA 2JC2A 4GNKB 2WCLA 1TNWA 3OX6A 4ICBA 1TRFA 4GGFA 1N65A 2MBXA 2M3WA 1OMDA 4NQGA 2KYFA 1DGUA 1SBJA 2Q4UA 2L5YA 1DTLA 5HLOA 1LS8A 2AMIA 1K94A 1F71A 4NDBA 1JC2A 1KQVA 2L4IA 5ER5A 3RLZA 1BLQA 4PHKA 1PK0D 1B7TZ 3UO9A 1B9AA 2LVJA 1ZUZA 1H8BA 3VRQA 3B6XA 1LINA 1EG3A 2HQ8A 3AKAA 3R72A 3PM2A 2D8NA 2BCBA 1M63B 4I5NB 4MBEA 1BJFA 1MXLC 1C7WA 1GQMA 4I5KA 3VRPA 1CM1A 1QX2A 1TTXA 3EVVA 1A75A 2PSRA 3GK4X 1YX7A 1AUIB 1CMFA 1QLKA 2COLB 1ZMZA 3OGNA 1JBAA 3D77A 1B7TY 1CFFA 2KHNA 2KAXA 4WQ3A 1BU3A 2LNKA 3WXAA 2KI4C 1JF2A 2QEHA 5CSFA 1IIOA 2P6BB 1A75B 1TN4A 3LCPC 3VRNA 3O6BA 5AANA 2ZKMX 1OOIX 2I18A 2M1KB 2LHLA 1S6JA 2BNXA 3NXAA 4GGFC 3I5HC 3S0GA 1DJWA 1IJ5A 3DZTA 1S5GZ 2DOQA 3JTDB 1F4OA 2EC6C 2L2CA 2OTGB 3CABA 4MRYA 1CB1A 1DELA 2KFFA 1CNPA 1XYDA 3R1PA 1AP4A 2F33A 2BL0B 3DF0A 1C7VA 3A4UB 2BAPA 1UHHA 4OZDA 1P28A 2F3YA 2KAYA 4QJ3B 2I7AA 2JWWA 2LLUA 1FF1A 5IBWA 1K9KA 2L50A 2M49B 5PALA 1MWNA 2M29A 3O2PA 1FI5A 4GBAA 1S1EA 3OHMB 1J7PA 1S36A 1SL8A 1BMOA 1QATA 4NDDA 3TDZA 3D76A 1K96A 4D1EA 1YTZC 3WHUB 5KTYA 1BODA 2F3ZA 1IJ6A 2JNFA 4ZCUA 1Z2CB 2QEVA 1B1GA 2LANA 4UPGA 1NX2A 3NSLA 5G08A 1H4BA
chains in the Genus database with same CATH topology
2SASA 1YVLA 4XYNA 2L0PA 1JUOA 1M31A 4CFRA 1KK8C 1SPYA 5D7FA 1TIZA 1AVSA 4ORBB 2F2PA 1U5IA 1UUSA 2JT3A 1UURA 2CTNA 2E6WA 1CTRA 1QLSA 1UHKA 5K89A 2KGRA 3VROA 2K2FA 2JU0A 2MAZA 1SR6C 2ZN8A 1SNLA 2LE9B 1K9UA 2K8MB 2KI6D 2G2BA 1GGWA 4YBHB 1TNQA 4MZJA 2LP2A 1QV1A 4PDZA 2FCEA 2WORA 2HQWA 3FWCA 4JQ0D 4P2YB 4Q04A 3LK0A 1RROA 3SG3A 3IF7A 3SG5A 2LUCA 1J7QA 3GK2A 1J1DA 5CSJA 2JQ6A 4A4BA 1L2OC 1IKUA 1KCYA 4YI9A 3EVRA 4FTGA 5AXIA 1JFJA 1GGZA 2FOTA 1TOPA 2H61A 3WHTB 1DGVA 4CLNA 4YGEB 1QV0A 2KBIA 4HRGA 1KK7Z 1EJ3A 3ICBA 2ZN9A 2L51A 3BUXB 2ZRSA 1OZSA 1S6IA 3JVTC 2ZRTA 1SYMA 3DVJA 1YRUB 1CDMA 1R6PA 1LKJA 1PULA 2WCFA 2LUXA 5TNCA 3TUYC 5GQQC 1FW4A 2M8UA 2JT0A 3O4YA 3I5IC 1KK7Y 3E3RA 2LHIA 2LMVA 2I2RE 3AAKA 4HRHA 1YUUA 3OP0A 1WY9A 1N0YA 1RJVA 3PSRA 1B8CA 1AJ5A 1ALWA 1TNXA 4ORCB 1CLMA 1XVJA 1YRTB 1GJYA 1PSRA 2KI4B 1OMRA 2GV5A 2FJUB 2CT9A 2WC8A 2JTTA 2LMTA 3DVKA 3KF9A 4N1GA 2KSPA 2OS8C 1CFPA 2M7LA 1MUXA 1CLBA 1IG5A 4XJKA 1CFCA 2KOTA 3M0WA 3I5HB 5DKRA 1N2DA 2G9BA 1CM4A 2CCMA 1W7JB 2EC6B 4PE0A 4YI8A 2K7DA 1SRAA 2JT8A 1YUTA 1A2XA 1WLZA 2KDHA 2H61C 2MA2A 1R2UA 2VRGA 1NIWA 4MSPA 1WRZA 2NCOA 3BUMB 4CIDA 3AKBA 1D1OA 1YUSA 2LLSA 2LVKA 3CR2A 5CPVA 1LA0A 1OZOA 1M46A 5B8IB 1SY9A 2LMUA 4OKHA 1OOJA 2HETA 2ZFDA 1CDLA 2M97A 1XFWO 2H2KA 1SCMB 1IQ5A 4A4CA 3KO0A 1SW8A 2ISDA 4MRXA 1X02A 1KSMA 2KNEA 4ZCVA 1BT6A 2LVVA 2BCXA 1Y1UA 4HREE 1UHJA 5DKQA 3EKJA 2LCPA 1LA3A 4F0ZB 1YVHA 1KK8B 1CMGA 2O5GA 1QX5B 1S3PA 1A4PA 1K93D 2LVIA 1HQVA 1BR4B 2K2AA 1ODBA 5J3XA 1HT9A 2RGIA 1NYAA 1PRWA 2MLEC 1SR6B 1CLLA 3SIAA 1WLMA 2MRDA 3PM8A 1QXPA 4YGBB 3DF0B 1SCMC 4N1FA 3OX5A 2Y1MA 1L2OB 2AAOA 2MLFC 3ZNIA 2BECA 2CXJA 4JWQA 3BUWB 4CFQA 2PALA 5HKYA 2WOSA 4IL1A 4DIRA 2V53A 1K2HA 4NDCA 1MR8A 1QVIY 4DRWA 1IQ3A 5HKZA 2GGMA 4PE7A 1NUBA 2I94A 1QTXA 2Y4QA 3LLEA 4PHNA 5AEQA 4WRIA 3JVTB 1ZFSA 1DVIA 2KGBC 4MEWA 4OCIA 1BR1B 3D0YA 3CTNA 1B8LA 1PVBA 1DMOA 2BCAA 1E8AA 3KPXA 1SMGA 1TCFA 1QS7A 2NZ0A 1UWOA 1FBVA 3TUYB 2LAPA 1JFKA 1RFJA 2QACA 3I5GC 1OMVA 3I5IB 1EXRA 2LC5A 1QX7A 1IRJA 2NCPA 1QIVA 1NSHA 1MQ1A 1OSAA 1U5IB 1F54A 2F2OA 1NP8A 1QASA 3LL8B 5CSNA 1FI6A 2JRFA 2KQYA 2LP3A 1CFDA 1PVAA 3BOWA 2K7CA 2OS8B 3ZWHA 2KI6C 1DJZA 1A29A 3QRXA 1NWDA 1DJIA 1B47A 4I5JA 3LK1A 2K7OA 3D10A 5ER4X 1XA5A 1KQMC 1M39A 2L5XB 1KFXL 1TNPA 3CS1A 2KYCA 3TS5C 2NXQA 1DT7B 3CWGA 3CR4X 1PSBA 4WQ2A 3AAJA 4AOMA 1EH2A 2JXLA 4L9MA 5I2OA 3IQQA 1C07A 3PLFB 2F8PA 1SCVA 1DF0A 1KFUS 1MXEA 1IWQA 2JPTA 1SL7A 3TDUA 1KSOA 3I5FC 3MSEB 2KBMA 1YURA 3CLNA 1FPWA 4ORAB 4BY5A 4MZKA 1NCZA 1SK6D 2KAVA 3PATA 1K8UA 4TNCA 4C0JA 1F70A 4PALA 2FCDA 2IS9A 2L98A 1DJHA 4DS7A 1KWOB 1OQPA 1XFZO 3DVMA 4DCKA 2O60A 1JWDA 4XJKB 3PN7C 1S6CA 1XO5A 4BY4A 2HF5A 1L7ZA 2KFHA 1XK4A 1KFXS 4USLA 4JPZB 3O78A 1LXFC 5CSIA 2LM5A 3EK7A 1CDNA 1DJYA 3HX4A 4MN0A 1NX0A 3SG6A 1CDPA 2BKHB 1EG4A 3K21A 3FWBA 4GPLB 