1Y0VH

Crystal structure of anthrax edema factor (ef) in complex with calmodulin and pyrophosphate
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
146
structure length
146
Chain Sequence
AATEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMTAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Calmodulin-sensitive adenylate cyclase
publication title Calcium-independent calmodulin binding and two-metal-ion catalytic mechanism of anthrax edema factor
pubmed doi rcsb
source organism Bacillus anthracis
molecule tags Lyase
total genus 27
structure length 146
sequence length 146
chains with identical sequence I, J, K, L, M
ec nomenclature
pdb deposition date 2004-11-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1y0vH01
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1y0vH02
3CR4X 2EHBA 1NYAA 4AQJA 1XK4A 3BOWB 1XYDA 2MJWB 1CFCA 4PHNA 3OHMB 1WDCC 1YUUA 2L98A 2JULA 4YRUA 3A4UB 3SJSA 1GQMA 1NX2A 4YGBB 5F6TA 2M8UA 2DOQA 3PM8A 1FI5A 1C7WA 2ZKMX 4DRWA 1TNWA 1TRFA 3NSOA 5G08A 2KDHA 1UP5A 1KFXL 2KFFA 3DVKA 4GBAA 2WCFA 4MEWA 4PDZA 1BODA 3KO0A 3EK7A 3DVJA 4NDCA 2M7LA 1GGZA 2I18A 3EVRA 3D10A 2LVKA 2MLFC 4GUKA 1BF5A 1AUIB 2BBNA 2JZIA 2TN4A 5HLVA 1Y1UA 4DIRA 2I7AA 2FJUB 1K9KA 1BJFA 5HLOA 4NQGA 1YVLA 1F8HA 1YUTA 3CS1A 2KBIA 5BPJA 3A8RA 1CM4A 2ZFDA 4XYNA 2KNEA 2LVVA 1CKKA 2F8PA 4FTGA 1YX8A 2LP3A 5HKWA 2E30A 3FWCA 2SASA 2F2OA 5AFPA 3KHEA 1SK6D 2A4JA 2BL0B 1A03A 1AJ5A 4YGDB 2PSRA 1KWOB 2QACA 2ZN8A 2OS8C 1ZFSA 1S6JA 2LVJA 1PK0D 3BUNB 4PE0A 3GK2A 1BLQA 2G2BA 3PN7C 1JSAA 4MZKA 1MXLC 4TNCA 1IWQA 3SG2A 2KBMA 3FWBA 2K61A 1QS7A 5KTYA 3PALA 3VRQA 1RECA 2P6BB 1CDNA 1C7VA 1SW8A 2Q4UA 1S5GZ 1L2OC 4GNKB 2KGRA 1TCOB 2KSPA 3GOFA 2LLTA 3PATA 3PSRA 1AVSA 1Y6WA 1M45A 