2M9GA

Solution structure of calcium-bound human s100a12
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
92
structure length
92
Chain Sequence
b'MTKLEEHLEGIVNIFHQYSVRKGHFDTLSKGELKQLLTKELANTIKNIKDKAVIDEIFQGLDANQDEQVDFQEFISLVAIALKAAHYHTHKE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein S100-A12
publication title Solution structure of human Ca(2+)-bound S100A12
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal binding protein
total genus 27
structure length 92
sequence length 92
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-06-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2m9gA00
1K94A 4YBHB 1IH0A 4YGDB 3LLEA 2L98A 1MHOA 2KFHA 2KFGA 2PSRA 1BR1B 3IQOA 1W7IB 3SIAA 4ETOA 1J55A 3PM8A 1CLLA 1GJYA 1G8IA 2LCPA 1UHHA 4ORAB 3DD4A 2SASA 1PALA 1HT9A 1M46A 1RFJA 4JWQA 2PALA 4UPGA 2FJUB 2KBIA 1BG1A 2BL0B 1FI6A 1SL7A 4C0JA 2SCPA 2E30A 3PALA 4CPVA 2LNKA 1DJGA 1DT7B 3FIAA 1SR6C 2MLFC 1S5GY 1ODBA 3SG4A 4WQ3A 5KU1A 2LLUA 2LAPA 3F45A 1SRAA 2Y1NA 4MN0A 5HLOA 3NSKA 2LLTA 1JFJA 4R1EA 1UHIA 5DKRA 2Y5IA 1KQVA 1TNWA 2BBNA 1DJXA 1K90D 3I5FB 1H8BA 4YGEB 2LP3A 4USLA 4E68A 1S3PA 2CNPA 2WCBA 1XA5A 1AP4A 4ZCVA 2KDHA 1OMVA 2LMUA 4GPLB 1KFUS 1QX2A 2JULA 2MAZA 2AMIA 2KQYA 3WNXB 3NSLA 2KYCA 1IGVA 4PE1A 1EJ3A 3EK8A 4CFQA 2BCXA 2KHNA 1JBAA 3I5IC 4M2PA 3DVMA 1MF8B 4DCKA 1NCXA 3FWCA 5J3XA 2KBMA 1JF2A 1R2UA 5I2QA 1J7PA 4IL1A 1AUIB 1ZACA 3I5HB 1CFCA 5HKWA 4XYNA 1N65A 4MBEA 1NWDA 3BQ3A 1XFUO 3BUMB 2EC6B 1OE9B 3PN7B 1DF0B 1XFXO 3E3RA 1K95A 3BOWB 1U5IB 1NCYA 1YUUA 2LLSA 4WQ2A 2PMYA 1EXRA 2KAVA 2KQ6A 1D1OA 2OTGC 1M63B 2L0PA 4ORBB 1RJVA 3OB1B 4NDBA 4HREE 3LL8B 4OCIA 3AAKA 3DVJA 1XK4C 1Y0VH 4HRGA 2H2KA 1QXPA 4YI9A 3KEVA 1SCMC 3OX6A 5AXIA 3VGOA 1BLQA 2GGZA 2RGIA 5KTYA 1PSRA 1NX3A 1EG4A 2LHIA 2LUCA 2MRDA 4PHNA 4CLNA 2LM5A 2KI4C 1JSAA 2ZRTA 1S6JA 1B9AA 2L5XB 2BCAA 3DF0B 4NDCA 1KQMB 2LHLA 1K2HA 1DVIA 2LV7A 1M45A 2CCMA 1NYAA 1IJ6A 1DJHA 2KSPA 2ISDA 4GGNA 3VRQA 1BOCA 1K93D 2QACA 2M8UA 5PALA 3JTDC 1J1DA 1KWOC 2JU0A 4DRWA 2K61A 4OR9B 3DF0A 3OHMB 2M7LA 4CFRA 1YURA 2K7OA 1S6CA 3TS5C 2DOQA 2KOTA 2Q4UA 1QTXA 1TCOB 2LVVA 5BPJA 1VRKA 2JT8A 3EVUA 1PRWA 1TNQA 4PHMA 2F33A 3KHEA 1TCFA 5AERA 1W7JB 2F8PA 4P2YB 3FWBA 2PVBA 1X02A 2CT9A 1CKKA 2JT0A 3CGAA 3CR4X 1TRFA 3CS1A 3AKAA 1AHRA 1SR6B 1K9UA 4FTGA 1K9PA 1SL9A 2E6WA 1J7OA 2BECA 1QVIZ 1CFFA 2F3ZA 1QATA 3GK1A 1UP5A 1S36A 2M49B 4C0LA 2LMTA 1ZUZA 5I2LA 1OZSA 5IBWA 1V1FA 3MSEB 1CDPA 2H61A 4A4BA 3BUWB 4OKHA 1LINA 1B7TY 1SBJA 2FCEA 1N0YA 4PE0A 4HRHA 2QPTA 2JOJA 2KYFA 5CSJA 2BE6A 2GGMA 4GGFA 1MWNA 1TTXA 2A4JA 4M2QA 4BY4A 4NDDA 1KK7Z 1YRTB 1F4OA 3I5IB 1A75B 2KNEA 2JXCA 4ICBA 1MQ1A 3O6BA 1LXFC 3PSRA 1GGZA 1WRLA 2HPSA 2L2EA 4MZLA 4NQGA 2NXQA 4PHJA 3WHUB 1UWOA 3JVTB 4I5JA 4YRUA 1KFXL 2LANA 2BBMA 4MSPA 2JPTA 4YGAA 1K8UA 3PATA 1JC2A 2LC5A 1ZOTB 1B47A 2O60A 4L9MA 1CDMA 1SMGA 2M7NA 1RK9A 1QV0A 3KO0A 3M0WA 4AOMA 1UHJA 1L2OC 1NCZA 2KAYA 5ER4X 2AAOA 1SL8A 5F6TA 1BODA 2LVJA 1CDLA 2ZKMX 2OTGB 1B1GA 3TDIA 2M29A 1Y1AA 2HF5A 1BMOA 1CM4A 1SK6D 3AAJA 3OX5A 2K7BA 4Q04A 5G08A 4ZCUA 3C1VA 4GUKA 2HQWA 2KAXA 2OS8C 4TNCA 2MA2A 1SCMB 3KPXA 4YI8A 2ZNEA 1EH2A 4XJKB 4CIDA 1LKJA 1CM1A 5CSNA 2BCBA 2LVIA 2KI4B 4GFTA 3NSIA 1B8RA 2BKHB 3EVRA 3KF9A 1PULA 1EL4A 1BJFA 1YX8A 1J7QA 1RECA 3CTNA 2JT3A 3A4UB 4OV2A 1IWQA 1YRUB 1CLBA 1H4BA 1B4CA 1IKUA 2JRFA 5GQQC 1AVSA 1RROA 4PE7A 1KK8C 3GOFA 2NLNA 1TIZA 1DJIA 3JTDB 2NCOA 1KWOB 1SY9A 1KSMA 1JWDA 4WRIA 1IQ5A 1TNXA 3HCMA 2F2PA 1BR4B 1PSBA 1JFKA 1XFWO 1CB1A 2M0RA 1QX5B 2K7CA 1WDCC 1OOJA 1DF0A 3TUYC 2CTNA 1QIWA 3CZTX 3BOWA 4MRYA 1U5IA 2K7DA 1WY9A 1FPWA 1YX7A 3GK2A 3ZNIA 5AFPA 1LA0A 2L51A 1K9KA 1QV1A 4PALA 5FYXA 4QJ3B 2KGBC 2HQ8A 2EHBA 1IRJA 1F55A 3BUNB 1S5GZ 1G4YR 1GQMA 1NUBA 2ZRSA 3D0YB 3FS7A 5I2OA 1WRZA 2KI6D 3EKJA 2LE9B 3VROA 3WXAA 1RTP1 1DJWA 1SCVA 4N1FA 1F70A 3IQQA 5JOLA 5K89A 4DIRA 1OMDA 3QRXA 5CPVA 1C07A 1A4PA 5HYDA 1F71A 2M97A 3O78A 2B1UA 1SYMA 2KFFA 2M9GA 1OZOA 2Q91A 4I5KA 3BUXB 1RWYA 1QS7A 1AJ4A 4N1GA 5B8IB 2M1KB 1FW4A 2HETA 5I8NA 4I5NB 5CSIA 2GV5A 2JZIA 3LK1A 1CMGA 1YUTA 2K2AA 1JUOA 2Y4QA 1NPQA 3NSOA 2CBLA 4GAOA 5ER5A 1S26D 1NP8A 2JC2A 2M1UA 4MLWA 4JPZB 1A03A 1ALVA 1NX2A 4GNKB 3CR2A 4DUQA 4MRXA 2ZN8A 3I5GC 1YTZC 1WRKA 1OQPA 1J7RA 2IS9A 3RLZA 3WHTB 1KCYA 3SG2A 1XFVO 1A29A 2WC8A 1C7VA 3VRNA 1DGUA 1V1GA 4JQ0D 1PK0D 1DMOA 2F3YA 1TN4A 1XVJA 1Q80A 1FI5A 1OMRA 3ZWHA 2JTZA 2OS8B 3SG6A 2CXJA 1SPYA 2O5GA 3NXAA 4OVNF 1M39A 1SKTA 1YVHA 2MJWB 3H4SE 4AQJA 5HKYA 1Y6WA 2I7AA 4MZKA 2JQ6A 5AEQA 1L7ZA 1QLSA 5D69A 4QJ4B 2LUXA 1TOPA 4F0ZB 1K96A 1YVLA 1B8LA 1TNPA 1Y1XA 5HLVA 3CLNA 1QJTA 2WORA 3DVEA 4N5XA 1A75A 1N2DA 2JNXA 1BU3A 1S1EA 2Y1MA 5CSFA 3RM1A 1KK8B 1E8AA 2NZ0A 1PVAA 2R2IA 3BXKA 1LVCD 3BUOB 5TNCA 3LK0A 1OSAA 1JF0A 1A2XA 2FCDA 1WDCB 2G2BA 2H61C 3TUYB 1BT6A 1CLMA 3SG3A 4PCWA 1CDNA 2KI6C 2AUCA 2D8NA 4GGFC 2EGDA 1DJZA 2NCPA 3A8RA 5D7FA 2VRGA 4YGCB 1NX1A 4P5OE 3SG7A 1R6PA 1XK4A 2ZNDA 4YGBB 2M3WA 5DKQA 1CFDA 1CFPA 2P6BB 1DJYA 3AKBA 1HQVA 4PE4A 1QLKA 1SNLA 4XJKA 2F2OA 3D10A 5DKNA 1FBVA 1AK8A 2LMVA 4QJ5B 2BL0C 2PRUA 1YR5A 3TZ1A 3PLFB 4BY5A 2PASA 1LA3A 1CMFA 1B7TZ 3TS5B 1Y1UA 2KGRA 1MXEA 1DTLA 1YUSA 4HSZA 3SIBA 3JVTC 2JTTA 2MLEC 1IG5A 1GGWA 3O2PA 1MUXA 3LCPC 1KFXS 1QVIY 4MEWA 2TN4A 2WOSA 1M31A 1QASA 3SG5A 4D1EA 1G33A 4I5LB 1UHKA 5KSZA 3OB2B 4PHKA 1XO5A 1NIWA 3HX4A 4M2OA 3EVVA 3I5FC 3CR5X 4MZJA 2ZFDA 4ORCB 1PVBA 1IJ5A 3DVKA 1ZFSA 3BYAA 1NX0A 2LP2A 3IF7A 2MHHA 2K0JA 3VRRA 3GK4X 3I5GB 2BE4A 4GBAA 4C0KA 1KK7Y 1WLMA 4DS7A 1FF1A 1CNPA 1KSOA 2L50A 3PFVA 1XFZO 1AJ5A 2JNFA 2WCEA 1J1EA 2WCFA 2BKIB 2K2FA 2MBXA 3OP0A 3D0YA 2OPOA 3ICBA 1IQ3A 3TDZA 3EK7A 3I5HC 1WLZA 5JJGA 1XFYO 2I2RE 2I18A 3CWGA 3VRPA 4A4CA 1NSHA 1DGVA 2EC6C 3PN7C 1BF5A 1F8HA 4PDZA 1ZMZA 1S6IA 3O4YA 4U8DA 5HKZA 1F54A 1XYDA 2L4IA 2V53A 4MVFA 1L2OB 2L4HA 2K8MB 2JWWA 4AQIA 1QIVA 1C7WA 2G9BA 1MXLC 3TDUA 2WNDA 1F4QA 2JXLA 1KFUL 2I94A 2ZN9A 2LVKA 2COLB 5AANA 1MR8A 2FOTA 3SJSA 1EG3A 1B8CA 1ALWA 3EK4A 1UUSA 1UURA 1CTRA 4FQOA 1UHNA 3EKHA 3K21A 1QX7A 1KQMC 1SW8A