1QIWA 2WCEA 3KHEA 3TZ1A 1UHNA 1J7OA 2Y5IA 3WNXB 4PE4A 4OV2A 2CBLA 4GUKA 4YGCB 2TN4A 1RECA 4M2PA 3SG4A 3BXKA 1JSAA 2Y1NA 5DKNA 2BE6A 2E30A 1DJXA 5HLVA 1RWYA 2K7BA 2M9GA 1BF5A 5F6TA 1KWOC 1G8IA 3TDIA 1BOCA 2JXCA 1WDCB 1ZACA 3DVEA 3NSOA 3KEVA 5I8NA 1G33A 1NX1A 4OVNF 3BUNB 1AK8A 3I5GB 4PHJA 1ALVA 2OPOA 1QVIZ 1F8HA 4C0LA 5AERA 1IGVA 2A4JA 2BBNA 1VRKA 3FS7A 1YR5A 4QJ5B 2K61A 2BBMA 1B8RA 1MHOA 1XFXO 2M0RA 4AQJA 3RM1A 5KU1A 1Y1XA 2ZNEA 1XFUO 1PALA 4N5XA 4QJ4B 2K0JA 3OB2B 1XK4C 1IH0A 2Q91A 2BE4A 2SCPA 2MHHA 1RK9A 1MF8B 2PVBA 3BQ3A 2KFGA 1J55A 1JF0A 3SG2A 1F4QA 4MVFA 4P5OE 5HKWA 4I5LB 4PCWA 1S5GY 3SJSA 2JULA 5I2QA 1AJ4A 1UHIA 1QJTA 2HPSA 1RTP1 1KQMB 1WDCC 3HCMA 5HYDA 3EKHA 5JOLA 3TS5B 3VGOA 3SIBA 2EHBA 1Y6WA 1KFUL 2JTZA 3IQOA 3DD4A 3PFVA 3SG7A 3VRRA 2ZNDA 1OE9B 1YX8A 2QPTA 3D0YB 3GOFA 2LV7A 4HSZA 1DJGA 5FYXA 2JNXA 3JTDC 3NSKA 1A03A 2OTGC 1WRLA 4DUQA 3I5FB 2CNPA 3A8RA 2NLNA 1Y1AA 5AFPA 5KSZA 2BL0C 1XFVO 3NSIA 1K90D 5I2LA 1NCYA 3PALA 3EK8A 2L4HA 4GGNA 1SL9A 3GK1A 3OB1B 3CGAA 4ETOA 1SKTA 3CR5X 1Q80A 4GAOA 2PMYA 3CZTX 4MLWA 3BYAA 1AHRA 5BPJA 1B4CA 1UP5A 3BOWB 2WNDA 2R2IA 2KQ6A 1V1FA 2PRUA 4M2QA 5JJGA 1CKKA 1F55A 1V1GA 1K95A 1J1EA 2L2EA 3PN7B 3EVUA 1BG1A 4C0KA 2EGDA 2JOJA 1S26D 1G4YR 4U8DA 4CPVA 2LLTA 2GGZA 1EL4A 1W7IB 2JZIA 2WCBA 2PASA 4YGAA 4GFTA 4YRUA 1K9PA 1NCXA 3F45A 1TCOB 3BUOB 3EK4A 4AQIA 4PE1A 4PHMA 3H4SE 3C1VA 4OR9B 2B1UA 4FQOA 3FIAA 5D69A 1XFYO 1DF0B 1NX3A 1ZOTB 2M7NA 4R1EA 1J7RA 1M45A 4YGDB 2M1UA 1WRKA 2BKIB 4E68A 2AUCA 4MZLA 1Y0VH 1NPQA 1LVCD 2MJWB 4M2OA 2JC2A 4GNKB 1TNWA 3OX6A 4ICBA 1TRFA 4GGFA 1N65A 2MBXA 2M3WA 1OMDA 4NQGA 2KYFA 1DGUA 1SBJA 2Q4UA 1DTLA 5HLOA 2AMIA 1K94A 1F71A 4NDBA 1JC2A 1KQVA 2L4IA 5ER5A 3RLZA 1BLQA 4PHKA 1PK0D 1B7TZ 1B9AA 2LVJA 1ZUZA 1H8BA 3VRQA 1LINA 1EG3A 2HQ8A 3AKAA 2D8NA 2BCBA 1M63B 4I5NB 4MBEA 1BJFA 1MXLC 1C7WA 1GQMA 4I5KA 3VRPA 1CM1A 1QX2A 1TTXA 3EVVA 1A75A 2PSRA 3GK4X 1YX7A 1AUIB 1CMFA 1QLKA 2COLB 1ZMZA 1JBAA 1B7TY 1CFFA 2KHNA 2KAXA 4WQ3A 1BU3A 2LNKA 3WXAA 2KI4C 1JF2A 5CSFA 2P6BB 1A75B 1TN4A 3LCPC 3VRNA 3O6BA 5AANA 2ZKMX 2I18A 2M1KB 2LHLA 1S6JA 3NXAA 4GGFC 3I5HC 1DJWA 1IJ5A 1S5GZ 2DOQA 3JTDB 1F4OA 2EC6C 2OTGB 4MRYA 1CB1A 2KFFA 1CNPA 1XYDA 1AP4A 2F33A 2BL0B 3DF0A 1C7VA 3A4UB 1UHHA 1FF1A 2KAYA 2F3YA 4QJ3B 2I7AA 2JWWA 2LLUA 5IBWA 1K9KA 2L50A 2M49B 5PALA 1MWNA 2M29A 3O2PA 1FI5A 4GBAA 1S1EA 3OHMB 1J7PA 1S36A 1SL8A 1BMOA 1QATA 4NDDA 3TDZA 1K96A 4D1EA 1YTZC 3WHUB 5KTYA 1BODA 2F3ZA 1IJ6A 2JNFA 4ZCUA 1B1GA 2LANA 4UPGA 1NX2A 3NSLA 5G08A 1H4BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2SAS A;  1YVL A;  4XYN A;  2L0P A;  1JUO A;  1M31 A;  4CFR A;  1KK8 C;  1SPY A;  5D7F A;  1TIZ A;  1AVS A;  4ORB B;  2F2P A;  1U5I A;  1UUS A;  2JT3 A;  1UUR A;  2CTN A;  2E6W A;  1CTR A;  1QLS A;  1UHK A;  5K89 A;  2KGR A;  3VRO A;  2K2F A;  2JU0 A;  2MAZ A;  1SR6 C;  2ZN8 A;  1SNL A;  2LE9 B;  1K9U A;  2K8M B;  2KI6 D;  2G2B A;  1GGW A;  4YBH B;  1TNQ A;  4MZJ A;  2LP2 A;  1QV1 A;  4PDZ A;  2FCE A;  2WOR A;  2HQW A;  3FWC A;  4JQ0 D;  4P2Y B;  4Q04 A;  3LK0 A;  1RRO A;  3SG3 A;  3IF7 A;  3SG5 A;  2LUC A;  1J7Q A;  3GK2 A;  1J1D A;  5CSJ A;  2JQ6 A;  4A4B A;  1L2O C;  1IKU A;  1KCY A;  4YI9 A;  3EVR A;  4FTG A;  5AXI A;  1JFJ A;  1GGZ A;  2FOT A;  1TOP A;  2H61 A;  3WHT B;  1DGV A;  4CLN A;  4YGE B;  1QV0 A;  2KBI A;  4HRG A;  1KK7 Z;  1EJ3 A;  3ICB A;  2ZN9 A;  2L51 A;  3BUX B;  2ZRS A;  1OZS A;  1S6I A;  3JVT C;  2ZRT A;  1SYM A;  3DVJ A;  1YRU B;  1CDM A;  1R6P A;  1LKJ A;  1PUL A;  2WCF A;  2LUX A;  5TNC A;  3TUY C;  5GQQ C;  1FW4 A;  2M8U A;  2JT0 A;  3O4Y A;  3I5I C;  1KK7 Y;  3E3R A;  2LHI A;  2LMV A;  2I2R E;  3AAK A;  4HRH A;  1YUU A;  3OP0 A;  1WY9 A;  1N0Y A;  1RJV A;  3PSR A;  1B8C A;  1AJ5 A;  1ALW A;  1TNX A;  4ORC B;  1CLM A;  1XVJ A;  1YRT B;  1GJY A;  1PSR A;  2KI4 B;  1OMR A;  2GV5 A;  2FJU B;  2CT9 A;  2WC8 A;  2JTT A;  2LMT A;  3DVK A;  3KF9 A;  4N1G A;  2KSP A;  2OS8 C;  1CFP A;  2M7L A;  1MUX A;  1CLB A;  1IG5 A;  4XJK A;  1CFC