2M9GA

Solution structure of calcium-bound human s100a12
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
92
structure length
92
Chain Sequence
MTKLEEHLEGIVNIFHQYSVRKGHFDTLSKGELKQLLTKELANTIKNIKDKAVIDEIFQGLDANQDEQVDFQEFISLVAIALKAAHYHTHKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of human Ca(2+)-bound S100A12
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal binding protein
molecule keywords Protein S100-A12
total genus 27
structure length 92
sequence length 92
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-06-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2m9gA00
1QX7A 5ER5A 4N1GA 2F3ZA 3SIAA 1NUBA 1LKJA 4FQOA 1WRLA 3FS7A 1DJXA 5I2OA 4M2OA 1N2DA 1OSAA 2V53A 1TNXA 3SG3A 1BU3A 1SL9A 4GUKA 3SG5A 3NSOA 1F55A 2OS8C 3WHTB 3KHEA 1KWOC 4I5LB 5PALA 2LMTA 2FOTA 2HETA 1Y6WA 2M1KB 3CLNA 3I5IC 2ZN8A 3IF7A 5JOLA 4M2QA 2LLSA 2JXCA 4MN0A 1ZOTB 1CNPA 1NX2A 3D0YA 1QVIZ 1WLZA 1NIWA 5BPJA 1C07A 1DMOA 3BUWB 1KFUS 2KAVA 1DJHA 3FWBA 5HKYA 4CFRA 4CFQA 1CMFA 3D10A 1L7ZA 1XK4C 2KYFA 2TN4A 3RLZA 4GGFA 4DUQA 1BF5A 1NP8A 3VRNA 1YRUB 1R2UA 3AAJA 4UPGA 1V1GA 1UP5A 1KCYA 1PULA 4CPVA 1A4PA 1CLMA 2KHNA 4PHMA 3EVRA 1BR1B 3HX4A 3JVTB 2H2KA 3I5FC 5G08A 3KPXA 1DJWA 4A4CA 2M1UA 5DKNA 4IL1A 3I5IB 5HLOA 4MZLA 1DJYA 1KK7Z 2KSPA 4GAOA 1XFVO 1VRKA 2WCBA 1SL7A 4XYNA 5I8NA 2K7BA 1R6PA 3DD4A 2JTTA 3O6BA 3M0WA 2JWWA 2JNXA 2LLTA 2OPOA 1CTRA 3TDUA 4ORBB 1S36A 1J1DA 2BE4A 2COLB 2LVJA 2KOTA 4YI8A 3VRRA 4I5KA 2M7NA 2MAZA 1K93D 2KI6C 1UHIA 2LLUA 2LHIA 1FF1A 4MVFA 2LHLA 1QXPA 2WCFA 4C0JA 1F4QA 3LK1A 1IQ3A 2MLEC 1AVSA 4D1EA 2CBLA 5HYDA 2HQWA 1S6JA 2JPTA 1SK6D 3HCMA 3I5HC 1IJ5A 5CSJA 4N5XA 1B7TZ 1SCMC 3OP0A 2KFGA 3DVJA 1ALVA 1PSRA 4DRWA 1SCMB 5AANA 1QASA 2JTZA 1KK8C 1MR8A 1B47A 4YRUA 1IWQA 1U5IA 2ZKMX 4L9MA 1Y1UA 4FTGA 4I5NB 1TNQA 5B8IB 2K2FA 2MRDA 2PASA 2MA2A 1D1OA 3GK1A 2CNPA 4YBHB 3D0YB 2JZIA 1EXRA 1NCXA 2SASA 1F71A 4QJ5B 1QX5B 1CFFA 4DIRA 3MSEB 2ZN9A 1WRKA 1L2OB 1RFJA 1JC2A 1BT6A 1IRJA 1K9KA 1IH0A 4PE4A 4R1EA 3JTDC 1IGVA 1DF0A 2GV5A 1W7JB 1YUSA 2JOJA 2KBIA 2Y1MA 3H4SE 1EH2A 3K21A 2MLFC 1A03A 1K8UA 1SMGA 4A4BA 1UHKA 1NWDA 1OMVA 1ZUZA 2L4HA 2LM5A 3CR5X 3LL8B 3RM1A 3I5HB 1BG1A 4ORCB 1IKUA 5FYXA 3OB1B 1TOPA 3OB2B 5J3XA 4MEWA 1UURA 1Y1XA 1ZFSA 1WDCB 2F2OA 2JT3A 2LP2A 2R2IA 1QS7A 4OVNF 1LA3A 2NXQA 3BOWA 1WDCC 1MF8B 2WC8A 4GPLB 3LCPC 4BY5A 1QIWA 2DOQA 1YX7A 2L50A 3CWGA 1EL4A 1NX3A 3PN7B 1HQVA 2JC2A 2LVVA 4JWQA 1NSHA 1KK7Y 1YUTA 1CFDA 3GK2A 1J1EA 1EJ3A 3SIBA 4OR9B 2Q4UA 1DJIA 2LNKA 2O5GA 2WCEA 2LMUA 1QV0A 3BUXB 4NQGA 1KSOA 2AMIA 4TNCA 1TIZA 4YGBB 1S6IA 1YUUA 5CSIA 4CLNA 1FW4A 2NZ0A 1MXEA 3CTNA 3ZWHA 2L98A 1PALA 1CDPA 3CR4X 3BUMB 1Y1AA 5KTYA 1BLQA 1IJ6A 1JBAA 1G4YR 3CZTX 2LC5A 2A4JA 3AKBA 2L2EA 2LV7A 1MQ1A 1LA0A 1WLMA 2SCPA 1GQMA 4P2YB 3PALA 2L51A 2M29A 3DF0B 1QJTA 3KF9A 3NXAA 1B4CA 1TRFA 2Q91A 2MBXA 4HSZA 4PHKA 3TUYC 1CFPA 2KDHA 1JSAA 4HRGA 1JFJA 4OV2A 1YR5A 4U8DA 2BCBA 5JJGA 1Y0VH 1LVCD 2ZRSA 4PE1A 1OQPA 4MZKA 4AOMA 4USLA 4YGDB 2BCXA 1NYAA 1CDNA 4ZCVA 1RTP1 1K95A 1JFKA 1UWOA 3IQOA 1NX0A 1TCFA 2PALA 4PDZA 1RK9A 1J7PA 1A75A 2AUCA 2GGZA 1DJZA 2RGIA 3JVTC 1GGWA 1B8LA 1B1GA 2JU0A 1ODBA 1MWNA 2G2BA 4ETOA 1DGUA 4JQ0D 2FJUB 1K2HA 5ER4X 4MZJA 1ZACA 2KI4B 4QJ4B 2HF5A 3ICBA 5I2QA 2I2RE 2I18A 1PK0D 3PM8A 1N65A 2LVIA 2NCOA 4PALA 2BKIB 2CT9A 3BOWB 4QJ3B 3BYAA 5AERA 1BODA 4YGAA 1YVHA 1SRAA 1CFCA 4PE0A 3DF0A 5F6TA 4N1FA 1CDMA 2QACA 1KFXS 1RROA 3PSRA 4PE7A 3KEVA 2MHHA 5KU1A 1TNPA 4MRYA 1CM4A 1DT7B 2EC6C 3E3RA 4CIDA 2O60A 2H61C 2L0PA 2FCDA 2JULA 3C1VA 2NCPA 1YVLA 1QIVA 5KSZA 1KFXL 1UHJA 3DVKA 2M7LA 4NDCA 1F8HA 1J55A 3VROA 1XO5A 2F3YA 3NSKA 1E8AA 1MUXA 2BKHB 1S1EA 3PATA 1C7VA 3I5GB 1XFYO 4PHJA 4GFTA 1XFUO 1K9PA 1OZOA 2JQ6A 1Q80A 2G9BA 3VGOA 3FWCA 3EKHA 1SW8A 5D7FA 2LUXA 3EKJA 3PLFB 5AFPA 1G8IA 1SBJA 2LVKA 3TDZA 2PRUA 1XA5A 3BXKA 2VRGA 5AEQA 1CM1A 5CPVA 4ICBA 4ZCUA 1SL8A 2CTNA 2P6BB 3BUNB 4YI9A 5TNCA 3BQ3A 2KI6D 3IQQA 3AKAA 3NSLA 1PVBA 2KQYA 1TCOB 1M63B 3FIAA 1MHOA 5DKRA 2BE6A 3LLEA 3CGAA 1AJ4A 1AK8A 2EC6B 2K7OA 1JUOA 4MLWA 3OX5A 1A29A 3EK8A 2CXJA 2K2AA 3F45A 4HREE 4OKHA 3ZNIA 1K9UA 4DCKA 1AJ5A 4MRXA 1N0YA 3SG2A 1F54A 3LK0A 1BOCA 3CS1A 1RWYA 1PSBA 1BJFA 1FBVA 1K96A 1NCZA 1KSMA 1DVIA 1LINA 1PVAA 1BR4B 3VRQA 1DF0B 1S5GY 2HPSA 2I7AA 1XYDA 3KO0A 2ISDA 2KNEA 2FCEA 1CLLA 1M46A 4NDBA 3TUYB 4E68A 1YRTB 4GNKB 2IS9A 1J7QA 1FI5A 1SNLA 3OX6A 2KBMA 5GQQC 1B9AA 2KGBC 4OCIA 1TN4A 1J7OA 4AQIA 4M2PA 1MXLC 2E30A 3BUOB 2K7CA 1BMOA 1CMGA 1UHHA 1ALWA 1LXFC 1WY9A 1XK4A 1HT9A 1V1FA 2ZNDA 4C0KA 2KFFA 1IQ5A 1QV1A 1K94A 2GGMA 3I5FB 4JPZB 3WHUB 4DS7A 1QLKA 2H61A 4PHNA 1F4OA 2BBMA 2JRFA 2KGRA 3OHMB 1X02A 3PFVA 1SPYA 2OS8B 5HKWA 3SJSA 2AAOA 1IG5A 2K0JA 1XVJA 5IBWA 2ZFDA 2BBNA 1AP4A 1OE9B 5HKZA 1NX1A 4XJKB 4YGEB 1SCVA 2LANA 1B8CA 2CCMA 4F0ZB 1DTLA 1SY9A 2M49B 2NLNA 2LAPA 2BCAA 1S26D 1SR6C 3EVUA 1M31A 1QATA 2LUCA 3QRXA 4ORAB 1RJVA 1YURA 1W7IB 1KFUL 2JXLA 2I94A 3CR2A 1DJGA 2F33A 2KAXA 1K90D 1S6CA 1WRZA 1U5IB 2F8PA 2Y4QA 1CDLA 1XFZO 1OOJA 2L5XB 4I5JA 4Q04A 1A2XA 4XJKA 4YGCB 1QVIY 1KQMB 5HLVA 1H8BA 2LCPA 2M0RA 4WQ2A 1S3PA 1UHNA 1QX2A 2EGDA 3EK7A 4AQJA 5CSNA 1M39A 2B1UA 3EK4A 3EVVA 1TNWA 1PRWA 1GGZA 2OTGB 2KAYA 1QLSA 1AHRA 4WQ3A 1B8RA 2BL0C 2KQ6A 1CB1A 3WXAA 1S5GZ 2MJWB 2BL0B 4GBAA 2QPTA 1OMDA 2K61A 3SG7A 4P5OE 1ZMZA 1FPWA 2KI4C 1SR6B 4C0LA 2LMVA 4BY4A 3PN7C 4MBEA 3O78A 2PVBA 2JT8A 1CLBA 2ZRTA 1DGVA 3NSIA 5CSFA 3DVEA 5D69A 2ZNEA 5K89A 2PMYA 1NPQA 5AXIA 3DVMA 1H4BA 1C7WA 1XFWO 2KFHA 1JF0A 4PCWA 3SG6A 2M9GA 2WNDA 2LE9B 1RECA 2JT0A 3O2PA 2Y1NA 2JNFA 1XFXO 1FI6A 1M45A 1SKTA 1EG4A 2WORA 3AAKA 4MSPA 3GOFA 1G33A 2OTGC 3WNXB 4HRHA 2LP3A 2Y5IA 1YTZC 2L4IA 1J7RA 4WRIA 1CKKA 2M3WA 3TS5B 1KWOB 2HQ8A 4NDDA 1NCYA 2WOSA 1F70A 1KK8B 1TTXA 2M97A 3TS5C 4GGNA 3SG4A 2KYCA 2M8UA 2BECA 3I5GC 3GK4X 1KQVA 2EHBA 1SYMA 1JF2A 1EG3A 1QTXA 1AUIB 1A75B 2K8MB 1JWDA 1B7TY 3A8RA 1OMRA 4GGFC 2F2PA 1OZSA 3TDIA 1UUSA 1YX8A 1L2OC 3VRPA 1GJYA 3TZ1A 3A4UB 2K7DA 5I2LA 2PSRA 1KQMC 2D8NA 2E6WA 3JTDB 3O4YA 5DKQA