2KQYA 1OQPA 3PFVA 3DD4A 1SL7A 2CCMA 1QIWA 2JXCA 1NWDA 4OKHA 3SG5A 3LCPC 4F0ZB 2M29A 1SR6C 3AAJA 1OSAA 2MHHA 1RFJA 4ZCVA 4DCKA 1JC2A 1KFUL 1B7TZ 5IBWA 1QJTA 1UHJA 2OTGB 1GJYA 1EH2A 2L4IA 2WNDA 2CTNA 1HT9A 4N1FA 1DF0A 3WNXB 2QPTA 1YRUB 1WDCB 3I5HB 1YR5A 1CDPA 1G33A 3GK1A 1OE9B 1SL9A 4HRHA 1EG3A 3BUWB 3PLFB 4YGCB 1MUXA 1GGWA 1SYMA 5HKYA 1SPYA 2H61A 1K9UA 1NCXA 2KOTA 2Y5IA 5DKRA 1QIVA 1JWDA 5J3XA 1DJIA 2KFGA 1DMOA 3OX5A 1B8CA 4QJ3B 2MA2A 5TNCA 3M0WA 2BCBA 1QV1A 1XFWO 1LA0A 1UUSA 1XVJA 3WHUB 1JFKA 1TOPA 4PCWA 1ZMZA 1YUSA 3BQ3A 3IF7A 4MVFA 4DS7A 5AERA 1Q80A 1OMDA 1M46A 1BR1B 1XA5A 1B1GA 2HQ8A 1PALA 1BMOA 1IJ6A 1S1EA 2I2RE 2JTTA 2K7OA 2WC8A 3JVTC 1EJ3A 1LVCD 4FQOA 1M63B 3I5IC 3SG7A 1QX2A 1RK9A 4PE4A 1XFZO 2WCEA 3F45A 1LXFC 1F4QA 1NPQA 2JRFA 4NDBA 2G9BA 1J7QA 5CSIA 3NSKA 5DKNA 1YURA 2K2AA 2BE4A 3RLZA 4QJ4B 2AMIA 3OB1B 2EC6C 3I5FC 1J1DA 1DTLA 1K90D 1S36A 5GQQC 1HQVA 4ORBB 4XJKB 2KYCA 3WHTB 3OX6A 1WLZA 3VGOA 3LK0A 1TTXA 2LLSA 1M39A 3EK8A 2GGMA 2OS8B 2PRUA 1TNQA 4I5LB 2M3WA 2MBXA 1UHIA 1F55A 1NIWA 2IS9A 1S3PA 1CDLA 4IL1A 3PN7B 3OP0A 1E8AA 1N0YA 4WQ2A 5D7FA 1MXEA 1KK8C 1TNXA 1JUOA 3KEVA 2JU0A 4AQIA 2H61C 2Y1MA 1L2OB 1LA3A 2PALA 1CLLA 2M7NA 1F71A 1JBAA 2KI6C 5I8NA 1LKJA 2H2KA 1R2UA 2FCEA 1IH0A 1NX1A 1S26D 3DVEA 1CLBA 1B8LA 2FCDA 4USLA 1S6CA 4PHMA 1NCZA 5KU1A 1J1EA 3VRRA 2KI4C 1TIZA 1B9AA 4E68A 2LCPA 4PE1A 1KCYA 4PHKA 5I2QA 2M97A 5AXIA 3CZTX 1SR6B 4GPLB 1UHNA 2JPTA 4ORAB 4AOMA 3CR2A 4UPGA 2SCPA 2NLNA 1PULA 4YBHB 3K21A 2CT9A 3TDIA 1XFVO 2L5XB 1KSOA 4MRXA 1B4CA 1QLSA 4GAOA 4WRIA 4C0JA 1MWNA 5K89A 1EXRA 1MF8B 1RJVA 1W7IB 1XFUO 1DJHA 1WLMA 3O6BA 5I2LA 1CFFA 3KPXA 1CB1A 3SIAA 3JTDB 4PHJA 2JQ6A 4YI9A 4OV2A 2RGIA 1V1GA 2WCBA 1CDMA 3CGAA 3O78A 4L9MA 4MZLA 1SCVA 4U8DA 3EVVA 