1Y0VH

Crystal structure of anthrax edema factor (ef) in complex with calmodulin and pyrophosphate
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
146
structure length
146
Chain Sequence
b'AATEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMTAK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Calmodulin-sensitive adenylate cyclase
publication title Calcium-independent calmodulin binding and two-metal-ion catalytic mechanism of anthrax edema factor
pubmed doi rcsb
source organism Bacillus anthracis
molecule tags Lyase
total genus 27
structure length 146
sequence length 146
chains with identical sequence I, J, K, L, M
ec nomenclature
pdb deposition date 2004-11-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1y0vH01
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1y0vH02
4I5LB 4QJ3B 2K2FA 1XYDA 4BY4A 1RJVA 1Q80A 3I5GC 1FBVA 2BL0B 4I5JA 2KQ6A 1SL7A 1K93D 1XFUO 1XFXO 3JTDC 4E68A 1V1GA 1W7IB 4GBAA 1IH0A 1SR6B 4YI9A 3NSIA 2BCXA 1U5IB 1CB1A 1A2XA 2Y4QA 1WDCC 4GAOA 1GGWA 5I2LA 5AANA 5I2QA 1YUUA 5AEQA 3CZTX 1XVJA 3CR4X 3SIBA 4MBEA 1QVIZ 1NUBA 3BUXB 1XK4C 1KSMA 1JFKA 4MVFA 3WHUB 4HRGA 3BXKA 5GQQC 5KSZA 1B7TZ 1EL4A 3BYAA 2KHNA 1XFZO 3VGOA 1FPWA 2CBLA 1KWOC 1YR5A 4TNCA 1XO5A 1BT6A 2ZRTA 3KEVA 2MA2A 1M46A 3LCPC 1TNPA 2K7DA 3EVRA 1UP5A 2LM5A 5HKWA 3MSEB 3TDZA 1PSBA 3BUNB 3CR5X 1C7VA 1RK9A 1DGVA 1YX8A 1JWDA 2KGBC 4PALA 1SR6C 1B8LA 1M63B 1TOPA 3WHTB 4GGNA 1NP8A 4F0ZB 1MUXA 2BKHB 3FS7A 1Y1UA 1KFXS 2F8PA 1KQMC 3QRXA 1A75A 3GK1A 1QX5B 1WLMA 2K8MB 2VRGA 3GK2A 4OCIA 4CIDA 3KO0A 2H61C 2L0PA 1J7RA 3M0WA 5IBWA 4ZCVA 2RGIA 3EKHA 2PVBA 2O5GA 4AOMA 2HETA 1BMOA 1S6JA 2CNPA 4ETOA 2HF5A 4YGBB 2V53A 3VRQA 2I2RE 2JT0A 2KFGA 2SASA 5J3XA 1J7PA 1OE9B 2L2EA 2WNDA 2BCBA 3DF0B 3O2PA 5KTYA 2F33A 4XJKA 1N0YA 1DJWA 1S26D 2KI6C 2LMUA 2LLSA 2L5XB 1L2OC 3LLEA 3DF0A 1SW8A 1QLSA 4PHNA 3TS5B 3WXAA 4U8DA 2COLB 3AAKA 2MLFC 3H4SE 4GUKA 2LVKA 3ZNIA 1K94A 2JXCA 3FWBA 3I5GB 4MRXA 4YGCB 5I8NA 1JFJA 3AAJA 2WCEA 3JTDB 1W7JB 2LHLA 4ORCB 1OMDA 4CPVA 1Y6WA 3SG5A 2WORA 1E8AA 1TCOB 4P2YB 1B8CA 2LCPA 1CMFA 2LLTA 1F55A 1WDCB 3SG2A 1AHRA 1ALVA 3LK1A 4PHJA 1K9UA 1KFUL 1OSAA 1QX7A 5CPVA 2Q91A 3IQQA 2PRUA 1DF0A 1OMVA 4NDBA 1M45A 2I7AA 2JPTA 1QS7A 4CLNA 3D0YB 1DJYA 1FI5A 1MR8A 1DJHA 5ER5A 1XFWO 1AVSA 2F2OA 5B8IB 1DT7B 1ZOTB 1F4QA 3D10A 2OTGC 3OB1B 2AAOA 1Y1AA 1B1GA 4N1GA 2LHIA 2KAVA 1KWOB 2BE6A 2Y1MA 4R1EA 3ICBA 2K7CA 1N65A 2ZRSA 2LV7A 3DD4A 4GGFA 1M39A 3O6BA 2JZIA 1JC2A 1ZFSA 2JC2A 2DOQA 1ZMZA 1SRAA 3EKJA 4NDDA 1EG4A 1QLKA 3AKBA 2M9GA 2G2BA 3A8RA 1K9KA 2R2IA 2F2PA 4USLA 1YX7A 3PM8A 1OQPA 2JOJA 1IJ5A 1WY9A 2IS9A 2LMTA 2LUCA 3EVVA 1KQMB 1BODA 3O4YA 1OZOA 2MLEC 1J1DA 3CLNA 4GPLB 2HQWA 1PRWA 3TUYC 1CLBA 1DJZA 2L98A 3EK8A 1C7WA 1S5GY 4MRYA 3PATA 1PVAA 1DVIA 1SCMC 2ZFDA 1KK7Z 1CM4A 4GGFC 1R2UA 1YURA 5AERA 1TIZA 2KQYA 4JPZB 1DJXA 1IRJA 2KGRA 3BQ3A 1JF0A 1RTP1 2PSRA 5HLVA 3CWGA 1SCVA 2QACA 1CDNA 4MZKA 3JVTB 4D1EA 2PMYA 1FI6A 4HSZA 1NX1A 4DUQA 1SNLA 1PSRA 3SG7A 2JRFA 4YGDB 2L4HA 3GOFA 3GK4X 3O78A 5I2OA 1A75B 3FIAA 3PN7C 2M7LA 3NSLA 1S3PA 1L2OB 4OKHA 1S36A 1RFJA 1SL9A 3OP0A 4NDCA 2JWWA 1ODBA 1CFPA 2JNFA 1G8IA 4PE1A 3C1VA 1D1OA 1YVLA 3CS1A 1DJIA 5AFPA 4PHKA 1CFCA 3RLZA 2KYCA 4Q04A 1QXPA 2NZ0A 3LK0A 2OPOA 4BY5A 1GGZA 1LINA 2P6BB 5AXIA 2BKIB 4N5XA 3TDUA 1M31A 1R6PA 2MHHA 2WOSA 4ORAB 1ZACA 1N2DA 4XJKB 1CDPA 4I5NB 1AJ4A 1X02A 4AQIA 2WCFA 1BR1B 2LANA 1RECA 1OOJA 2LE9B 2E30A 1KFXL 3PALA 5HKYA 1TNWA 1K96A 3JVTC 1UHIA 2E6WA 1IG5A 1KK8B 2KBIA 1AK8A 3AKAA 2L4IA 2M3WA 4OV2A 2HPSA 2ISDA 4QJ5B 1OMRA 2KAYA 1SK6D 3IF7A 5D7FA 2MRDA 3F45A 1MXEA 4YI8A 3OX5A 3TZ1A 1IWQA 2FJUB 1K2HA 3FWCA 2LLUA 2OTGB 5BPJA 4PHMA 5D69A 4MSPA 1IQ5A 1YRTB 2M1KB 1KSOA 1G33A 2EGDA 2FCEA 3DVMA 2AMIA 2KSPA 3OB2B 3BOWA 4OR9B 4YGAA 1PULA 1B8RA 1QIVA 2EC6C 2KYFA 1DTLA 2GGZA 1H8BA 1QIWA 2NLNA 5K89A 2LVVA 1G4YR 4PE0A 1DF0B 1JSAA 2AUCA 1K8UA 1F4OA 2F3ZA 2K7OA 2ZN9A 5FYXA 2K2AA 1KFUS 1SKTA 1RROA 1OZSA 3PSRA 1YUSA 1NCZA 4GFTA 1HT9A 2LVJA 1QVIY 4AQJA 3OHMB 1WRLA 2HQ8A 1KK8C 2LAPA 2NCOA 4MZJA 2LUXA 3TUYB 2CCMA 3EK4A 2Y1NA 5DKQA 1A29A 1EH2A 1HQVA 2GV5A 4DCKA 2LP2A 1NCXA 1IGVA 2D8NA 1SCMB 2TN4A 1MXLC 1B7TY 1JBAA 1MF8B 1XFYO 1KCYA 4HRHA 4MZLA 2EHBA 1CDMA 2KFHA 3IQOA 3SIAA 1J7OA 2CT9A 1CMGA 1DGUA 1NIWA 1YRUB 2BBMA 1CFFA 1C07A 2JU0A 1CFDA 1TNXA 2FCDA 3E3RA 2KI4C 2ZN8A 2KDHA 3LL8B 1DMOA 3PN7B 4HREE 1S1EA 1SBJA 2M8UA 1LA3A 3I5IC 1AUIB 1F54A 2BE4A 3PFVA 4UPGA 4I5KA 1K95A 3RM1A 3KPXA 1KQVA 1YVHA 2LP3A 2BBNA 2M0RA 3CTNA 3I5FB 4P5OE 2KOTA 4XYNA 1IKUA 2L50A 3SG4A 1B4CA 5JOLA 1PK0D 1NSHA 2Q4UA 2K0JA 4WRIA 1SPYA 4CFQA 3VRNA 5G08A 3KF9A 4WQ2A 1H4BA 4N1FA 2WCBA 1NYAA 3I5HC 1BF5A 3K21A 2SCPA 1LXFC 3SG3A 1MHOA 2QPTA 1YTZC 2KBMA 5HYDA 4DS7A 2I18A 2M29A 1TN4A 2NXQA 2NCPA 2MBXA 4DRWA 5DKRA 1CM1A 1QV1A 3HX4A 2OS8C 1JUOA 1U5IA 2A4JA 1BG1A 1LKJA 4PCWA 3BUWB 3OX6A 4M2OA 5PALA 4WQ3A 4M2PA 1QX2A 3EK7A 3SG6A 3BUMB 5JJGA 3VRPA 2JTZA 2GGMA 1SMGA 2K61A 1L7ZA 2BECA 1TNQA 3CR2A 3DVKA 3I5FC 4PE7A 4YGEB 1UHJA 5F6TA 3DVEA 2H61A 1BR4B 3EVUA 4FTGA 4QJ4B 1SYMA 2I94A 2O60A 2EC6B 2M7NA 1WLZA 1CKKA 2BL0C 1UHKA 4M2QA 1B9AA 2Y5IA 5DKNA 1UUSA 1AP4A 1V1FA 1UHHA 1YUTA 1BU3A 1XFVO 1F71A 1S6CA 3NSKA 3VRRA 1BOCA 1QASA 1ALWA 2H2KA 2M1UA 1NCYA 1EJ3A 3KHEA 1Y1XA 4A4CA 4MEWA 1Y0VH 2LNKA 1BLQA 4CFRA 4PDZA 1QTXA 1B47A 2L51A 2ZKMX 1MQ1A 4NQGA 1LVCD 4YBHB 3ZWHA 3VROA 1NX3A 2JULA 3BOWB 1PVBA 1WRZA 3TDIA 1UWOA 1XA5A 1ZUZA 1S5GZ 5CSNA 1GJYA 2BCAA 1QV0A 4JWQA 5CSFA 5HLOA 1SY9A 1NX2A 2CTNA 5HKZA 4MN0A 2KAXA 5KU1A 1F8HA 1A03A 1TTXA 2KI6D 1NWDA 1IQ3A 3NSOA 1J1EA 2FOTA 2JXLA 1UURA 2KI4B 4YRUA 3NXAA 1J7QA 1QATA 3WNXB 1MWNA 2F3YA 2B1UA 3A4UB 1GQMA 3I5IB 5CSIA 1TRFA 1TCFA 1F70A 4ZCUA 1WRKA 2MAZA 2M97A 2ZNDA 1BJFA 2MJWB 1IJ6A 1K9PA 1FF1A 5ER4X 5CSJA 4OVNF 1PALA 2JT8A 2KFFA 1EG3A 4MLWA 1K90D 1CDLA 1S6IA 2G9BA 2K7BA 3HCMA 3SJSA 1KK7Y 3PLFB 2WC8A 1CLLA 2ZNEA 3I5HB 4ICBA 1RWYA 4A4BA 3DVJA 2JT3A 1NPQA 4IL1A 4C0KA 1FW4A 2M49B 4C0JA 2LMVA 2LC5A 1EXRA 2KNEA 2JNXA 2PALA 2LVIA 2JTTA 4FQOA 2JQ6A 4PE4A 2OS8B 1VRKA 3BUOB 3CGAA 4DIRA 1NX0A 1CLMA 4C0LA 1DJGA 1CTRA 1SL8A 1J55A 2PASA 5TNCA 4JQ0D 4ORBB 1A4PA 1AJ5A 1QJTA 2CXJA 3TS5C 1XK4A 1UHNA 1LA0A 3D0YA 1CNPA 1JF2A 4L9MA 4GNKB