chains in the Genus database with same CATH superfamily
3N7HA 1QX7A 5ER5A 4N1GA 2F3ZA 3SIAA 1NUBA 1LKJA 2P71A 4FQOA 1WRLA 3FS7A 1DJXA 2KLEA 5I2OA 4M2OA 1N2DA 1OSAA 2V53A 1TNXA 3SG3A 1BU3A 1SL9A 4F7FA 4GUKA 3SG5A 3NSOA 1F55A 2OS8C 3WHTB 1QWVA 3KHEA 1DC1A 1KWOC 3NGVA 4I5LB 5PALA 2LMTA 2FOTA 2HETA 1Y6WA 2M1KB 3CLNA 3I5IC 2ZN8A 3IF7A 3R1PA 5JOLA 4PT1A 4M2QA 4JD9A 2LLSA 2JXCA 4MN0A 3B87A 1ZOTB 1CNPA 1NX2A 3D0YA 1QVIZ 1WLZA 1NIWA 5BPJA 1C07A 1DMOA 3BUWB 1KFUS 2KAVA 1DJHA 3FWBA 5HKYA 4CFRA 4CFQA 1CMFA 2QEVA 3D10A 1L7ZA 1XK4C 2KYFA 2TN4A 3RLZA 4GGFA 4DUQA 2WCLA 1BF5A 1NP8A 3OBVA 3VRNA 1YRUB 1R2UA 3AAJA 4UPGA 1V1GA 1UP5A 1KCYA 1PULA 1OOHA 4CPVA 1A4PA 1CLMA 2KHNA 4PHMA 3EVRA 1BR1B 3HX4A 3JVTB 2H2KA 3I5FC 3O4XA 5G08A 3KPXA 1DJWA 3Q8IA 4A4CA 2M1UA 5DKNA 3UO9A 4IL1A 3I5IB 5HLOA 4MZLA 1DJYA 1KK7Z 2KSPA 4GAOA 5I94A 1XFVO 1DELA 3NHIA 1VRKA 2WCBA 1SL7A 4XYNA 5I8NA 2K7BA 3DZTA 1R6PA 3DD4A 2JTTA 3O6BA 2WCJA 3M0WA 2JWWA 2JNXA 2LLTA 2OPOA 3FE6A 1CTRA 3TDUA 4ORBB 1S36A 1J1DA 1Z2CB 2BE4A 2COLB 2LVJA 2KOTA 4YI8A 3VRRA 4I5KA 2M7NA 2MAZA 3BFAA 1K93D 2KI6C 1UHIA 3DY9A 2LLUA 5HKWA 2LHIA 1FF1A 4MVFA 2LHLA 1QXPA 2WCFA 3D77A 1F4QA 3LK1A 4C0JA 2MLEC 1AVSA 4D1EA 2CBLA 5HYDA 1IQ3A 2HQWA 1S6JA 2JPTA 1SK6D 3HCMA 3I5HC 3R1VA 3V2LA 1IJ5A 5CSJA 4N5XA 1B7TZ 1SCMC 3OP0A 2KFGA 3DVJA 1ALVA 1PSRA 4DRWA 1SCMB 5AANA 1QASA 2JTZA 1KK8C 1MR8A 1B47A 4YRUA 1IWQA 1U5IA 2ZKMX 4L9MA 1Y1UA 4FTGA 4I5NB 1TNQA 5B8IB 2K2FA 2MRDA 2PASA 2MA2A 1D1OA 3GK1A 2ERBA 2CNPA 4YBHB 3D0YB 2JZIA 1EXRA 1NCXA 2K60A 2SASA 3SS3A 1F71A 4IJ7A 4QJ5B 1QX5B 3B86A 1CFFA 4DIRA 3MSEB 2ZN9A 1WRKA 1L2OB 1RFJA 3BJHA 1JC2A 1BT6A 1IRJA 1K9KA 1IH0A 4PE4A 4R1EA 3JTDC 1IGVA 1DF0A 2GV5A 1T14A 3D76A 1OOIX 1W7JB 1YUSA 2JOJA 2KBIA 2Y1MA 3H4SE 3IVTA 4INWA 1EH2A 3K21A 2MLFC 3DXLA 1A03A 1K8UA 1SMGA 4A4BA 1UHKA 1NWDA 1OMVA 1ZUZA 2L4HA 2LM5A 3CR5X 3LL8B 3RM1A 3I5HB 1BG1A 4ORCB 1IKUA 5FYXA 3OB1B 3S0DA 5EL2A 1TOPA 3OB2B 5J3XA 4MEWA 1UURA 1Y1XA 1ZFSA 1WDCB 2F2OA 2JT3A 2LP2A 2R2IA 1QS7A 1DEKA 4OVNF 1LA3A 2NXQA 3BOWA 1WDCC 1MF8B 3S0GA 2WC8A 4GPLB 1OW4A 3LCPC 4BY5A 2H8VA 1QIWA 2DOQA 1YX7A 2L50A 3CWGA 1EL4A 1NX3A 3PN7B 1HQVA 2JC2A 2LVVA 4JWQA 1NSHA 1KK7Y 1YUTA 1CFDA 3GK2A 1J1EA 1EJ3A 3SIBA 4OR9B 2Q4UA 1DJIA 2LNKA 2L5YA 2O5GA 2WCEA 2LMUA 1QV0A 1P28A 3BUXB 4NQGA 1KSOA 2AMIA 4TNCA 1TIZA 4YGBB 1S6IA 1YUUA 5CSIA 3NHTA 4CLNA 1FW4A 2NZ0A 1MXEA 3CTNA 3ZWHA 2L98A 1PALA 1CDPA 3CR4X 3BUMB 1Y1AA 5KTYA 1BLQA 1IJ6A 1JBAA 1G4YR 3CZTX 2LC5A 4DCKA 2A4JA 3AKBA 2L2EA 2LV7A 1MQ1A 1LA0A 1WLMA 2SCPA 3CZ2A 4KYNA 1GQMA 4P2YB 3PALA 2L51A 2M29A 3DF0B 1QJTA 3KF9A 3NXAA 1B4CA 1TRFA 2Q91A 2MBXA 4HSZA 4PHKA 3TUYC 1CFPA 2KDHA 1JSAA 4HRGA 1JFJA 4OV2A 1YR5A 4U8DA 2BCBA 5JJGA 1Y0VH 1LVCD 2ZRSA 4PE1A 1OQPA 3CABA 4MZKA 2BAPA 4AOMA 4USLA 4YGDB 2BCXA 1NYAA 1CDNA 5FI7A 2PYQA 1RTP1 4ZCVA 1K95A 1JFKA 1UWOA 3IQOA 1NX0A 1TCFA 2PALA 4PDZA 1RK9A 1J7PA 5FI2A 1A75A 2AUCA 1DJZA 2GGZA 2RGIA 3JVTC 1GGWA 1B8LA 1B1GA 2JU0A 1ODBA 1MWNA 3D73A 2G2BA 4ETOA 1DGUA 2KPHA 3R72A 1XFRA 2YGUA 4JQ0D 2FJUB 1K2HA 5ER4X 4FQTA 1IIOA 4MZJA 1ZACA 2KI4B 4QJ4B 2HF5A 3ICBA 5I2QA 3OGNA 2I2RE 3EG5B 2I18A 1PK0D 3PM8A 1N65A 2LVIA 3RZSA 2NCOA 4PALA 2BKIB 2CT9A 3BOWB 4QJ3B 3BYAA 5AERA 4OZDA 1BODA 4YGAA 1YVHA 1SRAA 3CZ1A 5D3OA 1SSEB 1CFCA 4PE0A 3DF0A 5F6TA 4N1FA 1CDMA 2QACA 1KFXS 4JKTA 1RROA 2KLDA 3PSRA 4PE7A 3KEVA 2MHHA 3B7AA 5KU1A 1TNPA 4MRYA 1CM4A 1DT7B 2EC6C 2PQLA 3E3RA 4CIDA 2O60A 2H61C 2L0PA 2FCDA 2JULA 3C1VA 2NCPA 1YVLA 1QIVA 3FE9A 5KSZA 1KFXL 1UHJA 3DVKA 2M7LA 4NDCA 1F8HA 3S0EA 1J55A 2FJYA 1XO5A 2F3YA 3VROA 3NSKA 1E8AA 1MUXA 1Z4HA 2BKHB 1S1EA 1C3YA 3PATA 1C7VA 3I5GB 1XFYO 4PHJA 4GFTA 2GTEA 1XFUO 1K9PA 1OZOA 2JQ6A 1Q80A 2G9BA 3VGOA 3FWCA 3EKHA 1SW8A 5D7FA 2LUXA 3EKJA 3PLFB 5AFPA 1G8IA 1SBJA 2LVKA 3TDZA 2PRUA 1XA5A 3FE8A 3BXKA 2VRGA 5AEQA 1CM1A 5CPVA 4ICBA 4ZCUA 1SL8A 2CTNA 2P6BB 3BUNB 4YI9A 5TNCA 3BQ3A 2KI6D 3IQQA 3AKAA 3D74A 3NSLA 1PVBA 2KQYA 1TCOB 1M63B 3FIAA 1MHOA 5DKRA 2BE6A 3LLEA 3CGAA 1AJ4A 3S0AA 1AK8A 3L47A 3S0BA 2EC6B 2K7OA 2WC6A 1JUOA 4MLWA 3OX5A 1A29A 3EK8A 2CXJA 2K2AA 3F45A 4HREE 1OOFA 4OKHA 1K9UA 3ZNIA 1AJ5A 4MRXA 3VB1A 1N0YA 3SG2A 1F54A 1ORGA 3LK0A 1BOCA 3CS1A 1RWYA 3CZ0A 1PSBA 1BJFA 1FBVA 1K96A 2BNXA 3B6XA 1NCZA 1KSMA 1DVIA 1LINA 1PVAA 5DICA 1BR4B 3VRQA 1DF0B 1S5GY 2HPSA 2I7AA 1XYDA 3KO0A 2ISDA 2KNEA 2FCEA 1CLLA 1M46A 4NDBA 3TUYB 4E68A 1YRTB 4GNKB 2IS9A 1J7QA 1FI5A 1SNLA 3OX6A 2KBMA 5GQQC 3D78A 1B9AA 2KGBC 4OCIA 1TN4A 1J7OA 4AQIA 4M2PA 1MXLC 2E30A 3SS5A 3BUOB 2K7CA 1BMOA 2WCHA 1CMGA 1UHHA 1ALWA 1LXFC 1WY9A 1XK4A 1HT9A 1V1FA 2ZNDA 4C0KA 2KFFA 1IQ5A 1QV1A 1K94A 2GGMA 3I5FB 4JPZB 3WHUB 3R1OA 4DS7A 1QLKA 2H61A 4PHNA 1F4OA 2BBMA 2JRFA 2KGRA 1OOGA 3OHMB 1X02A 3PFVA 1SPYA 2OS8B 2WCKA 1W9ZA 2AAOA 1IG5A 2K0JA 1TUZA 3SJSA 1TUJA 1XVJA 5HL1A 2QDIA 5IBWA 2ZFDA 2BBNA 1AP4A 1OE9B 5HKZA 1NX1A 