4MRYA 1Y0VH 1J7OA 4PALA 4N1GA 2LHLA 1WRLA 1AK8A 1AP4A 3BUOB 4Q04A 3RM1A 1L7ZA 1JF2A 1TCFA 4OVNF 1BU3A 2L51A 1KQVA 1KSMA 3TS5C 1NX3A 2LHIA 3TDZA 4C0LA 1DJYA 1OMRA 2O60A 4M2PA 3CR5X 2HPSA 4OR9B 2F2PA 2I94A 1ALVA 1DVIA 3HCMA 1XFYO 3JVTB 2BCXA 1SL8A 2BKHB 4I5JA 1SKTA 2LUCA 1KQMC 2AUCA 3I5IB 3EK4A 3I5GC 5ER4X 2LV7A 3IQOA 2V53A 2M0RA 4QJ5B 4CIDA 1SCMC 2NXQA 4CFRA 3NSIA 4GGFC 4HSZA 3TUYC 2LMVA 3EKHA 2WOSA 2WORA 1KK7Y 2EC6B 4CFQA 3I5FB 3O2PA 1K9PA 3TZ1A 3ZWHA 2LMTA 1RWYA 2HQWA 1TN4A 1W7JB 1NP8A 2GGZA 4MN0A 1PVAA 1QV0A 2VRGA 1QVIY 4R1EA 2PASA 5DKQA 5D69A 1CNPA 2Y4QA 4MLWA 1K2HA 1SBJA 2KAYA 4GGNA 1VRKA 5CPVA 4A4BA 1SMGA 5JJGA 2PMYA 2LVIA 3LK1A 1DF0B 2JTZA 1UWOA 3QRXA 1D1OA 1SRAA 2ZRSA 1U5IA 2M1KB 3GK4X 2BCAA 1J55A 1KK8B 4CLNA 1NCYA 1CM1A 1Y1XA 1EG4A 3CTNA 4OCIA 1G4YR 3IQQA 1ZUZA 1UHHA 1NUBA 1YRTB 1BOCA 4I5KA 5FYXA 1SNLA 2LMUA 2PVBA 3LLEA 1KFXS 2LANA 1DJWA 2LAPA 2Q91A 1N65A 3KF9A 3D0YA 1QX5B 3VROA 2K7BA 2F3YA 2JT8A 2JNFA 1S6IA 1OMVA 1OZOA 1IGVA 1ZACA 2E6WA 3AKBA 3I5HC 2KI4B 3SG4A 1A75A 1QTXA 2LC5A 4NDDA 1XO5A 1DGVA 1QXPA 1IRJA 2K0JA 1QX7A 2EGDA 4DUQA 1F4OA 5B8IB 4BY5A 1ALWA 2ZNEA 4HREE 5KSZA 1FW4A 3BYAA 2CXJA 3HX4A 1J7RA 1MQ1A 1K93D 2HF5A 1U5IB 1FBVA 2Y1NA 3MSEB 1FI6A 2BBMA 2BKIB 1FPWA 1UURA 2JNXA 5JOLA 5AANA 1LINA 1PRWA 2MAZA 3BUMB 2NCOA 4MBEA 1DT7B 1IKUA 3DVMA 2LP2A 4HRGA 1ZOTB 2L4HA 3D0YB 1IQ3A 1PVBA 5ER5A 4MZJA 4PE7A 3BUXB 4GGFA 1A75B 1DGUA 4ZCUA 2BECA 2KYFA 4JWQA 3CLNA 5HYDA 2JOJA 2K8MB 1CLMA 4ICBA 2KQ6A 3CWGA 4YGAA 1DJXA 2AAOA 2MLEC 4MSPA 3TS5B 2M1UA 3DF0A 1J7PA 1JF0A 3H4SE 2KFHA 2F3ZA 3NSLA 3VRPA 5HKZA 2KHNA 4P2YB 2ZNDA 1FF1A 3SIBA 2LUXA 1NSHA 5AEQA 4P5OE 1BG1A 1ODBA 2BE6A 3C1VA 2JT3A 4JPZB 3AAKA 5CSFA 1SY9A 2HETA 1DJGA 4YI8A 1TNPA 1M31A 1XK4C 4ETOA 