A;  2KOT A;  3M0W A;  3I5H B;  5DKR A;  1N2D A;  2G9B A;  1CM4 A;  2CCM A;  1W7J B;  2EC6 B;  4PE0 A;  4YI8 A;  2K7D A;  1SRA A;  2JT8 A;  1YUT A;  1A2X A;  1WLZ A;  2KDH A;  2H61 C;  2MA2 A;  1R2U A;  2VRG A;  1NIW A;  4MSP A;  1WRZ A;  2NCO A;  3BUM B;  4CID A;  3AKB A;  1D1O A;  1YUS A;  2LLS A;  2LVK A;  3CR2 A;  5CPV A;  1LA0 A;  1OZO A;  1M46 A;  5B8I B;  1SY9 A;  2LMU A;  4OKH A;  1OOJ A;  2HET A;  2ZFD A;  1CDL A;  2M97 A;  1XFW O;  2H2K A;  1SCM B;  1IQ5 A;  4A4C A;  3KO0 A;  1SW8 A;  2ISD A;  4MRX A;  1X02 A;  1KSM A;  2KNE A;  4ZCV A;  1BT6 A;  2LVV A;  2BCX A;  1Y1U A;  4HRE E;  1UHJ A;  5DKQ A;  3EKJ A;  2LCP A;  1LA3 A;  4F0Z B;  1YVH A;  1KK8 B;  1CMG A;  2O5G A;  1QX5 B;  1S3P A;  1A4P A;  1K93 D;  2LVI A;  1HQV A;  1BR4 B;  2K2A A;  1ODB A;  5J3X A;  1HT9 A;  2RGI A;  1NYA A;  1PRW A;  2MLE C;  1SR6 B;  1CLL A;  3SIA A;  1WLM A;  2MRD A;  3PM8 A;  1QXP A;  4YGB B;  3DF0 B;  1SCM C;  4N1F A;  3OX5 A;  2Y1M A;  1L2O B;  2AAO A;  2MLF C;  3ZNI A;  2BEC A;  2CXJ A;  4JWQ A;  3BUW B;  4CFQ A;  2PAL A;  5HKY A;  2WOS A;  4IL1 A;  4DIR A;  2V53 A;  1K2H A;  4NDC A;  1MR8 A;  1QVI Y;  4DRW A;  1IQ3 A;  5HKZ A;  2GGM A;  4PE7 A;  1NUB A;  2I94 A;  1QTX A;  2Y4Q A;  3LLE A;  4PHN A;  5AEQ A;  4WRI A;  3JVT B;  1ZFS A;  1DVI A;  2KGB C;  4MEW A;  4OCI A;  1BR1 B;  3D0Y A;  3CTN A;  1B8L A;  1PVB A;  1DMO A;  2BCA A;  1E8A A;  3KPX A;  1SMG A;  1TCF A;  1QS7 A;  2NZ0 A;  1UWO A;  1FBV A;  3TUY B;  2LAP A;  1JFK A;  1RFJ A;  2QAC A;  3I5G C;  1OMV A;  3I5I B;  1EXR A;  2LC5 A;  1QX7 A;  1IRJ A;  2NCP A;  1QIV A;  1NSH A;  1MQ1 A;  1OSA A;  1U5I B;  1F54 A;  2F2O A;  1NP8 A;  1QAS A;  3LL8 B;  5CSN A;  1FI6 A;  2JRF A;  2KQY A;  2LP3 A;  1CFD A;  1PVA A;  3BOW A;  2K7C A;  2OS8 B;  3ZWH A;  2KI6 C;  1DJZ A;  1A29 A;  3QRX A;  1NWD A;  1DJI A;  1B47 A;  4I5J A;  3LK1 A;  2K7O A;  3D10 A;  5ER4 X;  1XA5 A;  1KQM C;  1M39 A;  2L5X B;  1KFX L;  1TNP A;  3CS1 A;  2KYC A;  3TS5 C;  2NXQ A;  1DT7 B;  3CWG A;  3CR4 X;  1PSB A;  4WQ2 A;  3AAJ A;  4AOM A;  1EH2 A;  2JXL A;  4L9M A;  5I2O A;  3IQQ A;  1C07 A;  3PLF B;  2F8P A;  1SCV A;  1DF0 A;  1KFU S;  1MXE A;  1IWQ A;  2JPT A;  1SL7 A;  3TDU A;  1KSO A;  3I5F C;  3MSE B;  2KBM A;  1YUR A;  3CLN A;  1FPW A;  4ORA B;  4BY5 A;  4MZK A;  1NCZ A;  1SK6 D;  2KAV A;  3PAT A;  1K8U A;  4TNC A;  4C0J A;  1F70 A;  4PAL A;  2FCD A;  2IS9 A;  2L98 A;  1DJH A;  4DS7 A;  1KWO B;  1OQP A;  1XFZ O;  3DVM A;  4DCK A;  2O60 A;  1JWD A;  4XJK B;  3PN7 C;  1S6C A;  1XO5 A;  4BY4 A;  2HF5 A;  1L7Z A;  2KFH A;  1XK4 A;  1KFX S;  4USL A;  4JPZ B;  3O78 A;  1LXF C;  5CSI A;  2LM5 A;  3EK7 A;  1CDN A;  1DJY A;  3HX4 A;  4MN0 A;  1NX0 A;  3SG6 A;  1CDP A;  2BKH B;  1EG4 A;  3K21 A;  3FWB A;  4GPL B;  1QIW A;  2WCE A;  3KHE A;  3TZ1 A;  1UHN A;  1J7O A;  2Y5I A;  3WNX B;  4PE4 A;  4OV2 A;  2CBL A;  4GUK A;  4YGC B;  2TN4 A;  1REC A;  4M2P A;  3SG4 A;  3BXK A;  1JSA A;  2Y1N A;  5DKN A;  2BE6 A;  2E30 A;  1DJX A;  5HLV A;  1RWY A;  2K7B A;  2M9G A;  1BF5 A;  5F6T A;  1KWO C;  1G8I A;  3TDI A;  1BOC A;  2JXC A;  1WDC B;  1ZAC A;  3DVE A;  3NSO A;  3KEV A;  5I8N A;  1G33 A;  1NX1 A;  4OVN F;  3BUN B;  1AK8 A;  3I5G B;  4PHJ A;  1ALV A;  2OPO A;  1QVI Z;  1F8H A;  4C0L A;  5AER A;  1IGV A;  2A4J A;  2BBN A;  1VRK A;  3FS7 A;  1YR5 A;  4QJ5 B;  2K61 A;  2BBM A;  1B8R A;  1MHO A;  1XFX O;  2M0R A;  4AQJ A;  3RM1 A;  5KU1 A;  1Y1X A;  2ZNE A;  1XFU O;  1PAL A;  4N5X A;  4QJ4 B;  2K0J A;  3OB2 B;  1XK4 C;  1IH0 A;  2Q91 A;  2BE4 A;  2SCP A;  2MHH A;  1RK9 A;  1MF8 B;  2PVB A;  3BQ3 A;  2KFG A;  1J55 A;  1JF0 A;  3SG2 A;  1F4Q A;  4MVF A;  4P5O E;  5HKW A;  4I5L B;  4PCW A;  1S5G Y;  3SJS A;  2JUL A;  5I2Q A;  1AJ4 A;  1UHI A;  1QJT A;  2HPS A;  1RTP 1;  1KQM B;  1WDC C;  3HCM A;  5HYD A;  3EKH A;  5JOL A;  3TS5 B;  3VGO A;  3SIB A;  2EHB A;  1Y6W A;  1KFU L;  2JTZ A;  3IQO A;  3DD4 A;  3PFV A;  3SG7 A;  3VRR A;  2ZND A;  1OE9 B;  1YX8 A;  2QPT