chains in the Genus database with same CATH superfamily
1K94A 3CYZA 4YBHB 1IH0A 5DICA 2WCMA 4YGDB 3LLEA 2L98A 1MHOA 2KFHA 2KFGA 2PSRA 1OOIX 1BR1B 3IQOA 3SS5A 1W7IB 3SIAA 4ETOA 1J55A 3PM8A 1CLLA 1GJYA 1G8IA 2LCPA 3DXLA 1UHHA 4ORAB 3DD4A 2SASA 1PALA 1HT9A 1M46A 1RFJA 4JWQA 2PALA 4UPGA 2FJYA 2FJUB 2WCJA 2KBIA 1BG1A 2BL0B 1FI6A 1SL7A 4C0JA 2SCPA 2E30A 3PALA 2JPOA 1OOGA 4CPVA 2LNKA 1DJGA 1DT7B 3FIAA 1SR6C 2MLFC 1S5GY 1ODBA 3SG4A 4WQ3A 5KU1A 2LLUA 2LAPA 3F45A 1SRAA 2Y1NA 3N7HA 4MN0A 5HLOA 3NSKA 2BAPA 2LLTA 1JFJA 4R1EA 1UHIA 5DKRA 2Y5IA 1KQVA 1TNWA 2BBNA 1DJXA 1K90D 3I5FB 1H8BA 3R1PA 4YGEB 2LP3A 2H8VA 4USLA 4E68A 1S3PA 2CNPA 2WCBA 3IVTA 1XA5A 1AP4A 4ZCVA 2KDHA 3R72A 1OMVA 2LMUA 3B86A 4GPLB 1KFUS 1QX2A 2JULA 2MAZA 2AMIA 2KQYA 3NHTA 3WNXB 3CZ0A 2WC5A 3NSLA 4F7FA 2KYCA 1IGVA 4PE1A 1EJ3A 3EK8A 4CFQA 2BCXA 2KHNA 3BFBA 1JBAA 3PJIA 3I5IC 4M2PA 3DVMA 1MF8B 2PQLA 4DCKA 1NCXA 1SSEB 3FWCA 3OBVA 5J3XA 2KBMA 1JF2A 3D73A 1R2UA 3S0GA 5I2QA 2WCHA 1J7PA 4IL1A 1AUIB 1ZACA 3I5HB 1CFCA 5HKWA 5I94A 4XYNA 1N65A 4MBEA 1NWDA 2K60A 1XFUO 3BQ3A 2EC6B 1OE9B 3BUMB 3PN7B 1DF0B 2QEOA 1XFXO 3E3RA 1K95A 3BOWB 1U5IB 4INXA 1NCYA 1YUUA 2LLSA 4WQ2A 2PMYA 1EXRA 2KAVA 2KQ6A 1D1OA 2OTGC 1M63B 2L0PA 4FQTA 4ORBB 1RJVA 3OB1B 4NDBA 4HREE 3LL8B 4OCIA 3AAKA 3DVJA 1XK4C 1Y0VH 4HRGA 2H2KA 3B6XA 1QXPA 4YI9A 3KEVA 1SCMC 3OX6A 5AXIA 3VGOA 5D3OA 1BLQA 2GGZA 2RGIA 4INWA 1PSRA 1NX3A 1EG4A 2LHIA 2LUCA 2MRDA 5KTYA 4PHNA 4CLNA 2LM5A 1C3YA 2KI4C 1JSAA 2ZRTA 1S6JA 1B9AA 2L5XB 2BCAA 3DF0B 4NDCA 1KQMB 2LHLA 1K2HA 1W9ZA 1TUJA 1DVIA 2LV7A 1M45A 2CCMA 1NYAA 1IJ6A 1DJHA 2KSPA 3R1OA 2ISDA 4GGNA 3VRQA 2P70A 1K93D 1BOCA 2QACA 2M8UA 5PALA 3JTDC 3CDNA 1J1DA 1KWOC 2JU0A 4DRWA 2K61A 4OR9B 3DF0A 3OHMB 2M7LA 4CFRA 1YURA 2K7OA 1S6CA 3TS5C 2DOQA 2KOTA 2Q4UA 1QTXA 1TCOB 2LVVA 3BJHA 5BPJA 1VRKA 2JT8A 3EVUA 1PRWA 3S0AA 1TNQA 4PHMA 2F33A 3KHEA 1TCFA 2KLDA 1W7JB 3D74A 2L2CA 3S0DA 3B88A 2F8PA 4P2YB 3FWBA 2PVBA 1X02A 2CT9A 1CKKA 2JT0A 3CGAA 3CR4X 1TRFA 3CS1A 3AKAA 1AHRA 1SR6B 1K9UA 4FTGA 1LS8A 1K9PA 1SL9A 3D77A 5FI2A 2E6WA 1DQEA 1J7OA 2BECA 1QVIZ 2YGUA 1CFFA 3D76A 2F3ZA 1QATA 3GK1A 1UP5A 1S36A 2M49B 4C0LA 2LMTA 1ZUZA 5I2LA 1DEKA 1OZSA 5IBWA 1V1FA 3MSEB 1CDPA 4IJ7A 2H61A 4A4BA 3BUWB 4OKHA 1LINA 1B7TY 1SBJA 2FCEA 1N0YA 2P71A 3O4XA 4HRHA 4PE0A 2QPTA 2JOJA 2KYFA 3PM2A 1OOFA 3SS3A 5CSJA 2BE6A 2GGMA 4GGFA 1MWNA 1TTXA 2A4JA 2BNXA 3B7AA 3CZ1A 4M2QA 4BY4A 4NDDA 1KK7Z 1YRTB 1F4OA 3I5IB 1A75B 2KNEA 2JXCA 3K1EA 4ICBA 1MQ1A 3O6BA 1LXFC 1DELA 1GGZA 1WRLA 2HPSA 2L2EA 3DYEA 3PSRA 2NXQA 4MZLA 4NQGA 4PHJA 3WHUB 1UWOA 3JVTB 4I5JA 4YRUA 1KFXL 2LANA 2BBMA 4MSPA 2JPTA 4YGAA 1K8UA 3PATA 1JC2A 2LC5A 1ZOTB 1B47A 2O60A 4L9MA 1CDMA 1SMGA 2M7NA 1RK9A 3Q8IA 1QV0A 3KO0A 3M0WA 3R1VA 4AOMA 1UHJA 1L2OC 1NCZA 2KAYA 2QEVA 5ER4X 2AAOA 1SL8A 5F6TA 1BODA 2LVJA 3CZ2A 1CDLA 2ZKMX 2OTGB 1B1GA 3TDIA 2M29A 1Y1AA 2HF5A 1TUZA 1BMOA 1CM4A 1SK6D 3AAJA 3OX5A 2K7BA 3BFHA 4Q04A 5G08A 4ZCUA 3C1VA 4GUKA 2HQWA 2KAXA 2OS8C 4TNCA 2MA2A 1SCMB 3KPXA 4YI8A 2ZNEA 5HL1A 1EH2A 4XJKB 4CIDA 1LKJA 1CM1A 5CSNA 2BCBA 2LVIA 2KI4B 4GFTA 3VB1A 3NSIA 1B8RA 2BKHB 3EVRA 3KF9A 1PULA 1EL4A 1BJFA 1YX8A 1J7QA 1RECA 3CTNA 2JT3A 3A4UB 3DY9A 1IWQA 1YRUB 3FE8A 4OV2A 1CLBA 1B4CA 1H4BA 1IKUA 2JRFA 5GQQC 1AVSA 1RROA 4PE7A 2ERBA 1KK8C 3GOFA 2NLNA 1TIZA 1GM0A 1OW4A 1DJIA 3FE6A 3JTDB 2NCOA 1KWOB 1SY9A 1KSMA 1JWDA 4WRIA 1IQ5A 1TNXA 3HCMA 2F2PA 1BR4B 1PSBA 1JFKA 1XFWO 1CB1A 2M0RA 1QX5B 2K7CA 1WDCC 1Z4HA 1OOJA 1DF0A 3TUYC 2CTNA 3S0EA 1QIWA 3CZTX 3BOWA 4MRYA 1U5IA 2K7DA 1WY9A 1FPWA 1YX7A 3GK2A 3ZNIA 5AFPA 1LA0A 2L51A 1K9KA 1QV1A 1T14A 4PALA 5FYXA 1P28A 4QJ3B 2KGBC 2HQ8A 2QEBA 2EHBA 1IRJA 5FI7A 1F55A 3BUNB 2QEHA 1S5GZ 1G4YR 1GQMA 1NUBA 2ZRSA 3D0YB 3FS7A 3NGVA 5I2OA 1WRZA 2KI6D 3EKJA 2LE9B 3VROA 3WXAA 1RTP1 1DJWA 1SCVA 4N1FA 1F70A 1ORGA 4JD9A 3IQQA 4OZDA 5JOLA 5K89A 4DIRA 1OMDA 1Z2CB 3QRXA 5CPVA 1C07A 1A4PA 5HYDA 1F71A 2M97A 3O78A 2B1UA 3FE9A 1SYMA 2KFFA 2M9GA 1OZOA 3L4LA 2Q91A 4I5KA 3BUXB 1RWYA 1QS7A 1AJ4A 4N1GA 5FI6A 5B8IB 2M1KB 1FW4A 2HETA 5I8NA 4I5NB 5CSIA 3D78A 2GV5A 2JZIA 3LK1A 1CMGA 4JKTA 1YUTA 2K2AA 1JUOA 2Y4QA 1NPQA 3NSOA 2CBLA 4GAOA 5ER5A 1S26D 1NP8A 2JC2A 2M1UA 4MLWA 4JPZB 1A03A 1ALVA 1NX2A 1TWOA 3OGNA 4GNKB 3CR2A 4DUQA 4MRXA 3UNWA 2ZN8A 3SS4A 3I5GC 1YTZC 3L47A 1WRKA 1OQPA 1J7RA 2IS9A 3RLZA 3WHTB 1KCYA 3SG2A 1XFVO 1A29A 2WC8A 1C7VA 3D75A 3VRNA 1DGUA 1V1GA 3RZSA 4JQ0D 1PK0D 1DMOA 2F3YA 1TN4A 1XVJA 1Q80A 1FI5A 1OMRA 3ZWHA 2JTZA 2OS8B 2WC6A 2CXJA 1SPYA 2L5YA 2O5GA 3SG6A 3NXAA 4OVNF 1M39A 1SKTA 1YVHA 2MJWB 3H4SE 4AQJA 5HKYA 1Y6WA 2I7AA 4MZKA 2JQ6A 5AEQA 1L7ZA 1QLSA 5D69A 4QJ4B 2LUXA 1TOPA 4F0ZB 1K96A 1OOHA 1B8LA 1TNPA 1YVLA 1Y1XA 5HLVA 3CLNA 1QJTA 2WORA 3DVEA 4N5XA 1A75A 1N2DA 2JNXA 1BU3A 1S1EA 2Y1MA 5CSFA 3RM1A 1KK8B 5AERA 1E8AA 2NZ0A 1PVAA 2R2IA 3BXKA 1LVCD 3BUOB 3S0BA 