chains in the Genus database with same CATH superfamily
4I5LB 4QJ3B 2K2FA 1XYDA 4BY4A 1RJVA 1Q80A 3I5GC 1FBVA 2BL0B 3BFAA 2KQ6A 1SL7A 1K93D 1XFUO 1XFXO 3JTDC 4I5JA 4E68A 1V1GA 1W7IB 4GBAA 3CZ2A 3N7HA 1IH0A 1SR6B 4YI9A 3CZ0A 3NSIA 2BCXA 1U5IB 3DZTA 1CB1A 1A2XA 1C3ZA 2Y4QA 1WDCC 4GAOA 5HL1A 1GGWA 5I2LA 5AANA 1W9ZA 5I2QA 1YUUA 3L47A 5AEQA 3CZTX 3OGNA 1XVJA 3CR4X 3SIBA 4MBEA 3V2LA 1QVIZ 2QEBA 1NUBA 3BUXB 1XK4C 1KSMA 1JFKA 4MVFA 3WHUB 4HRGA 3BXKA 5GQQC 5KSZA 3SS4A 1B7TZ 1EL4A 3BYAA 2KHNA 1XFZO 3VGOA 1FPWA 2CBLA 1KWOC 1YR5A 4TNCA 1XO5A 1BT6A 2ZRTA 3KEVA 2MA2A 1M46A 3LCPC 1TNPA 2K7DA 4INWA 3EVRA 3B87A 1UP5A 2LM5A 4KYNA 2QEOA 5HKWA 3MSEB 3Q8IA 3TDZA 1PSBA 3BUNB 3CR5X 1C7VA 1RK9A 1DGVA 1YX8A 1JWDA 2KGBC 4PALA 1SR6C 1B8LA 1M63B 1TOPA 3WHTB 4GGNA 1NP8A 4F0ZB 1MUXA 1DELA 2BKHB 3FS7A 1Y1UA 1KFXS 2F8PA 1KQMC 3QRXA 1A75A 3GK1A 2JPOA 1QX5B 1WLMA 2K8MB 2VRGA 3GK2A 3D78A 4OCIA 4CIDA 3KO0A 2H61C 2L0PA 1J7RA 3S0AA 3M0WA 5IBWA 4ZCVA 2RGIA 3EKHA 2PVBA 2O5GA 4AOMA 2HETA 1LS8A 1BMOA 1S6JA 2CNPA 4ETOA 2HF5A 3QMEA 3B6XA 3CABA 4YGBB 2V53A 3L4LA 3VRQA 2I2RE 2JT0A 2KFGA 2SASA 5J3XA 4OZDA 1OE9B 1J7PA 2L2EA 2WNDA 2BCBA 3DF0B 3R1PA 3O2PA 5KTYA 2F33A 4XJKA 3SS5A 1TWOA 1N0YA 1DJWA 1S26D 2KI6C 2LMUA 2LLSA 2L5XB 1L2OC 3LLEA 3O4XA 3DF0A 4IJ7A 1SW8A 1QLSA 4PHNA 3TS5B 3WXAA 4U8DA 2COLB 3AAKA 2MLFC 3H4SE 4GUKA 2LVKA 2QDIA 3ZNIA 1K94A 2JXCA 3FWBA 3I5GB 4MRXA 4YGCB 5I8NA 5I94A 1JFJA 3AAJA 2WCEA 3JTDB 1W7JB 2LHLA 4ORCB 2WCLA 1OMDA 3S0DA 1Y6WA 3SG5A 4CPVA 2WORA 1E8AA 1TCOB 4P2YB 1B8CA 2LCPA 1CMFA 2LLTA 1F55A 1WDCB 3DYEA 3SG2A 1AHRA 1ALVA 3LK1A 4PHJA 1K9UA 2KPHA 1KFUL 1OSAA 1QX7A 5CPVA 2Q91A 3IQQA 2PRUA 1DF0A 1OMVA 4NDBA 1M45A 2I7AA 2JPTA 1QS7A 4CLNA 3D0YB 1DJYA 1FI5A 1MR8A 3B88A 1DJHA 5ER5A 1XFWO 1AVSA 2F2OA 5B8IB 1DT7B 1ZOTB 1OW4A 1F4QA 3D10A 2OTGC 3SS3A 3OB1B 2AAOA 1Y1AA 1B1GA 4N1GA 2LHIA 2KAVA 1KWOB 2BE6A 2Y1MA 4R1EA 3ICBA 2K7CA 3CZ1A 1N65A 2ZRSA 2LV7A 3DD4A 4GGFA 1M39A 2WCHA 2JZIA 2P71A 3EG5B 1ZFSA 3O6BA 1JC2A 2JC2A 2DOQA 1ZMZA 1SRAA 3EKJA 4NDDA 1EG4A 1QLKA 2QEVA 3AKBA 1P28A 2M9GA 2G2BA 3A8RA 1K9KA 2R2IA 2F2PA 4USLA 1YX7A 3PM8A 1OQPA 2JOJA 1IJ5A 1WY9A 2IS9A 2LMTA 2LUCA 3EVVA 1KQMB 1BODA 3IVTA 3O4YA 1OZOA 2MLEC 1J1DA 3CLNA 4GPLB 2HQWA 3FE9A 1PRWA 3TUYC 1CLBA 1DJZA 3D75A 2L98A 3EK8A 1C7WA 1S5GY 4MRYA 3PATA 1PVAA 1DVIA 1SCMC 2ZFDA 1KK7Z 1CM4A 4GGFC 1R2UA 1SSEB 1YURA 3VB1A 5AERA 1TIZA 2KQYA 3DXLA 1DJXA 4JPZB 1IRJA 2L2CA 2KGRA 3BQ3A 1JF0A 2PQLA 1RTP1 2PSRA 5HLVA 3CWGA 2K60A 1SCVA 2QACA 1CDNA 4MZKA 3JVTB 4D1EA 2PMYA 1FI6A 4HSZA 1NX1A 4DUQA 1SNLA 1PSRA 3SG7A 2JRFA 4YGDB 2L4HA 2FJYA 3GOFA 3GK4X 3O78A 5I2OA 5DICA 1A75B 2BNXA 3FIAA 3PN7C 2M7LA 3NSLA 1S3PA 1L2OB 2QEHA 3PM2A 4OKHA 1S36A 1RFJA 1SL9A 3OP0A 4NDCA 2JWWA 1ODBA 1CFPA 2JNFA 1G8IA 4PE1A 4FQTA 3C1VA 1D1OA 1YVLA 3CS1A 3S0BA 1DJIA 3B7AA 5AFPA 4PHKA 1CFCA 3RLZA 2KYCA 4Q04A 1QXPA 1XFRA 2NZ0A 3LK0A 2OPOA 4BY5A 1GGZA 3UO9A 1LINA 2P6BB 5AXIA 2BKIB 4N5XA 3TDUA 1M31A 1R6PA 2MHHA 2WCKA 2WOSA 1ZACA 3D76A 4ORAB 1N2DA 4XJKB 1CDPA 4I5NB 1AJ4A 1X02A 4AQIA 2WCFA 1BR1B 2LANA 1RECA 1OOJA 2LE9B 2E30A 1KFXL 3PALA 5HKYA 1TNWA 4INXA 1K96A 3JVTC 3S0FA 1UHIA 3BJHA 2E6WA 1IG5A 1KK8B 2KBIA 2PYQA 1AK8A 3AKAA 2L4IA 2M3WA 4OV2A 2HPSA 2ISDA 4QJ5B 1OMRA 2KAYA 1SK6D 3IF7A 5D7FA 2MRDA 3F45A 1MXEA 4YI8A 3OX5A 3TZ1A 2WCMA 1IWQA 2FJUB 1K2HA 3FWCA 2LLUA 2OTGB 5BPJA 4PHMA 5D69A 4MSPA 1IQ5A 1YRTB 2M1KB 1KSOA 1G33A 2EGDA 2FCEA 1DQEA 2AMIA 2KSPA 3DVMA 3BOWA 3OB2B 4OR9B 2WC5A 1PULA 4YGAA 1B8RA 1QIVA 4F7FA 2EC6C 2KYFA 1DTLA 2GGZA 1H8BA 2GTEA 1QIWA 2NLNA 3K1EA 5K89A 2LVVA 2WCJA 1G4YR 4PE0A 1DF0B 1JSAA 2AUCA 3R72A 1K8UA 1F4OA 2F3ZA 2K7OA 2ZN9A 3L4AA 5FI6A 5FYXA 2K2AA 1KFUS 1SKTA 1RROA 1OZSA 3PSRA 1YUSA 1NCZA 4GFTA 1HT9A 1C3YA 2LVJA 3D74A 1QVIY 3D73A 4AQJA 3OHMB 1WRLA 2HQ8A 1KK8C 2LAPA 2NCOA 4MZJA 2LUXA 3S0GA 2CCMA 2P70A 3EK4A 2Y1NA 5DKQA 1A29A 3TUYB 1EH2A 1HQVA 2GV5A 3DY9A 4DCKA 2LP2A 1NCXA 2KLEA 1IGVA 2D8NA 1SCMB 2TN4A 1MXLC 3PJIA 1B7TY 3RZSA 1MF8B 1XFYO 1JBAA 1KCYA 4HRHA 4MZLA 2EHBA 1CDMA 2KFHA 3IQOA 3SIAA 1J7OA 2CT9A 1CMGA 1DGUA 1NIWA 1YRUB 1T14A 2BBMA 1CFFA 1C07A 2JU0A 1CFDA 1TNXA 2FCDA 3E3RA 2KI4C 2ZN8A 2KDHA 3LL8B 1DMOA 3PN7B 3FE8A 1S1EA 1SBJA 2M8UA 1LA3A 3I5IC 1AUIB 2BAPA 4HREE 1F54A 3UNWA 2BE4A 3PFVA 4UPGA 4I5KA 1K95A 3RM1A 3KPXA 3BFHA 1KQVA 1YVHA 2LP3A 2BBNA 2M0RA 3CTNA 3I5FB 4P5OE 2KOTA 4XYNA 1IKUA 2L50A 3SG4A 1B4CA 5JOLA 1PK0D 1NSHA 2Q4UA 2K0JA 4JD9A 4WRIA 3CYZA 1SPYA 4CFQA 3VRNA 5G08A 3KF9A 4WQ2A 1H4BA 2WC6A 4N1FA 1IIOA 2WCBA 1NYAA 3I5HC 1BF5A 3K21A 2SCPA 1LXFC 3SG3A 1MHOA 2QPTA 1YTZC 2KBMA 5HYDA 3R1VA 4DS7A 1DEKA 2I18A 2M29A 1TN4A 2NXQA 2NCPA 2MBXA 4DRWA 5DKRA 1DC1A 1ORGA 1CM1A 1OOIX 1QV1A 