A;  3D0Y B;  3GOF A;  2LV7 A;  4HSZ A;  1DJG A;  5FYX A;  2JNX A;  3JTD C;  3NSK A;  1A03 A;  2OTG C;  1WRL A;  4DUQ A;  3I5F B;  2CNP A;  3A8R A;  2NLN A;  1Y1A A;  5AFP A;  5KSZ A;  2BL0 C;  1XFV O;  3NSI A;  1K90 D;  5I2L A;  1NCY A;  3PAL A;  3EK8 A;  2L4H A;  4GGN A;  1SL9 A;  3GK1 A;  3OB1 B;  3CGA A;  4ETO A;  1SKT A;  3CR5 X;  1Q80 A;  4GAO A;  2PMY A;  3CZT X;  4MLW A;  3BYA A;  1AHR A;  5BPJ A;  1B4C A;  1UP5 A;  3BOW B;  2WND A;  2R2I A;  2KQ6 A;  1V1F A;  2PRU A;  4M2Q A;  5JJG A;  1CKK A;  1F55 A;  1V1G A;  1K95 A;  1J1E A;  2L2E A;  3PN7 B;  3EVU A;  1BG1 A;  4C0K A;  2EGD A;  2JOJ A;  1S26 D;  1G4Y R;  4U8D A;  4CPV A;  2LLT A;  2GGZ A;  1EL4 A;  1W7I B;  2JZI A;  2WCB A;  2PAS A;  4YGA A;  4GFT A;  4YRU A;  1K9P A;  1NCX A;  3F45 A;  1TCO B;  3BUO B;  3EK4 A;  4AQI A;  4PE1 A;  4PHM A;  3H4S E;  3C1V A;  4OR9 B;  2B1U A;  4FQO A;  3FIA A;  5D69 A;  1XFY O;  1DF0 B;  1NX3 A;  1ZOT B;  2M7N A;  4R1E A;  1J7R A;  1M45 A;  4YGD B;  2M1U A;  1WRK A;  2BKI B;  4E68 A;  2AUC A;  4MZL A;  1Y0V H;  1NPQ A;  1LVC D;  2MJW B;  4M2O A;  2JC2 A;  4GNK B;  1TNW A;  3OX6 A;  4ICB A;  1TRF A;  4GGF A;  1N65 A;  2MBX A;  2M3W A;  1OMD A;  4NQG A;  2KYF A;  1DGU A;  1SBJ A;  2Q4U A;  1DTL A;  5HLO A;  2AMI A;  1K94 A;  1F71 A;  4NDB A;  1JC2 A;  1KQV A;  2L4I A;  5ER5 A;  3RLZ A;  1BLQ A;  4PHK A;  1PK0 D;  1B7T Z;  1B9A A;  2LVJ A;  1ZUZ A;  1H8B A;  3VRQ A;  1LIN A;  1EG3 A;  2HQ8 A;  3AKA A;  2D8N A;  2BCB A;  1M63 B;  4I5N B;  4MBE A;  1BJF A;  1MXL C;  1C7W A;  1GQM A;  4I5K A;  3VRP A;  1CM1 A;  1QX2 A;  1TTX A;  3EVV A;  1A75 A;  2PSR A;  3GK4 X;  1YX7 A;  1AUI B;  1CMF A;  1QLK A;  2COL B;  1ZMZ A;  1JBA A;  1B7T Y;  1CFF A;  2KHN A;  2KAX A;  4WQ3 A;  1BU3 A;  2LNK A;  3WXA A;  2KI4 C;  1JF2 A;  5CSF A;  2P6B B;  1A75 B;  1TN4 A;  3LCP C;  3VRN A;  3O6B A;  5AAN A;  2ZKM X;  2I18 A;  2M1K B;  2LHL A;  1S6J A;  3NXA A;  4GGF C;  3I5H C;  1DJW A;  1IJ5 A;  1S5G Z;  2DOQ A;  3JTD B;  1F4O A;  2EC6 C;  2OTG B;  4MRY A;  1CB1 A;  2KFF A;  1CNP A;  1XYD A;  1AP4 A;  2F33 A;  2BL0 B;  3DF0 A;  1C7V A;  3A4U B;  1UHH A;  1FF1 A;  2KAY A;  2F3Y A;  4QJ3 B;  2I7A A;  2JWW A;  2LLU A;  5IBW A;  1K9K A;  2L50 A;  2M49 B;  5PAL A;  1MWN A;  2M29 A;  3O2P A;  1FI5 A;  4GBA A;  1S1E A;  3OHM B;  1J7P A;  1S36 A;  1SL8 A;  1BMO A;  1QAT A;  4NDD A;  3TDZ A;  1K96 A;  4D1E A;  1YTZ C;  3WHU B;  5KTY A;  1BOD A;  2F3Z A;  1IJ6 A;  2JNF A;  4ZCU A;  1B1G A;  2LAN A;  4UPG A;  1NX2 A;  3NSL A;  5G08 A;  1H4B A; 
#chains in the Genus database with same CATH topology
 3OBV A;  2SAS A;  1YVL A;  4XYN A;  2L0P A;  1JUO A;  1M31 A;  4CFR A;  1KK8 C;  1SPY A;  4F7F A;  5D7F A;  1TIZ A;  2JPO A;  1AVS A;  4ORB B;  2F2P A;  3SS5 A;  1U5I A;  1UUS A;  2QEO A;  2JT3 A;  1UUR A;  2CTN A;  2E6W A;  1CTR A;  1QLS A;  1UHK A;  5K89 A;  2KGR A;  3VRO A;  2K60 A;  2K2F A;  2JU0 A;  2MAZ A;  1SR6 C;  2ZN8 A;  1SNL A;  2LE9 B;  1K9U A;  2K8M B;  2KI6 D;  1W9Z A;  2G2B A;  1GGW A;  4YBH B;  1TNQ A;  4MZJ A;  2LP2 A;  1QV1 A;  4PDZ A;  2FCE A;  2WOR A;  2HQW A;  3FWC A;  4JQ0 D;  4P2Y B;  4Q04 A;  3LK0 A;  1RRO A;  3SG3 A;  3IF7 A;  3D73 A;  2LUC A;  3SG5 A;  1J7Q A;  3GK2 A;  1J1D A;  5CSJ A;  2JQ6 A;  4A4B A;  2WC5 A;  1L2O C;  1IKU A;  1KCY A;  4YI9 A;  3EVR A;  4FTG A;  5AXI A;  1JFJ A;  1GGZ A;  1TUZ A;  2FOT A;  1TOP A;  2H61 A;  3WHT B;  1DGV A;  4CLN A;  4YGE B;  1QV0 A;  2KBI A;  4HRG A;  1KK7 Z;  1EJ3 A;  1ORG A;  3ICB A;  4FQT A;  2ZN9 A;  2L51 A;  3BUX B;  3EG5 B;  2ZRS A;  1OZS A;  1S6I A;  3JVT C;  2ZRT A;  2H8V A;  1SYM A;  3DVJ A;  1YRU B;  1CDM A;  4KYN A;  3R1V A;  1R6P A;  1LKJ A;  2KLE A;  5HL1 A;  1PUL A;  2WCF A;  2LUX A;  5TNC A;  3TUY C;  5GQQ C;  1FW4 A;  2M8U A;  2JT0 A;  3O4Y A;  3I5I C;  1KK7 Y;  3E3R A;  2LHI A;  2LMV A;  2I2R E;  3AAK A;  4HRH A;  1YUU A;  1SSE B;  3OP0 A;  1WY9 A;  1N0Y A;  1RJV A;  3PSR A;  1B8C A;  1AJ5 A;  1ALW A;  1TNX A;  4ORC B;  