5TNCA 3LK0A 1OSAA 1JF0A 1A2XA 2FCDA 1WDCB 2G2BA 2H61C 3TUYB 1BT6A 1CLMA 3SG3A 4PCWA 1CDNA 2KLEA 2KI6C 2AUCA 2D8NA 4GGFC 2EGDA 1DJZA 2KPHA 2NCPA 2QDIA 1IIOA 3A8RA 1C3ZA 5D7FA 2VRGA 4YGCB 1NX1A 4P5OE 3SG7A 1R6PA 1XK4A 2GTEA 2ZNDA 4YGBB 2M3WA 5DKQA 1CFDA 1CFPA 2P6BB 1DJYA 3AKBA 1HQVA 4PE4A 1QLKA 1SNLA 4XJKA 2F2OA 3S0FA 3D10A 5DKNA 1FBVA 1AK8A 2LMVA 4QJ5B 2BL0C 2PRUA 1YR5A 3TZ1A 3PLFB 4BY5A 2PASA 1LA3A 1CMFA 1B7TZ 3TS5B 1Y1UA 2KGRA 1MXEA 1DTLA 1YUSA 4HSZA 5EL2A 3SIBA 3JVTC 2JTTA 2MLEC 1IG5A 1GGWA 3O2PA 1MUXA 3LCPC 1KFXS 1QVIY 4MEWA 2TN4A 2WOSA 1M31A 1QASA 3SG5A 1DC1A 4D1EA 1G33A 4I5LB 1UHKA 5KSZA 3OB2B 4PHKA 1XO5A 1NIWA 3HX4A 4M2OA 3EVVA 3I5FC 3CR5X 4MZJA 2ZFDA 4ORCB 1PVBA 1IJ5A 3DVKA 1ZFSA 3BYAA 1NX0A 2LP2A 3IF7A 2WCKA 2MHHA 2K0JA 3VRRA 3GK4X 3I5GB 3DZTA 2BE4A 4GBAA 4C0KA 1KK7Y 1WLMA 4DS7A 1FF1A 1CNPA 1KSOA 2L50A 3PFVA 1XFZO 1AJ5A 2JNFA 2WCEA 1J1EA 2WCFA 2BKIB 2K2FA 2MBXA 3OP0A 3D0YA 2OPOA 3V2LA 3ICBA 1IQ3A 3TDZA 3EK7A 3I5HC 1WLZA 5JJGA 1XFYO 2I2RE 2I18A 3CWGA 3VRPA 4A4CA 1NSHA 1DGVA 2EC6C 3PN7C 1BF5A 1F8HA 3UO9A 4PDZA 1ZMZA 2WCLA 1S6IA 3O4YA 2PYQA 3NHIA 4U8DA 5HKZA 1F54A 1XYDA 2L4IA 3QMEA 1XFRA 2V53A 4MVFA 4PT1A 1L2OB 2L4HA 1QWVA 2K8MB 3CABA 4KYNA 3L4AA 2JWWA 4AQIA 1QIVA 1C7WA 2G9BA 1MXLC 3EG5B 3TDUA 2WNDA 1F4QA 2JXLA 1KFUL 2I94A 3BFAA 2ZN9A 2LVKA 2COLB 5AANA 1MR8A 2FOTA 3SJSA 1EG3A 1B8CA 3B87A 1ALWA 3EK4A 1UUSA 1UURA 1CTRA 4FQOA 1UHNA 3EKHA 3K21A 1QX7A 1KQMC 1SW8A
chains in the Genus database with same CATH topology
1K94A 4YBHB 1IH0A 4YGDB 3LLEA 2L98A 1MHOA 2KFHA 2KFGA 2PSRA 1BR1B 3IQOA 1W7IB 3SIAA 4ETOA 1J55A 3PM8A 1CLLA 1GJYA 1G8IA 2LCPA 1UHHA 4ORAB 3DD4A 2SASA 1PALA 1HT9A 1M46A 1RFJA 4JWQA 2PALA 4UPGA 2FJUB 2KBIA 1BG1A 2BL0B 1FI6A 1SL7A 4C0JA 2SCPA 2E30A 3PALA 4CPVA 2LNKA 1DJGA 1DT7B 3FIAA 1SR6C 2MLFC 1S5GY 1ODBA 3SG4A 4WQ3A 5KU1A 2LLUA 2LAPA 3F45A 1SRAA 2Y1NA 4MN0A 5HLOA 3NSKA 2LLTA 1JFJA 4R1EA 1UHIA 5DKRA 2Y5IA 1KQVA 1TNWA 2BBNA 1DJXA 1K90D 3I5FB 1H8BA 4YGEB 2LP3A 4USLA 4E68A 1S3PA 2CNPA 2WCBA 1XA5A 1AP4A 4ZCVA 2KDHA 1OMVA 2LMUA 4GPLB 1KFUS 1QX2A 2JULA 2MAZA 2AMIA 2KQYA 3WNXB 3NSLA 2KYCA 1IGVA 4PE1A 1EJ3A 3EK8A 4CFQA 2BCXA 2KHNA 1JBAA 3I5IC 4M2PA 3DVMA 1MF8B 4DCKA 1NCXA 3FWCA 5J3XA 2KBMA 1JF2A 1R2UA 5I2QA 1J7PA 4IL1A 1AUIB 1ZACA 3I5HB 1CFCA 5HKWA 4XYNA 1N65A 4MBEA 1NWDA 3BQ3A 1XFUO 3BUMB 2EC6B 1OE9B 3PN7B 1DF0B 1XFXO 3E3RA 1K95A 3BOWB 1U5IB 1NCYA 1YUUA 2LLSA 4WQ2A 2PMYA 1EXRA 2KAVA 2KQ6A 1D1OA 2OTGC 1M63B 2L0PA 4ORBB 1RJVA 3OB1B 4NDBA 4HREE 3LL8B 4OCIA 3AAKA 3DVJA 1XK4C 1Y0VH 4HRGA 2H2KA 1QXPA 4YI9A 3KEVA 1SCMC 3OX6A 5AXIA 3VGOA 1BLQA 2GGZA 2RGIA 5KTYA 1PSRA 1NX3A 1EG4A 2LHIA 2LUCA 2MRDA 4PHNA 4CLNA 2LM5A 2KI4C 1JSAA 2ZRTA 1S6JA 1B9AA 2L5XB 2BCAA 3DF0B 4NDCA 1KQMB 2LHLA 1K2HA 1DVIA 2LV7A 1M45A 2CCMA 1NYAA 1IJ6A 1DJHA 2KSPA 2ISDA 4GGNA 3VRQA 1BOCA 1K93D 2QACA 2M8UA 5PALA 3JTDC 1J1DA 1KWOC 2JU0A 4DRWA 2K61A 4OR9B 3DF0A 3OHMB 2M7LA 4CFRA 1YURA 2K7OA 1S6CA 3TS5C 2DOQA 2KOTA 2Q4UA 1QTXA 1TCOB 2LVVA 5BPJA 1VRKA 2JT8A 3EVUA 1PRWA 1TNQA 4PHMA 2F33A 3KHEA 1TCFA 5AERA 1W7JB 2F8PA 4P2YB 3FWBA 2PVBA 1X02A 2CT9A 1CKKA 2JT0A 3CGAA 3CR4X 1TRFA 3CS1A 3AKAA 1AHRA 1SR6B 1K9UA 4FTGA 1K9PA 1SL9A 2E6WA 1J7OA 2BECA 1QVIZ 1CFFA 2F3ZA 1QATA 3GK1A 1UP5A 1S36A 2M49B 4C0LA 2LMTA 1ZUZA 5I2LA 1OZSA 5IBWA 1V1FA 3MSEB 1CDPA 2H61A 4A4BA 3BUWB 4OKHA 1LINA 1B7TY 1SBJA 2FCEA 1N0YA 4PE0A 4HRHA 2QPTA 2JOJA 2KYFA 5CSJA 2BE6A 2GGMA 4GGFA 1MWNA 1TTXA 2A4JA 4M2QA 4BY4A 4NDDA 1KK7Z 1YRTB 1F4OA 3I5IB 1A75B 2KNEA 2JXCA 4ICBA 1MQ1A 3O6BA 1LXFC 3PSRA 1GGZA 1WRLA 2HPSA 2L2EA 4MZLA 4NQGA 2NXQA 4PHJA 3WHUB 1UWOA 3JVTB 4I5JA 4YRUA 1KFXL 2LANA 2BBMA 4MSPA 2JPTA 4YGAA 1K8UA 3PATA 1JC2A 2LC5A 1ZOTB 1B47A 2O60A 4L9MA 1CDMA 1SMGA 2M7NA 1RK9A 1QV0A 3KO0A 3M0WA 4AOMA 1UHJA 1L2OC 1NCZA 2KAYA 5ER4X 2AAOA 1SL8A 5F6TA 1BODA 2LVJA 1CDLA 2ZKMX 2OTGB 1B1GA 3TDIA 2M29A 1Y1AA 2HF5A 1BMOA 1CM4A 1SK6D 3AAJA 3OX5A 2K7BA 4Q04A 5G08A 4ZCUA 3C1VA 4GUKA 2HQWA 2KAXA 2OS8C 4TNCA 2MA2A 1SCMB 3KPXA 4YI8A 2ZNEA 1EH2A 4XJKB 4CIDA 1LKJA 1CM1A 5CSNA 2BCBA 2LVIA 2KI4B 4GFTA 3NSIA 1B8RA 2BKHB 3EVRA 3KF9A 1PULA 1EL4A 1BJFA 1YX8A 1J7QA 1RECA 3CTNA 2JT3A 3A4UB 4OV2A 1IWQA 1YRUB 1CLBA 1H4BA 1B4CA 1IKUA 2JRFA 5GQQC 1AVSA 1RROA 4PE7A 1KK8C 3GOFA 2NLNA 1TIZA 1DJIA 3JTDB 2NCOA 1KWOB 1SY9A 1KSMA 1JWDA 4WRIA 1IQ5A 1TNXA 3HCMA 2F2PA 1BR4B 1PSBA 1JFKA 1XFWO 1CB1A 2M0RA 1QX5B 2K7CA 1WDCC 1OOJA 1DF0A 3TUYC 2CTNA 1QIWA 3CZTX 3BOWA 4MRYA 1U5IA 2K7DA 1WY9A 1FPWA 1YX7A 3GK2A 3ZNIA 5AFPA 1LA0A 2L51A 1K9KA 1QV1A 4PALA 5FYXA 4QJ3B 2KGBC 2HQ8A 2EHBA 1IRJA 1F55A 3BUNB 1S5GZ 1G4YR 1GQMA 1NUBA 2ZRSA 3D0YB 3FS7A 5I2OA 1WRZA 2KI6D 3EKJA 2LE9B 3VROA 3WXAA 1RTP1 1DJWA 1SCVA 4N1FA 1F70A 3IQQA 5JOLA 5K89A 4DIRA 1OMDA 3QRXA 5CPVA 1C07A 1A4PA 5HYDA 1F71A 2M97A 3O78A 2B1UA 1SYMA 2KFFA 2M9GA 1OZOA 2Q91A 4I5KA 3BUXB 1RWYA 1QS7A 1AJ4A 4N1GA 5B8IB 2M1KB 1FW4A 2HETA 5I8NA 4I5NB 5CSIA 2GV5A 2JZIA 3LK1A 1CMGA 1YUTA 2K2AA 1JUOA 2Y4QA 1NPQA 3NSOA 2CBLA 4GAOA 5ER5A 1S26D 1NP8A 2JC2A 2M1UA 4MLWA 4JPZB 1A03A 1ALVA 1NX2A 4GNKB 3CR2A 4DUQA 4MRXA 2ZN8A 3I5GC 1YTZC 1WRKA 1OQPA 1J7RA 2IS9A 3RLZA 3WHTB 1KCYA 3SG2A 1XFVO 1A29A 2WC8A 1C7VA 3VRNA 1DGUA 1V1GA 4JQ0D 1PK0D 1DMOA 2F3YA 1TN4A 1XVJA 1Q80A 1FI5A 1OMRA 3ZWHA 2JTZA 2OS8B 3SG6A 2CXJA 1SPYA 2O5GA 3NXAA 4OVNF 1M39A 1SKTA 1YVHA 2MJWB 3H4SE 4AQJA 5HKYA 1Y6WA 2I7AA 4MZKA 2JQ6A 5AEQA 1L7ZA 1QLSA 5D69A 4QJ4B 2LUXA 1TOPA 4F0ZB 1K96A 