1XFXO 1BT6A 2OPOA 1KQMB 1H4BA 1V1FA 1A2XA 3I5GB 2JT0A 1B47A 1PSBA 3BXKA 1UHKA 2B1UA 1R6PA 2M49B 1SCMB 4BY4A 1NX0A 3TUYB 2K7CA 1QATA 1S5GY 1KFUS 1QLKA 1WY9A 2LNKA 1MR8A 4JQ0D 2JXLA 1A29A 4C0KA 1F70A 3VRNA 4YGEB 2K7DA 3DF0B 2FOTA 3LL8B 1CMGA 2GV5A 2L0PA 3SG3A 4CPVA 2BL0C 3O4YA 1YX7A 5PALA 5I2OA 1F54A 2JWWA 1IG5A 1G8IA 1OZSA 2JC2A 4WQ3A 1WRKA 1WRZA 1KWOC 1EL4A 4M2QA 4GFTA 1RROA 3NXAA 1YVHA 5CSJA 2K2FA 3EVUA 1N2DA 1H8BA 1MHOA 2KAXA 4M2OA 1IQ5A 1B7TY 1K94A 3FS7A 2R2IA 1JFJA 1CFDA 3TDUA 1K95A 2O5GA 2ZRTA 1CTRA 2D8NA 3FIAA 1CMFA 1Y1AA 2NCPA 3BOWA 1KK7Z 2ISDA 1AJ4A 1YTZC 1QASA 3E3RA 3SG6A 2LM5A 2KI6D 1CFPA 2KGBC 1QVIZ 1RTP1 3JTDC 2LE9B 3WXAA 1B8RA 2CNPA 1K8UA 5CSNA 1A4PA 2L2EA 3EKJA 4I5NB 2MRDA 2F33A 1IJ5A 4D1EA 3ZNIA 3AKAA 1BR4B 1OOJA 1X02A 2L50A 4ORCB 1PSRA 2COLB 4XJKA 4A4CA 1DJZA 1AHRA 1K96A 2KAVA 2LLUA 3OB2B 2M9GA 3ICBA 4N5XA 2NZ0A 2OTGC 2ZN9A 1C07A 2CBLA
chains in the Genus database with same CATH superfamily
2H8VA 3CR4X 2EHBA 3S0FA 2L2CA 1NYAA 4AQJA 1XK4A 3BOWB 1XYDA 2MJWB 1CFCA 4JD9A 4PHNA 3OHMB 1WDCC 1YUUA 2L98A 2JULA 4YRUA 3A4UB 3SJSA 1GQMA 1NX2A 4YGBB 5F6TA 2M8UA 3O4XA 2DOQA 3PM8A 3NHTA 1FI5A 1C7WA 2ZKMX 4DRWA 3R1PA 1TNWA 1TRFA 3NSOA 3R1VA 5G08A 2KDHA 1UP5A 1KFXL 2KFFA 3CZ0A 5FYXA 3DVKA 4GBAA 2WCFA 4MEWA 1OOHA 4PDZA 1BODA 3KO0A 3EK7A 3DVJA 4NDCA 2M7LA 1GGZA 2I18A 3EVRA 3D10A 3OBVA 2LVKA 2MLFC 4GUKA 1BF5A 1AUIB 2BBNA 2JZIA 2TN4A 2YGUA 1Y1UA 5HLVA 2I7AA 4DIRA 2FJUB 3DXLA 1K9KA 1BJFA 5HLOA 4NQGA 1YVLA 1F8HA 1YUTA 3CS1A 2KBIA 5BPJA 3A8RA 1CM4A 2ZFDA 4XYNA 2KNEA 2LVVA 1CKKA 2KLDA 2F8PA 4FTGA 3CYZA 1YX8A 2QEVA 2LP3A 5HKWA 2WCJA 2E30A 3RZSA 3FWCA 2SASA 2F2OA 5AFPA 3KHEA 1SK6D 2A4JA 2BL0B 1A03A 1AJ5A 4YGDB 2PSRA 1KWOB 2QACA 2ZN8A 2OS8C 1ZFSA 1S6JA 2LVJA 