1CLM A;  1XVJ A;  1YRT B;  1GJY A;  1PSR A;  2KI4 B;  1OMR A;  2GV5 A;  2FJU B;  2CT9 A;  4INW A;  2FJY A;  2WC8 A;  2JTT A;  2LMT A;  3DVK A;  3KF9 A;  4N1G A;  2KSP A;  2OS8 C;  1CFP A;  2M7L A;  1MUX A;  1CLB A;  1IG5 A;  4XJK A;  1CFC A;  2KOT A;  3M0W A;  3I5H B;  5DKR A;  1N2D A;  2G9B A;  1CM4 A;  3D78 A;  2CCM A;  1W7J B;  2EC6 B;  4PE0 A;  4YI8 A;  2K7D A;  1SRA A;  2JT8 A;  1YUT A;  1A2X A;  1WLZ A;  2KDH A;  2H61 C;  2MA2 A;  1R2U A;  2VRG A;  1NIW A;  4MSP A;  1WRZ A;  2NCO A;  2KPH A;  3BUM B;  1TWO A;  4CID A;  3AKB A;  1D1O A;  1YUS A;  2LLS A;  2LVK A;  3CR2 A;  5CPV A;  1LA0 A;  1OZO A;  1M46 A;  2YGU A;  5B8I B;  1SY9 A;  2LMU A;  4OKH A;  1OOJ A;  3NHT A;  2HET A;  2ZFD A;  1CDL A;  2M97 A;  1XFW O;  2H2K A;  1SCM B;  4IJ7 A;  1IQ5 A;  4A4C A;  3KO0 A;  1SW8 A;  3CZ0 A;  2ISD A;  4MRX A;  3B87 A;  1X02 A;  1KSM A;  2KNE A;  4ZCV A;  3S0A A;  1BT6 A;  3BFA A;  2LVV A;  2BCX A;  1Y1U A;  3D75 A;  4HRE E;  1UHJ A;  5DKQ A;  3EKJ A;  2LCP A;  1LA3 A;  4F0Z B;  1YVH A;  1KK8 B;  1CMG A;  2O5G A;  1QX5 B;  1S3P A;  1A4P A;  1K93 D;  2LVI A;  3S0E A;  1HQV A;  1BR4 B;  2K2A A;  1ODB A;  5J3X A;  3N7H A;  1HT9 A;  2RGI A;  1T14 A;  1NYA A;  5DIC A;  1PRW A;  2MLE C;  1SR6 B;  1CLL A;  3Q8I A;  3SIA A;  1WLM A;  2MRD A;  3PM8 A;  1XFR A;  1QXP A;  4YGB B;  3DF0 B;  1SCM C;  4N1F A;  3OX5 A;  2Y1M A;  1L2O B;  2AAO A;  2MLF C;  3ZNI A;  2BEC A;  2CXJ A;  4JWQ A;  3SS3 A;  3BUW B;  4CFQ A;  2PAL A;  5HKY A;  2WOS A;  4IL1 A;  4DIR A;  2V53 A;  1K2H A;  4NDC A;  1MR8 A;  1QVI Y;  4DRW A;  2GTE A;  1IQ3 A;  5HKZ A;  2GGM A;  3CYZ A;  4PE7 A;  3R1O A;  1NUB A;  3BJH A;  2I94 A;  1QTX A;  2Y4Q A;  3LLE A;  4PHN A;  5AEQ A;  3B7A A;  4WRI A;  3JVT B;  1ZFS A;  1DVI A;  2KGB C;  2KLD A;  4MEW A;  1BR1 B;  4OCI A;  3D0Y A;  3CTN A;  1B8L A;  1PVB A;  1DMO A;  2BCA A;  1E8A A;  3KPX A;  1OOG A;  1SMG A;  1TCF A;  1QS7 A;  2NZ0 A;  1UWO A;  1FBV A;  3TUY B;  2LAP A;  4INX A;  1JFK A;  1RFJ A;  2QAC A;  3I5G C;  1OMV A;  3I5I B;  5FI6 A;  1EXR A;  2LC5 A;  1QX7 A;  3VB1 A;  1IRJ A;  2NCP A;  1QIV A;  1NSH A;  1MQ1 A;  1OSA A;  1U5I B;  3SS4 A;  1F54 A;  2F2O A;  1NP8 A;  1QAS A;  3LL8 B;  1QWV A;  3L47 A;  5CSN A;  2P70 A;  1FI6 A;  2JRF A;  2KQY A;  2LP3 A;  3L4A A;  1CFD A;  1PVA A;  3BOW A;  5I94 A;  2K7C A;  2OS8 B;  3ZWH A;  2KI6 C;  1DJZ A;  1A29 A;  3O4X A;  3QRX A;  1NWD A;  3FE9 A;  1DJI A;  1B47 A;  1DQE A;  4I5J A;  3LK1 A;  2K7O A;  3UNW A;  3D10 A;  5ER4 X;  1XA5 A;  1KQM C;  1M39 A;  2L5X B;  1KFX L;  1TNP A;  3CS1 A;  2KYC A;  3TS5 C;  2NXQ A;  1DT7 B;  3BFB A;  3CWG A;  3CR4 X;  1PSB A;  4WQ2 A;  1C3Z A;  3AAJ A;  3L4L A;  4AOM A;  2JXL A;  4L9M A;  5I2O A;  1EH2 A;  3IQQ A;  1C07 A;  3PLF B;  2F8P A;  1SCV A;  1DF0 A;  1KFU S;  2WCK A;  1MXE A;  1IWQ A;  2JPT A;  1SL7 A;  3TDU A;  1KSO A;  3I5F C;  3MSE B;  2KBM A;  1YUR A;  3CLN A;  4JD9 A;  1FPW A;  3IVT A;  4ORA B;  4BY5 A;  2WCH A;  4MZK A;  1NCZ A;  1SK6 D;  2KAV A;  3PAT A;  1K8U A;  4TNC A;  4C0J A;  1F70 A;  4PAL A;  2FCD A;  2IS9 A;  2L98 A;  1DJH A;  3CZ1 A;  4DS7 A;  1KWO B;  1OQP A;  1XFZ O;  1OOH A;  2QEB A;  3DVM A;  4DCK A;  2O60 A;  1JWD A;  4XJK B;  3PN7 C;  1S6C A;  3D74 A;  1XO5 A;  4BY4 A;  2HF5 A;  1L7Z A;  2KFH A;  1XK4 A;  1KFX S;  4USL A;  4JPZ B;  3O78 A;  1LXF C;  5CSI A;  2LM5 A;  3S0F A;  3BFH A;  3EK7 A;  1CDN A;  1DJY A;  3HX4 A;  4MN0 A;  1NX0 A;  3SG6 A;  1CDP A;  2BKH B;  1EG4 A;  3K21 A;  3FWB A;  4GPL B;  1DEK A;  1QIW A;  2WCE A;  3KHE A;  3TZ1 A;  1UHN A;  1J7O A;  2Y5I A;  3WNX B;  4PE4 A;  4OV2 A;  2CBL A;  4GUK A;  4YGC B;  2TN4 A;  1REC A;  4M2P A;  3SG4 A;  3BXK A;  1JSA A;  2Y1N A;  5DKN A;  2BE6 A;  2E30 A;  1DJX A;  5HLV A;  1RWY A;  2K7B A;  2M9G A;  1BF5 A;  3DYE A;  2PYQ A;  5F6T A;  1KWO C;  1G8I A;  3TDI A;  1BOC A;  2JXC A;  1WDC B;  1ZAC A;  3DVE A;  3NSO A;  3K1E A;  3KEV A;  5I8N A;  1G33 A;  1NX1 A;  4OVN F;  3BUN B;  1AK8 A;  3I5G B;  