2OS8C 2YGUA 1JUOA 1U5IA 3HX4A 5FI2A 2A4JA 1BG1A 1LKJA 4PCWA 3BUWB 3OX6A 4M2OA 5PALA 4WQ3A 4M2PA 3S0EA 1QX2A 3EK7A 3SG6A 3BUMB 5JJGA 3VRPA 2JTZA 2GGMA 1SMGA 2K61A 1L7ZA 2BECA 1TNQA 3CR2A 3DVKA 3I5FC 4PE7A 4YGEB 1UHJA 5F6TA 3DVEA 2H61A 1BR4B 3EVUA 4FTGA 4QJ4B 1SYMA 2I94A 2KLDA 2O60A 2EC6B 2M7NA 1WLZA 1CKKA 1GM0A 2BL0C 1UHKA 4M2QA 1B9AA 2Y5IA 5DKNA 1UUSA 1AP4A 1V1FA 3NGVA 3NHTA 1UHHA 1YUTA 1BU3A 1XFVO 1F71A 1TUZA 3FE6A 1S6CA 1Z4HA 3NSKA 3VRRA 1BOCA 1QASA 1ALWA 1QWVA 2H2KA 3OBVA 2M1UA 1NCYA 1EJ3A 3NHIA 3KHEA 2H8VA 1Y1XA 4A4CA 4PT1A 4MEWA 1Y0VH 2LNKA 1BLQA 3B86A 4CFRA 4PDZA 1QTXA 1B47A 2L51A 2ZKMX 1MQ1A 4NQGA 1LVCD 4YBHB 3ZWHA 3VROA 1NX3A 2JULA 3BOWB 1PVBA 1WRZA 3TDIA 1UWOA 1XA5A 1ZUZA 3D77A 1S5GZ 5CSNA 1GJYA 2BCAA 1QV0A 4JWQA 5CSFA 5HLOA 1SY9A 4JKTA 1NX2A 1Z2CB 2CTNA 5HKZA 4MN0A 2KAXA 5KU1A 1F8HA 1A03A 1TTXA 2KI6D 1NWDA 1IQ3A 3NSOA 1J1EA 2FOTA 2JXLA 1UURA 2KI4B 4YRUA 3NXAA 1OOHA 1J7QA 1QATA 3WNXB 3R1OA 1MWNA 2F3YA 2B1UA 3A4UB 1GQMA 3I5IB 5CSIA 1TRFA 1TCFA 1F70A 4ZCUA 1WRKA 2MAZA 2M97A 2ZNDA 1BJFA 2MJWB 1IJ6A 1K9PA 1FF1A 2L5YA 5ER4X 5CSJA 4OVNF 1PALA 2JT8A 2KFFA 1EG3A 4MLWA 1K90D 1CDLA 1S6IA 2G9BA 2K7BA 3HCMA 3CDNA 3SJSA 1KK7Y 3PLFB 5D3OA 2WC8A 1CLLA 2ZNEA 3I5HB 4ICBA 1RWYA 4A4BA 3DVJA 2JT3A 1NPQA 4IL1A 5EL2A 1FW4A 2M49B 4C0KA 4C0JA 2LMVA 2LC5A 1TUJA 1EXRA 2KNEA 2JNXA 1OOGA 5FI7A 2PALA 2ERBA 2LVIA 2JTTA 4FQOA 2JQ6A 4PE4A 2OS8B 1VRKA 3BFBA 3BUOB 3CGAA 1NX0A 4DIRA 1CLMA 4C0LA 1DJGA 1CTRA 1SL8A 1J55A 2PASA 5TNCA 4JQ0D 4ORBB 1A4PA 1AJ5A 1QJTA 2CXJA 3TS5C 1XK4A 1UHNA 1LA0A 3D0YA 1OOFA 1CNPA 1JF2A 4L9MA 4GNKB
chains in the Genus database with same CATH topology
4I5LB 4QJ3B 2K2FA 1XYDA 4BY4A 1RJVA 1Q80A 3I5GC 1FBVA 2BL0B 4I5JA 2KQ6A 1SL7A 1K93D 1XFUO 1XFXO 3JTDC 4E68A 1V1GA 1W7IB 4GBAA 1IH0A 1SR6B 4YI9A 3NSIA 2BCXA 1U5IB 1CB1A 1A2XA 2Y4QA 1WDCC 4GAOA 1GGWA 5I2LA 5AANA 5I2QA 1YUUA 5AEQA 3CZTX 1XVJA 3CR4X 3SIBA 4MBEA 1QVIZ 1NUBA 3BUXB 1XK4C 1KSMA 1JFKA 4MVFA 3WHUB 4HRGA 3BXKA 5GQQC 5KSZA 1B7TZ 1EL4A 3BYAA 2KHNA 1XFZO 3VGOA 1FPWA 2CBLA 1KWOC 1YR5A 4TNCA 1XO5A 1BT6A 2ZRTA 3KEVA 2MA2A 1M46A 3LCPC 1TNPA 2K7DA 3EVRA 1UP5A 2LM5A 5HKWA 3MSEB 3TDZA 1PSBA 3BUNB 3CR5X 1C7VA 1RK9A 1DGVA 1YX8A 1JWDA 2KGBC 4PALA 1SR6C 1B8LA 1M63B 1TOPA 3WHTB 4GGNA 1NP8A 4F0ZB 1MUXA 2BKHB 3FS7A 1Y1UA 1KFXS 2F8PA 1KQMC 3QRXA 1A75A 3GK1A 1QX5B 1WLMA 2K8MB 2VRGA 3GK2A 4OCIA 4CIDA 3KO0A 2H61C 2L0PA 1J7RA 3M0WA 5IBWA 4ZCVA 2RGIA 3EKHA 2PVBA 2O5GA 4AOMA 2HETA 1BMOA 1S6JA 2CNPA 4ETOA 2HF5A 4YGBB 2V53A 3VRQA 2I2RE 2JT0A 2KFGA 2SASA 5J3XA 1J7PA 1OE9B 2L2EA 2WNDA 2BCBA 3DF0B 3O2PA 5KTYA 2F33A 4XJKA 1N0YA 1DJWA 1S26D 2KI6C 2LMUA 2LLSA 2L5XB 1L2OC 3LLEA 3DF0A 1SW8A 1QLSA 4PHNA 3TS5B 3WXAA 4U8DA 2COLB 3AAKA 2MLFC 3H4SE 4GUKA 2LVKA 3ZNIA 1K94A 2JXCA 3FWBA 3I5GB 4MRXA 4YGCB 5I8NA 1JFJA 3AAJA 2WCEA 3JTDB 1W7JB 2LHLA 4ORCB 1OMDA 4CPVA 1Y6WA 3SG5A 2WORA 1E8AA 1TCOB 4P2YB 1B8CA 2LCPA 1CMFA 2LLTA 1F55A 1WDCB 3SG2A 1AHRA 1ALVA 3LK1A 4PHJA 1K9UA 1KFUL 1OSAA 1QX7A 5CPVA 2Q91A 3IQQA 2PRUA 1DF0A 1OMVA 4NDBA 1M45A 2I7AA 2JPTA 1QS7A 4CLNA 3D0YB 1DJYA 1FI5A 1MR8A 1DJHA 5ER5A 1XFWO 1AVSA 2F2OA 5B8IB 1DT7B 1ZOTB 1F4QA 3D10A 2OTGC 3OB1B 2AAOA 1Y1AA 1B1GA 4N1GA 2LHIA 2KAVA 1KWOB 2BE6A 2Y1MA 4R1EA 3ICBA 2K7CA 1N65A 2ZRSA 2LV7A 3DD4A 4GGFA 1M39A 3O6BA 2JZIA 1JC2A 1ZFSA 2JC2A 2DOQA 1ZMZA 1SRAA 3EKJA 4NDDA 1EG4A 1QLKA 3AKBA 2M9GA 2G2BA 3A8RA 1K9KA 2R2IA 2F2PA 4USLA 1YX7A 3PM8A 1OQPA 2JOJA 1IJ5A 1WY9A 2IS9A 2LMTA 2LUCA 3EVVA 1KQMB 1BODA 3O4YA 1OZOA 2MLEC 1J1DA 3CLNA 4GPLB 2HQWA 1PRWA 3TUYC 1CLBA 1DJZA 2L98A 3EK8A 1C7WA 1S5GY 4MRYA 3PATA 1PVAA 1DVIA 1SCMC 2ZFDA 1KK7Z 1CM4A 4GGFC 1R2UA 1YURA 5AERA 1TIZA 2KQYA 4JPZB 1DJXA 1IRJA 2KGRA 3BQ3A 1JF0A 1RTP1 2PSRA 5HLVA 3CWGA 1SCVA 2QACA 1CDNA 4MZKA 3JVTB 4D1EA 2PMYA 1FI6A 4HSZA 1NX1A 4DUQA 1SNLA 1PSRA 3SG7A 2JRFA 4YGDB 2L4HA 3GOFA 3GK4X 3O78A 5I2OA 1A75B 3FIAA 3PN7C 2M7LA 3NSLA 1S3PA 1L2OB 4OKHA 1S36A 1RFJA 1SL9A 3OP0A 4NDCA 2JWWA 1ODBA 1CFPA 2JNFA 1G8IA 4PE1A 3C1VA 1D1OA 1YVLA 3CS1A 1DJIA 5AFPA 4PHKA 1CFCA 3RLZA 2KYCA 4Q04A 1QXPA 2NZ0A 3LK0A 2OPOA 4BY5A 1GGZA 1LINA 2P6BB 5AXIA 2BKIB 4N5XA 3TDUA 1M31A 1R6PA 2MHHA 2WOSA 4ORAB 1ZACA 1N2DA 4XJKB 1CDPA 4I5NB 1AJ4A 1X02A 4AQIA 2WCFA 1BR1B 2LANA 1RECA 1OOJA 2LE9B 2E30A 1KFXL 3PALA 5HKYA 1TNWA 1K96A 3JVTC 1UHIA 2E6WA 1IG5A 1KK8B 2KBIA 1AK8A 3AKAA 2L4IA 2M3WA 4OV2A 2HPSA 2ISDA 4QJ5B 1OMRA 2KAYA 1SK6D 3IF7A 5D7FA 2MRDA 3F45A 1MXEA 4YI8A 3OX5A 3TZ1A 1IWQA 2FJUB 1K2HA 3FWCA 2LLUA 2OTGB 5BPJA 4PHMA 5D69A 4MSPA 1IQ5A 1YRTB 2M1KB 1KSOA 1G33A 2EGDA 2FCEA 3DVMA 2AMIA 2KSPA 3OB2B 3BOWA 4OR9B 4YGAA 1PULA 1B8RA 1QIVA 2EC6C 2KYFA 1DTLA 2GGZA 1H8BA 1QIWA 2NLNA 5K89A 2LVVA 1G4YR 4PE0A 1DF0B 1JSAA 2AUCA 1K8UA 1F4OA 2F3ZA 2K7OA 2ZN9A 5FYXA 2K2AA 1KFUS 1SKTA 1RROA 1OZSA 3PSRA 1YUSA 1NCZA 4GFTA 1HT9A 2LVJA 1QVIY 4AQJA 3OHMB 1WRLA 2HQ8A 1KK8C 2LAPA 2NCOA 4MZJA 2LUXA 3TUYB 2CCMA 3EK4A 2Y1NA 5DKQA 1A29A 1EH2A 1HQVA 2GV5A 4DCKA 2LP2A 1NCXA 1IGVA 2D8NA 1SCMB 2TN4A 1MXLC 1B7TY 1JBAA 1MF8B 1XFYO 1KCYA 4HRHA 4MZLA 2EHBA 1CDMA 2KFHA 3IQOA 3SIAA 1J7OA 2CT9A 1CMGA 1DGUA 1NIWA 1YRUB 2BBMA 1CFFA 1C07A 2JU0A 1CFDA 1TNXA 2FCDA 3E3RA 2KI4C 2ZN8A 2KDHA 3LL8B 1DMOA 3PN7B 4HREE 1S1EA 1SBJA 2M8UA 1LA3A 3I5IC 1AUIB 1F54A 2BE4A 3PFVA 4UPGA 4I5KA 1K95A 3RM1A 3KPXA 1KQVA 1YVHA 2LP3A 2BBNA 2M0RA 3CTNA 3I5FB 4P5OE 2KOTA 4XYNA 1IKUA 2L50A 3SG4A 1B4CA 5JOLA 1PK0D 1NSHA 2Q4UA 2K0JA 4WRIA 1SPYA 4CFQA 3VRNA 5G08A 3KF9A 