1PK0D 3BUNB 4PE0A 3BFAA 3GK2A 3FE6A 2G2BA 3PN7C 1BLQA 4MZKA 1MXLC 4TNCA 1JSAA 1IWQA 3SG2A 2KBMA 2KPHA 3FWBA 2K61A 1QS7A 5KTYA 3PALA 3UO9A 3VRQA 1RECA 2P6BB 1CDNA 1C7VA 1SW8A 2Q4UA 1S5GZ 1L2OC 3SS4A 4GNKB 2KGRA 1TCOB 2KSPA 3GOFA 2LLTA 3PATA 3OGNA 3PSRA 1AVSA 1Y6WA 1M45A 2KQYA 1OQPA 3VB1A 1TUJA 3PFVA 2P71A 3DD4A 1SL7A 2CCMA 1QIWA 2JXCA 1NWDA 4OKHA 1T14A 3SG5A 3LCPC 4F0ZB 2M29A 1SR6C 3AAJA 1OSAA 2MHHA 1RFJA 4ZCVA 4DCKA 1JC2A 1KFUL 1B7TZ 2WCMA 3NGVA 5IBWA 1QJTA 1UHJA 2OTGB 1GJYA 3D78A 1EH2A 2L4IA 5FI7A 2WNDA 2CTNA 1HT9A 4N1FA 3B86A 1DF0A 3WNXB 2QPTA 1YRUB 1WDCB 3I5HB 1YR5A 1CDPA 1G33A 3GK1A 1OE9B 2QEOA 1SL9A 4HRHA 1EG3A 3BUWB 3IVTA 3PLFB 1MUXA 4YGCB 1GGWA 1SYMA 5HKYA 1SPYA 2H61A 1K9UA 1NCXA 2KOTA 2Y5IA 5DKRA 1QIVA 1JWDA 5J3XA 1DJIA 2KFGA 2QEBA 1DMOA 3OX5A 1B8CA 4QJ3B 2MA2A 3CZ1A 2PQLA 5TNCA 3M0WA 2BCBA 1QV1A 1XFWO 1LA0A 1UUSA 1XVJA 3WHUB 3B6XA 1JFKA 1TOPA 4PCWA 1ZMZA 1YUSA 3BQ3A 3IF7A 4MVFA 2QDIA 4DS7A 5AERA 1Q80A 1OMDA 1M46A 1BR1B 1XA5A 1B1GA 2HQ8A 1PALA 1BMOA 1IJ6A 1S1EA 2I2RE 2JTTA 2K7OA 2WC8A 3JVTC 3V2LA 1EJ3A 1IIOA 1LVCD 4FQOA 1M63B 3I5IC 3SG7A 1QX2A 1RK9A 4PE4A 1XFZO 2WCEA 3F45A 1LXFC 1F4QA 1NPQA 2JRFA 1TUZA 4NDBA 2G9BA 1J7QA 5CSIA 3NSKA 5DKNA 1YURA 2K2AA 2BE4A 3RLZA 4QJ4B 2AMIA 3OB1B 2EC6C 1P28A 3FE9A 3I5FC 1J1DA 1DTLA 1K90D 1S36A 5GQQC 1HQVA 4ORBB 4XJKB 2KYCA 3WHTB 5D3OA 3OX6A 1WLZA 3VGOA 3LK0A 1TTXA 2LLSA 3PM2A 1M39A 2P70A 3EK8A 2GGMA 2OS8B 2PRUA 1TWOA 1DEKA 1TNQA 4I5LB 2M3WA 2MBXA 1UHIA 1F55A 1NIWA 2IS9A 1S3PA 1CDLA 4IL1A 5DICA 3PN7B 3OP0A 1E8AA 1N0YA 4WQ2A 5D7FA 1MXEA 1KK8C 1TNXA 1JUOA 3KEVA 2JU0A 4AQIA 2H61C 2Y1MA 1L2OB 1LA3A 2PALA 3S0EA 3EG5B 1CLLA 2M7NA 1F71A 1JBAA 2KI6C 5I8NA 1LKJA 2H2KA 1R2UA 2FCEA 4F7FA 1NX1A 3S0DA 1IH0A 1S26D 1SSEB 3DVEA 