3FE8 A;  1ALV A;  4JKT A;  2OPO A;  1QVI Z;  4PHJ A;  1F8H A;  3B88 A;  3S0B A;  4C0L A;  5AER A;  3S0D A;  1IGV A;  2A4J A;  2BBN A;  1VRK A;  3FS7 A;  1YR5 A;  4QJ5 B;  2K61 A;  2BBM A;  1B8R A;  1MHO A;  1XFX O;  2M0R A;  4AQJ A;  3RM1 A;  5KU1 A;  1Y1X A;  2ZNE A;  1XFU O;  1PAL A;  2WCJ A;  4N5X A;  4QJ4 B;  2K0J A;  3OB2 B;  1XK4 C;  1IH0 A;  2ERB A;  2BE4 A;  2Q91 A;  2MHH A;  2SCP A;  1RK9 A;  1MF8 B;  2PVB A;  3BQ3 A;  2KFG A;  1J55 A;  1JF0 A;  5EL2 A;  3SG2 A;  1F4Q A;  3PJI A;  4MVF A;  4P5O E;  5HKW A;  4I5L B;  4PCW A;  1S5G Y;  3SJS A;  2JUL A;  5I2Q A;  1AJ4 A;  1UHI A;  1QJT A;  5FI7 A;  2HPS A;  1RTP 1;  1KQM B;  1WDC C;  3HCM A;  5HYD A;  3RZS A;  3EKH A;  1OOF A;  5JOL A;  3TS5 B;  3SIB A;  3VGO A;  2EHB A;  3FE6 A;  1Y6W A;  1KFU L;  2JTZ A;  3IQO A;  3DD4 A;  3PFV A;  2P71 A;  3SG7 A;  3VRR A;  2ZND A;  1OE9 B;  1YX8 A;  2QPT A;  3D0Y B;  3GOF A;  2LV7 A;  3CDN A;  4HSZ A;  1DJG A;  5FYX A;  2JNX A;  3JTD C;  3NSK A;  1A03 A;  2OTG C;  1WRL A;  4DUQ A;  1C3Y A;  3V2L A;  3I5F B;  2CNP A;  3A8R A;  2NLN A;  5FI2 A;  1Y1A A;  5AFP A;  5KSZ A;  2BL0 C;  1XFV O;  3NSI A;  1K90 D;  5I2L A;  1NCY A;  3PAL A;  3EK8 A;  2L4H A;  4GGN A;  1SL9 A;  3GK1 A;  3OB1 B;  3CGA A;  4ETO A;  1SKT A;  3CR5 X;  1Q80 A;  4GAO A;  2PMY A;  3CZT X;  4MLW A;  3BYA A;  1AHR A;  5BPJ A;  3CZ2 A;  1B4C A;  1UP5 A;  3BOW B;  2WND A;  2R2I A;  4PT1 A;  2KQ6 A;  3QME A;  5D3O A;  1V1F A;  2PRU A;  4M2Q A;  5JJG A;  1CKK A;  1TUJ A;  2WC6 A;  1V1G A;  1K95 A;  1J1E A;  2L2E A;  3PN7 B;  3EVU A;  1BG1 A;  1F55 A;  4C0K A;  1OW4 A;  2EGD A;  1S26 D;  2JOJ A;  1G4Y R;  1GM0 A;  4U8D A;  4CPV A;  2LLT A;  2GGZ A;  1EL4 A;  1W7I B;  2JZI A;  2WCB A;  1DC1 A;  2PAS A;  4YGA A;  4GFT A;  4YRU A;  1K9P A;  1NCX A;  3F45 A;  1TCO B;  3BUO B;  3EK4 A;  4AQI A;  3B86 A;  4PHM A;  3H4S E;  3C1V A;  4OR9 B;  4PE1 A;  2B1U A;  3DY9 A;  4FQO A;  3FIA A;  5D69 A;  1XFY O;  1Z4H A;  3NHI A;  1DF0 B;  1NX3 A;  1ZOT B;  2M7N A;  2QDI A;  1J7R A;  1M45 A;  4R1E A;  4YGD B;  2M1U A;  1WRK A;  2BKI B;  4E68 A;  3DXL A;  2AUC A;  2PQL A;  2WCM A;  4MZL A;  1Y0V H;  1NPQ A;  3NGV A;  1LVC D;  2MJW B;  4M2O A;  2JC2 A;  4GNK B;  2WCL A;  1TNW A;  3OX6 A;  4ICB A;  1TRF A;  4GGF A;  1N65 A;  2MBX A;  2M3W A;  1OMD A;  4NQG A;  2KYF A;  1DGU A;  1SBJ A;  2Q4U A;  2L5Y A;  1DTL A;  5HLO A;  1LS8 A;  2AMI A;  1K94 A;  1F71 A;  4NDB A;  1JC2 A;  1KQV A;  2L4I A;  5ER5 A;  3RLZ A;  1BLQ A;  4PHK A;  1PK0 D;  1B7T Z;  3UO9 A;  1B9A A;  2LVJ A;  1ZUZ A;  1H8B A;  3VRQ A;  3B6X A;  1LIN A;  1EG3 A;  2HQ8 A;  3AKA A;  3R72 A;  3PM2 A;  2D8N A;  2BCB A;  1M63 B;  4I5N B;  4MBE A;  1BJF A;  1MXL C;  1C7W A;  1GQM A;  4I5K A;  3VRP A;  1CM1 A;  1QX2 A;  1TTX A;  3EVV A;  1A75 A;  2PSR A;  3GK4 X;  1YX7 A;  1AUI B;  1CMF A;  1QLK A;  2COL B;  1ZMZ A;  3OGN A;  1JBA A;  3D77 A;  1B7T Y;  1CFF A;  2KHN A;  2KAX A;  4WQ3 A;  1BU3 A;  2LNK A;  3WXA A;  2KI4 C;  1JF2 A;  2QEH A;  5CSF A;  1IIO A;  2P6B B;  1A75 B;  1TN4 A;  3LCP C;  3VRN A;  3O6B A;  5AAN A;  2ZKM X;  1OOI X;  2I18 A;  2M1K B;  2LHL A;  1S6J A;  2BNX A;  3NXA A;  4GGF C;  3I5H C;  3S0G A;  1DJW A;  1IJ5 A;  3DZT A;  1S5G Z;  2DOQ A;  3JTD B;  1F4O A;  2EC6 C;  2L2C A;  2OTG B;  3CAB A;  4MRY A;  1CB1 A;  1DEL A;  2KFF A;  1CNP A;  1XYD A;  3R1P A;  1AP4 A;  2F33 A;  2BL0 B;  3DF0 A;  1C7V A;  3A4U B;  2BAP A;  1UHH A;  4OZD A;  1P28 A;  2F3Y A;  2KAY A;  4QJ3 B;  2I7A A;  2JWW A;  2LLU A;  1FF1 A;  5IBW A;  1K9K A;  2L50 A;  2M49 B;  5PAL A;  1MWN A;  2M29 A;  3O2P A;  1FI5 A;  4GBA A;  1S1E A;  3OHM B;  1J7P A;  1S36 A;  1SL8 A;  1BMO A;  1QAT A;  4NDD A;  3TDZ A;  3D76 A;  1K96 A;  4D1E A;  1YTZ C;  3WHU B;  5KTY A;  1BOD A;  2F3Z A;  1IJ6 A;  2JNF A;  4ZCU A;  1Z2C B;  2QEV A;  1B1G A;  2LAN A;  4UPG A;  1NX2 A;  3NSL A;  5G08 A;  1H4B A; 
#chains in the Genus database with same CATH homology