4XJKB 4YGEB 3K1EA 1SCVA 3CYZA 2LANA 1B8CA 2CCMA 4F0ZB 1DTLA 1SY9A 2M49B 2NLNA 2LAPA 3S0FA 2BCAA 1S26D 1SR6C 3EVUA 1M31A 1QATA 2LUCA 3QRXA 4ORAB 1RJVA 1YURA 1W7IB 1KFUL 2JXLA 3CDNA 2I94A 3CR2A 1DJGA 2F33A 2KAXA 1K90D 1S6CA 1WRZA 1U5IB 2F8PA 2Y4QA 1CDLA 1XFZO 3L4LA 1OOJA 2L5XB 4I5JA 4Q04A 1A2XA 4XJKA 4YGCB 1QVIY 1KQMB 5HLVA 1LS8A 1H8BA 2LCPA 2M0RA 4WQ2A 1S3PA 1UHNA 1QX2A 2EGDA 3EK7A 2WC5A 5CSNA 4AQJA 1M39A 2B1UA 3EK4A 3EVVA 1TNWA 1PRWA 1GGZA 2OTGB 2KAYA 3SS4A 1QLSA 1AHRA 4WQ3A 1B8RA 2BL0C 2KQ6A 1CB1A 3QMEA 1S5GZ 2MJWB 3WXAA 2BL0B 4GBAA 2QPTA 1OMDA 2K61A 4INXA 3SG7A 2L2CA 4P5OE 3PJIA 1ZMZA 1FPWA 3BFBA 3D75A 2KI4C 1SR6B 4C0LA 2LMVA 2QEOA 4BY4A 3PN7C 4MBEA 3O78A 2PVBA 2JT8A 1CLBA 3BFHA 2ZRTA 3DYEA 1DGVA 3NSIA 5CSFA 2WCMA 3DVEA 5D69A 2ZNEA 5K89A 2QEBA 2PMYA 1NPQA 2JPOA 3DVMA 5AXIA 1H4BA 1DQEA 1C7WA 1XFWO 2KFHA 1JF0A 4PCWA 3SG6A 2M9GA 1TWOA 2WNDA 2LE9B 1RECA 2JT0A 2QEHA 3O2PA 2Y1NA 2JNFA 1XFXO 1FI6A 1M45A 1SKTA 1EG4A 2WORA 3AAKA 4MSPA 3GOFA 1G33A 2OTGC 2P70A 3WNXB 4HRHA 2LP3A 2Y5IA 1YTZC 2L4IA 1J7RA 4WRIA 1CKKA 2M3WA 3TS5B 1KWOB 2HQ8A 4NDDA 1NCYA 2WOSA 1F70A 1KK8B 3B88A 1TTXA 2M97A 3TS5C 4GGNA 3SG4A 2KYCA 2M8UA 2BECA 3I5GC 3GK4X 1KQVA 3L4AA 2EHBA 3UNWA 1SYMA 1JF2A 1EG3A 1QTXA 1AUIB 1A75B 2K8MB 3PM2A 1JWDA 1B7TY 3A8RA 1OMRA 4GGFC 1OZSA 2F2PA 5FI6A 3TDIA 1UUSA 1YX8A 1L2OC 3VRPA 1GJYA 3TZ1A 3A4UB 2K7DA 5I2LA 2PSRA 1KQMC 2D8NA 2E6WA 1GM0A 3JTDB 3O4YA 1C3ZA 5DKQA
chains in the Genus database with same CATH topology
1QX7A 5ER5A 4N1GA 2F3ZA 3SIAA 1NUBA 1LKJA 4FQOA 1WRLA 3FS7A 1DJXA 5I2OA 4M2OA 1N2DA 1OSAA 2V53A 1TNXA 3SG3A 1BU3A 1SL9A 4GUKA 3SG5A 3NSOA 1F55A 2OS8C 3WHTB 3KHEA 1KWOC 4I5LB 5PALA 2LMTA 2FOTA 2HETA 1Y6WA 2M1KB 3CLNA 3I5IC 2ZN8A 3IF7A 5JOLA 4M2QA 2LLSA 2JXCA 4MN0A 1ZOTB 1CNPA 1NX2A 3D0YA 1QVIZ 1WLZA 1NIWA 5BPJA 1C07A 1DMOA 3BUWB 1KFUS 2KAVA 1DJHA 3FWBA 5HKYA 4CFRA 4CFQA 1CMFA 3D10A 1L7ZA 1XK4C 2KYFA 2TN4A 3RLZA 4GGFA 4DUQA 1BF5A 1NP8A 3VRNA 1YRUB 1R2UA 3AAJA 4UPGA 1V1GA 1UP5A 1KCYA 1PULA 4CPVA 1A4PA 1CLMA 2KHNA 4PHMA 3EVRA 1BR1B 3HX4A 3JVTB 2H2KA 3I5FC 5G08A 3KPXA 1DJWA 4A4CA 2M1UA 5DKNA 4IL1A 3I5IB 5HLOA 4MZLA 1DJYA 1KK7Z 2KSPA 4GAOA 1XFVO 1VRKA 2WCBA 1SL7A 4XYNA 5I8NA 2K7BA 1R6PA 3DD4A 2JTTA 3O6BA 3M0WA 2JWWA 2JNXA 2LLTA 2OPOA 1CTRA 3TDUA 4ORBB 1S36A 1J1DA 2BE4A 2COLB 2LVJA 2KOTA 4YI8A 3VRRA 4I5KA 2M7NA 2MAZA 1K93D 2KI6C 1UHIA 2LLUA 2LHIA 1FF1A 4MVFA 2LHLA 1QXPA 2WCFA 4C0JA 1F4QA 3LK1A 1IQ3A 2MLEC 1AVSA 4D1EA 2CBLA 5HYDA 2HQWA 1S6JA 2JPTA 1SK6D 3HCMA 3I5HC 1IJ5A 5CSJA 4N5XA 1B7TZ 1SCMC 3OP0A 2KFGA 3DVJA 1ALVA 1PSRA 4DRWA 1SCMB 5AANA 1QASA 2JTZA 1KK8C 1MR8A 1B47A 4YRUA 1IWQA 1U5IA 2ZKMX 4L9MA 1Y1UA 4FTGA 4I5NB 1TNQA 5B8IB 2K2FA 2MRDA 2PASA 2MA2A 1D1OA 3GK1A 2CNPA 4YBHB 3D0YB 2JZIA 1EXRA 1NCXA 2SASA 1F71A 4QJ5B 1QX5B 1CFFA 4DIRA 3MSEB 2ZN9A 1WRKA 1L2OB 1RFJA 1JC2A 1BT6A 1IRJA 1K9KA 1IH0A 4PE4A 4R1EA 3JTDC 1IGVA 1DF0A 2GV5A 1W7JB 1YUSA 2JOJA 2KBIA 2Y1MA 3H4SE 1EH2A 3K21A 2MLFC 1A03A 1K8UA 1SMGA 4A4BA 1UHKA 1NWDA 1OMVA 1ZUZA 2L4HA 2LM5A 3CR5X 3LL8B 3RM1A 3I5HB 1BG1A 4ORCB 1IKUA 5FYXA 3OB1B 1TOPA 3OB2B 5J3XA 4MEWA 1UURA 1Y1XA 1ZFSA 1WDCB 2F2OA 2JT3A 2LP2A 2R2IA 1QS7A 4OVNF 1LA3A 2NXQA 3BOWA 1WDCC 1MF8B 2WC8A 4GPLB 3LCPC 4BY5A 1QIWA 2DOQA 1YX7A 2L50A 3CWGA 1EL4A 1NX3A 3PN7B 1HQVA 2JC2A 2LVVA 4JWQA 1NSHA 1KK7Y 1YUTA 1CFDA 3GK2A 1J1EA 1EJ3A 3SIBA 4OR9B 2Q4UA 1DJIA 2LNKA 2O5GA 2WCEA 2LMUA 1QV0A 3BUXB 4NQGA 1KSOA 2AMIA 4TNCA 1TIZA 4YGBB 1S6IA 1YUUA 5CSIA 4CLNA 1FW4A 2NZ0A 1MXEA 3CTNA 3ZWHA 2L98A 1PALA 1CDPA 3CR4X 3BUMB 1Y1AA 5KTYA 1BLQA 1IJ6A 1JBAA 1G4YR 3CZTX 2LC5A 2A4JA 3AKBA 2L2EA 2LV7A 1MQ1A 1LA0A 1WLMA 2SCPA 1GQMA 4P2YB 3PALA 2L51A 2M29A 3DF0B 1QJTA 3KF9A 3NXAA 1B4CA 1TRFA 2Q91A 2MBXA 4HSZA 4PHKA 3TUYC 1CFPA 2KDHA 1JSAA 4HRGA 1JFJA 4OV2A 1YR5A 4U8DA 2BCBA 5JJGA 1Y0VH 1LVCD 2ZRSA 4PE1A 1OQPA 4MZKA 4AOMA 4USLA 4YGDB 2BCXA 1NYAA 1CDNA 4ZCVA 1RTP1 1K95A 1JFKA 1UWOA 3IQOA 1NX0A 1TCFA 2PALA 4PDZA 1RK9A 1J7PA 1A75A 2AUCA 2GGZA 1DJZA 2RGIA 3JVTC 1GGWA 1B8LA 1B1GA 2JU0A 1ODBA 1MWNA 2G2BA 4ETOA 1DGUA 4JQ0D 2FJUB 1K2HA 5ER4X 4MZJA 1ZACA 2KI4B 4QJ4B 2HF5A 3ICBA 5I2QA 2I2RE 2I18A 1PK0D 3PM8A 1N65A 2LVIA 2NCOA 4PALA 2BKIB 2CT9A 3BOWB 4QJ3B 3BYAA 5AERA 1BODA 4YGAA 1YVHA 1SRAA 1CFCA 4PE0A 3DF0A 5F6TA 4N1FA 1CDMA 2QACA 1KFXS 1RROA 3PSRA 4PE7A 3KEVA 2MHHA 5KU1A 1TNPA 4MRYA 1CM4A 1DT7B 2EC6C 3E3RA 4CIDA 2O60A 2H61C 2L0PA 2FCDA 2JULA 3C1VA 2NCPA 1YVLA 1QIVA 5KSZA 1KFXL 1UHJA 3DVKA 2M7LA 4NDCA 1F8HA 1J55A 3VROA 1XO5A 2F3YA 3NSKA 1E8AA 1MUXA 2BKHB 1S1EA 3PATA 1C7VA 3I5GB 1XFYO 4PHJA 4GFTA 1XFUO 1K9PA 1OZOA 2JQ6A 1Q80A 2G9BA 3VGOA 3FWCA 3EKHA 1SW8A 5D7FA 2LUXA 3EKJA 3PLFB 5AFPA 1G8IA 1SBJA 2LVKA 3TDZA 2PRUA 1XA5A 3BXKA 2VRGA 5AEQA 1CM1A 5CPVA 4ICBA 4ZCUA 1SL8A 2CTNA 2P6BB 3BUNB 4YI9A 5TNCA 3BQ3A 2KI6D 3IQQA 3AKAA 3NSLA 1PVBA 2KQYA 1TCOB 1M63B 3FIAA 1MHOA 5DKRA 2BE6A 3LLEA 3CGAA 1AJ4A 1AK8A 2EC6B 2K7OA 1JUOA 4MLWA 3OX5A 1A29A 3EK8A 2CXJA 2K2AA 3F45A 4HREE 4OKHA 3ZNIA 1K9UA 4DCKA 1AJ5A 4MRXA 1N0YA 3SG2A 1F54A 3LK0A 1BOCA 3CS1A 1RWYA 1PSBA 1BJFA 1FBVA 1K96A 1NCZA 1KSMA 1DVIA 1LINA 1PVAA 1BR4B 3VRQA 1DF0B 1S5GY 2HPSA 2I7AA 1XYDA 3KO0A 2ISDA 2KNEA 2FCEA 1CLLA 1M46A 4NDBA 3TUYB 4E68A 1YRTB 4GNKB 2IS9A 1J7QA 1FI5A 1SNLA 3OX6A 2KBMA 5GQQC 1B9AA 2KGBC 4OCIA 1TN4A 1J7OA 4AQIA 4M2PA 1MXLC 2E30A 3BUOB 2K7CA 1BMOA 1CMGA 1UHHA 1ALWA 1LXFC 1WY9A 1XK4A 1HT9A 1V1FA 2ZNDA 4C0KA 2KFFA 1IQ5A 1QV1A 