4WQ2A 1H4BA 4N1FA 2WCBA 1NYAA 3I5HC 1BF5A 3K21A 2SCPA 1LXFC 3SG3A 1MHOA 2QPTA 1YTZC 2KBMA 5HYDA 4DS7A 2I18A 2M29A 1TN4A 2NXQA 2NCPA 2MBXA 4DRWA 5DKRA 1CM1A 1QV1A 3HX4A 2OS8C 1JUOA 1U5IA 2A4JA 1BG1A 1LKJA 4PCWA 3BUWB 3OX6A 4M2OA 5PALA 4WQ3A 4M2PA 1QX2A 3EK7A 3SG6A 3BUMB 5JJGA 3VRPA 2JTZA 2GGMA 1SMGA 2K61A 1L7ZA 2BECA 1TNQA 3CR2A 3DVKA 3I5FC 4PE7A 4YGEB 1UHJA 5F6TA 3DVEA 2H61A 1BR4B 3EVUA 4FTGA 4QJ4B 1SYMA 2I94A 2O60A 2EC6B 2M7NA 1WLZA 1CKKA 2BL0C 1UHKA 4M2QA 1B9AA 2Y5IA 5DKNA 1UUSA 1AP4A 1V1FA 1UHHA 1YUTA 1BU3A 1XFVO 1F71A 1S6CA 3NSKA 3VRRA 1BOCA 1QASA 1ALWA 2H2KA 2M1UA 1NCYA 1EJ3A 3KHEA 1Y1XA 4A4CA 4MEWA 1Y0VH 2LNKA 1BLQA 4CFRA 4PDZA 1QTXA 1B47A 2L51A 2ZKMX 1MQ1A 4NQGA 1LVCD 4YBHB 3ZWHA 3VROA 1NX3A 2JULA 3BOWB 1PVBA 1WRZA 3TDIA 1UWOA 1XA5A 1ZUZA 1S5GZ 5CSNA 1GJYA 2BCAA 1QV0A 4JWQA 5CSFA 5HLOA 1SY9A 1NX2A 2CTNA 5HKZA 4MN0A 2KAXA 5KU1A 1F8HA 1A03A 1TTXA 2KI6D 1NWDA 1IQ3A 3NSOA 1J1EA 2FOTA 2JXLA 1UURA 2KI4B 4YRUA 3NXAA 1J7QA 1QATA 3WNXB 1MWNA 2F3YA 2B1UA 3A4UB 1GQMA 3I5IB 5CSIA 1TRFA 1TCFA 1F70A 4ZCUA 1WRKA 2MAZA 2M97A 2ZNDA 1BJFA 2MJWB 1IJ6A 1K9PA 1FF1A 5ER4X 5CSJA 4OVNF 1PALA 2JT8A 2KFFA 1EG3A 4MLWA 1K90D 1CDLA 1S6IA 2G9BA 2K7BA 3HCMA 3SJSA 1KK7Y 3PLFB 2WC8A 1CLLA 2ZNEA 3I5HB 4ICBA 1RWYA 4A4BA 3DVJA 2JT3A 1NPQA 4IL1A 4C0KA 1FW4A 2M49B 4C0JA 2LMVA 2LC5A 1EXRA 2KNEA 2JNXA 2PALA 2LVIA 2JTTA 4FQOA 2JQ6A 4PE4A 2OS8B 1VRKA 3BUOB 3CGAA 4DIRA 1NX0A 1CLMA 4C0LA 1DJGA 1CTRA 1SL8A 1J55A 2PASA 5TNCA 4JQ0D 4ORBB 1A4PA 1AJ5A 1QJTA 2CXJA 3TS5C 1XK4A 1UHNA 1LA0A 3D0YA 1CNPA 1JF2A 4L9MA 4GNKB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4I5L B;  4QJ3 B;  2K2F A;  1XYD A;  4BY4 A;  1RJV A;  1Q80 A;  3I5G C;  1FBV A;  2BL0 B;  4I5J A;  2KQ6 A;  1SL7 A;  1K93 D;  1XFU O;  1XFX O;  3JTD C;  4E68 A;  1V1G A;  1W7I B;  4GBA A;  1IH0 A;  1SR6 B;  4YI9 A;  3NSI A;  2BCX A;  1U5I B;  1CB1 A;  1A2X A;  2Y4Q A;  1WDC C;  4GAO A;  1GGW A;  5I2L A;  5AAN A;  5I2Q A;  1YUU A;  5AEQ A;  3CZT X;  1XVJ A;  3CR4 X;  3SIB A;  4MBE A;  1QVI Z;  1NUB A;  3BUX B;  1XK4 C;  1KSM A;  1JFK A;  4MVF A;  3WHU B;  4HRG A;  3BXK A;  5GQQ C;  5KSZ A;  1B7T Z;  1EL4 A;  3BYA A;  2KHN A;  1XFZ O;  3VGO A;  1FPW A;  2CBL A;  1KWO C;  1YR5 A;  4TNC A;  1XO5 A;  1BT6 A;  2ZRT A;  3KEV A;  2MA2 A;  1M46 A;  3LCP C;  1TNP A;  2K7D A;  3EVR A;  1UP5 A;  2LM5 A;  5HKW A;  3MSE B;  3TDZ A;  1PSB A;  3BUN B;  3CR5 X;  1C7V A;  1RK9 A;  1DGV A;  1YX8 A;  1JWD A;  2KGB C;  4PAL A;  1SR6 C;  1B8L A;  1M63 B;  1TOP A;  3WHT B;  4GGN A;  1NP8 A;  4F0Z B;  1MUX A;  2BKH B;  3FS7 A;  1Y1U A;  1KFX S;  2F8P A;  1KQM C;  3QRX A;  1A75 A;  3GK1 A;  1QX5 B;  1WLM A;  2K8M B;  2VRG A;  3GK2 A;  4OCI A;  4CID A;  3KO0 A;  2H61 C;  2L0P A;  1J7R A;  3M0W A;  5IBW A;  4ZCV A;  2RGI A;  3EKH A;  2PVB A;  2O5G A;  4AOM A;  2HET A;  1BMO A;  1S6J A;  2CNP A;  4ETO A;  2HF5 A;  4YGB B;  2V53 A;  3VRQ A;  2I2R E;  2JT0 A;  2KFG A;  2SAS A;  5J3X A;  1J7P A;  1OE9 B;  2L2E A;  2WND A;  2BCB A;  3DF0 B;  3O2P A;  5KTY A;  2F33 A;  4XJK A;  1N0Y A;  1DJW A;  1S26 D;  2KI6 C;  2LMU A;  2LLS A;  2L5X B;  1L2O C;  3LLE A;  3DF0 A;  1SW8 A;  1QLS A;  4PHN A;  3TS5 B;  3WXA A;  4U8D A;  2COL B;  3AAK A;  2MLF C;  3H4S E;  4GUK A;  2LVK A;  3ZNI A;  1K94 A;  2JXC A;  3FWB A;  3I5G B;  4MRX A;  4YGC B;  5I8N A;  1JFJ A;  3AAJ A;  2WCE A;  3JTD B;  1W7J B;  2LHL A;  4ORC B;  1OMD A;  4CPV A;  1Y6W A;  3SG5 A;  2WOR A;  1E8A A;  1TCO B;  4P2Y B;  1B8C A;  2LCP A;  1CMF A;  2LLT A;  1F55 A;  1WDC B;  3SG2 A;  1AHR A;  1ALV A;  3LK1 A;  4PHJ A;  1K9U A;  1KFU L;  1OSA A;  1QX7 A;  5CPV A;  2Q91 A;  3IQQ A;  2PRU A;  1DF0 A;  1OMV A;  4NDB A;  1M45 A;  2I7A A;  2JPT A;  1QS7 A;  4CLN A;  3D0Y B;  1DJY A;  1FI5 A;  1MR8 A;  1DJH A;  5ER5 A;  1XFW O;  1AVS A;  2F2O A;  5B8I B;  1DT7 B;  1ZOT B;  1F4Q A;  3D10 A;  2OTG C;  3OB1 B;  2AAO A;  1Y1A A;  1B1G A;  4N1G A;  2LHI A;  2KAV A;  1KWO B;  2BE6 A;  2Y1M A;  4R1E A;  3ICB A;  2K7C A;  1N65 A;  2ZRS A;  2LV7 A;  3DD4 A;  4GGF A;  1M39 A;  3O6B A;  2JZI A;  1JC2 A;  1ZFS A;  2JC2 A;  2DOQ A;  1ZMZ A;  1SRA A;  3EKJ A;  4NDD A;  1EG4 A;  1QLK A;  3AKB A;  2M9G A;  2G2B A;  3A8R A;  1K9K A;  2R2I A;  2F2P A;  4USL A;  1YX7 A;  3PM8 A;  1OQP A;  2JOJ A;  1IJ5 A;  1WY9 A;  2IS9 A;  2LMT A;  2LUC A;  3EVV A;  1KQM B;  1BOD A;  3O4Y A;  1OZO A;  2MLE C;  1J1D A;  3CLN A;  4GPL B;  2HQW A;  1PRW A;  3TUY C;  1CLB A;  1DJZ A;  2L98 A;  3EK8 A;  1C7W A;  1S5G Y;  4MRY A;  3PAT A;  1PVA A;  1DVI A;  1SCM C;  2ZFD A;  1KK7 Z;  1CM4 A;  4GGF C;  1R2U A;  1YUR A;  5AER A;  1TIZ A;  2KQY A;  4JPZ B;  1DJX A;  1IRJ A;  2KGR A;  3BQ3 A;  1JF0 A;  1RTP 1;  2PSR A;  5HLV A;  3CWG A;  1SCV A;  2QAC A;  1CDN A;  4MZK A;  3JVT B;  4D1E A;  2PMY A;  1FI6 A;  4HSZ A;  1NX1 A;  4DUQ A;  1SNL A;  1PSR A;  3SG7 A;  2JRF A;  4YGD B;  2L4H A;  3GOF A;  3GK4 X;  3O78 A;  5I2O A;  1A75 B;  3FIA A;  3PN7 C;  2M7L A;  3NSL A;  1S3P A;  1L2O B;  4OKH A;  1S36 A;  1RFJ A;  1SL9 A;  3OP0 A;  4NDC A;  2JWW A;  1ODB A;  1CFP A;  2JNF A;  1G8I A;  4PE1 A;  3C1V A;  1D1O A;  1YVL A;  3CS1 A;  1DJI A;  5AFP A;  4PHK A;  1CFC A;  3RLZ A;  2KYC A;  4Q04 A;  1QXP A;  2NZ0 A;  3LK0 A;  2OPO A;  4BY5 A;  1GGZ A;  1LIN A;  2P6B B;  5AXI A;  2BKI B;  4N5X A;  3TDU A;  1M31 A;  1R6P A;  2MHH A;  2WOS A;  4ORA B;  1ZAC A;  1N2D A;  4XJK B;  1CDP A;  4I5N B;  1AJ4 