1YVLA 1B8LA 1TNPA 1Y1XA 5HLVA 3CLNA 1QJTA 2WORA 3DVEA 4N5XA 1A75A 1N2DA 2JNXA 1BU3A 1S1EA 2Y1MA 5CSFA 3RM1A 1KK8B 1E8AA 2NZ0A 1PVAA 2R2IA 3BXKA 1LVCD 3BUOB 5TNCA 3LK0A 1OSAA 1JF0A 1A2XA 2FCDA 1WDCB 2G2BA 2H61C 3TUYB 1BT6A 1CLMA 3SG3A 4PCWA 1CDNA 2KI6C 2AUCA 2D8NA 4GGFC 2EGDA 1DJZA 2NCPA 3A8RA 5D7FA 2VRGA 4YGCB 1NX1A 4P5OE 3SG7A 1R6PA 1XK4A 2ZNDA 4YGBB 2M3WA 5DKQA 1CFDA 1CFPA 2P6BB 1DJYA 3AKBA 1HQVA 4PE4A 1QLKA 1SNLA 4XJKA 2F2OA 3D10A 5DKNA 1FBVA 1AK8A 2LMVA 4QJ5B 2BL0C 2PRUA 1YR5A 3TZ1A 3PLFB 4BY5A 2PASA 1LA3A 1CMFA 1B7TZ 3TS5B 1Y1UA 2KGRA 1MXEA 1DTLA 1YUSA 4HSZA 3SIBA 3JVTC 2JTTA 2MLEC 1IG5A 1GGWA 3O2PA 1MUXA 3LCPC 1KFXS 1QVIY 4MEWA 2TN4A 2WOSA 1M31A 1QASA 3SG5A 4D1EA 1G33A 4I5LB 1UHKA 5KSZA 3OB2B 4PHKA 1XO5A 1NIWA 3HX4A 4M2OA 3EVVA 3I5FC 3CR5X 4MZJA 2ZFDA 4ORCB 1PVBA 1IJ5A 3DVKA 1ZFSA 3BYAA 1NX0A 2LP2A 3IF7A 2MHHA 2K0JA 3VRRA 3GK4X 3I5GB 2BE4A 4GBAA 4C0KA 1KK7Y 1WLMA 4DS7A 1FF1A 1CNPA 1KSOA 2L50A 3PFVA 1XFZO 1AJ5A 2JNFA 2WCEA 1J1EA 2WCFA 2BKIB 2K2FA 2MBXA 3OP0A 3D0YA 2OPOA 3ICBA 1IQ3A 3TDZA 3EK7A 3I5HC 1WLZA 5JJGA 1XFYO 2I2RE 2I18A 3CWGA 3VRPA 4A4CA 1NSHA 1DGVA 2EC6C 3PN7C 1BF5A 1F8HA 4PDZA 1ZMZA 1S6IA 3O4YA 4U8DA 5HKZA 1F54A 1XYDA 2L4IA 2V53A 4MVFA 1L2OB 2L4HA 2K8MB 2JWWA 4AQIA 1QIVA 1C7WA 2G9BA 1MXLC 3TDUA 2WNDA 1F4QA 2JXLA 1KFUL 2I94A 2ZN9A 2LVKA 2COLB 5AANA 1MR8A 2FOTA 3SJSA 1EG3A 1B8CA 1ALWA 3EK4A 1UUSA 1UURA 1CTRA 4FQOA 1UHNA 3EKHA 3K21A 1QX7A 1KQMC 1SW8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K94 A;  4YBH B;  1IH0 A;  4YGD B;  3LLE A;  2L98 A;  1MHO A;  2KFH A;  2KFG A;  2PSR A;  1BR1 B;  3IQO A;  1W7I B;  3SIA A;  4ETO A;  1J55 A;  3PM8 A;  1CLL A;  1GJY A;  1G8I A;  2LCP A;  1UHH A;  4ORA B;  3DD4 A;  2SAS A;  1PAL A;  1HT9 A;  1M46 A;  1RFJ A;  4JWQ A;  2PAL A;  4UPG A;  2FJU B;  2KBI A;  1BG1 A;  2BL0 B;  1FI6 A;  1SL7 A;  4C0J A;  2SCP A;  2E30 A;  3PAL A;  4CPV A;  2LNK A;  1DJG A;  1DT7 B;  3FIA A;  1SR6 C;  2MLF C;  1S5G Y;  1ODB A;  3SG4 A;  4WQ3 A;  5KU1 A;  2LLU A;  2LAP A;  3F45 A;  1SRA A;  2Y1N A;  4MN0 A;  5HLO A;  3NSK A;  2LLT A;  1JFJ A;  4R1E A;  1UHI A;  5DKR A;  2Y5I A;  1KQV A;  1TNW A;  2BBN A;  1DJX A;  1K90 D;  3I5F B;  1H8B A;  4YGE B;  2LP3 A;  4USL A;  4E68 A;  1S3P A;  2CNP A;  2WCB A;  1XA5 A;  1AP4 A;  4ZCV A;  2KDH A;  1OMV A;  2LMU A;  4GPL B;  1KFU S;  1QX2 A;  2JUL A;  2MAZ A;  2AMI A;  2KQY A;  3WNX B;  3NSL A;  2KYC A;  1IGV A;  4PE1 A;  1EJ3 A;  3EK8 A;  4CFQ A;  2BCX A;  2KHN A;  1JBA A;  3I5I C;  4M2P A;  3DVM A;  1MF8 B;  4DCK A;  1NCX A;  3FWC A;  5J3X A;  2KBM A;  1JF2 A;  1R2U A;  5I2Q A;  1J7P A;  4IL1 A;  1AUI B;  1ZAC A;  3I5H B;  1CFC A;  5HKW A;  4XYN A;  1N65 A;  4MBE A;  1NWD A;  3BQ3 A;  1XFU O;  3BUM B;  2EC6 B;  1OE9 B;  3PN7 B;  1DF0 B;  1XFX O;  3E3R A;  1K95 A;  3BOW B;  1U5I B;  1NCY A;  1YUU A;  2LLS A;  4WQ2 A;  2PMY A;  1EXR A;  2KAV A;  2KQ6 A;  1D1O A;  2OTG C;  1M63 B;  2L0P A;  4ORB B;  1RJV A;  3OB1 B;  4NDB A;  4HRE E;  3LL8 B;  4OCI A;  3AAK A;  3DVJ A;  1XK4 C;  1Y0V H;  4HRG A;  2H2K A;  1QXP A;  4YI9 A;  3KEV A;  1SCM C;  3OX6 A;  5AXI A;  3VGO A;  1BLQ A;  2GGZ A;  2RGI A;  5KTY A;  1PSR A;  1NX3 A;  1EG4 A;  2LHI A;  2LUC A;  2MRD A;  4PHN A;  4CLN A;  2LM5 A;  2KI4 C;  1JSA A;  2ZRT A;  1S6J A;  1B9A A;  2L5X B;  2BCA A;  3DF0 B;  4NDC A;  1KQM B;  2LHL A;  1K2H A;  1DVI A;  2LV7 A;  1M45 A;  2CCM A;  1NYA A;  1IJ6 A;  1DJH A;  2KSP A;  2ISD A;  4GGN A;  3VRQ A;  1BOC A;  1K93 D;  2QAC A;  2M8U A;  5PAL A;  3JTD C;  1J1D A;  1KWO C;  2JU0 A;  4DRW A;  2K61 A;  4OR9 B;  3DF0 A;  3OHM B;  2M7L A;  4CFR A;  1YUR A;  2K7O A;  1S6C A;  3TS5 C;  2DOQ A;  2KOT A;  2Q4U A;  1QTX A;  1TCO B;  2LVV A;  5BPJ A;  1VRK A;  2JT8 A;  3EVU A;  1PRW A;  1TNQ A;  4PHM A;  2F33 A;  3KHE A;  1TCF A;  5AER A;  1W7J B;  2F8P A;  4P2Y B;  3FWB A;  2PVB A;  1X02 A;  2CT9 A;  1CKK A;  2JT0 A;  3CGA A;  3CR4 X;  1TRF A;  3CS1 A;  3AKA A;  1AHR A;  1SR6 B;  1K9U A;  4FTG A;  1K9P A;  1SL9 A;  2E6W A;  1J7O A;  2BEC A;  1QVI Z;  1CFF A;  2F3Z A;  1QAT A;  3GK1 A;  1UP5 A;  1S36 A;  2M49 B;  4C0L A;  2LMT A;  1ZUZ A;  5I2L A;  1OZS A;  5IBW A;  1V1F A;  3MSE B;  1CDP A;  2H61 A;  4A4B A;  3BUW B;  4OKH A;  1LIN A;  1B7T Y;  1SBJ A;  2FCE A;  1N0Y A;  4PE0 A;  4HRH A;  2QPT A;  2JOJ A;  2KYF A;  5CSJ A;  2BE6 A;  2GGM A;  4GGF A;  1MWN A;  1TTX A;  2A4J A;  4M2Q A;  4BY4 A;  4NDD A;  1KK7 Z;  1YRT B;  1F4O A;  3I5I B;  1A75 B;  2KNE A;  2JXC A;  4ICB A;  1MQ1 A;  3O6B A;  1LXF C;  3PSR A;  1GGZ A;  1WRL A;  2HPS A;  2L2E A;  4MZL A;  4NQG A;  2NXQ A;  4PHJ A;  3WHU B;  1UWO A;  3JVT B;  4I5J A;  4YRU A;  1KFX L;  2LAN A;  2BBM A;  4MSP A;  2JPT A;  4YGA A;  1K8U A;  3PAT A;  1JC2 A;  2LC5 A;  1ZOT B;  1B47 A;  2O60 A;  4L9M A;  1CDM A;  1SMG A;  2M7N A;  1RK9 A;  1QV0 A;  3KO0 A;  3M0W A;  4AOM A;  1UHJ A;  1L2O C;  1NCZ A;  2KAY A;  5ER4 X;  2AAO A;  1SL8 A;  5F6T A;  1BOD A;  2LVJ A;  1CDL A;  2ZKM X;  2OTG B;  1B1G A;  3TDI A;  2M29 A;  1Y1A A;  2HF5 A;  1BMO A;  1CM4 A;  1SK6 D;  3AAJ A;  3OX5 A;  2K7B A;  4Q04 A;  5G08 A;  4ZCU A;  3C1V A;  4GUK A;  2HQW A;  2KAX A;  2OS8 C;  4TNC A;  2MA2 A;  1SCM B;  3KPX A;  4YI8 A;  2ZNE A;  1EH2 A;  4XJK B;  4CID A;  1LKJ A;  1CM1 A;  5CSN A;  2BCB A;  2LVI A;  2KI4 B;  4GFT A;  3NSI A;  1B8R A;  2BKH B;  3EVR A;  3KF9 A;  1PUL A;  1EL4 A;  1BJF A;  