1CLBA 1B8LA 2FCDA 3D73A 4USLA 1S6CA 4PHMA 1NCZA 5EL2A 5KU1A 1J1EA 3VRRA 2KI4C 3PJIA 1TIZA 1B9AA 4IJ7A 4E68A 2LCPA 4PE1A 1KCYA 4PHKA 5I2QA 2M97A 5AXIA 3CZTX 1SR6B 4GPLB 1UHNA 2JPTA 4ORAB 4AOMA 3CR2A 4UPGA 2SCPA 2NLNA 3D74A 1PULA 4YBHB 3BFBA 3K21A 2CT9A 3TDIA 1XFVO 2L5XB 1KSOA 4MRXA 1B4CA 1QLSA 4GAOA 4WRIA 3S0GA 4C0JA 1MWNA 2FJYA 5K89A 1EXRA 1MF8B 1RJVA 1W7IB 1XFUO 1DJHA 1WLMA 3O6BA 2L5YA 5I2LA 1DC1A 1CFFA 3KPXA 1CB1A 3SIAA 3JTDB 4PHJA 4KYNA 2JQ6A 4YI9A 4OV2A 2RGIA 1V1GA 2WCBA 1CDMA 3CGAA 3O78A 4L9MA 4MZLA 1SCVA 3B7AA 3EVVA 4MRYA 1Y0VH 4U8DA 1J7OA 4PALA 4N1GA 2LHLA 1WRLA 3DZTA 1AK8A 1AP4A 3BUOB 4Q04A 3RM1A 1L7ZA 1JF2A 1TCFA 4OVNF 1BU3A 2L51A 1KQVA 1KSMA 3TS5C 3D75A 2JPOA 1NX3A 2LHIA 3TDZA 4C0LA 1DJYA 1OMRA 2O60A 3L47A 4M2PA 1Z2CB 4INXA 3CR5X 2HPSA 4OR9B 2F2PA 2I94A 1ALVA 1DVIA 2K60A 1XFYO 3HCMA 3JVTB 2BCXA 1SL8A 2BKHB 4I5JA 1SKTA 2LUCA 4FQTA 1KQMC 2AUCA 3I5IB 3EK4A 3I5GC 5ER4X 2LV7A 1OW4A 3N7HA 3IQOA 4OZDA 2V53A 2M0RA 2PYQA 4QJ5B 4CIDA 1SCMC 2NXQA 4CFRA 3NSIA 4GGFC 4HSZA 3TUYC 2LMVA 3EKHA 2WOSA 2WORA 1KK7Y 2EC6B 3FE8A 4CFQA 3I5FB 3O2PA 1K9PA 3TZ1A 3ZWHA 2LMTA 1RWYA 5HL1A 2HQWA 1TN4A 1W7JB 3B87A 1NP8A 2GGZA 4MN0A 1PVAA 1QV0A 2VRGA 1QVIY 4R1EA 2PASA 5DKQA 1W9ZA 5D69A 1CNPA 2Y4QA 4MLWA 1K2HA 1SBJA 2KAYA 4GGNA 1VRKA 5CPVA 4A4BA 1SMGA 2ERBA 5JJGA 2PMYA 3D76A 2LVIA 3LK1A 1QWVA 1DF0B 2GTEA 5FI6A 2JTZA 1UWOA 3QRXA 1D1OA 1SRAA 2WC6A 2ZRSA 1U5IA 2M1KB 3GK4X 2BCAA 1J55A 4JKTA 1KK8B 4CLNA 1NCYA 1CM1A 1Y1XA 1EG4A 3CTNA 3R72A 4OCIA 1G4YR 3R1OA 3IQQA 1ZUZA 1UHHA 1NUBA 1YRTB 1BOCA 1DQEA 3DYEA 1OOFA 4I5KA 2BAPA 1SNLA 2LMUA 2PVBA 3LLEA 1KFXS 2LANA 1DJWA 2LAPA 2Q91A 1N65A 3KF9A 3D0YA 1QX5B 4PT1A 3VROA 2K7BA 3CABA 2F3YA 2JT8A 2JNFA 1S6IA 1OMVA 1OZOA 1IGVA 1ZACA 2E6WA 3AKBA 