A;  1X02 A;  4AQI A;  2WCF A;  1BR1 B;  2LAN A;  1REC A;  1OOJ A;  2LE9 B;  2E30 A;  1KFX L;  3PAL A;  5HKY A;  1TNW A;  1K96 A;  3JVT C;  1UHI A;  2E6W A;  1IG5 A;  1KK8 B;  2KBI A;  1AK8 A;  3AKA A;  2L4I A;  2M3W A;  4OV2 A;  2HPS A;  2ISD A;  4QJ5 B;  1OMR A;  2KAY A;  1SK6 D;  3IF7 A;  5D7F A;  2MRD A;  3F45 A;  1MXE A;  4YI8 A;  3OX5 A;  3TZ1 A;  1IWQ A;  2FJU B;  1K2H A;  3FWC A;  2LLU A;  2OTG B;  5BPJ A;  4PHM A;  5D69 A;  4MSP A;  1IQ5 A;  1YRT B;  2M1K B;  1KSO A;  1G33 A;  2EGD A;  2FCE A;  3DVM A;  2AMI A;  2KSP A;  3OB2 B;  3BOW A;  4OR9 B;  4YGA A;  1PUL A;  1B8R A;  1QIV A;  2EC6 C;  2KYF A;  1DTL A;  2GGZ A;  1H8B A;  1QIW A;  2NLN A;  5K89 A;  2LVV A;  1G4Y R;  4PE0 A;  1DF0 B;  1JSA A;  2AUC A;  1K8U A;  1F4O A;  2F3Z A;  2K7O A;  2ZN9 A;  5FYX A;  2K2A A;  1KFU S;  1SKT A;  1RRO A;  1OZS A;  3PSR A;  1YUS A;  1NCZ A;  4GFT A;  1HT9 A;  2LVJ A;  1QVI Y;  4AQJ A;  3OHM B;  1WRL A;  2HQ8 A;  1KK8 C;  2LAP A;  2NCO A;  4MZJ A;  2LUX A;  3TUY B;  2CCM A;  3EK4 A;  2Y1N A;  5DKQ A;  1A29 A;  1EH2 A;  1HQV A;  2GV5 A;  4DCK A;  2LP2 A;  1NCX A;  1IGV A;  2D8N A;  1SCM B;  2TN4 A;  1MXL C;  1B7T Y;  1JBA A;  1MF8 B;  1XFY O;  1KCY A;  4HRH A;  4MZL A;  2EHB A;  1CDM A;  2KFH A;  3IQO A;  3SIA A;  1J7O A;  2CT9 A;  1CMG A;  1DGU A;  1NIW A;  1YRU B;  2BBM A;  1CFF A;  1C07 A;  2JU0 A;  1CFD A;  1TNX A;  2FCD A;  3E3R A;  2KI4 C;  2ZN8 A;  2KDH A;  3LL8 B;  1DMO A;  3PN7 B;  4HRE E;  1S1E A;  1SBJ A;  2M8U A;  1LA3 A;  3I5I C;  1AUI B;  1F54 A;  2BE4 A;  3PFV A;  4UPG A;  4I5K A;  1K95 A;  3RM1 A;  3KPX A;  1KQV A;  1YVH A;  2LP3 A;  2BBN A;  2M0R A;  3CTN A;  3I5F B;  4P5O E;  2KOT A;  4XYN A;  1IKU A;  2L50 A;  3SG4 A;  1B4C A;  5JOL A;  1PK0 D;  1NSH A;  2Q4U A;  2K0J A;  4WRI A;  1SPY A;  4CFQ A;  3VRN A;  5G08 A;  3KF9 A;  4WQ2 A;  1H4B A;  4N1F A;  2WCB A;  1NYA A;  3I5H C;  1BF5 A;  3K21 A;  2SCP A;  1LXF C;  3SG3 A;  1MHO A;  2QPT A;  1YTZ C;  2KBM A;  5HYD A;  4DS7 A;  2I18 A;  2M29 A;  1TN4 A;  2NXQ A;  2NCP A;  2MBX A;  4DRW A;  5DKR A;  1CM1 A;  1QV1 A;  3HX4 A;  2OS8 C;  1JUO A;  1U5I A;  2A4J A;  1BG1 A;  1LKJ A;  4PCW A;  3BUW B;  3OX6 A;  4M2O A;  5PAL A;  4WQ3 A;  4M2P A;  1QX2 A;  3EK7 A;  3SG6 A;  3BUM B;  5JJG A;  3VRP A;  2JTZ A;  2GGM A;  1SMG A;  2K61 A;  1L7Z A;  2BEC A;  1TNQ A;  3CR2 A;  3DVK A;  3I5F C;  4PE7 A;  4YGE B;  1UHJ A;  5F6T A;  3DVE A;  2H61 A;  1BR4 B;  3EVU A;  4FTG A;  4QJ4 B;  1SYM A;  2I94 A;  2O60 A;  2EC6 B;  2M7N A;  1WLZ A;  1CKK A;  2BL0 C;  1UHK A;  4M2Q A;  1B9A A;  2Y5I A;  5DKN A;  1UUS A;  1AP4 A;  1V1F A;  1UHH A;  1YUT A;  1BU3 A;  1XFV O;  1F71 A;  1S6C A;  3NSK A;  3VRR A;  1BOC A;  1QAS A;  1ALW A;  2H2K A;  2M1U A;  1NCY A;  1EJ3 A;  3KHE A;  1Y1X A;  4A4C A;  4MEW A;  1Y0V H;  2LNK A;  1BLQ A;  4CFR A;  4PDZ A;  1QTX A;  1B47 A;  2L51 A;  2ZKM X;  1MQ1 A;  4NQG A;  1LVC D;  4YBH B;  3ZWH A;  3VRO A;  1NX3 A;  2JUL A;  3BOW B;  1PVB A;  1WRZ A;  3TDI A;  1UWO A;  1XA5 A;  1ZUZ A;  1S5G Z;  5CSN A;  1GJY A;  2BCA A;  1QV0 A;  4JWQ A;  5CSF A;  5HLO A;  1SY9 A;  1NX2 A;  2CTN A;  5HKZ A;  4MN0 A;  2KAX A;  5KU1 A;  1F8H A;  1A03 A;  1TTX A;  2KI6 D;  1NWD A;  1IQ3 A;  3NSO A;  1J1E A;  2FOT A;  2JXL A;  1UUR A;  2KI4 B;  4YRU A;  3NXA A;  1J7Q A;  1QAT A;  3WNX B;  1MWN A;  2F3Y A;  2B1U A;  3A4U B;  1GQM A;  3I5I B;  5CSI A;  1TRF A;  1TCF A;  1F70 A;  4ZCU A;  1WRK A;  2MAZ A;  2M97 A;  2ZND A;  1BJF A;  2MJW B;  1IJ6 A;  1K9P A;  1FF1 A;  5ER4 X;  5CSJ A;  4OVN F;  1PAL A;  2JT8 A;  2KFF A;  1EG3 A;  4MLW A;  1K90 D;  1CDL A;  1S6I A;  2G9B A;  2K7B A;  3HCM A;  3SJS A;  1KK7 Y;  3PLF B;  2WC8 A;  1CLL A;  2ZNE A;  3I5H B;  4ICB A;  1RWY A;  4A4B A;  3DVJ A;  2JT3 A;  1NPQ A;  4IL1 A;  4C0K A;  1FW4 A;  2M49 B;  4C0J A;  2LMV A;  2LC5 A;  1EXR A;  2KNE A;  2JNX A;  2PAL A;  2LVI A;  2JTT A;  4FQO A;  2JQ6 A;  4PE4 A;  2OS8 B;  1VRK A;  3BUO B;  3CGA A;  4DIR A;  1NX0 A;  1CLM A;  4C0L A;  1DJG A;  1CTR A;  1SL8 A;  1J55 A;  2PAS A;  5TNC A;  4JQ0 D;  4ORB B;  1A4P A;  1AJ5 A;  1QJT A;  2CXJ A;  3TS5 C;  1XK4 A;  1UHN A;  1LA0 A;  3D0Y A;  1CNP A;  1JF2 A;  4L9M A;  4GNK B; 
#chains in the Genus database with same CATH topology
 4I5L B;  4QJ3 B;  2K2F A;  1XYD A;  4BY4 A;  1RJV A;  1Q80 A;  3I5G C;  1FBV A;  2BL0 B;  3BFA A;  2KQ6 A;  1SL7 A;  1K93 D;  1XFU O;  1XFX O;  3JTD C;  4I5J A;  4E68 A;  1V1G A;  1W7I B;  4GBA A;  3CZ2 A;  3N7H A;  1IH0 A;  1SR6 B;  4YI9 A;  3CZ0 A;  3NSI A;  2BCX A;  1U5I B;  3DZT A;  1CB1 A;  1A2X A;  1C3Z A;  2Y4Q A;  1WDC C;  4GAO A;  5HL1 A;  1GGW A;  5I2L A;  5AAN A;  1W9Z A;  5I2Q A;  1YUU A;  3L47 A;  5AEQ A;  3CZT X;  3OGN A;  1XVJ A;  3CR4 X;  3SIB A;  4MBE A;  3V2L A;  1QVI Z;  2QEB A;  1NUB A;  3BUX B;  1XK4 C;  1KSM A;  1JFK A;  4MVF A;  3WHU B;  4HRG A;  3BXK A;  5GQQ C;  5KSZ A;  3SS4 A;  1B7T Z;  1EL4 A;  3BYA A;  2KHN A;  1XFZ O;  3VGO A;  1FPW A;  2CBL A;  1KWO C;  1YR5 A;  4TNC A;  1XO5 A;  1BT6 A;  2ZRT A;  3KEV A;  2MA2 A;  1M46 A;  3LCP C;  1TNP A;  2K7D A;  4INW A;  3EVR A;  3B87 A;  1UP5 A;  2LM5 A;  4KYN A;  2QEO A;  5HKW A;  3MSE B;  3Q8I A;  3TDZ A;  1PSB A;  3BUN B;  3CR5 X;  1C7V A;  1RK9 A;  1DGV A;  1YX8 A;  1JWD A;  2KGB C;  4PAL A;  1SR6 C;  1B8L A;  1M63 B;  1TOP A;  3WHT B;  4GGN A;  1NP8 A;  4F0Z B;  1MUX A;  1DEL A;  2BKH B;  3FS7 A;  1Y1U A;  1KFX