1K94A 2GGMA 3I5FB 4JPZB 3WHUB 4DS7A 1QLKA 2H61A 4PHNA 1F4OA 2BBMA 2JRFA 2KGRA 3OHMB 1X02A 3PFVA 1SPYA 2OS8B 5HKWA 3SJSA 2AAOA 1IG5A 2K0JA 1XVJA 5IBWA 2ZFDA 2BBNA 1AP4A 1OE9B 5HKZA 1NX1A 4XJKB 4YGEB 1SCVA 2LANA 1B8CA 2CCMA 4F0ZB 1DTLA 1SY9A 2M49B 2NLNA 2LAPA 2BCAA 1S26D 1SR6C 3EVUA 1M31A 1QATA 2LUCA 3QRXA 4ORAB 1RJVA 1YURA 1W7IB 1KFUL 2JXLA 2I94A 3CR2A 1DJGA 2F33A 2KAXA 1K90D 1S6CA 1WRZA 1U5IB 2F8PA 2Y4QA 1CDLA 1XFZO 1OOJA 2L5XB 4I5JA 4Q04A 1A2XA 4XJKA 4YGCB 1QVIY 1KQMB 5HLVA 1H8BA 2LCPA 2M0RA 4WQ2A 1S3PA 1UHNA 1QX2A 2EGDA 3EK7A 4AQJA 5CSNA 1M39A 2B1UA 3EK4A 3EVVA 1TNWA 1PRWA 1GGZA 2OTGB 2KAYA 1QLSA 1AHRA 4WQ3A 1B8RA 2BL0C 2KQ6A 1CB1A 3WXAA 1S5GZ 2MJWB 2BL0B 4GBAA 2QPTA 1OMDA 2K61A 3SG7A 4P5OE 1ZMZA 1FPWA 2KI4C 1SR6B 4C0LA 2LMVA 4BY4A 3PN7C 4MBEA 3O78A 2PVBA 2JT8A 1CLBA 2ZRTA 1DGVA 3NSIA 5CSFA 3DVEA 5D69A 2ZNEA 5K89A 2PMYA 1NPQA 5AXIA 3DVMA 1H4BA 1C7WA 1XFWO 2KFHA 1JF0A 4PCWA 3SG6A 2M9GA 2WNDA 2LE9B 1RECA 2JT0A 3O2PA 2Y1NA 2JNFA 1XFXO 1FI6A 1M45A 1SKTA 1EG4A 2WORA 3AAKA 4MSPA 3GOFA 1G33A 2OTGC 3WNXB 4HRHA 2LP3A 2Y5IA 1YTZC 2L4IA 1J7RA 4WRIA 1CKKA 2M3WA 3TS5B 1KWOB 2HQ8A 4NDDA 1NCYA 2WOSA 1F70A 1KK8B 1TTXA 2M97A 3TS5C 4GGNA 3SG4A 2KYCA 2M8UA 2BECA 3I5GC 3GK4X 1KQVA 2EHBA 1SYMA 1JF2A 1EG3A 1QTXA 1AUIB 1A75B 2K8MB 1JWDA 1B7TY 3A8RA 1OMRA 4GGFC 2F2PA 1OZSA 3TDIA 1UUSA 1YX8A 1L2OC 3VRPA 1GJYA 3TZ1A 3A4UB 2K7DA 5I2LA 2PSRA 1KQMC 2D8NA 2E6WA 3JTDB 3O4YA 5DKQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QX7 A;  5ER5 A;  4N1G A;  2F3Z A;  3SIA A;  1NUB A;  1LKJ A;  4FQO A;  1WRL A;  3FS7 A;  1DJX A;  5I2O A;  4M2O A;  1N2D A;  1OSA A;  2V53 A;  1TNX A;  3SG3 A;  1BU3 A;  1SL9 A;  4GUK A;  3SG5 A;  3NSO A;  1F55 A;  2OS8 C;  3WHT B;  3KHE A;  1KWO C;  4I5L B;  5PAL A;  2LMT A;  2FOT A;  2HET A;  1Y6W A;  2M1K B;  3CLN A;  3I5I C;  2ZN8 A;  3IF7 A;  5JOL A;  4M2Q A;  2LLS A;  2JXC A;  4MN0 A;  1ZOT B;  1CNP A;  1NX2 A;  3D0Y A;  1QVI Z;  1WLZ A;  1NIW A;  5BPJ A;  1C07 A;  1DMO A;  3BUW B;  1KFU S;  2KAV A;  1DJH A;  3FWB A;  5HKY A;  4CFR A;  4CFQ A;  1CMF A;  3D10 A;  1L7Z A;  1XK4 C;  2KYF A;  2TN4 A;  3RLZ A;  4GGF A;  4DUQ A;  1BF5 A;  1NP8 A;  3VRN A;  1YRU B;  1R2U A;  3AAJ A;  4UPG A;  1V1G A;  1UP5 A;  1KCY A;  1PUL A;  4CPV A;  1A4P A;  1CLM A;  2KHN A;  4PHM A;  3EVR A;  1BR1 B;  3HX4 A;  3JVT B;  2H2K A;  3I5F C;  5G08 A;  3KPX A;  1DJW A;  4A4C A;  2M1U A;  5DKN A;  4IL1 A;  3I5I B;  5HLO A;  4MZL A;  1DJY A;  1KK7 Z;  2KSP A;  4GAO A;  1XFV O;  1VRK A;  2WCB A;  1SL7 A;  4XYN A;  5I8N A;  2K7B A;  1R6P A;  3DD4 A;  2JTT A;  3O6B A;  3M0W A;  2JWW A;  2JNX A;  2LLT A;  2OPO A;  1CTR A;  3TDU A;  4ORB B;  1S36 A;  1J1D A;  2BE4 A;  2COL B;  2LVJ A;  2KOT A;  4YI8 A;  3VRR A;  4I5K A;  2M7N A;  2MAZ A;  1K93 D;  2KI6 C;  1UHI A;  2LLU A;  2LHI A;  1FF1 A;  4MVF A;  2LHL A;  1QXP A;  2WCF A;  4C0J A;  1F4Q A;  3LK1 A;  1IQ3 A;  2MLE C;  1AVS A;  4D1E A;  2CBL A;  5HYD A;  2HQW A;  1S6J A;  2JPT A;  1SK6 D;  3HCM A;  3I5H C;  1IJ5 A;  5CSJ A;  4N5X A;  1B7T Z;  1SCM C;  3OP0 A;  2KFG A;  3DVJ A;  1ALV A;  1PSR A;  4DRW A;  1SCM B;  5AAN A;  1QAS A;  2JTZ A;  1KK8 C;  1MR8 A;  1B47 A;  4YRU A;  1IWQ A;  1U5I A;  2ZKM X;  4L9M A;  1Y1U A;  4FTG A;  4I5N B;  1TNQ A;  5B8I B;  2K2F A;  2MRD A;  2PAS A;  2MA2 A;  1D1O A;  3GK1 A;  2CNP A;  4YBH B;  3D0Y B;  2JZI A;  1EXR A;  1NCX A;  2SAS A;  1F71 A;  4QJ5 B;  1QX5 B;  1CFF A;  4DIR A;  3MSE B;  2ZN9 A;  1WRK A;  1L2O B;  1RFJ A;  1JC2 A;  1BT6 A;  1IRJ A;  1K9K A;  1IH0 A;  4PE4 A;  4R1E A;  3JTD C;  1IGV A;  1DF0 A;  2GV5 A;  1W7J B;  1YUS A;  2JOJ A;  2KBI A;  2Y1M A;  3H4S E;  1EH2 A;  3K21 A;  2MLF C;  1A03 A;  1K8U A;  1SMG A;  4A4B A;  1UHK A;  1NWD A;  1OMV A;  1ZUZ A;  2L4H A;  2LM5 A;  3CR5 X;  3LL8 B;  3RM1 A;  3I5H B;  1BG1 A;  4ORC B;  1IKU A;  5FYX A;  3OB1 B;  1TOP A;  3OB2 B;  5J3X A;  4MEW A;  1UUR A;  1Y1X A;  1ZFS A;  1WDC B;  2F2O A;  2JT3 A;  2LP2 A;  2R2I A;  1QS7 A;  4OVN F;  1LA3 A;  2NXQ A;  3BOW A;  1WDC C;  1MF8 B;  2WC8 A;  4GPL B;  3LCP C;  4BY5 A;  1QIW A;  2DOQ A;  1YX7 A;  2L50 A;  3CWG A;  1EL4 A;  1NX3 A;  3PN7 B;  1HQV A;  2JC2 A;  2LVV A;  4JWQ A;  1NSH A;  1KK7 Y;  1YUT A;  1CFD A;  3GK2 A;  1J1E A;  1EJ3 A;  3SIB A;  4OR9 B;  2Q4U A;  1DJI A;  2LNK A;  2O5G A;  2WCE A;  2LMU A;  1QV0 A;  3BUX B;  4NQG A;  1KSO A;  2AMI A;  4TNC A;  1TIZ A;  4YGB B;  1S6I A;  1YUU A;  5CSI A;  4CLN A;  1FW4 A;  2NZ0 A;  1MXE A;  3CTN A;  3ZWH A;  2L98 A;  1PAL A;  1CDP A;  3CR4 X;  3BUM B;  1Y1A A;  5KTY A;  1BLQ A;  1IJ6 A;  1JBA A;  1G4Y R;  3CZT X;  2LC5 A;  2A4J A;  3AKB A;  2L2E A;  2LV7 A;  1MQ1 A;  1LA0 A;  1WLM A;  2SCP A;  1GQM A;  4P2Y B;  3PAL A;  2L51 A;  2M29 A;  3DF0 B;  1QJT A;  3KF9 A;  3NXA A;  1B4C A;  1TRF A;  2Q91 A;  2MBX A;  4HSZ A;  4PHK A;  3TUY C;  1CFP A;  2KDH A;  1JSA A;  4HRG A;  1JFJ A;  4OV2 A;  1YR5 A;  4U8D A;  2BCB A;  5JJG A;  1Y0V H;  1LVC D;  2ZRS A;  4PE1 A;  1OQP A;  4MZK A;  4AOM A;  4USL A;  4YGD B;  2BCX A;  1NYA A;  1CDN A;  4ZCV A;  1RTP 1;  1K95 A;  1JFK A;  1UWO A;  3IQO A;  1NX0 A;  1TCF A;  2PAL A;  4PDZ A;  1RK9 A;  1J7P A;  1A75 A;  2AUC A;  2GGZ A;  1DJZ A;  2RGI A;  3JVT C;  1GGW A;  1B8L A;  1B1G A;  2JU0 A;  1ODB A;  1MWN A;  2G2B A;  4ETO A;  1DGU A;  4JQ0 D;  2FJU B;  1K2H A;  5ER4 X;  4MZJ A;  1ZAC A;  2KI4 B;  4QJ4 B;  2HF5 A;  