2WC5A 2KI4B 3I5HC 3Q8IA 3SG4A 1A75A 1QTXA 2LC5A 3L4AA 4NDDA 1XO5A 2WCKA 1DGVA 1QXPA 1IRJA 2K0JA 1QX7A 2EGDA 4DUQA 1F4OA 5B8IB 4BY5A 1ALWA 2ZNEA 4HREE 5KSZA 1FW4A 1XFRA 3BYAA 1C3ZA 2CXJA 3HX4A 1J7RA 1MQ1A 1K93D 2HF5A 1U5IB 1FBVA 2Y1NA 3MSEB 3S0BA 3CZ2A 1FI6A 2BBMA 2BKIB 5I94A 1FPWA 1UURA 2JNXA 5JOLA 5AANA 1LINA 1PRWA 2MAZA 3BUMB 2NCOA 4MBEA 1DT7B 1IKUA 3DVMA 2LP2A 4HRGA 1ZOTB 3SS3A 2L4HA 1ORGA 3D0YB 1IQ3A 1PVBA 5ER5A 4MZJA 4PE7A 3BUXB 3S0AA 4GGFA 1A75B 1DGUA 4ZCUA 2BECA 2KYFA 4JWQA 3CLNA 5HYDA 2JOJA 2K8MB 1CLMA 4ICBA 2KQ6A 3BFHA 3CWGA 4YGAA 1DJXA 2AAOA 2MLEC 3B88A 4MSPA 3TS5B 2M1UA 3DF0A 1J7PA 1JF0A 3H4SE 2KFHA 2F3ZA 3NSLA 3VRPA 5HKZA 2KHNA 4P2YB 2ZNDA 1FF1A 3SIBA 2LUXA 1NSHA 5AEQA 4P5OE 1BG1A 1ODBA 2BE6A 3C1VA 2JT3A 4JPZB 3AAKA 5CSFA 1SY9A 2HETA 1DJGA 3CDNA 1TNPA 1M31A 1XK4C 4YI8A 4ETOA 1XFXO 1BT6A 2OPOA 1KQMB 1H4BA 1V1FA 1A2XA 3I5GB 2JT0A 1B47A 1PSBA 3K1EA 3BXKA 1UHKA 2B1UA 1R6PA 2M49B 3NHIA 5FI2A 1SCMB 4BY4A 1NX0A 3TUYB 2K7CA 3DY9A 1QATA 1S5GY 1KFUS 1QLKA 1WY9A 2LNKA 1MR8A 3D77A 4JQ0D 1GM0A 2JXLA 1A29A 4C0KA 1F70A 3VRNA 4YGEB 3UNWA 2K7DA 3DF0B 2FOTA 3LL8B 1CMGA 2GV5A 2L0PA 2WCHA 3SG3A 4CPVA 2BL0C 3O4YA 1YX7A 5PALA 1Z4HA 5I2OA 2JWWA 1F54A 1IG5A 1OOIX 1G8IA 1OZSA 2JC2A 4WQ3A 1WRKA 1WRZA 1KWOC 1EL4A 4M2QA 4GFTA 1RROA 2KLEA 1YVHA 3NXAA 2K2FA 5CSJA 3EVUA 1N2DA 1H8BA 1MHOA 2KAXA 4M2OA 1IQ5A 1B7TY 1K94A 3FS7A 2R2IA 1JFJA 1CFDA 3TDUA 1K95A 2O5GA 2ZRTA 1CTRA 2D8NA 3FIAA 1CMFA 1Y1AA 2NCPA 2QEHA 3BOWA 1KK7Z 2BNXA 2ISDA 1AJ4A 1YTZC 1DELA 1QASA 3E3RA 3SG6A 2LM5A 2KI6D 4INWA 1CFPA 2KGBC 1QVIZ 1RTP1 3JTDC 2WCLA 3SS5A 2LE9B 3WXAA 1B8RA 2CNPA 1K8UA 5CSNA 1A4PA 2L2EA 3EKJA 3L4LA 4I5NB 2MRDA 3BJHA 2F33A 1IJ5A 4D1EA 3ZNIA 3AKAA 1BR4B 1OOJA 1X02A 2L50A 4ORCB 1PSRA 2COLB 4XJKA 4A4CA 1DJZA 1AHRA 1K96A 2KAVA 2LLUA 3OB2B 1C3YA 1OOGA 2M9GA 3ICBA 4N5XA 2NZ0A 2OTGC 1LS8A 3QMEA 2ZN9A 1C07A 2CBLA