 2SAS A;  1YVL A;  4XYN A;  2L0P A;  1JUO A;  1M31 A;  4CFR A;  1KK8 C;  1SPY A;  5D7F A;  1TIZ A;  1AVS A;  4ORB B;  2F2P A;  1U5I A;  1UUS A;  2JT3 A;  1UUR A;  2CTN A;  2E6W A;  1CTR A;  1QLS A;  1UHK A;  5K89 A;  2KGR A;  3VRO A;  2K2F A;  2JU0 A;  2MAZ A;  1SR6 C;  2ZN8 A;  1SNL A;  2LE9 B;  1K9U A;  2K8M B;  2KI6 D;  2G2B A;  1GGW A;  4YBH B;  1TNQ A;  4MZJ A;  2LP2 A;  1QV1 A;  4PDZ A;  2FCE A;  2WOR A;  2HQW A;  3FWC A;  4JQ0 D;  4P2Y B;  4Q04 A;  3LK0 A;  1RRO A;  3SG3 A;  3IF7 A;  3SG5 A;  2LUC A;  1J7Q A;  3GK2 A;  1J1D A;  5CSJ A;  2JQ6 A;  4A4B A;  1L2O C;  1IKU A;  1KCY A;  4YI9 A;  3EVR A;  4FTG A;  5AXI A;  1JFJ A;  1GGZ A;  2FOT A;  1TOP A;  2H61 A;  3WHT B;  1DGV A;  4CLN A;  4YGE B;  1QV0 A;  2KBI A;  4HRG A;  1KK7 Z;  1EJ3 A;  3ICB A;  2ZN9 A;  2L51 A;  3BUX B;  2ZRS A;  1OZS A;  1S6I A;  3JVT C;  2ZRT A;  1SYM A;  3DVJ A;  1YRU B;  1CDM A;  1R6P A;  1LKJ A;  1PUL A;  2WCF A;  2LUX A;  5TNC A;  3TUY C;  5GQQ C;  1FW4 A;  2M8U A;  2JT0 A;  3O4Y A;  3I5I C;  1KK7 Y;  3E3R A;  2LHI A;  2LMV A;  2I2R E;  3AAK A;  4HRH A;  1YUU A;  3OP0 A;  1WY9 A;  1N0Y A;  1RJV A;  3PSR A;  1B8C A;  1AJ5 A;  1ALW A;  1TNX A;  4ORC B;  1CLM A;  1XVJ A;  1YRT B;  1GJY A;  1PSR A;  2KI4 B;  1OMR A;  2GV5 A;  2FJU B;  2CT9 A;  2WC8 A;  2JTT A;  2LMT A;  3DVK A;  3KF9 A;  4N1G A;  2KSP A;  2OS8 C;  1CFP A;  2M7L A;  1MUX A;  1CLB A;  1IG5 A;  4XJK A;  1CFC A;  2KOT A;  3M0W A;  3I5H B;  5DKR A;  1N2D A;  2G9B A;  1CM4 A;  2CCM A;  1W7J B;  2EC6 B;  4PE0 A;  4YI8 A;  2K7D A;  1SRA A;  2JT8 A;  1YUT A;  1A2X A;  1WLZ A;  2KDH A;  2H61 C;  2MA2 A;  1R2U A;  2VRG A;  1NIW A;  4MSP A;  1WRZ A;  2NCO A;  3BUM B;  4CID A;  3AKB A;  1D1O A;  1YUS A;  2LLS A;  2LVK A;  3CR2 A;  5CPV A;  1LA0 A;  1OZO A;  1M46 A;  5B8I B;  1SY9 A;  2LMU A;  4OKH A;  1OOJ A;  2HET A;  2ZFD A;  1CDL A;  2M97 A;  1XFW O;  2H2K A;  1SCM B;  1IQ5 A;  4A4C A;  3KO0 A;  1SW8 A;  2ISD A;  4MRX A;  1X02 A;  1KSM A;  2KNE A;  4ZCV A;  1BT6 A;  2LVV A;  2BCX A;  1Y1U A;  4HRE E;  1UHJ A;  5DKQ A;  3EKJ A;  2LCP A;  1LA3 A;  4F0Z B;  1YVH A;  1KK8 B;  1CMG A;  2O5G A;  1QX5 B;  1S3P A;  1A4P A;  1K93 D;  2LVI A;  1HQV A;  1BR4 B;  2K2A A;  1ODB A;  5J3X A;  1HT9 A;  2RGI A;  1NYA A;  1PRW A;  2MLE C;  1SR6 B;  1CLL A;  3SIA A;  1WLM A;  2MRD A;  3PM8 A;  1QXP A;  4YGB B;  3DF0 B;  1SCM C;  4N1F A;  3OX5 A;  2Y1M A;  1L2O B;  2AAO A;  2MLF C;  3ZNI A;  2BEC A;  2CXJ A;  4JWQ A;  3BUW B;  4CFQ A;  2PAL A;  5HKY A;  2WOS A;  4IL1 A;  4DIR A;  2V53 A;  1K2H A;  4NDC A;  1MR8 A;  1QVI Y;  4DRW A;  1IQ3 A;  5HKZ A;  2GGM A;  4PE7 A;  1NUB A;  2I94 A;  1QTX A;  2Y4Q A;  3LLE A;  4PHN A;  5AEQ A;  4WRI A;  3JVT B;  1ZFS A;  1DVI A;  2KGB C;  4MEW A;  4OCI A;  1BR1 B;  3D0Y A;  3CTN A;  1B8L A;  1PVB A;  1DMO A;  2BCA A;  1E8A A;  3KPX A;  1SMG A;  1TCF A;  1QS7 A;  2NZ0 A;  1UWO A;  1FBV A;  3TUY B;  2LAP A;  1JFK A;  1RFJ A;  2QAC A;  3I5G C;  1OMV A;  3I5I B;  1EXR A;  2LC5 A;  1QX7 A;  1IRJ A;  2NCP A;  1QIV A;  1NSH A;  1MQ1 A;  1OSA A;  1U5I B;  1F54 A;  2F2O A;  1NP8 A;  1QAS A;  3LL8 B;  5CSN A;  1FI6 A;  2JRF A;  2KQY A;  2LP3 A;  1CFD A;  1PVA A;  3BOW A;  2K7C A;  2OS8 B;  3ZWH A;  2KI6 C;  1DJZ A;  1A29 A;  3QRX A;  1NWD A;  1DJI A;  1B47 A;  4I5J A;  3LK1 A;  2K7O A;  3D10 A;  5ER4 X;  1XA5 A;  1KQM C;  1M39 A;  2L5X B;  1KFX L;  1TNP A;  3CS1 A;  2KYC A;  3TS5 C;  2NXQ A;  1DT7 B;  3CWG A;  3CR4 X;  1PSB A;  4WQ2 A;  3AAJ A;  4AOM A;  1EH2 A;  2JXL A;  4L9M A;  5I2O A;  3IQQ A;  1C07 A;  3PLF B;  2F8P A;  1SCV A;  1DF0 A;  1KFU S;  1MXE A;  1IWQ A;  2JPT A;  1SL7 A;  3TDU A;  1KSO A;  3I5F C;  3MSE B;  2KBM A;  1YUR A;  3CLN A;  1FPW A;  4ORA B;  4BY5 A;  4MZK A;  1NCZ A;  1SK6 D;  2KAV A;  3PAT A;  1K8U A;  4TNC A;  4C0J A;  1F70 A;  4PAL A;  2FCD A;  2IS9 A;  2L98 A;  1DJH A;  4DS7 A;  1KWO B;  1OQP A;  1XFZ O;  3DVM A;  4DCK A;  2O60 A;  1JWD A;  4XJK B;  3PN7 C;  1S6C A;  1XO5 A;  4BY4 A;  2HF5 A;  1L7Z A;  2KFH A;  1XK4 A;  1KFX S;  