3ICB A;  5I2Q A;  2I2R E;  2I18 A;  1PK0 D;  3PM8 A;  1N65 A;  2LVI A;  2NCO A;  4PAL A;  2BKI B;  2CT9 A;  3BOW B;  4QJ3 B;  3BYA A;  5AER A;  1BOD A;  4YGA A;  1YVH A;  1SRA A;  1CFC A;  4PE0 A;  3DF0 A;  5F6T A;  4N1F A;  1CDM A;  2QAC A;  1KFX S;  1RRO A;  3PSR A;  4PE7 A;  3KEV A;  2MHH A;  5KU1 A;  1TNP A;  4MRY A;  1CM4 A;  1DT7 B;  2EC6 C;  3E3R A;  4CID A;  2O60 A;  2H61 C;  2L0P A;  2FCD A;  2JUL A;  3C1V A;  2NCP A;  1YVL A;  1QIV A;  5KSZ A;  1KFX L;  1UHJ A;  3DVK A;  2M7L A;  4NDC A;  1F8H A;  1J55 A;  3VRO A;  1XO5 A;  2F3Y A;  3NSK A;  1E8A A;  1MUX A;  2BKH B;  1S1E A;  3PAT A;  1C7V A;  3I5G B;  1XFY O;  4PHJ A;  4GFT A;  1XFU O;  1K9P A;  1OZO A;  2JQ6 A;  1Q80 A;  2G9B A;  3VGO A;  3FWC A;  3EKH A;  1SW8 A;  5D7F A;  2LUX A;  3EKJ A;  3PLF B;  5AFP A;  1G8I A;  1SBJ A;  2LVK A;  3TDZ A;  2PRU A;  1XA5 A;  3BXK A;  2VRG A;  5AEQ A;  1CM1 A;  5CPV A;  4ICB A;  4ZCU A;  1SL8 A;  2CTN A;  2P6B B;  3BUN B;  4YI9 A;  5TNC A;  3BQ3 A;  2KI6 D;  3IQQ A;  3AKA A;  3NSL A;  1PVB A;  2KQY A;  1TCO B;  1M63 B;  3FIA A;  1MHO A;  5DKR A;  2BE6 A;  3LLE A;  3CGA A;  1AJ4 A;  1AK8 A;  2EC6 B;  2K7O A;  1JUO A;  4MLW A;  3OX5 A;  1A29 A;  3EK8 A;  2CXJ A;  2K2A A;  3F45 A;  4HRE E;  4OKH A;  3ZNI A;  1K9U A;  4DCK A;  1AJ5 A;  4MRX A;  1N0Y A;  3SG2 A;  1F54 A;  3LK0 A;  1BOC A;  3CS1 A;  1RWY A;  1PSB A;  1BJF A;  1FBV A;  1K96 A;  1NCZ A;  1KSM A;  1DVI A;  1LIN A;  1PVA A;  1BR4 B;  3VRQ A;  1DF0 B;  1S5G Y;  2HPS A;  2I7A A;  1XYD A;  3KO0 A;  2ISD A;  2KNE A;  2FCE A;  1CLL A;  1M46 A;  4NDB A;  3TUY B;  4E68 A;  1YRT B;  4GNK B;  2IS9 A;  1J7Q A;  1FI5 A;  1SNL A;  3OX6 A;  2KBM A;  5GQQ C;  1B9A A;  2KGB C;  4OCI A;  1TN4 A;  1J7O A;  4AQI A;  4M2P A;  1MXL C;  2E30 A;  3BUO B;  2K7C A;  1BMO A;  1CMG A;  1UHH A;  1ALW A;  1LXF C;  1WY9 A;  1XK4 A;  1HT9 A;  1V1F A;  2ZND A;  4C0K A;  2KFF A;  1IQ5 A;  1QV1 A;  1K94 A;  2GGM A;  3I5F B;  4JPZ B;  3WHU B;  4DS7 A;  1QLK A;  2H61 A;  4PHN A;  1F4O A;  2BBM A;  2JRF A;  2KGR A;  3OHM B;  1X02 A;  3PFV A;  1SPY A;  2OS8 B;  5HKW A;  3SJS A;  2AAO A;  1IG5 A;  2K0J A;  1XVJ A;  5IBW A;  2ZFD A;  2BBN A;  1AP4 A;  1OE9 B;  5HKZ A;  1NX1 A;  4XJK B;  4YGE B;  1SCV A;  2LAN A;  1B8C A;  2CCM A;  4F0Z B;  1DTL A;  1SY9 A;  2M49 B;  2NLN A;  2LAP A;  2BCA A;  1S26 D;  1SR6 C;  3EVU A;  1M31 A;  1QAT A;  2LUC A;  3QRX A;  4ORA B;  1RJV A;  1YUR A;  1W7I B;  1KFU L;  2JXL A;  2I94 A;  3CR2 A;  1DJG A;  2F33 A;  2KAX A;  1K90 D;  1S6C A;  1WRZ A;  1U5I B;  2F8P A;  2Y4Q A;  1CDL A;  1XFZ O;  1OOJ A;  2L5X B;  4I5J A;  4Q04 A;  1A2X A;  4XJK A;  4YGC B;  1QVI Y;  1KQM B;  5HLV A;  1H8B A;  2LCP A;  2M0R A;  4WQ2 A;  1S3P A;  1UHN A;  1QX2 A;  2EGD A;  3EK7 A;  4AQJ A;  5CSN A;  1M39 A;  2B1U A;  3EK4 A;  3EVV A;  1TNW A;  1PRW A;  1GGZ A;  2OTG B;  2KAY A;  1QLS A;  1AHR A;  4WQ3 A;  1B8R A;  2BL0 C;  2KQ6 A;  1CB1 A;  3WXA A;  1S5G Z;  2MJW B;  2BL0 B;  4GBA A;  2QPT A;  1OMD A;  2K61 A;  3SG7 A;  4P5O E;  1ZMZ A;  1FPW A;  2KI4 C;  1SR6 B;  4C0L A;  2LMV A;  4BY4 A;  3PN7 C;  4MBE A;  3O78 A;  2PVB A;  2JT8 A;  1CLB A;  2ZRT A;  1DGV A;  3NSI A;  5CSF A;  3DVE A;  5D69 A;  2ZNE A;  5K89 A;  2PMY A;  1NPQ A;  5AXI A;  3DVM A;  1H4B A;  1C7W A;  1XFW O;  2KFH A;  1JF0 A;  4PCW A;  3SG6 A;  2M9G A;  2WND A;  2LE9 B;  1REC A;  2JT0 A;  3O2P A;  2Y1N A;  2JNF A;  1XFX O;  1FI6 A;  1M45 A;  1SKT A;  1EG4 A;  2WOR A;  3AAK A;  4MSP A;  3GOF A;  1G33 A;  2OTG C;  3WNX B;  4HRH A;  2LP3 A;  2Y5I A;  1YTZ C;  2L4I A;  1J7R A;  4WRI A;  1CKK A;  2M3W A;  3TS5 B;  1KWO B;  2HQ8 A;  4NDD A;  1NCY A;  2WOS A;  1F70 A;  1KK8 B;  1TTX A;  2M97 A;  3TS5 C;  4GGN A;  3SG4 A;  2KYC A;  2M8U A;  2BEC A;  3I5G C;  3GK4 X;  1KQV A;  2EHB A;  1SYM A;  1JF2 A;  1EG3 A;  1QTX A;  1AUI B;  1A75 B;  2K8M B;  1JWD A;  1B7T Y;  3A8R A;  1OMR A;  4GGF C;  2F2P A;  1OZS A;  3TDI A;  1UUS A;  1YX8 A;  1L2O C;  3VRP A;  1GJY A;  3TZ1 A;  3A4U B;  2K7D A;  5I2L A;  2PSR A;  1KQM C;  2D8N A;  2E6W A;  3JTD B;  3O4Y A;  5DKQ A; 
#chains in the Genus database with same CATH topology
 3N7H A;  1QX7 A;  5ER5 A;  4N1G A;  2F3Z A;  3SIA A;  1NUB A;  1LKJ A;  2P71 A;  4FQO A;  1WRL A;  3FS7 A;  1DJX A;  2KLE A;  5I2O A;  4M2O A;  1N2D A;  1OSA A;  2V53 A;  1TNX A;  3SG3 A;  1BU3 A;  1SL9 A;  4F7F A;  4GUK A;  3SG5 A;  3NSO A;  1F55 A;  2OS8 C;  3WHT B;  1QWV A;  3KHE A;  1DC1 A;  1KWO C;  3NGV A;  4I5L B;  5PAL A;  2LMT A;  2FOT A;  2HET A;  1Y6W A;  2M1K B;  3CLN A;  3I5I C;  2ZN8 A;  3IF7 A;  3R1P A;  5JOL A;  4PT1 A;  4M2Q A;  4JD9 A;  2LLS A;  2JXC A;  4MN0 A;  3B87 A;  1ZOT B;  1CNP A;  1NX2 A;  3D0Y A;  1QVI Z;  1WLZ A;  1NIW A;  5BPJ A;  1C07 A;  1DMO A;  3BUW B;  1KFU S;  2KAV A;  1DJH A;  3FWB A;  5HKY A;  4CFR A;  4CFQ A;  1CMF A;  2QEV A;  3D10 A;  1L7Z A;  1XK4 C;  2KYF A;  2TN4 A;  3RLZ A;  4GGF A;  4DUQ A;  2WCL A;  1BF5 A;  1NP8 A;  3OBV A;  3VRN A;  1YRU B;  1R2U A;  3AAJ A;  4UPG A;  1V1G A;  1UP5 A;  1KCY A;  1PUL A;  1OOH A;  4CPV A;  1A4P A;  1CLM A;  2KHN A;  4PHM A;  3EVR A;  1BR1 B;  3HX4 A;  3JVT B;  2H2K A;  3I5F C;  3O4X A;  5G08 A;  3KPX A;  1DJW A;  3Q8I A;  4A4C A;  2M1U A;  5DKN A;  3UO9 A;  4IL1 A;  3I5I B;  5HLO A;  4MZL A;  1DJY A;  1KK7 Z;  2KSP A;  4GAO A;  5I94 A;  1XFV O;  1DEL A;  3NHI A;  1VRK A;  2WCB A;  