S;  2F8P A;  1KQM C;  3QRX A;  1A75 A;  3GK1 A;  2JPO A;  1QX5 B;  1WLM A;  2K8M B;  2VRG A;  3GK2 A;  3D78 A;  4OCI A;  4CID A;  3KO0 A;  2H61 C;  2L0P A;  1J7R A;  3S0A A;  3M0W A;  5IBW A;  4ZCV A;  2RGI A;  3EKH A;  2PVB A;  2O5G A;  4AOM A;  2HET A;  1LS8 A;  1BMO A;  1S6J A;  2CNP A;  4ETO A;  2HF5 A;  3QME A;  3B6X A;  3CAB A;  4YGB B;  2V53 A;  3L4L A;  3VRQ A;  2I2R E;  2JT0 A;  2KFG A;  2SAS A;  5J3X A;  4OZD A;  1OE9 B;  1J7P A;  2L2E A;  2WND A;  2BCB A;  3DF0 B;  3R1P A;  3O2P A;  5KTY A;  2F33 A;  4XJK A;  3SS5 A;  1TWO A;  1N0Y A;  1DJW A;  1S26 D;  2KI6 C;  2LMU A;  2LLS A;  2L5X B;  1L2O C;  3LLE A;  3O4X A;  3DF0 A;  4IJ7 A;  1SW8 A;  1QLS A;  4PHN A;  3TS5 B;  3WXA A;  4U8D A;  2COL B;  3AAK A;  2MLF C;  3H4S E;  4GUK A;  2LVK A;  2QDI A;  3ZNI A;  1K94 A;  2JXC A;  3FWB A;  3I5G B;  4MRX A;  4YGC B;  5I8N A;  5I94 A;  1JFJ A;  3AAJ A;  2WCE A;  3JTD B;  1W7J B;  2LHL A;  4ORC B;  2WCL A;  1OMD A;  3S0D A;  1Y6W A;  3SG5 A;  4CPV A;  2WOR A;  1E8A A;  1TCO B;  4P2Y B;  1B8C A;  2LCP A;  1CMF A;  2LLT A;  1F55 A;  1WDC B;  3DYE A;  3SG2 A;  1AHR A;  1ALV A;  3LK1 A;  4PHJ A;  1K9U A;  2KPH A;  1KFU L;  1OSA A;  1QX7 A;  5CPV A;  2Q91 A;  3IQQ A;  2PRU A;  1DF0 A;  1OMV A;  4NDB A;  1M45 A;  2I7A A;  2JPT A;  1QS7 A;  4CLN A;  3D0Y B;  1DJY A;  1FI5 A;  1MR8 A;  3B88 A;  1DJH A;  5ER5 A;  1XFW O;  1AVS A;  2F2O A;  5B8I B;  1DT7 B;  1ZOT B;  1OW4 A;  1F4Q A;  3D10 A;  2OTG C;  3SS3 A;  3OB1 B;  2AAO A;  1Y1A A;  1B1G A;  4N1G A;  2LHI A;  2KAV A;  1KWO B;  2BE6 A;  2Y1M A;  4R1E A;  3ICB A;  2K7C A;  3CZ1 A;  1N65 A;  2ZRS A;  2LV7 A;  3DD4 A;  4GGF A;  1M39 A;  2WCH A;  2JZI A;  2P71 A;  3EG5 B;  1ZFS A;  3O6B A;  1JC2 A;  2JC2 A;  2DOQ A;  1ZMZ A;  1SRA A;  3EKJ A;  4NDD A;  1EG4 A;  1QLK A;  2QEV A;  3AKB A;  1P28 A;  2M9G A;  2G2B A;  3A8R A;  1K9K A;  2R2I A;  2F2P A;  4USL A;  1YX7 A;  3PM8 A;  1OQP A;  2JOJ A;  1IJ5 A;  1WY9 A;  2IS9 A;  2LMT A;  2LUC A;  3EVV A;  1KQM B;  1BOD A;  3IVT A;  3O4Y A;  1OZO A;  2MLE C;  1J1D A;  3CLN A;  4GPL B;  2HQW A;  3FE9 A;  1PRW A;  3TUY C;  1CLB A;  1DJZ A;  3D75 A;  2L98 A;  3EK8 A;  1C7W A;  1S5G Y;  4MRY A;  3PAT A;  1PVA A;  1DVI A;  1SCM C;  2ZFD A;  1KK7 Z;  1CM4 A;  4GGF C;  1R2U A;  1SSE B;  1YUR A;  3VB1 A;  5AER A;  1TIZ A;  2KQY A;  3DXL A;  1DJX A;  4JPZ B;  1IRJ A;  2L2C A;  2KGR A;  3BQ3 A;  1JF0 A;  2PQL A;  1RTP 1;  2PSR A;  5HLV A;  3CWG A;  2K60 A;  1SCV A;  2QAC A;  1CDN A;  4MZK A;  3JVT B;  4D1E A;  2PMY A;  1FI6 A;  4HSZ A;  1NX1 A;  4DUQ A;  1SNL A;  1PSR A;  3SG7 A;  2JRF A;  4YGD B;  2L4H A;  2FJY A;  3GOF A;  3GK4 X;  3O78 A;  5I2O A;  5DIC A;  1A75 B;  2BNX A;  3FIA A;  3PN7 C;  2M7L A;  3NSL A;  1S3P A;  1L2O B;  2QEH A;  3PM2 A;  4OKH A;  1S36 A;  1RFJ A;  1SL9 A;  3OP0 A;  4NDC A;  2JWW A;  1ODB A;  1CFP A;  2JNF A;  1G8I A;  4PE1 A;  4FQT A;  3C1V A;  1D1O A;  1YVL A;  3CS1 A;  3S0B A;  1DJI A;  3B7A A;  5AFP A;  4PHK A;  1CFC A;  3RLZ A;  2KYC A;  4Q04 A;  1QXP A;  1XFR A;  2NZ0 A;  3LK0 A;  2OPO A;  4BY5 A;  1GGZ A;  3UO9 A;  1LIN A;  2P6B B;  5AXI A;  2BKI B;  4N5X A;  3TDU A;  1M31 A;  1R6P A;  2MHH A;  2WCK A;  2WOS A;  1ZAC A;  3D76 A;  4ORA B;  1N2D A;  4XJK B;  1CDP A;  4I5N B;  1AJ4 A;  1X02 A;  4AQI A;  2WCF A;  1BR1 B;  2LAN A;  1REC A;  1OOJ A;  2LE9 B;  2E30 A;  1KFX L;  3PAL A;  5HKY A;  1TNW A;  4INX A;  1K96 A;  3JVT C;  3S0F A;  1UHI A;  3BJH A;  2E6W A;  1IG5 A;  1KK8 B;  2KBI A;  2PYQ A;  1AK8 A;  3AKA A;  2L4I A;  2M3W A;  4OV2 A;  2HPS A;  2ISD A;  4QJ5 B;  1OMR A;  2KAY A;  1SK6 D;  3IF7 A;  5D7F A;  2MRD A;  3F45 A;  1MXE A;  4YI8 A;  3OX5 A;  3TZ1 A;  2WCM A;  1IWQ A;  2FJU B;  1K2H A;  3FWC A;  2LLU A;  2OTG B;  5BPJ A;  4PHM A;  5D69 A;  4MSP A;  1IQ5 A;  1YRT B;  2M1K B;  1KSO A;  1G33 A;  2EGD A;  2FCE A;  1DQE A;  2AMI A;  2KSP A;  3DVM A;  3BOW A;  3OB2 B;  4OR9 B;  2WC5 A;  1PUL A;  4YGA A;  1B8R A;  1QIV A;  4F7F A;  2EC6 C;  2KYF A;  1DTL A;  2GGZ A;  1H8B A;  2GTE A;  1QIW A;  2NLN A;  3K1E A;  5K89 A;  2LVV A;  2WCJ A;  1G4Y R;  4PE0 A;  1DF0 B;  1JSA A;  2AUC A;  3R72 A;  1K8U A;  1F4O A;  2F3Z A;  2K7O A;  2ZN9 A;  3L4A A;  5FI6 A;  5FYX A;  2K2A A;  1KFU S;  1SKT A;  1RRO A;  1OZS A;  3PSR A;  1YUS A;  1NCZ A;  4GFT A;  1HT9 A;  1C3Y A;  2LVJ A;  3D74 A;  1QVI Y;  3D73 A;  4AQJ A;  3OHM B;  1WRL A;  2HQ8 A;  1KK8 C;  2LAP A;  2NCO A;  4MZJ A;  2LUX A;  3S0G A;  2CCM A;  2P70 A;  3EK4 A;  2Y1N A;  5DKQ A;  1A29 A;  3TUY B;  1EH2 A;  1HQV A;  2GV5 A;  3DY9 A;  4DCK A;  2LP2 A;  1NCX A;  2KLE A;  1IGV A;  2D8N A;  1SCM B;  2TN4 A;  1MXL C;  3PJI A;  1B7T Y;  3RZS A;  1MF8 B;  1XFY O;  1JBA A;  1KCY A;  4HRH A;  4MZL A;  2EHB A;  1CDM A;  2KFH A;  3IQO A;  3SIA A;  1J7O A;  2CT9 A;  1CMG A;  1DGU A;  1NIW A;  1YRU B;  1T14 A;  2BBM A;  1CFF A;  1C07 A;  2JU0 A;  1CFD A;  1TNX A;  2FCD A;  3E3R A;  2KI4 C;  2ZN8 A;  2KDH A;  3LL8 B;  1DMO A;  3PN7 B;  3FE8 A;  1S1E A;  1SBJ A;  2M8U A;  1LA3 A;  3I5I C;  1AUI B;  2BAP A;  4HRE E;  1F54 A;  3UNW A;  2BE4 A;  3PFV A;  4UPG A;  4I5K A;  1K95 A;  3RM1 A;  3KPX A;  3BFH A;  1KQV A;  1YVH A;  2LP3 A;  2BBN A;  2M0R A;  3CTN A;  3I5F B;  4P5O E;  2KOT A;  4XYN A;  1IKU A;  2L50 A;  3SG4 A;  1B4C A;  5JOL A;  1PK0 D;  1NSH A;  2Q4U A;  2K0J A;  4JD9 A;  4WRI A;  3CYZ A;  1SPY A;  4CFQ A;  3VRN A;  5G08 A;  3KF9 