1YX8 A;  1J7Q A;  1REC A;  3CTN A;  2JT3 A;  3A4U B;  4OV2 A;  1IWQ A;  1YRU B;  1CLB A;  1H4B A;  1B4C A;  1IKU A;  2JRF A;  5GQQ C;  1AVS A;  1RRO A;  4PE7 A;  1KK8 C;  3GOF A;  2NLN A;  1TIZ A;  1DJI A;  3JTD B;  2NCO A;  1KWO B;  1SY9 A;  1KSM A;  1JWD A;  4WRI A;  1IQ5 A;  1TNX A;  3HCM A;  2F2P A;  1BR4 B;  1PSB A;  1JFK A;  1XFW O;  1CB1 A;  2M0R A;  1QX5 B;  2K7C A;  1WDC C;  1OOJ A;  1DF0 A;  3TUY C;  2CTN A;  1QIW A;  3CZT X;  3BOW A;  4MRY A;  1U5I A;  2K7D A;  1WY9 A;  1FPW A;  1YX7 A;  3GK2 A;  3ZNI A;  5AFP A;  1LA0 A;  2L51 A;  1K9K A;  1QV1 A;  4PAL A;  5FYX A;  4QJ3 B;  2KGB C;  2HQ8 A;  2EHB A;  1IRJ A;  1F55 A;  3BUN B;  1S5G Z;  1G4Y R;  1GQM A;  1NUB A;  2ZRS A;  3D0Y B;  3FS7 A;  5I2O A;  1WRZ A;  2KI6 D;  3EKJ A;  2LE9 B;  3VRO A;  3WXA A;  1RTP 1;  1DJW A;  1SCV A;  4N1F A;  1F70 A;  3IQQ A;  5JOL A;  5K89 A;  4DIR A;  1OMD A;  3QRX A;  5CPV A;  1C07 A;  1A4P A;  5HYD A;  1F71 A;  2M97 A;  3O78 A;  2B1U A;  1SYM A;  2KFF A;  2M9G A;  1OZO A;  2Q91 A;  4I5K A;  3BUX B;  1RWY A;  1QS7 A;  1AJ4 A;  4N1G A;  5B8I B;  2M1K B;  1FW4 A;  2HET A;  5I8N A;  4I5N B;  5CSI A;  2GV5 A;  2JZI A;  3LK1 A;  1CMG A;  1YUT A;  2K2A A;  1JUO A;  2Y4Q A;  1NPQ A;  3NSO A;  2CBL A;  4GAO A;  5ER5 A;  1S26 D;  1NP8 A;  2JC2 A;  2M1U A;  4MLW A;  4JPZ B;  1A03 A;  1ALV A;  1NX2 A;  4GNK B;  3CR2 A;  4DUQ A;  4MRX A;  2ZN8 A;  3I5G C;  1YTZ C;  1WRK A;  1OQP A;  1J7R A;  2IS9 A;  3RLZ A;  3WHT B;  1KCY A;  3SG2 A;  1XFV O;  1A29 A;  2WC8 A;  1C7V A;  3VRN A;  1DGU A;  1V1G A;  4JQ0 D;  1PK0 D;  1DMO A;  2F3Y A;  1TN4 A;  1XVJ A;  1Q80 A;  1FI5 A;  1OMR A;  3ZWH A;  2JTZ A;  2OS8 B;  3SG6 A;  2CXJ A;  1SPY A;  2O5G A;  3NXA A;  4OVN F;  1M39 A;  1SKT A;  1YVH A;  2MJW B;  3H4S E;  4AQJ A;  5HKY A;  1Y6W A;  2I7A A;  4MZK A;  2JQ6 A;  5AEQ A;  1L7Z A;  1QLS A;  5D69 A;  4QJ4 B;  2LUX A;  1TOP A;  4F0Z B;  1K96 A;  1YVL A;  1B8L A;  1TNP A;  1Y1X A;  5HLV A;  3CLN A;  1QJT A;  2WOR A;  3DVE A;  4N5X A;  1A75 A;  1N2D A;  2JNX A;  1BU3 A;  1S1E A;  2Y1M A;  5CSF A;  3RM1 A;  1KK8 B;  1E8A A;  2NZ0 A;  1PVA A;  2R2I A;  3BXK A;  1LVC D;  3BUO B;  5TNC A;  3LK0 A;  1OSA A;  1JF0 A;  1A2X A;  2FCD A;  1WDC B;  2G2B A;  2H61 C;  3TUY B;  1BT6 A;  1CLM A;  3SG3 A;  4PCW A;  1CDN A;  2KI6 C;  2AUC A;  2D8N A;  4GGF C;  2EGD A;  1DJZ A;  2NCP A;  3A8R A;  5D7F A;  2VRG A;  4YGC B;  1NX1 A;  4P5O E;  3SG7 A;  1R6P A;  1XK4 A;  2ZND A;  4YGB B;  2M3W A;  5DKQ A;  1CFD A;  1CFP A;  2P6B B;  1DJY A;  3AKB A;  1HQV A;  4PE4 A;  1QLK A;  1SNL A;  4XJK A;  2F2O A;  3D10 A;  5DKN A;  1FBV A;  1AK8 A;  2LMV A;  4QJ5 B;  2BL0 C;  2PRU A;  1YR5 A;  3TZ1 A;  3PLF B;  4BY5 A;  2PAS A;  1LA3 A;  1CMF A;  1B7T Z;  3TS5 B;  1Y1U A;  2KGR A;  1MXE A;  1DTL A;  1YUS A;  4HSZ A;  3SIB A;  3JVT C;  2JTT A;  2MLE C;  1IG5 A;  1GGW A;  3O2P A;  1MUX A;  3LCP C;  1KFX S;  1QVI Y;  4MEW A;  2TN4 A;  2WOS A;  1M31 A;  1QAS A;  3SG5 A;  4D1E A;  1G33 A;  4I5L B;  1UHK A;  5KSZ A;  3OB2 B;  4PHK A;  1XO5 A;  1NIW A;  3HX4 A;  4M2O A;  3EVV A;  3I5F C;  3CR5 X;  4MZJ A;  2ZFD A;  4ORC B;  1PVB A;  1IJ5 A;  3DVK A;  1ZFS A;  3BYA A;  1NX0 A;  2LP2 A;  3IF7 A;  2MHH A;  2K0J A;  3VRR A;  3GK4 X;  3I5G B;  2BE4 A;  4GBA A;  4C0K A;  1KK7 Y;  1WLM A;  4DS7 A;  1FF1 A;  1CNP A;  1KSO A;  2L50 A;  3PFV A;  1XFZ O;  1AJ5 A;  2JNF A;  2WCE A;  1J1E A;  2WCF A;  2BKI B;  2K2F A;  2MBX A;  3OP0 A;  3D0Y A;  2OPO A;  3ICB A;  1IQ3 A;  3TDZ A;  3EK7 A;  3I5H C;  1WLZ A;  5JJG A;  1XFY O;  2I2R E;  2I18 A;  3CWG A;  3VRP A;  4A4C A;  1NSH A;  1DGV A;  2EC6 C;  3PN7 C;  1BF5 A;  1F8H A;  4PDZ A;  1ZMZ A;  1S6I A;  3O4Y A;  4U8D A;  5HKZ A;  1F54 A;  1XYD A;  2L4I A;  2V53 A;  4MVF A;  1L2O B;  2L4H A;  2K8M B;  2JWW A;  4AQI A;  1QIV A;  1C7W A;  2G9B A;  1MXL C;  3TDU A;  2WND A;  1F4Q A;  2JXL A;  1KFU L;  2I94 A;  2ZN9 A;  2LVK A;  2COL B;  5AAN A;  1MR8 A;  2FOT A;  3SJS A;  1EG3 A;  1B8C A;  1ALW A;  3EK4 A;  1UUS A;  1UUR A;  1CTR A;  4FQO A;  1UHN A;  3EKH A;  3K21 A;  1QX7 A;  1KQM C;  1SW8 A; 
#chains in the Genus database with same CATH topology
 1K94 A;  3CYZ A;  4YBH B;  1IH0 A;  5DIC A;  2WCM A;  4YGD B;  3LLE A;  2L98 A;  1MHO A;  2KFH A;  2KFG A;  2PSR A;  1OOI X;  1BR1 B;  3IQO A;  3SS5 A;  1W7I B;  3SIA A;  4ETO A;  1J55 A;  3PM8 A;  1CLL A;  1GJY A;  1G8I A;  2LCP A;  3DXL A;  1UHH A;  4ORA B;  3DD4 A;  2SAS A;  1PAL A;  1HT9 A;  1M46 A;  1RFJ A;  4JWQ A;  2PAL A;  4UPG A;  2FJY A;  2FJU B;  2WCJ A;  2KBI A;  1BG1 A;  2BL0 B;  1FI6 A;  1SL7 A;  4C0J A;  2SCP A;  2E30 A;  3PAL A;  2JPO A;  1OOG A;  4CPV A;  2LNK A;  1DJG A;  1DT7 B;  3FIA A;  1SR6 C;  2MLF C;  1S5G Y;  1ODB A;  3SG4 A;  4WQ3 A;  5KU1 A;  2LLU A;  2LAP A;  3F45 A;  1SRA A;  2Y1N A;  3N7H A;  4MN0 A;  5HLO A;  3NSK A;  2BAP A;  2LLT A;  1JFJ A;  4R1E A;  1UHI A;  5DKR A;  2Y5I A;  1KQV A;  1TNW A;  2BBN A;  1DJX A;  1K90 D;  3I5F B;  1H8B A;  3R1P A;  4YGE B;  2LP3 A;  2H8V A;  4USL A;  4E68 A;  1S3P A;  2CNP A;  2WCB A;  3IVT A;  1XA5 A;  1AP4 A;  4ZCV A;  2KDH A;  3R72 A;  1OMV A;  2LMU A;  3B86 A;  4GPL B;  1KFU S;  1QX2 A;  2JUL A;  2MAZ A;  2AMI A;  2KQY A;  3NHT A;  3WNX B;  3CZ0 A;  2WC5 A;  3NSL A;  4F7F A;  2KYC A;  1IGV A;  4PE1 A;  1EJ3 A;  3EK8 A;  4CFQ A;  2BCX A;  2KHN A;  3BFB A;  1JBA A;  3PJI A;  3I5I C;  