1SL7 A;  4XYN A;  5I8N A;  2K7B A;  3DZT A;  1R6P A;  3DD4 A;  2JTT A;  3O6B A;  2WCJ A;  3M0W A;  2JWW A;  2JNX A;  2LLT A;  2OPO A;  3FE6 A;  1CTR A;  3TDU A;  4ORB B;  1S36 A;  1J1D A;  1Z2C B;  2BE4 A;  2COL B;  2LVJ A;  2KOT A;  4YI8 A;  3VRR A;  4I5K A;  2M7N A;  2MAZ A;  3BFA A;  1K93 D;  2KI6 C;  1UHI A;  3DY9 A;  2LLU A;  5HKW A;  2LHI A;  1FF1 A;  4MVF A;  2LHL A;  1QXP A;  2WCF A;  3D77 A;  1F4Q A;  3LK1 A;  4C0J A;  2MLE C;  1AVS A;  4D1E A;  2CBL A;  5HYD A;  1IQ3 A;  2HQW A;  1S6J A;  2JPT A;  1SK6 D;  3HCM A;  3I5H C;  3R1V A;  3V2L A;  1IJ5 A;  5CSJ A;  4N5X A;  1B7T Z;  1SCM C;  3OP0 A;  2KFG A;  3DVJ A;  1ALV A;  1PSR A;  4DRW A;  1SCM B;  5AAN A;  1QAS A;  2JTZ A;  1KK8 C;  1MR8 A;  1B47 A;  4YRU A;  1IWQ A;  1U5I A;  2ZKM X;  4L9M A;  1Y1U A;  4FTG A;  4I5N B;  1TNQ A;  5B8I B;  2K2F A;  2MRD A;  2PAS A;  2MA2 A;  1D1O A;  3GK1 A;  2ERB A;  2CNP A;  4YBH B;  3D0Y B;  2JZI A;  1EXR A;  1NCX A;  2K60 A;  2SAS A;  3SS3 A;  1F71 A;  4IJ7 A;  4QJ5 B;  1QX5 B;  3B86 A;  1CFF A;  4DIR A;  3MSE B;  2ZN9 A;  1WRK A;  1L2O B;  1RFJ A;  3BJH A;  1JC2 A;  1BT6 A;  1IRJ A;  1K9K A;  1IH0 A;  4PE4 A;  4R1E A;  3JTD C;  1IGV A;  1DF0 A;  2GV5 A;  1T14 A;  3D76 A;  1OOI X;  1W7J B;  1YUS A;  2JOJ A;  2KBI A;  2Y1M A;  3H4S E;  3IVT A;  4INW A;  1EH2 A;  3K21 A;  2MLF C;  3DXL A;  1A03 A;  1K8U A;  1SMG A;  4A4B A;  1UHK A;  1NWD A;  1OMV A;  1ZUZ A;  2L4H A;  2LM5 A;  3CR5 X;  3LL8 B;  3RM1 A;  3I5H B;  1BG1 A;  4ORC B;  1IKU A;  5FYX A;  3OB1 B;  3S0D A;  5EL2 A;  1TOP A;  3OB2 B;  5J3X A;  4MEW A;  1UUR A;  1Y1X A;  1ZFS A;  1WDC B;  2F2O A;  2JT3 A;  2LP2 A;  2R2I A;  1QS7 A;  1DEK A;  4OVN F;  1LA3 A;  2NXQ A;  3BOW A;  1WDC C;  1MF8 B;  3S0G A;  2WC8 A;  4GPL B;  1OW4 A;  3LCP C;  4BY5 A;  2H8V A;  1QIW A;  2DOQ A;  1YX7 A;  2L50 A;  3CWG A;  1EL4 A;  1NX3 A;  3PN7 B;  1HQV A;  2JC2 A;  2LVV A;  4JWQ A;  1NSH A;  1KK7 Y;  1YUT A;  1CFD A;  3GK2 A;  1J1E A;  1EJ3 A;  3SIB A;  4OR9 B;  2Q4U A;  1DJI A;  2LNK A;  2L5Y A;  2O5G A;  2WCE A;  2LMU A;  1QV0 A;  1P28 A;  3BUX B;  4NQG A;  1KSO A;  2AMI A;  4TNC A;  1TIZ A;  4YGB B;  1S6I A;  1YUU A;  5CSI A;  3NHT A;  4CLN A;  1FW4 A;  2NZ0 A;  1MXE A;  3CTN A;  3ZWH A;  2L98 A;  1PAL A;  1CDP A;  3CR4 X;  3BUM B;  1Y1A A;  5KTY A;  1BLQ A;  1IJ6 A;  1JBA A;  1G4Y R;  3CZT X;  2LC5 A;  4DCK A;  2A4J A;  3AKB A;  2L2E A;  2LV7 A;  1MQ1 A;  1LA0 A;  1WLM A;  2SCP A;  3CZ2 A;  4KYN A;  1GQM A;  4P2Y B;  3PAL A;  2L51 A;  2M29 A;  3DF0 B;  1QJT A;  3KF9 A;  3NXA A;  1B4C A;  1TRF A;  2Q91 A;  2MBX A;  4HSZ A;  4PHK A;  3TUY C;  1CFP A;  2KDH A;  1JSA A;  4HRG A;  1JFJ A;  4OV2 A;  1YR5 A;  4U8D A;  2BCB A;  5JJG A;  1Y0V H;  1LVC D;  2ZRS A;  4PE1 A;  1OQP A;  3CAB A;  4MZK A;  2BAP A;  4AOM A;  4USL A;  4YGD B;  2BCX A;  1NYA A;  1CDN A;  5FI7 A;  2PYQ A;  1RTP 1;  4ZCV A;  1K95 A;  1JFK A;  1UWO A;  3IQO A;  1NX0 A;  1TCF A;  2PAL A;  4PDZ A;  1RK9 A;  1J7P A;  5FI2 A;  1A75 A;  2AUC A;  1DJZ A;  2GGZ A;  2RGI A;  3JVT C;  1GGW A;  1B8L A;  1B1G A;  2JU0 A;  1ODB A;  1MWN A;  3D73 A;  2G2B A;  4ETO A;  1DGU A;  2KPH A;  3R72 A;  1XFR A;  2YGU A;  4JQ0 D;  2FJU B;  1K2H A;  5ER4 X;  4FQT A;  1IIO A;  4MZJ A;  1ZAC A;  2KI4 B;  4QJ4 B;  2HF5 A;  3ICB A;  5I2Q A;  3OGN A;  2I2R E;  3EG5 B;  2I18 A;  1PK0 D;  3PM8 A;  1N65 A;  2LVI A;  3RZS A;  2NCO A;  4PAL A;  2BKI B;  2CT9 A;  3BOW B;  4QJ3 B;  3BYA A;  5AER A;  4OZD A;  1BOD A;  4YGA A;  1YVH A;  1SRA A;  3CZ1 A;  5D3O A;  1SSE B;  1CFC A;  4PE0 A;  3DF0 A;  5F6T A;  4N1F A;  1CDM A;  2QAC A;  1KFX S;  4JKT A;  1RRO A;  2KLD A;  3PSR A;  4PE7 A;  3KEV A;  2MHH A;  3B7A A;  5KU1 A;  1TNP A;  4MRY A;  1CM4 A;  1DT7 B;  2EC6 C;  2PQL A;  3E3R A;  4CID A;  2O60 A;  2H61 C;  2L0P A;  2FCD A;  2JUL A;  3C1V A;  2NCP A;  1YVL A;  1QIV A;  3FE9 A;  5KSZ A;  1KFX L;  1UHJ A;  3DVK A;  2M7L A;  4NDC A;  1F8H A;  3S0E A;  1J55 A;  2FJY A;  1XO5 A;  2F3Y A;  3VRO A;  3NSK A;  1E8A A;  1MUX A;  1Z4H A;  2BKH B;  1S1E A;  1C3Y A;  3PAT A;  1C7V A;  3I5G B;  1XFY O;  4PHJ A;  4GFT A;  2GTE A;  1XFU O;  1K9P A;  1OZO A;  2JQ6 A;  1Q80 A;  2G9B A;  3VGO A;  3FWC A;  3EKH A;  1SW8 A;  5D7F A;  2LUX A;  3EKJ A;  3PLF B;  5AFP A;  1G8I A;  1SBJ A;  2LVK A;  3TDZ A;  2PRU A;  1XA5 A;  3FE8 A;  3BXK A;  2VRG A;  5AEQ A;  1CM1 A;  5CPV A;  4ICB A;  4ZCU A;  1SL8 A;  2CTN A;  2P6B B;  3BUN B;  4YI9 A;  5TNC A;  3BQ3 A;  2KI6 D;  3IQQ A;  3AKA A;  3D74 A;  3NSL A;  1PVB A;  2KQY A;  1TCO B;  1M63 B;  3FIA A;  1MHO A;  5DKR A;  2BE6 A;  3LLE A;  3CGA A;  1AJ4 A;  3S0A A;  1AK8 A;  3L47 A;  3S0B A;  2EC6 B;  2K7O A;  2WC6 A;  1JUO A;  4MLW A;  3OX5 A;  1A29 A;  3EK8 A;  2CXJ A;  2K2A A;  3F45 A;  4HRE E;  1OOF A;  4OKH A;  1K9U A;  3ZNI A;  1AJ5 A;  4MRX A;  3VB1 A;  1N0Y A;  3SG2 A;  1F54 A;  1ORG A;  3LK0 A;  1BOC A;  3CS1 A;  1RWY A;  3CZ0 A;  1PSB A;  1BJF A;  1FBV A;  1K96 A;  2BNX A;  3B6X A;  1NCZ A;  1KSM A;  1DVI A;  1LIN A;  1PVA A;  5DIC A;  1BR4 B;  3VRQ A;  1DF0 B;  1S5G Y;  2HPS A;  2I7A A;  1XYD A;  3KO0 A;  2ISD A;  2KNE A;  2FCE A;  1CLL A;  1M46 A;  4NDB A;  3TUY B;  4E68 A;  1YRT B;  4GNK B;  2IS9 A;  1J7Q A;  1FI5 A;  1SNL A;  3OX6 A;  2KBM A;  5GQQ C;  3D78 A;  1B9A A;  2KGB C;  4OCI A;  1TN4 A;  1J7O A;  4AQI A;  4M2P A;  1MXL C;  2E30 A;  3SS5 A;  3BUO B;  