A;  4WQ2 A;  1H4B A;  2WC6 A;  4N1F A;  1IIO A;  2WCB A;  1NYA A;  3I5H C;  1BF5 A;  3K21 A;  2SCP A;  1LXF C;  3SG3 A;  1MHO A;  2QPT A;  1YTZ C;  2KBM A;  5HYD A;  3R1V A;  4DS7 A;  1DEK A;  2I18 A;  2M29 A;  1TN4 A;  2NXQ A;  2NCP A;  2MBX A;  4DRW A;  5DKR A;  1DC1 A;  1ORG A;  1CM1 A;  1OOI X;  1QV1 A;  2OS8 C;  2YGU A;  1JUO A;  1U5I A;  3HX4 A;  5FI2 A;  2A4J A;  1BG1 A;  1LKJ A;  4PCW A;  3BUW B;  3OX6 A;  4M2O A;  5PAL A;  4WQ3 A;  4M2P A;  3S0E A;  1QX2 A;  3EK7 A;  3SG6 A;  3BUM B;  5JJG A;  3VRP A;  2JTZ A;  2GGM A;  1SMG A;  2K61 A;  1L7Z A;  2BEC A;  1TNQ A;  3CR2 A;  3DVK A;  3I5F C;  4PE7 A;  4YGE B;  1UHJ A;  5F6T A;  3DVE A;  2H61 A;  1BR4 B;  3EVU A;  4FTG A;  4QJ4 B;  1SYM A;  2I94 A;  2KLD A;  2O60 A;  2EC6 B;  2M7N A;  1WLZ A;  1CKK A;  1GM0 A;  2BL0 C;  1UHK A;  4M2Q A;  1B9A A;  2Y5I A;  5DKN A;  1UUS A;  1AP4 A;  1V1F A;  3NGV A;  3NHT A;  1UHH A;  1YUT A;  1BU3 A;  1XFV O;  1F71 A;  1TUZ A;  3FE6 A;  1S6C A;  1Z4H A;  3NSK A;  3VRR A;  1BOC A;  1QAS A;  1ALW A;  1QWV A;  2H2K A;  3OBV A;  2M1U A;  1NCY A;  1EJ3 A;  3NHI A;  3KHE A;  2H8V A;  1Y1X A;  4A4C A;  4PT1 A;  4MEW A;  1Y0V H;  2LNK A;  1BLQ A;  3B86 A;  4CFR A;  4PDZ A;  1QTX A;  1B47 A;  2L51 A;  2ZKM X;  1MQ1 A;  4NQG A;  1LVC D;  4YBH B;  3ZWH A;  3VRO A;  1NX3 A;  2JUL A;  3BOW B;  1PVB A;  1WRZ A;  3TDI A;  1UWO A;  1XA5 A;  1ZUZ A;  3D77 A;  1S5G Z;  5CSN A;  1GJY A;  2BCA A;  1QV0 A;  4JWQ A;  5CSF A;  5HLO A;  1SY9 A;  4JKT A;  1NX2 A;  1Z2C B;  2CTN A;  5HKZ A;  4MN0 A;  2KAX A;  5KU1 A;  1F8H A;  1A03 A;  1TTX A;  2KI6 D;  1NWD A;  1IQ3 A;  3NSO A;  1J1E A;  2FOT A;  2JXL A;  1UUR A;  2KI4 B;  4YRU A;  3NXA A;  1OOH A;  1J7Q A;  1QAT A;  3WNX B;  3R1O A;  1MWN A;  2F3Y A;  2B1U A;  3A4U B;  1GQM A;  3I5I B;  5CSI A;  1TRF A;  1TCF A;  1F70 A;  4ZCU A;  1WRK A;  2MAZ A;  2M97 A;  2ZND A;  1BJF A;  2MJW B;  1IJ6 A;  1K9P A;  1FF1 A;  2L5Y A;  5ER4 X;  5CSJ A;  4OVN F;  1PAL A;  2JT8 A;  2KFF A;  1EG3 A;  4MLW A;  1K90 D;  1CDL A;  1S6I A;  2G9B A;  2K7B A;  3HCM A;  3CDN A;  3SJS A;  1KK7 Y;  3PLF B;  5D3O A;  2WC8 A;  1CLL A;  2ZNE A;  3I5H B;  4ICB A;  1RWY A;  4A4B A;  3DVJ A;  2JT3 A;  1NPQ A;  4IL1 A;  5EL2 A;  1FW4 A;  2M49 B;  4C0K A;  4C0J A;  2LMV A;  2LC5 A;  1TUJ A;  1EXR A;  2KNE A;  2JNX A;  1OOG A;  5FI7 A;  2PAL A;  2ERB A;  2LVI A;  2JTT A;  4FQO A;  2JQ6 A;  4PE4 A;  2OS8 B;  1VRK A;  3BFB A;  3BUO B;  3CGA A;  1NX0 A;  4DIR A;  1CLM A;  4C0L A;  1DJG A;  1CTR A;  1SL8 A;  1J55 A;  2PAS A;  5TNC A;  4JQ0 D;  4ORB B;  1A4P A;  1AJ5 A;  1QJT A;  2CXJ A;  3TS5 C;  1XK4 A;  1UHN A;  1LA0 A;  3D0Y A;  1OOF A;  1CNP A;  1JF2 A;  4L9M A;  4GNK B; 
#chains in the Genus database with same CATH homology
 4I5L B;  4QJ3 B;  2K2F A;  1XYD A;  4BY4 A;  1RJV A;  1Q80 A;  3I5G C;  1FBV A;  2BL0 B;  4I5J A;  2KQ6 A;  1SL7 A;  1K93 D;  1XFU O;  1XFX O;  3JTD C;  4E68 A;  1V1G A;  1W7I B;  4GBA A;  1IH0 A;  1SR6 B;  4YI9 A;  3NSI A;  2BCX A;  1U5I B;  1CB1 A;  1A2X A;  2Y4Q A;  1WDC C;  4GAO A;  1GGW A;  5I2L A;  5AAN A;  5I2Q A;  1YUU A;  5AEQ A;  3CZT X;  1XVJ A;  3CR4 X;  3SIB A;  4MBE A;  1QVI Z;  1NUB A;  3BUX B;  1XK4 C;  1KSM A;  1JFK A;  4MVF A;  3WHU B;  4HRG A;  3BXK A;  5GQQ C;  5KSZ A;  1B7T Z;  1EL4 A;  3BYA A;  2KHN A;  1XFZ O;  3VGO A;  1FPW A;  2CBL A;  1KWO C;  1YR5 A;  4TNC A;  1XO5 A;  1BT6 A;  2ZRT A;  3KEV A;  2MA2 A;  1M46 A;  3LCP C;  1TNP A;  2K7D A;  3EVR A;  1UP5 A;  2LM5 A;  5HKW A;  3MSE B;  3TDZ A;  1PSB A;  3BUN B;  3CR5 X;  1C7V A;  1RK9 A;  1DGV A;  1YX8 A;  1JWD A;  2KGB C;  4PAL A;  1SR6 C;  1B8L A;  1M63 B;  1TOP A;  3WHT B;  4GGN A;  1NP8 A;  4F0Z B;  1MUX A;  2BKH B;  3FS7 A;  1Y1U A;  1KFX S;  2F8P A;  1KQM C;  3QRX A;  1A75 A;  3GK1 A;  1QX5 B;  1WLM A;  2K8M B;  2VRG A;  3GK2 A;  4OCI A;  4CID A;  3KO0 A;  2H61 C;  2L0P A;  1J7R A;  3M0W A;  5IBW A;  4ZCV A;  2RGI A;  3EKH A;  2PVB A;  2O5G A;  4AOM A;  2HET A;  1BMO A;  1S6J A;  2CNP A;  4ETO A;  2HF5 A;  4YGB B;  2V53 A;  3VRQ A;  2I2R E;  2JT0 A;  2KFG A;  2SAS A;  5J3X A;  1J7P A;  1OE9 B;  2L2E A;  2WND A;  2BCB A;  3DF0 B;  3O2P A;  5KTY A;  2F33 A;  4XJK A;  1N0Y A;  1DJW A;  1S26 D;  2KI6 C;  2LMU A;  2LLS A;  2L5X B;  1L2O C;  3LLE A;  3DF0 A;  1SW8 A;  1QLS A;  4PHN A;  3TS5 B;  3WXA A;  4U8D A;  2COL B;  3AAK A;  2MLF C;  3H4S E;  4GUK A;  2LVK A;  3ZNI A;  1K94 A;  2JXC A;  3FWB A;  3I5G B;  4MRX A;  4YGC B;  5I8N A;  1JFJ A;  3AAJ A;  2WCE A;  3JTD B;  1W7J B;  2LHL A;  4ORC B;  1OMD A;  4CPV A;  1Y6W A;  3SG5 A;  2WOR A;  1E8A A;  1TCO B;  4P2Y B;  1B8C A;  2LCP A;  1CMF A;  2LLT A;  1F55 A;  1WDC B;  3SG2 A;  1AHR A;  1ALV A;  3LK1 A;  4PHJ A;  1K9U A;  1KFU L;  1OSA A;  1QX7 A;  5CPV A;  2Q91 A;  3IQQ A;  2PRU A;  1DF0 A;  1OMV A;  4NDB A;  1M45 A;  2I7A A;  2JPT A;  1QS7 A;  4CLN A;  3D0Y B;  1DJY A;  1FI5 A;  1MR8 A;  1DJH A;  5ER5 A;  1XFW O;  1AVS A;  2F2O A;  5B8I B;  1DT7 B;  1ZOT B;  1F4Q A;  3D10 A;  2OTG C;  3OB1 B;  2AAO A;  1Y1A A;  1B1G A;  4N1G A;  2LHI A;  2KAV A;  1KWO B;  2BE6 A;  2Y1M A;  4R1E A;  3ICB A;  2K7C A;  1N65 A;  2ZRS A;  2LV7 A;  3DD4 A;  4GGF A;  1M39 A;  3O6B A;  2JZI A;  1JC2 A;  1ZFS A;  2JC2 A;  2DOQ A;  1ZMZ A;  1SRA A;  3EKJ A;  4NDD A;  1EG4 A;  1QLK A;  3AKB A;  2M9G A;  2G2B A;  3A8R A;  1K9K A;  2R2I A;  2F2P A;  4USL A;  1YX7 A;  3PM8 A;  