4M2P A;  3DVM A;  1MF8 B;  2PQL A;  4DCK A;  1NCX A;  1SSE B;  3FWC A;  3OBV A;  5J3X A;  2KBM A;  1JF2 A;  3D73 A;  1R2U A;  3S0G A;  5I2Q A;  2WCH A;  1J7P A;  4IL1 A;  1AUI B;  1ZAC A;  3I5H B;  1CFC A;  5HKW A;  5I94 A;  4XYN A;  1N65 A;  4MBE A;  1NWD A;  2K60 A;  1XFU O;  3BQ3 A;  2EC6 B;  1OE9 B;  3BUM B;  3PN7 B;  1DF0 B;  2QEO A;  1XFX O;  3E3R A;  1K95 A;  3BOW B;  1U5I B;  4INX A;  1NCY A;  1YUU A;  2LLS A;  4WQ2 A;  2PMY A;  1EXR A;  2KAV A;  2KQ6 A;  1D1O A;  2OTG C;  1M63 B;  2L0P A;  4FQT A;  4ORB B;  1RJV A;  3OB1 B;  4NDB A;  4HRE E;  3LL8 B;  4OCI A;  3AAK A;  3DVJ A;  1XK4 C;  1Y0V H;  4HRG A;  2H2K A;  3B6X A;  1QXP A;  4YI9 A;  3KEV A;  1SCM C;  3OX6 A;  5AXI A;  3VGO A;  5D3O A;  1BLQ A;  2GGZ A;  2RGI A;  4INW A;  1PSR A;  1NX3 A;  1EG4 A;  2LHI A;  2LUC A;  2MRD A;  5KTY A;  4PHN A;  4CLN A;  2LM5 A;  1C3Y A;  2KI4 C;  1JSA A;  2ZRT A;  1S6J A;  1B9A A;  2L5X B;  2BCA A;  3DF0 B;  4NDC A;  1KQM B;  2LHL A;  1K2H A;  1W9Z A;  1TUJ A;  1DVI A;  2LV7 A;  1M45 A;  2CCM A;  1NYA A;  1IJ6 A;  1DJH A;  2KSP A;  3R1O A;  2ISD A;  4GGN A;  3VRQ A;  2P70 A;  1K93 D;  1BOC A;  2QAC A;  2M8U A;  5PAL A;  3JTD C;  3CDN A;  1J1D A;  1KWO C;  2JU0 A;  4DRW A;  2K61 A;  4OR9 B;  3DF0 A;  3OHM B;  2M7L A;  4CFR A;  1YUR A;  2K7O A;  1S6C A;  3TS5 C;  2DOQ A;  2KOT A;  2Q4U A;  1QTX A;  1TCO B;  2LVV A;  3BJH A;  5BPJ A;  1VRK A;  2JT8 A;  3EVU A;  1PRW A;  3S0A A;  1TNQ A;  4PHM A;  2F33 A;  3KHE A;  1TCF A;  2KLD A;  1W7J B;  3D74 A;  2L2C A;  3S0D A;  3B88 A;  2F8P A;  4P2Y B;  3FWB A;  2PVB A;  1X02 A;  2CT9 A;  1CKK A;  2JT0 A;  3CGA A;  3CR4 X;  1TRF A;  3CS1 A;  3AKA A;  1AHR A;  1SR6 B;  1K9U A;  4FTG A;  1LS8 A;  1K9P A;  1SL9 A;  3D77 A;  5FI2 A;  2E6W A;  1DQE A;  1J7O A;  2BEC A;  1QVI Z;  2YGU A;  1CFF A;  3D76 A;  2F3Z A;  1QAT A;  3GK1 A;  1UP5 A;  1S36 A;  2M49 B;  4C0L A;  2LMT A;  1ZUZ A;  5I2L A;  1DEK A;  1OZS A;  5IBW A;  1V1F A;  3MSE B;  1CDP A;  4IJ7 A;  2H61 A;  4A4B A;  3BUW B;  4OKH A;  1LIN A;  1B7T Y;  1SBJ A;  2FCE A;  1N0Y A;  2P71 A;  3O4X A;  4HRH A;  4PE0 A;  2QPT A;  2JOJ A;  2KYF A;  3PM2 A;  1OOF A;  3SS3 A;  5CSJ A;  2BE6 A;  2GGM A;  4GGF A;  1MWN A;  1TTX A;  2A4J A;  2BNX A;  3B7A A;  3CZ1 A;  4M2Q A;  4BY4 A;  4NDD A;  1KK7 Z;  1YRT B;  1F4O A;  3I5I B;  1A75 B;  2KNE A;  2JXC A;  3K1E A;  4ICB A;  1MQ1 A;  3O6B A;  1LXF C;  1DEL A;  1GGZ A;  1WRL A;  2HPS A;  2L2E A;  3DYE A;  3PSR A;  2NXQ A;  4MZL A;  4NQG A;  4PHJ A;  3WHU B;  1UWO A;  3JVT B;  4I5J A;  4YRU A;  1KFX L;  2LAN A;  2BBM A;  4MSP A;  2JPT A;  4YGA A;  1K8U A;  3PAT A;  1JC2 A;  2LC5 A;  1ZOT B;  1B47 A;  2O60 A;  4L9M A;  1CDM A;  1SMG A;  2M7N A;  1RK9 A;  3Q8I A;  1QV0 A;  3KO0 A;  3M0W A;  3R1V A;  4AOM A;  1UHJ A;  1L2O C;  1NCZ A;  2KAY A;  2QEV A;  5ER4 X;  2AAO A;  1SL8 A;  5F6T A;  1BOD A;  2LVJ A;  3CZ2 A;  1CDL A;  2ZKM X;  2OTG B;  1B1G A;  3TDI A;  2M29 A;  1Y1A A;  2HF5 A;  1TUZ A;  1BMO A;  1CM4 A;  1SK6 D;  3AAJ A;  3OX5 A;  2K7B A;  3BFH A;  4Q04 A;  5G08 A;  4ZCU A;  3C1V A;  4GUK A;  2HQW A;  2KAX A;  2OS8 C;  4TNC A;  2MA2 A;  1SCM B;  3KPX A;  4YI8 A;  2ZNE A;  5HL1 A;  1EH2 A;  4XJK B;  4CID A;  1LKJ A;  1CM1 A;  5CSN A;  2BCB A;  2LVI A;  2KI4 B;  4GFT A;  3VB1 A;  3NSI A;  1B8R A;  2BKH B;  3EVR A;  3KF9 A;  1PUL A;  1EL4 A;  1BJF A;  1YX8 A;  1J7Q A;  1REC A;  3CTN A;  2JT3 A;  3A4U B;  3DY9 A;  1IWQ A;  1YRU B;  3FE8 A;  4OV2 A;  1CLB A;  1B4C A;  1H4B A;  1IKU A;  2JRF A;  5GQQ C;  1AVS A;  1RRO A;  4PE7 A;  2ERB A;  1KK8 C;  3GOF A;  2NLN A;  1TIZ A;  1GM0 A;  1OW4 A;  1DJI A;  3FE6 A;  3JTD B;  2NCO A;  1KWO B;  1SY9 A;  1KSM A;  1JWD A;  4WRI A;  1IQ5 A;  1TNX A;  3HCM A;  2F2P A;  1BR4 B;  1PSB A;  1JFK A;  1XFW O;  1CB1 A;  2M0R A;  1QX5 B;  2K7C A;  1WDC C;  1Z4H A;  1OOJ A;  1DF0 A;  3TUY C;  2CTN A;  3S0E A;  1QIW A;  3CZT X;  3BOW A;  4MRY A;  1U5I A;  2K7D A;  1WY9 A;  1FPW A;  1YX7 A;  3GK2 A;  3ZNI A;  5AFP A;  1LA0 A;  2L51 A;  1K9K A;  1QV1 A;  1T14 A;  4PAL A;  5FYX A;  1P28 A;  4QJ3 B;  2KGB C;  2HQ8 A;  2QEB A;  2EHB A;  1IRJ A;  5FI7 A;  1F55 A;  3BUN B;  2QEH A;  1S5G Z;  1G4Y R;  1GQM A;  1NUB A;  2ZRS A;  3D0Y B;  3FS7 A;  3NGV A;  5I2O A;  1WRZ A;  2KI6 D;  3EKJ A;  2LE9 B;  3VRO A;  3WXA A;  1RTP 1;  1DJW A;  1SCV A;  4N1F A;  1F70 A;  1ORG A;  4JD9 A;  3IQQ A;  4OZD A;  5JOL A;  5K89 A;  4DIR A;  1OMD A;  1Z2C B;  3QRX A;  5CPV A;  1C07 A;  1A4P A;  5HYD A;  1F71 A;  2M97 A;  3O78 A;  2B1U A;  3FE9 A;  1SYM A;  2KFF A;  2M9G A;  1OZO A;  3L4L A;  2Q91 A;  4I5K A;  3BUX B;  1RWY A;  1QS7 A;  1AJ4 A;  4N1G A;  5FI6 A;  5B8I B;  2M1K B;  1FW4 A;  2HET A;  5I8N A;  4I5N B;  5CSI A;  3D78 A;  2GV5 A;  2JZI A;  3LK1 A;  1CMG A;  4JKT A;  1YUT A;  2K2A A;  1JUO A;  2Y4Q A;  1NPQ A;  3NSO A;  2CBL A;  4GAO A;  5ER5 A;  1S26 D;  1NP8 A;  2JC2 A;  2M1U A;  4MLW A;  4JPZ B;  1A03 A;  1ALV A;  1NX2 A;  1TWO A;  3OGN A;  4GNK B;  3CR2 A;  4DUQ A;  4MRX A;  3UNW A;  2ZN8 A;  3SS4 A;  3I5G C;  1YTZ C;  3L47 A;  1WRK A;  1OQP A;  1J7R A;  2IS9 A;  3RLZ A;  3WHT B;  1KCY A;  3SG2 A;  1XFV O;  1A29 A;  2WC8 A;  1C7V A;  3D75 A;  3VRN A;  1DGU A;  1V1G A;  3RZS A;  4JQ0 D;  1PK0 D;  1DMO A;  2F3Y A;  1TN4 A;  1XVJ A;  1Q80 A;  1FI5 A;  1OMR A;  3ZWH A;  2JTZ A;  2OS8 B;  2WC6 A;  2CXJ A;  1SPY A;  2L5Y A;  2O5G