2K7C A;  1BMO A;  2WCH A;  1CMG A;  1UHH A;  1ALW A;  1LXF C;  1WY9 A;  1XK4 A;  1HT9 A;  1V1F A;  2ZND A;  4C0K A;  2KFF A;  1IQ5 A;  1QV1 A;  1K94 A;  2GGM A;  3I5F B;  4JPZ B;  3WHU B;  3R1O A;  4DS7 A;  1QLK A;  2H61 A;  4PHN A;  1F4O A;  2BBM A;  2JRF A;  2KGR A;  1OOG A;  3OHM B;  1X02 A;  3PFV A;  1SPY A;  2OS8 B;  2WCK A;  1W9Z A;  2AAO A;  1IG5 A;  2K0J A;  1TUZ A;  3SJS A;  1TUJ A;  1XVJ A;  5HL1 A;  2QDI A;  5IBW A;  2ZFD A;  2BBN A;  1AP4 A;  1OE9 B;  5HKZ A;  1NX1 A;  4XJK B;  4YGE B;  3K1E A;  1SCV A;  3CYZ A;  2LAN A;  1B8C A;  2CCM A;  4F0Z B;  1DTL A;  1SY9 A;  2M49 B;  2NLN A;  2LAP A;  3S0F A;  2BCA A;  1S26 D;  1SR6 C;  3EVU A;  1M31 A;  1QAT A;  2LUC A;  3QRX A;  4ORA B;  1RJV A;  1YUR A;  1W7I B;  1KFU L;  2JXL A;  3CDN A;  2I94 A;  3CR2 A;  1DJG A;  2F33 A;  2KAX A;  1K90 D;  1S6C A;  1WRZ A;  1U5I B;  2F8P A;  2Y4Q A;  1CDL A;  1XFZ O;  3L4L A;  1OOJ A;  2L5X B;  4I5J A;  4Q04 A;  1A2X A;  4XJK A;  4YGC B;  1QVI Y;  1KQM B;  5HLV A;  1LS8 A;  1H8B A;  2LCP A;  2M0R A;  4WQ2 A;  1S3P A;  1UHN A;  1QX2 A;  2EGD A;  3EK7 A;  2WC5 A;  5CSN A;  4AQJ A;  1M39 A;  2B1U A;  3EK4 A;  3EVV A;  1TNW A;  1PRW A;  1GGZ A;  2OTG B;  2KAY A;  3SS4 A;  1QLS A;  1AHR A;  4WQ3 A;  1B8R A;  2BL0 C;  2KQ6 A;  1CB1 A;  3QME A;  1S5G Z;  2MJW B;  3WXA A;  2BL0 B;  4GBA A;  2QPT A;  1OMD A;  2K61 A;  4INX A;  3SG7 A;  2L2C A;  4P5O E;  3PJI A;  1ZMZ A;  1FPW A;  3BFB A;  3D75 A;  2KI4 C;  1SR6 B;  4C0L A;  2LMV A;  2QEO A;  4BY4 A;  3PN7 C;  4MBE A;  3O78 A;  2PVB A;  2JT8 A;  1CLB A;  3BFH A;  2ZRT A;  3DYE A;  1DGV A;  3NSI A;  5CSF A;  2WCM A;  3DVE A;  5D69 A;  2ZNE A;  5K89 A;  2QEB A;  2PMY A;  1NPQ A;  2JPO A;  3DVM A;  5AXI A;  1H4B A;  1DQE A;  1C7W A;  1XFW O;  2KFH A;  1JF0 A;  4PCW A;  3SG6 A;  2M9G A;  1TWO A;  2WND A;  2LE9 B;  1REC A;  2JT0 A;  2QEH A;  3O2P A;  2Y1N A;  2JNF A;  1XFX O;  1FI6 A;  1M45 A;  1SKT A;  1EG4 A;  2WOR A;  3AAK A;  4MSP A;  3GOF A;  1G33 A;  2OTG C;  2P70 A;  3WNX B;  4HRH A;  2LP3 A;  2Y5I A;  1YTZ C;  2L4I A;  1J7R A;  4WRI A;  1CKK A;  2M3W A;  3TS5 B;  1KWO B;  2HQ8 A;  4NDD A;  1NCY A;  2WOS A;  1F70 A;  1KK8 B;  3B88 A;  1TTX A;  2M97 A;  3TS5 C;  4GGN A;  3SG4 A;  2KYC A;  2M8U A;  2BEC A;  3I5G C;  3GK4 X;  1KQV A;  3L4A A;  2EHB A;  3UNW A;  1SYM A;  1JF2 A;  1EG3 A;  1QTX A;  1AUI B;  1A75 B;  2K8M B;  3PM2 A;  1JWD A;  1B7T Y;  3A8R A;  1OMR A;  4GGF C;  1OZS A;  2F2P A;  5FI6 A;  3TDI A;  1UUS A;  1YX8 A;  1L2O C;  3VRP A;  1GJY A;  3TZ1 A;  3A4U B;  2K7D A;  5I2L A;  2PSR A;  1KQM C;  2D8N A;  2E6W A;  1GM0 A;  3JTD B;  3O4Y A;  1C3Z A;  5DKQ A; 
#chains in the Genus database with same CATH homology
 1QX7 A;  5ER5 A;  4N1G A;  2F3Z A;  3SIA A;  1NUB A;  1LKJ A;  4FQO A;  1WRL A;  3FS7 A;  1DJX A;  5I2O A;  4M2O A;  1N2D A;  1OSA A;  2V53 A;  1TNX A;  3SG3 A;  1BU3 A;  1SL9 A;  4GUK A;  3SG5 A;  3NSO A;  1F55 A;  2OS8 C;  3WHT B;  3KHE A;  1KWO C;  4I5L B;  5PAL A;  2LMT A;  2FOT A;  2HET A;  1Y6W A;  2M1K B;  3CLN A;  3I5I C;  2ZN8 A;  3IF7 A;  5JOL A;  4M2Q A;  2LLS A;  2JXC A;  4MN0 A;  1ZOT B;  1CNP A;  1NX2 A;  3D0Y A;  1QVI Z;  1WLZ A;  1NIW A;  5BPJ A;  1C07 A;  1DMO A;  3BUW B;  1KFU S;  2KAV A;  1DJH A;  3FWB A;  5HKY A;  4CFR A;  4CFQ A;  1CMF A;  3D10 A;  1L7Z A;  1XK4 C;  2KYF A;  2TN4 A;  3RLZ A;  4GGF A;  4DUQ A;  1BF5 A;  1NP8 A;  3VRN A;  1YRU B;  1R2U A;  3AAJ A;  4UPG A;  1V1G A;  1UP5 A;  1KCY A;  1PUL A;  4CPV A;  1A4P A;  1CLM A;  2KHN A;  4PHM A;  3EVR A;  1BR1 B;  3HX4 A;  3JVT B;  2H2K A;  3I5F C;  5G08 A;  3KPX A;  1DJW A;  4A4C A;  2M1U A;  5DKN A;  4IL1 A;  3I5I B;  5HLO A;  4MZL A;  1DJY A;  1KK7 Z;  2KSP A;  4GAO A;  1XFV O;  1VRK A;  2WCB A;  1SL7 A;  4XYN A;  5I8N A;  2K7B A;  1R6P A;  3DD4 A;  2JTT A;  3O6B A;  3M0W A;  2JWW A;  2JNX A;  2LLT A;  2OPO A;  1CTR A;  3TDU A;  4ORB B;  1S36 A;  1J1D A;  2BE4 A;  2COL B;  2LVJ A;  2KOT A;  4YI8 A;  3VRR A;  4I5K A;  2M7N A;  2MAZ A;  1K93 D;  2KI6 C;  1UHI A;  2LLU A;  2LHI A;  1FF1 A;  4MVF A;  2LHL A;  1QXP A;  2WCF A;  4C0J A;  1F4Q A;  3LK1 A;  1IQ3 A;  2MLE C;  1AVS A;  4D1E A;  2CBL A;  5HYD A;  2HQW A;  1S6J A;  2JPT A;  1SK6 D;  3HCM A;  3I5H C;  1IJ5 A;  5CSJ A;  4N5X A;  1B7T Z;  1SCM C;  3OP0 A;  2KFG A;  3DVJ A;  1ALV A;  1PSR A;  4DRW A;  1SCM B;  5AAN A;  1QAS A;  2JTZ A;  1KK8 C;  1MR8 A;  1B47 A;  4YRU A;  1IWQ A;  1U5I A;  2ZKM X;  4L9M A;  1Y1U A;  4FTG A;  4I5N B;  1TNQ A;  5B8I B;  2K2F A;  2MRD A;  2PAS A;  2MA2 A;  1D1O A;  3GK1 A;  2CNP A;  4YBH B;  3D0Y B;  2JZI A;  1EXR A;  1NCX A;  2SAS A;  1F71 A;  4QJ5 B;  1QX5 B;  1CFF A;  4DIR A;  3MSE B;  2ZN9 A;  1WRK A;  1L2O B;  1RFJ A;  1JC2 A;  1BT6 A;  1IRJ A;  1K9K A;  1IH0 A;  4PE4 A;  4R1E A;  3JTD C;  1IGV A;  1DF0 A;  2GV5 A;  1W7J B;  1YUS A;  2JOJ A;  2KBI A;  2Y1M A;  3H4S E;  1EH2 A;  3K21 A;  2MLF C;  1A03 A;  1K8U A;  1SMG A;  4A4B A;  1UHK A;  1NWD A;  1OMV A;  1ZUZ A;  2L4H A;  2LM5 A;  3CR5 X;  3LL8 B;  3RM1 A;  3I5H B;  1BG1 A;  4ORC B;  1IKU A;  5FYX A;  3OB1 B;  1TOP A;  3OB2 B;  5J3X A;  4MEW A;  1UUR A;  1Y1X A;  1ZFS A;  1WDC B;  2F2O A;  2JT3 A;  2LP2 A;  2R2I A;  1QS7 A;  4OVN F;  1LA3 A;  2NXQ A;  3BOW A;  1WDC C;  1MF8 B;  2WC8 A;  4GPL B;  3LCP C;  4BY5 A;  1QIW A;  2DOQ A;  1YX7 A;  2L50 A;  3CWG A;  1EL4 A;  1NX3 A;  3PN7 