1OQP A;  2JOJ A;  1IJ5 A;  1WY9 A;  2IS9 A;  2LMT A;  2LUC A;  3EVV A;  1KQM B;  1BOD A;  3O4Y A;  1OZO A;  2MLE C;  1J1D A;  3CLN A;  4GPL B;  2HQW A;  1PRW A;  3TUY C;  1CLB A;  1DJZ A;  2L98 A;  3EK8 A;  1C7W A;  1S5G Y;  4MRY A;  3PAT A;  1PVA A;  1DVI A;  1SCM C;  2ZFD A;  1KK7 Z;  1CM4 A;  4GGF C;  1R2U A;  1YUR A;  5AER A;  1TIZ A;  2KQY A;  4JPZ B;  1DJX A;  1IRJ A;  2KGR A;  3BQ3 A;  1JF0 A;  1RTP 1;  2PSR A;  5HLV A;  3CWG A;  1SCV A;  2QAC A;  1CDN A;  4MZK A;  3JVT B;  4D1E A;  2PMY A;  1FI6 A;  4HSZ A;  1NX1 A;  4DUQ A;  1SNL A;  1PSR A;  3SG7 A;  2JRF A;  4YGD B;  2L4H A;  3GOF A;  3GK4 X;  3O78 A;  5I2O A;  1A75 B;  3FIA A;  3PN7 C;  2M7L A;  3NSL A;  1S3P A;  1L2O B;  4OKH A;  1S36 A;  1RFJ A;  1SL9 A;  3OP0 A;  4NDC A;  2JWW A;  1ODB A;  1CFP A;  2JNF A;  1G8I A;  4PE1 A;  3C1V A;  1D1O A;  1YVL A;  3CS1 A;  1DJI A;  5AFP A;  4PHK A;  1CFC A;  3RLZ A;  2KYC A;  4Q04 A;  1QXP A;  2NZ0 A;  3LK0 A;  2OPO A;  4BY5 A;  1GGZ A;  1LIN A;  2P6B B;  5AXI A;  2BKI B;  4N5X A;  3TDU A;  1M31 A;  1R6P A;  2MHH A;  2WOS A;  4ORA B;  1ZAC A;  1N2D A;  4XJK B;  1CDP A;  4I5N B;  1AJ4 A;  1X02 A;  4AQI A;  2WCF A;  1BR1 B;  2LAN A;  1REC A;  1OOJ A;  2LE9 B;  2E30 A;  1KFX L;  3PAL A;  5HKY A;  1TNW A;  1K96 A;  3JVT C;  1UHI A;  2E6W A;  1IG5 A;  1KK8 B;  2KBI A;  1AK8 A;  3AKA A;  2L4I A;  2M3W A;  4OV2 A;  2HPS A;  2ISD A;  4QJ5 B;  1OMR A;  2KAY A;  1SK6 D;  3IF7 A;  5D7F A;  2MRD A;  3F45 A;  1MXE A;  4YI8 A;  3OX5 A;  3TZ1 A;  1IWQ A;  2FJU B;  1K2H A;  3FWC A;  2LLU A;  2OTG B;  5BPJ A;  4PHM A;  5D69 A;  4MSP A;  1IQ5 A;  1YRT B;  2M1K B;  1KSO A;  1G33 A;  2EGD A;  2FCE A;  3DVM A;  2AMI A;  2KSP A;  3OB2 B;  3BOW A;  4OR9 B;  4YGA A;  1PUL A;  1B8R A;  1QIV A;  2EC6 C;  2KYF A;  1DTL A;  2GGZ A;  1H8B A;  1QIW A;  2NLN A;  5K89 A;  2LVV A;  1G4Y R;  4PE0 A;  1DF0 B;  1JSA A;  2AUC A;  1K8U A;  1F4O A;  2F3Z A;  2K7O A;  2ZN9 A;  5FYX A;  2K2A A;  1KFU S;  1SKT A;  1RRO A;  1OZS A;  3PSR A;  1YUS A;  1NCZ A;  4GFT A;  1HT9 A;  2LVJ A;  1QVI Y;  4AQJ A;  3OHM B;  1WRL A;  2HQ8 A;  1KK8 C;  2LAP A;  2NCO A;  4MZJ A;  2LUX A;  3TUY B;  2CCM A;  3EK4 A;  2Y1N A;  5DKQ A;  1A29 A;  1EH2 A;  1HQV A;  2GV5 A;  4DCK A;  2LP2 A;  1NCX A;  1IGV A;  2D8N A;  1SCM B;  2TN4 A;  1MXL C;  1B7T Y;  1JBA A;  1MF8 B;  1XFY O;  1KCY A;  4HRH A;  4MZL A;  2EHB A;  1CDM A;  2KFH A;  3IQO A;  3SIA A;  1J7O A;  2CT9 A;  1CMG A;  1DGU A;  1NIW A;  1YRU B;  2BBM A;  1CFF A;  1C07 A;  2JU0 A;  1CFD A;  1TNX A;  2FCD A;  3E3R A;  2KI4 C;  2ZN8 A;  2KDH A;  3LL8 B;  1DMO A;  3PN7 B;  4HRE E;  1S1E A;  1SBJ A;  2M8U A;  1LA3 A;  3I5I C;  1AUI B;  1F54 A;  2BE4 A;  3PFV A;  4UPG A;  4I5K A;  1K95 A;  3RM1 A;  3KPX A;  1KQV A;  1YVH A;  2LP3 A;  2BBN A;  2M0R A;  3CTN A;  3I5F B;  4P5O E;  2KOT A;  4XYN A;  1IKU A;  2L50 A;  3SG4 A;  1B4C A;  5JOL A;  1PK0 D;  1NSH A;  2Q4U A;  2K0J A;  4WRI A;  1SPY A;  4CFQ A;  3VRN A;  5G08 A;  3KF9 A;  4WQ2 A;  1H4B A;  4N1F A;  2WCB A;  1NYA A;  3I5H C;  1BF5 A;  3K21 A;  2SCP A;  1LXF C;  3SG3 A;  1MHO A;  2QPT A;  1YTZ C;  2KBM A;  5HYD A;  4DS7 A;  2I18 A;  2M29 A;  1TN4 A;  2NXQ A;  2NCP A;  2MBX A;  4DRW A;  5DKR A;  1CM1 A;  1QV1 A;  3HX4 A;  2OS8 C;  1JUO A;  1U5I A;  2A4J A;  1BG1 A;  1LKJ A;  4PCW A;  3BUW B;  3OX6 A;  4M2O A;  5PAL A;  4WQ3 A;  4M2P A;  1QX2 A;  3EK7 A;  3SG6 A;  3BUM B;  5JJG A;  3VRP A;  2JTZ A;  2GGM A;  1SMG A;  2K61 A;  1L7Z A;  2BEC A;  1TNQ A;  3CR2 A;  3DVK A;  3I5F C;  4PE7 A;  4YGE B;  1UHJ A;  5F6T A;  3DVE A;  2H61 A;  1BR4 B;  3EVU A;  4FTG A;  4QJ4 B;  1SYM A;  2I94 A;  2O60 A;  2EC6 B;  2M7N A;  1WLZ A;  1CKK A;  2BL0 C;  1UHK A;  4M2Q A;  1B9A A;  2Y5I A;  5DKN A;  1UUS A;  1AP4 A;  1V1F A;  1UHH A;  1YUT A;  1BU3 A;  1XFV O;  1F71 A;  1S6C A;  3NSK A;  3VRR A;  1BOC A;  1QAS A;  1ALW A;  2H2K A;  2M1U A;  1NCY A;  1EJ3 A;  3KHE A;  1Y1X A;  4A4C A;  4MEW A;  1Y0V H;  2LNK A;  1BLQ A;  4CFR A;  4PDZ A;  1QTX A;  1B47 A;  2L51 A;  2ZKM X;  1MQ1 A;  4NQG A;  1LVC D;  4YBH B;  3ZWH A;  3VRO A;  1NX3 A;  2JUL A;  3BOW B;  1PVB A;  1WRZ A;  3TDI A;  1UWO A;  1XA5 A;  1ZUZ A;  1S5G Z;  5CSN A;  1GJY A;  2BCA A;  1QV0 A;  4JWQ A;  5CSF A;  5HLO A;  1SY9 A;  1NX2 A;  2CTN A;  5HKZ A;  4MN0 A;  2KAX A;  5KU1 A;  1F8H A;  1A03 A;  1TTX A;  2KI6 D;  1NWD A;  1IQ3 A;  3NSO A;  1J1E A;  2FOT A;  2JXL A;  1UUR A;  2KI4 B;  4YRU A;  3NXA A;  1J7Q A;  1QAT A;  3WNX B;  1MWN A;  2F3Y A;  2B1U A;  3A4U B;  1GQM A;  3I5I B;  5CSI A;  1TRF A;  1TCF A;  1F70 A;  4ZCU A;  1WRK A;  2MAZ A;  2M97 A;  2ZND A;  1BJF A;  2MJW B;  1IJ6 A;  1K9P A;  1FF1 A;  5ER4 X;  5CSJ A;  4OVN F;  1PAL A;  2JT8 A;  2KFF A;  1EG3 A;  4MLW A;  1K90 D;  1CDL A;  1S6I A;  2G9B A;  2K7B A;  3HCM A;  3SJS A;  1KK7 Y;  3PLF B;  2WC8 A;  1CLL A;  2ZNE A;  3I5H B;  4ICB A;  1RWY A;  4A4B A;  3DVJ A;  2JT3 A;  1NPQ A;  4IL1 A;  4C0K A;  1FW4 A;  2M49 B;  4C0J A;  2LMV A;  2LC5 A;  1EXR A;  2KNE A;  2JNX A;  2PAL A;  2LVI A;  2JTT A;  4FQO A;  2JQ6 A;  4PE4 A;  2OS8 B;  1VRK A;  3BUO B;  3CGA A;  4DIR A;  1NX0 A;  1CLM A;  4C0L A;  1DJG A;  1CTR A;  1SL8 A;  1J55 A;  2PAS A;  5TNC A;  4JQ0 D;  4ORB B;  1A4P A;  1AJ5 A;  1QJT A;  2CXJ A;  3TS5 C;  1XK4 A;  1UHN A;  1LA0 A;  3D0Y A;  1CNP A;  1JF2 A;  4L9M A;  4GNK B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...