A;  3SG6 A;  3NXA A;  4OVN F;  1M39 A;  1SKT A;  1YVH A;  2MJW B;  3H4S E;  4AQJ A;  5HKY A;  1Y6W A;  2I7A A;  4MZK A;  2JQ6 A;  5AEQ A;  1L7Z A;  1QLS A;  5D69 A;  4QJ4 B;  2LUX A;  1TOP A;  4F0Z B;  1K96 A;  1OOH A;  1B8L A;  1TNP A;  1YVL A;  1Y1X A;  5HLV A;  3CLN A;  1QJT A;  2WOR A;  3DVE A;  4N5X A;  1A75 A;  1N2D A;  2JNX A;  1BU3 A;  1S1E A;  2Y1M A;  5CSF A;  3RM1 A;  1KK8 B;  5AER A;  1E8A A;  2NZ0 A;  1PVA A;  2R2I A;  3BXK A;  1LVC D;  3BUO B;  3S0B A;  5TNC A;  3LK0 A;  1OSA A;  1JF0 A;  1A2X A;  2FCD A;  1WDC B;  2G2B A;  2H61 C;  3TUY B;  1BT6 A;  1CLM A;  3SG3 A;  4PCW A;  1CDN A;  2KLE A;  2KI6 C;  2AUC A;  2D8N A;  4GGF C;  2EGD A;  1DJZ A;  2KPH A;  2NCP A;  2QDI A;  1IIO A;  3A8R A;  1C3Z A;  5D7F A;  2VRG A;  4YGC B;  1NX1 A;  4P5O E;  3SG7 A;  1R6P A;  1XK4 A;  2GTE A;  2ZND A;  4YGB B;  2M3W A;  5DKQ A;  1CFD A;  1CFP A;  2P6B B;  1DJY A;  3AKB A;  1HQV A;  4PE4 A;  1QLK A;  1SNL A;  4XJK A;  2F2O A;  3S0F A;  3D10 A;  5DKN A;  1FBV A;  1AK8 A;  2LMV A;  4QJ5 B;  2BL0 C;  2PRU A;  1YR5 A;  3TZ1 A;  3PLF B;  4BY5 A;  2PAS A;  1LA3 A;  1CMF A;  1B7T Z;  3TS5 B;  1Y1U A;  2KGR A;  1MXE A;  1DTL A;  1YUS A;  4HSZ A;  5EL2 A;  3SIB A;  3JVT C;  2JTT A;  2MLE C;  1IG5 A;  1GGW A;  3O2P A;  1MUX A;  3LCP C;  1KFX S;  1QVI Y;  4MEW A;  2TN4 A;  2WOS A;  1M31 A;  1QAS A;  3SG5 A;  1DC1 A;  4D1E A;  1G33 A;  4I5L B;  1UHK A;  5KSZ A;  3OB2 B;  4PHK A;  1XO5 A;  1NIW A;  3HX4 A;  4M2O A;  3EVV A;  3I5F C;  3CR5 X;  4MZJ A;  2ZFD A;  4ORC B;  1PVB A;  1IJ5 A;  3DVK A;  1ZFS A;  3BYA A;  1NX0 A;  2LP2 A;  3IF7 A;  2WCK A;  2MHH A;  2K0J A;  3VRR A;  3GK4 X;  3I5G B;  3DZT A;  2BE4 A;  4GBA A;  4C0K A;  1KK7 Y;  1WLM A;  4DS7 A;  1FF1 A;  1CNP A;  1KSO A;  2L50 A;  3PFV A;  1XFZ O;  1AJ5 A;  2JNF A;  2WCE A;  1J1E A;  2WCF A;  2BKI B;  2K2F A;  2MBX A;  3OP0 A;  3D0Y A;  2OPO A;  3V2L A;  3ICB A;  1IQ3 A;  3TDZ A;  3EK7 A;  3I5H C;  1WLZ A;  5JJG A;  1XFY O;  2I2R E;  2I18 A;  3CWG A;  3VRP A;  4A4C A;  1NSH A;  1DGV A;  2EC6 C;  3PN7 C;  1BF5 A;  1F8H A;  3UO9 A;  4PDZ A;  1ZMZ A;  2WCL A;  1S6I A;  3O4Y A;  2PYQ A;  3NHI A;  4U8D A;  5HKZ A;  1F54 A;  1XYD A;  2L4I A;  3QME A;  1XFR A;  2V53 A;  4MVF A;  4PT1 A;  1L2O B;  2L4H A;  1QWV A;  2K8M B;  3CAB A;  4KYN A;  3L4A A;  2JWW A;  4AQI A;  1QIV A;  1C7W A;  2G9B A;  1MXL C;  3EG5 B;  3TDU A;  2WND A;  1F4Q A;  2JXL A;  1KFU L;  2I94 A;  3BFA A;  2ZN9 A;  2LVK A;  2COL B;  5AAN A;  1MR8 A;  2FOT A;  3SJS A;  1EG3 A;  1B8C A;  3B87 A;  1ALW A;  3EK4 A;  1UUS A;  1UUR A;  1CTR A;  4FQO A;  1UHN A;  3EKH A;  3K21 A;  1QX7 A;  1KQM C;  1SW8 A; 
#chains in the Genus database with same CATH homology
 1K94 A;  4YBH B;  1IH0 A;  4YGD B;  3LLE A;  2L98 A;  1MHO A;  2KFH A;  2KFG A;  2PSR A;  1BR1 B;  3IQO A;  1W7I B;  3SIA A;  4ETO A;  1J55 A;  3PM8 A;  1CLL A;  1GJY A;  1G8I A;  2LCP A;  1UHH A;  4ORA B;  3DD4 A;  2SAS A;  1PAL A;  1HT9 A;  1M46 A;  1RFJ A;  4JWQ A;  2PAL A;  4UPG A;  2FJU B;  2KBI A;  1BG1 A;  2BL0 B;  1FI6 A;  1SL7 A;  4C0J A;  2SCP A;  2E30 A;  3PAL A;  4CPV A;  2LNK A;  1DJG A;  1DT7 B;  3FIA A;  1SR6 C;  2MLF C;  1S5G Y;  1ODB A;  3SG4 A;  4WQ3 A;  5KU1 A;  2LLU A;  2LAP A;  3F45 A;  1SRA A;  2Y1N A;  4MN0 A;  5HLO A;  3NSK A;  2LLT A;  1JFJ A;  4R1E A;  1UHI A;  5DKR A;  2Y5I A;  1KQV A;  1TNW A;  2BBN A;  1DJX A;  1K90 D;  3I5F B;  1H8B A;  4YGE B;  2LP3 A;  4USL A;  4E68 A;  1S3P A;  2CNP A;  2WCB A;  1XA5 A;  1AP4 A;  4ZCV A;  2KDH A;  1OMV A;  2LMU A;  4GPL B;  1KFU S;  1QX2 A;  2JUL A;  2MAZ A;  2AMI A;  2KQY A;  3WNX B;  3NSL A;  2KYC A;  1IGV A;  4PE1 A;  1EJ3 A;  3EK8 A;  4CFQ A;  2BCX A;  2KHN A;  1JBA A;  3I5I C;  4M2P A;  3DVM A;  1MF8 B;  4DCK A;  1NCX A;  3FWC A;  5J3X A;  2KBM A;  1JF2 A;  1R2U A;  5I2Q A;  1J7P A;  4IL1 A;  1AUI B;  1ZAC A;  3I5H B;  1CFC A;  5HKW A;  4XYN A;  1N65 A;  4MBE A;  1NWD A;  3BQ3 A;  1XFU O;  3BUM B;  2EC6 B;  1OE9 B;  3PN7 B;  1DF0 B;  1XFX O;  3E3R A;  1K95 A;  3BOW B;  1U5I B;  1NCY A;  1YUU A;  2LLS A;  4WQ2 A;  2PMY A;  1EXR A;  2KAV A;  2KQ6 A;  1D1O A;  2OTG C;  1M63 B;  2L0P A;  4ORB B;  1RJV A;  3OB1 B;  4NDB A;  4HRE E;  3LL8 B;  4OCI A;  3AAK A;  3DVJ A;  1XK4 C;  1Y0V H;  4HRG A;  2H2K A;  1QXP A;  4YI9 A;  3KEV A;  1SCM C;  3OX6 A;  5AXI A;  3VGO A;  1BLQ A;  2GGZ A;  2RGI A;  5KTY A;  1PSR A;  1NX3 A;  1EG4 A;  2LHI A;  2LUC A;  2MRD A;  4PHN A;  4CLN A;  2LM5 A;  2KI4 C;  1JSA A;  2ZRT A;  1S6J A;  1B9A A;  2L5X B;  2BCA A;  3DF0 B;  4NDC A;  1KQM B;  2LHL A;  1K2H A;  1DVI A;  2LV7 A;  1M45 A;  2CCM A;  1NYA A;  1IJ6 A;  1DJH A;  2KSP A;  2ISD A;  4GGN A;  3VRQ A;  1BOC A;  1K93 D;  2QAC A;  2M8U A;  5PAL A;  3JTD C;  1J1D A;  1KWO C;  2JU0 A;  4DRW A;  2K61 A;  4OR9 B;  3DF0 A;  3OHM B;  2M7L A;  4CFR A;  1YUR A;  2K7O A;  1S6C A;  3TS5 C;  2DOQ A;  2KOT A;  2Q4U A;  1QTX A;  1TCO B;  2LVV A;  5BPJ A;  1VRK A;  2JT8 A;  3EVU A;  1PRW A;  1TNQ A;  4PHM A;  2F33 A;  3KHE A;  1TCF A;  5AER A;  1W7J B;  2F8P A;  4P2Y B;  3FWB A;  2PVB A;  1X02 A;  2CT9 A;  1CKK A;  2JT0 A;  3CGA A;  3CR4 X;  1TRF A;  3CS1 A;  3AKA A;  1AHR A;  1SR6 B;  1K9U A;  4FTG A;  1K9P A;  1SL9 A;  2E6W A;  1J7O A;  2BEC A;  1QVI Z;  1CFF A;  2F3Z A;  1QAT A;  3GK1 A;  1UP5 A;  1S36 A;  2M49 B;  4C0L A;  2LMT A;  1ZUZ A;  5I2L A;  1OZS A;  5IBW