B;  1HQV A;  2JC2 A;  2LVV A;  4JWQ A;  1NSH A;  1KK7 Y;  1YUT A;  1CFD A;  3GK2 A;  1J1E A;  1EJ3 A;  3SIB A;  4OR9 B;  2Q4U A;  1DJI A;  2LNK A;  2O5G A;  2WCE A;  2LMU A;  1QV0 A;  3BUX B;  4NQG A;  1KSO A;  2AMI A;  4TNC A;  1TIZ A;  4YGB B;  1S6I A;  1YUU A;  5CSI A;  4CLN A;  1FW4 A;  2NZ0 A;  1MXE A;  3CTN A;  3ZWH A;  2L98 A;  1PAL A;  1CDP A;  3CR4 X;  3BUM B;  1Y1A A;  5KTY A;  1BLQ A;  1IJ6 A;  1JBA A;  1G4Y R;  3CZT X;  2LC5 A;  2A4J A;  3AKB A;  2L2E A;  2LV7 A;  1MQ1 A;  1LA0 A;  1WLM A;  2SCP A;  1GQM A;  4P2Y B;  3PAL A;  2L51 A;  2M29 A;  3DF0 B;  1QJT A;  3KF9 A;  3NXA A;  1B4C A;  1TRF A;  2Q91 A;  2MBX A;  4HSZ A;  4PHK A;  3TUY C;  1CFP A;  2KDH A;  1JSA A;  4HRG A;  1JFJ A;  4OV2 A;  1YR5 A;  4U8D A;  2BCB A;  5JJG A;  1Y0V H;  1LVC D;  2ZRS A;  4PE1 A;  1OQP A;  4MZK A;  4AOM A;  4USL A;  4YGD B;  2BCX A;  1NYA A;  1CDN A;  4ZCV A;  1RTP 1;  1K95 A;  1JFK A;  1UWO A;  3IQO A;  1NX0 A;  1TCF A;  2PAL A;  4PDZ A;  1RK9 A;  1J7P A;  1A75 A;  2AUC A;  2GGZ A;  1DJZ A;  2RGI A;  3JVT C;  1GGW A;  1B8L A;  1B1G A;  2JU0 A;  1ODB A;  1MWN A;  2G2B A;  4ETO A;  1DGU A;  4JQ0 D;  2FJU B;  1K2H A;  5ER4 X;  4MZJ A;  1ZAC A;  2KI4 B;  4QJ4 B;  2HF5 A;  3ICB A;  5I2Q A;  2I2R E;  2I18 A;  1PK0 D;  3PM8 A;  1N65 A;  2LVI A;  2NCO A;  4PAL A;  2BKI B;  2CT9 A;  3BOW B;  4QJ3 B;  3BYA A;  5AER A;  1BOD A;  4YGA A;  1YVH A;  1SRA A;  1CFC A;  4PE0 A;  3DF0 A;  5F6T A;  4N1F A;  1CDM A;  2QAC A;  1KFX S;  1RRO A;  3PSR A;  4PE7 A;  3KEV A;  2MHH A;  5KU1 A;  1TNP A;  4MRY A;  1CM4 A;  1DT7 B;  2EC6 C;  3E3R A;  4CID A;  2O60 A;  2H61 C;  2L0P A;  2FCD A;  2JUL A;  3C1V A;  2NCP A;  1YVL A;  1QIV A;  5KSZ A;  1KFX L;  1UHJ A;  3DVK A;  2M7L A;  4NDC A;  1F8H A;  1J55 A;  3VRO A;  1XO5 A;  2F3Y A;  3NSK A;  1E8A A;  1MUX A;  2BKH B;  1S1E A;  3PAT A;  1C7V A;  3I5G B;  1XFY O;  4PHJ A;  4GFT A;  1XFU O;  1K9P A;  1OZO A;  2JQ6 A;  1Q80 A;  2G9B A;  3VGO A;  3FWC A;  3EKH A;  1SW8 A;  5D7F A;  2LUX A;  3EKJ A;  3PLF B;  5AFP A;  1G8I A;  1SBJ A;  2LVK A;  3TDZ A;  2PRU A;  1XA5 A;  3BXK A;  2VRG A;  5AEQ A;  1CM1 A;  5CPV A;  4ICB A;  4ZCU A;  1SL8 A;  2CTN A;  2P6B B;  3BUN B;  4YI9 A;  5TNC A;  3BQ3 A;  2KI6 D;  3IQQ A;  3AKA A;  3NSL A;  1PVB A;  2KQY A;  1TCO B;  1M63 B;  3FIA A;  1MHO A;  5DKR A;  2BE6 A;  3LLE A;  3CGA A;  1AJ4 A;  1AK8 A;  2EC6 B;  2K7O A;  1JUO A;  4MLW A;  3OX5 A;  1A29 A;  3EK8 A;  2CXJ A;  2K2A A;  3F45 A;  4HRE E;  4OKH A;  3ZNI A;  1K9U A;  4DCK A;  1AJ5 A;  4MRX A;  1N0Y A;  3SG2 A;  1F54 A;  3LK0 A;  1BOC A;  3CS1 A;  1RWY A;  1PSB A;  1BJF A;  1FBV A;  1K96 A;  1NCZ A;  1KSM A;  1DVI A;  1LIN A;  1PVA A;  1BR4 B;  3VRQ A;  1DF0 B;  1S5G Y;  2HPS A;  2I7A A;  1XYD A;  3KO0 A;  2ISD A;  2KNE A;  2FCE A;  1CLL A;  1M46 A;  4NDB A;  3TUY B;  4E68 A;  1YRT B;  4GNK B;  2IS9 A;  1J7Q A;  1FI5 A;  1SNL A;  3OX6 A;  2KBM A;  5GQQ C;  1B9A A;  2KGB C;  4OCI A;  1TN4 A;  1J7O A;  4AQI A;  4M2P A;  1MXL C;  2E30 A;  3BUO B;  2K7C A;  1BMO A;  1CMG A;  1UHH A;  1ALW A;  1LXF C;  1WY9 A;  1XK4 A;  1HT9 A;  1V1F A;  2ZND A;  4C0K A;  2KFF A;  1IQ5 A;  1QV1 A;  1K94 A;  2GGM A;  3I5F B;  4JPZ B;  3WHU B;  4DS7 A;  1QLK A;  2H61 A;  4PHN A;  1F4O A;  2BBM A;  2JRF A;  2KGR A;  3OHM B;  1X02 A;  3PFV A;  1SPY A;  2OS8 B;  5HKW A;  3SJS A;  2AAO A;  1IG5 A;  2K0J A;  1XVJ A;  5IBW A;  2ZFD A;  2BBN A;  1AP4 A;  1OE9 B;  5HKZ A;  1NX1 A;  4XJK B;  4YGE B;  1SCV A;  2LAN A;  1B8C A;  2CCM A;  4F0Z B;  1DTL A;  1SY9 A;  2M49 B;  2NLN A;  2LAP A;  2BCA A;  1S26 D;  1SR6 C;  3EVU A;  1M31 A;  1QAT A;  2LUC A;  3QRX A;  4ORA B;  1RJV A;  1YUR A;  1W7I B;  1KFU L;  2JXL A;  2I94 A;  3CR2 A;  1DJG A;  2F33 A;  2KAX A;  1K90 D;  1S6C A;  1WRZ A;  1U5I B;  2F8P A;  2Y4Q A;  1CDL A;  1XFZ O;  1OOJ A;  2L5X B;  4I5J A;  4Q04 A;  1A2X A;  4XJK A;  4YGC B;  1QVI Y;  1KQM B;  5HLV A;  1H8B A;  2LCP A;  2M0R A;  4WQ2 A;  1S3P A;  1UHN A;  1QX2 A;  2EGD A;  3EK7 A;  4AQJ A;  5CSN A;  1M39 A;  2B1U A;  3EK4 A;  3EVV A;  1TNW A;  1PRW A;  1GGZ A;  2OTG B;  2KAY A;  1QLS A;  1AHR A;  4WQ3 A;  1B8R A;  2BL0 C;  2KQ6 A;  1CB1 A;  3WXA A;  1S5G Z;  2MJW B;  2BL0 B;  4GBA A;  2QPT A;  1OMD A;  2K61 A;  3SG7 A;  4P5O E;  1ZMZ A;  1FPW A;  2KI4 C;  1SR6 B;  4C0L A;  2LMV A;  4BY4 A;  3PN7 C;  4MBE A;  3O78 A;  2PVB A;  2JT8 A;  1CLB A;  2ZRT A;  1DGV A;  3NSI A;  5CSF A;  3DVE A;  5D69 A;  2ZNE A;  5K89 A;  2PMY A;  1NPQ A;  5AXI A;  3DVM A;  1H4B A;  1C7W A;  1XFW O;  2KFH A;  1JF0 A;  4PCW A;  3SG6 A;  2M9G A;  2WND A;  2LE9 B;  1REC A;  2JT0 A;  3O2P A;  2Y1N A;  2JNF A;  1XFX O;  1FI6 A;  1M45 A;  1SKT A;  1EG4 A;  2WOR A;  3AAK A;  4MSP A;  3GOF A;  1G33 A;  2OTG C;  3WNX B;  4HRH A;  2LP3 A;  2Y5I A;  1YTZ C;  2L4I A;  1J7R A;  4WRI A;  1CKK A;  2M3W A;  3TS5 B;  1KWO B;  2HQ8 A;  4NDD A;  1NCY A;  2WOS A;  1F70 A;  1KK8 B;  1TTX A;  2M97 A;  3TS5 C;  4GGN A;  3SG4 A;  2KYC A;  2M8U A;  2BEC A;  3I5G C;  3GK4 X;  1KQV A;  2EHB A;  1SYM A;  1JF2 A;  1EG3 A;  1QTX A;  1AUI B;  1A75 B;  2K8M B;  1JWD A;  1B7T Y;  3A8R A;  1OMR A;  4GGF C;  2F2P A;  1OZS A;  3TDI A;  1UUS A;  1YX8 A;  1L2O C;  3VRP A;  1GJY A;  3TZ1 A;  3A4U B;  2K7D A;  5I2L A;  2PSR A;  1KQM C;  2D8N A;  2E6W A;  3JTD B;  3O4Y A;  5DKQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...