4USL A;  4JPZ B;  3O78 A;  1LXF C;  5CSI A;  2LM5 A;  3EK7 A;  1CDN A;  1DJY A;  3HX4 A;  4MN0 A;  1NX0 A;  3SG6 A;  1CDP A;  2BKH B;  1EG4 A;  3K21 A;  3FWB A;  4GPL B;  1QIW A;  2WCE A;  3KHE A;  3TZ1 A;  1UHN A;  1J7O A;  2Y5I A;  3WNX B;  4PE4 A;  4OV2 A;  2CBL A;  4GUK A;  4YGC B;  2TN4 A;  1REC A;  4M2P A;  3SG4 A;  3BXK A;  1JSA A;  2Y1N A;  5DKN A;  2BE6 A;  2E30 A;  1DJX A;  5HLV A;  1RWY A;  2K7B A;  2M9G A;  1BF5 A;  5F6T A;  1KWO C;  1G8I A;  3TDI A;  1BOC A;  2JXC A;  1WDC B;  1ZAC A;  3DVE A;  3NSO A;  3KEV A;  5I8N A;  1G33 A;  1NX1 A;  4OVN F;  3BUN B;  1AK8 A;  3I5G B;  4PHJ A;  1ALV A;  2OPO A;  1QVI Z;  1F8H A;  4C0L A;  5AER A;  1IGV A;  2A4J A;  2BBN A;  1VRK A;  3FS7 A;  1YR5 A;  4QJ5 B;  2K61 A;  2BBM A;  1B8R A;  1MHO A;  1XFX O;  2M0R A;  4AQJ A;  3RM1 A;  5KU1 A;  1Y1X A;  2ZNE A;  1XFU O;  1PAL A;  4N5X A;  4QJ4 B;  2K0J A;  3OB2 B;  1XK4 C;  1IH0 A;  2Q91 A;  2BE4 A;  2SCP A;  2MHH A;  1RK9 A;  1MF8 B;  2PVB A;  3BQ3 A;  2KFG A;  1J55 A;  1JF0 A;  3SG2 A;  1F4Q A;  4MVF A;  4P5O E;  5HKW A;  4I5L B;  4PCW A;  1S5G Y;  3SJS A;  2JUL A;  5I2Q A;  1AJ4 A;  1UHI A;  1QJT A;  2HPS A;  1RTP 1;  1KQM B;  1WDC C;  3HCM A;  5HYD A;  3EKH A;  5JOL A;  3TS5 B;  3VGO A;  3SIB A;  2EHB A;  1Y6W A;  1KFU L;  2JTZ A;  3IQO A;  3DD4 A;  3PFV A;  3SG7 A;  3VRR A;  2ZND A;  1OE9 B;  1YX8 A;  2QPT A;  3D0Y B;  3GOF A;  2LV7 A;  4HSZ A;  1DJG A;  5FYX A;  2JNX A;  3JTD C;  3NSK A;  1A03 A;  2OTG C;  1WRL A;  4DUQ A;  3I5F B;  2CNP A;  3A8R A;  2NLN A;  1Y1A A;  5AFP A;  5KSZ A;  2BL0 C;  1XFV O;  3NSI A;  1K90 D;  5I2L A;  1NCY A;  3PAL A;  3EK8 A;  2L4H A;  4GGN A;  1SL9 A;  3GK1 A;  3OB1 B;  3CGA A;  4ETO A;  1SKT A;  3CR5 X;  1Q80 A;  4GAO A;  2PMY A;  3CZT X;  4MLW A;  3BYA A;  1AHR A;  5BPJ A;  1B4C A;  1UP5 A;  3BOW B;  2WND A;  2R2I A;  2KQ6 A;  1V1F A;  2PRU A;  4M2Q A;  5JJG A;  1CKK A;  1F55 A;  1V1G A;  1K95 A;  1J1E A;  2L2E A;  3PN7 B;  3EVU A;  1BG1 A;  4C0K A;  2EGD A;  2JOJ A;  1S26 D;  1G4Y R;  4U8D A;  4CPV A;  2LLT A;  2GGZ A;  1EL4 A;  1W7I B;  2JZI A;  2WCB A;  2PAS A;  4YGA A;  4GFT A;  4YRU A;  1K9P A;  1NCX A;  3F45 A;  1TCO B;  3BUO B;  3EK4 A;  4AQI A;  4PE1 A;  4PHM A;  3H4S E;  3C1V A;  4OR9 B;  2B1U A;  4FQO A;  3FIA A;  5D69 A;  1XFY O;  1DF0 B;  1NX3 A;  1ZOT B;  2M7N A;  4R1E A;  1J7R A;  1M45 A;  4YGD B;  2M1U A;  1WRK A;  2BKI B;  4E68 A;  2AUC A;  4MZL A;  1Y0V H;  1NPQ A;  1LVC D;  2MJW B;  4M2O A;  2JC2 A;  4GNK B;  1TNW A;  3OX6 A;  4ICB A;  1TRF A;  4GGF A;  1N65 A;  2MBX A;  2M3W A;  1OMD A;  4NQG A;  2KYF A;  1DGU A;  1SBJ A;  2Q4U A;  1DTL A;  5HLO A;  2AMI A;  1K94 A;  1F71 A;  4NDB A;  1JC2 A;  1KQV A;  2L4I A;  5ER5 A;  3RLZ A;  1BLQ A;  4PHK A;  1PK0 D;  1B7T Z;  1B9A A;  2LVJ A;  1ZUZ A;  1H8B A;  3VRQ A;  1LIN A;  1EG3 A;  2HQ8 A;  3AKA A;  2D8N A;  2BCB A;  1M63 B;  4I5N B;  4MBE A;  1BJF A;  1MXL C;  1C7W A;  1GQM A;  4I5K A;  3VRP A;  1CM1 A;  1QX2 A;  1TTX A;  3EVV A;  1A75 A;  2PSR A;  3GK4 X;  1YX7 A;  1AUI B;  1CMF A;  1QLK A;  2COL B;  1ZMZ A;  1JBA A;  1B7T Y;  1CFF A;  2KHN A;  2KAX A;  4WQ3 A;  1BU3 A;  2LNK A;  3WXA A;  2KI4 C;  1JF2 A;  5CSF A;  2P6B B;  1A75 B;  1TN4 A;  3LCP C;  3VRN A;  3O6B A;  5AAN A;  2ZKM X;  2I18 A;  2M1K B;  2LHL A;  1S6J A;  3NXA A;  4GGF C;  3I5H C;  1DJW A;  1IJ5 A;  1S5G Z;  2DOQ A;  3JTD B;  1F4O A;  2EC6 C;  2OTG B;  4MRY A;  1CB1 A;  2KFF A;  1CNP A;  1XYD A;  1AP4 A;  2F33 A;  2BL0 B;  3DF0 A;  1C7V A;  3A4U B;  1UHH A;  1FF1 A;  2KAY A;  2F3Y A;  4QJ3 B;  2I7A A;  2JWW A;  2LLU A;  5IBW A;  1K9K A;  2L50 A;  2M49 B;  5PAL A;  1MWN A;  2M29 A;  3O2P A;  1FI5 A;  4GBA A;  1S1E A;  3OHM B;  1J7P A;  1S36 A;  1SL8 A;  1BMO A;  1QAT A;  4NDD A;  3TDZ A;  1K96 A;  4D1E A;  1YTZ C;  3WHU B;  5KTY A;  1BOD A;  2F3Z A;  1IJ6 A;  2JNF A;  4ZCU A;  1B1G A;  2LAN A;  4UPG A;  1NX2 A;  3NSL A;  5G08 A;  1H4B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...