A;  1V1F A;  3MSE B;  1CDP A;  2H61 A;  4A4B A;  3BUW B;  4OKH A;  1LIN A;  1B7T Y;  1SBJ A;  2FCE A;  1N0Y A;  4PE0 A;  4HRH A;  2QPT A;  2JOJ A;  2KYF A;  5CSJ A;  2BE6 A;  2GGM A;  4GGF A;  1MWN A;  1TTX A;  2A4J A;  4M2Q A;  4BY4 A;  4NDD A;  1KK7 Z;  1YRT B;  1F4O A;  3I5I B;  1A75 B;  2KNE A;  2JXC A;  4ICB A;  1MQ1 A;  3O6B A;  1LXF C;  3PSR A;  1GGZ A;  1WRL A;  2HPS A;  2L2E A;  4MZL A;  4NQG A;  2NXQ A;  4PHJ A;  3WHU B;  1UWO A;  3JVT B;  4I5J A;  4YRU A;  1KFX L;  2LAN A;  2BBM A;  4MSP A;  2JPT A;  4YGA A;  1K8U A;  3PAT A;  1JC2 A;  2LC5 A;  1ZOT B;  1B47 A;  2O60 A;  4L9M A;  1CDM A;  1SMG A;  2M7N A;  1RK9 A;  1QV0 A;  3KO0 A;  3M0W A;  4AOM A;  1UHJ A;  1L2O C;  1NCZ A;  2KAY A;  5ER4 X;  2AAO A;  1SL8 A;  5F6T A;  1BOD A;  2LVJ A;  1CDL A;  2ZKM X;  2OTG B;  1B1G A;  3TDI A;  2M29 A;  1Y1A A;  2HF5 A;  1BMO A;  1CM4 A;  1SK6 D;  3AAJ A;  3OX5 A;  2K7B A;  4Q04 A;  5G08 A;  4ZCU A;  3C1V A;  4GUK A;  2HQW A;  2KAX A;  2OS8 C;  4TNC A;  2MA2 A;  1SCM B;  3KPX A;  4YI8 A;  2ZNE A;  1EH2 A;  4XJK B;  4CID A;  1LKJ A;  1CM1 A;  5CSN A;  2BCB A;  2LVI A;  2KI4 B;  4GFT A;  3NSI A;  1B8R A;  2BKH B;  3EVR A;  3KF9 A;  1PUL A;  1EL4 A;  1BJF A;  1YX8 A;  1J7Q A;  1REC A;  3CTN A;  2JT3 A;  3A4U B;  4OV2 A;  1IWQ A;  1YRU B;  1CLB A;  1H4B A;  1B4C A;  1IKU A;  2JRF A;  5GQQ C;  1AVS A;  1RRO A;  4PE7 A;  1KK8 C;  3GOF A;  2NLN A;  1TIZ A;  1DJI A;  3JTD B;  2NCO A;  1KWO B;  1SY9 A;  1KSM A;  1JWD A;  4WRI A;  1IQ5 A;  1TNX A;  3HCM A;  2F2P A;  1BR4 B;  1PSB A;  1JFK A;  1XFW O;  1CB1 A;  2M0R A;  1QX5 B;  2K7C A;  1WDC C;  1OOJ A;  1DF0 A;  3TUY C;  2CTN A;  1QIW A;  3CZT X;  3BOW A;  4MRY A;  1U5I A;  2K7D A;  1WY9 A;  1FPW A;  1YX7 A;  3GK2 A;  3ZNI A;  5AFP A;  1LA0 A;  2L51 A;  1K9K A;  1QV1 A;  4PAL A;  5FYX A;  4QJ3 B;  2KGB C;  2HQ8 A;  2EHB A;  1IRJ A;  1F55 A;  3BUN B;  1S5G Z;  1G4Y R;  1GQM A;  1NUB A;  2ZRS A;  3D0Y B;  3FS7 A;  5I2O A;  1WRZ A;  2KI6 D;  3EKJ A;  2LE9 B;  3VRO A;  3WXA A;  1RTP 1;  1DJW A;  1SCV A;  4N1F A;  1F70 A;  3IQQ A;  5JOL A;  5K89 A;  4DIR A;  1OMD A;  3QRX A;  5CPV A;  1C07 A;  1A4P A;  5HYD A;  1F71 A;  2M97 A;  3O78 A;  2B1U A;  1SYM A;  2KFF A;  2M9G A;  1OZO A;  2Q91 A;  4I5K A;  3BUX B;  1RWY A;  1QS7 A;  1AJ4 A;  4N1G A;  5B8I B;  2M1K B;  1FW4 A;  2HET A;  5I8N A;  4I5N B;  5CSI A;  2GV5 A;  2JZI A;  3LK1 A;  1CMG A;  1YUT A;  2K2A A;  1JUO A;  2Y4Q A;  1NPQ A;  3NSO A;  2CBL A;  4GAO A;  5ER5 A;  1S26 D;  1NP8 A;  2JC2 A;  2M1U A;  4MLW A;  4JPZ B;  1A03 A;  1ALV A;  1NX2 A;  4GNK B;  3CR2 A;  4DUQ A;  4MRX A;  2ZN8 A;  3I5G C;  1YTZ C;  1WRK A;  1OQP A;  1J7R A;  2IS9 A;  3RLZ A;  3WHT B;  1KCY A;  3SG2 A;  1XFV O;  1A29 A;  2WC8 A;  1C7V A;  3VRN A;  1DGU A;  1V1G A;  4JQ0 D;  1PK0 D;  1DMO A;  2F3Y A;  1TN4 A;  1XVJ A;  1Q80 A;  1FI5 A;  1OMR A;  3ZWH A;  2JTZ A;  2OS8 B;  3SG6 A;  2CXJ A;  1SPY A;  2O5G A;  3NXA A;  4OVN F;  1M39 A;  1SKT A;  1YVH A;  2MJW B;  3H4S E;  4AQJ A;  5HKY A;  1Y6W A;  2I7A A;  4MZK A;  2JQ6 A;  5AEQ A;  1L7Z A;  1QLS A;  5D69 A;  4QJ4 B;  2LUX A;  1TOP A;  4F0Z B;  1K96 A;  1YVL A;  1B8L A;  1TNP A;  1Y1X A;  5HLV A;  3CLN A;  1QJT A;  2WOR A;  3DVE A;  4N5X A;  1A75 A;  1N2D A;  2JNX A;  1BU3 A;  1S1E A;  2Y1M A;  5CSF A;  3RM1 A;  1KK8 B;  1E8A A;  2NZ0 A;  1PVA A;  2R2I A;  3BXK A;  1LVC D;  3BUO B;  5TNC A;  3LK0 A;  1OSA A;  1JF0 A;  1A2X A;  2FCD A;  1WDC B;  2G2B A;  2H61 C;  3TUY B;  1BT6 A;  1CLM A;  3SG3 A;  4PCW A;  1CDN A;  2KI6 C;  2AUC A;  2D8N A;  4GGF C;  2EGD A;  1DJZ A;  2NCP A;  3A8R A;  5D7F A;  2VRG A;  4YGC B;  1NX1 A;  4P5O E;  3SG7 A;  1R6P A;  1XK4 A;  2ZND A;  4YGB B;  2M3W A;  5DKQ A;  1CFD A;  1CFP A;  2P6B B;  1DJY A;  3AKB A;  1HQV A;  4PE4 A;  1QLK A;  1SNL A;  4XJK A;  2F2O A;  3D10 A;  5DKN A;  1FBV A;  1AK8 A;  2LMV A;  4QJ5 B;  2BL0 C;  2PRU A;  1YR5 A;  3TZ1 A;  3PLF B;  4BY5 A;  2PAS A;  1LA3 A;  1CMF A;  1B7T Z;  3TS5 B;  1Y1U A;  2KGR A;  1MXE A;  1DTL A;  1YUS A;  4HSZ A;  3SIB A;  3JVT C;  2JTT A;  2MLE C;  1IG5 A;  1GGW A;  3O2P A;  1MUX A;  3LCP C;  1KFX S;  1QVI Y;  4MEW A;  2TN4 A;  2WOS A;  1M31 A;  1QAS A;  3SG5 A;  4D1E A;  1G33 A;  4I5L B;  1UHK A;  5KSZ A;  3OB2 B;  4PHK A;  1XO5 A;  1NIW A;  3HX4 A;  4M2O A;  3EVV A;  3I5F C;  3CR5 X;  4MZJ A;  2ZFD A;  4ORC B;  1PVB A;  1IJ5 A;  3DVK A;  1ZFS A;  3BYA A;  1NX0 A;  2LP2 A;  3IF7 A;  2MHH A;  2K0J A;  3VRR A;  3GK4 X;  3I5G B;  2BE4 A;  4GBA A;  4C0K A;  1KK7 Y;  1WLM A;  4DS7 A;  1FF1 A;  1CNP A;  1KSO A;  2L50 A;  3PFV A;  1XFZ O;  1AJ5 A;  2JNF A;  2WCE A;  1J1E A;  2WCF A;  2BKI B;  2K2F A;  2MBX A;  3OP0 A;  3D0Y A;  2OPO A;  3ICB A;  1IQ3 A;  3TDZ A;  3EK7 A;  3I5H C;  1WLZ A;  5JJG A;  1XFY O;  2I2R E;  2I18 A;  3CWG A;  3VRP A;  4A4C A;  1NSH A;  1DGV A;  2EC6 C;  3PN7 C;  1BF5 A;  1F8H A;  4PDZ A;  1ZMZ A;  1S6I A;  3O4Y A;  4U8D A;  5HKZ A;  1F54 A;  1XYD A;  2L4I A;  2V53 A;  4MVF A;  1L2O B;  2L4H A;  2K8M B;  2JWW A;  4AQI A;  1QIV A;  1C7W A;  2G9B A;  1MXL C;  3TDU A;  2WND A;  1F4Q A;  2JXL A;  1KFU L;  2I94 A;  2ZN9 A;  2LVK A;  2COL B;  5AAN A;  1MR8 A;  2FOT A;  3SJS A;  1EG3 A;  1B8C A;  1ALW A;  3EK4 A;  1UUS A;  1UUR A;  1CTR A;  4FQO A;  1UHN A;  3EKH A;  3K21 A;  1QX7 A;  1KQM C;  1SW8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...