chains in the Genus database with same CATH topology
3CR4X 2EHBA 1NYAA 4AQJA 1XK4A 3BOWB 1XYDA 2MJWB 1CFCA 4PHNA 3OHMB 1WDCC 1YUUA 2L98A 2JULA 4YRUA 3A4UB 3SJSA 1GQMA 1NX2A 4YGBB 5F6TA 2M8UA 2DOQA 3PM8A 1FI5A 1C7WA 2ZKMX 4DRWA 1TNWA 1TRFA 3NSOA 5G08A 2KDHA 1UP5A 1KFXL 2KFFA 3DVKA 4GBAA 2WCFA 4MEWA 4PDZA 1BODA 3KO0A 3EK7A 3DVJA 4NDCA 2M7LA 1GGZA 2I18A 3EVRA 3D10A 2LVKA 2MLFC 4GUKA 1BF5A 1AUIB 2BBNA 2JZIA 2TN4A 5HLVA 1Y1UA 4DIRA 2I7AA 2FJUB 1K9KA 1BJFA 5HLOA 4NQGA 1YVLA 1F8HA 1YUTA 3CS1A 2KBIA 5BPJA 3A8RA 1CM4A 2ZFDA 4XYNA 2KNEA 2LVVA 1CKKA 2F8PA 4FTGA 1YX8A 2LP3A 5HKWA 2E30A 3FWCA 2SASA 2F2OA 5AFPA 3KHEA 1SK6D 2A4JA 2BL0B 1A03A 1AJ5A 4YGDB 2PSRA 1KWOB 2QACA 2ZN8A 2OS8C 1ZFSA 1S6JA 2LVJA 1PK0D 3BUNB 4PE0A 3GK2A 1BLQA 2G2BA 3PN7C 1JSAA 4MZKA 1MXLC 4TNCA 1IWQA 3SG2A 2KBMA 3FWBA 2K61A 1QS7A 5KTYA 3PALA 3VRQA 1RECA 2P6BB 1CDNA 1C7VA 1SW8A 2Q4UA 1S5GZ 1L2OC 4GNKB 2KGRA 1TCOB 2KSPA 3GOFA 2LLTA 3PATA 3PSRA 1AVSA 1Y6WA 1M45A 2KQYA 1OQPA 3PFVA 3DD4A 1SL7A 2CCMA 1QIWA 2JXCA 1NWDA 4OKHA 3SG5A 3LCPC 4F0ZB 2M29A 1SR6C 3AAJA 1OSAA 2MHHA 1RFJA 4ZCVA 4DCKA 1JC2A 1KFUL 1B7TZ 5IBWA 1QJTA 1UHJA 2OTGB 1GJYA 1EH2A 2L4IA 2WNDA 2CTNA 1HT9A 4N1FA 1DF0A 3WNXB 2QPTA 1YRUB 1WDCB 3I5HB 1YR5A 1CDPA 1G33A 3GK1A 1OE9B 1SL9A 4HRHA 1EG3A 3BUWB 3PLFB 4YGCB 1MUXA 1GGWA 1SYMA 5HKYA 1SPYA 2H61A 1K9UA 1NCXA 2KOTA 2Y5IA 5DKRA 1QIVA 1JWDA 5J3XA 1DJIA 2KFGA 1DMOA 3OX5A 1B8CA 4QJ3B 2MA2A 5TNCA 3M0WA 2BCBA 1QV1A 1XFWO 1LA0A 1UUSA 1XVJA 3WHUB 1JFKA 1TOPA 4PCWA 1ZMZA 1YUSA 3BQ3A 3IF7A 4MVFA 4DS7A 5AERA 1Q80A 1OMDA 1M46A 1BR1B 1XA5A 1B1GA 2HQ8A 1PALA 1BMOA 1IJ6A 1S1EA 2I2RE 2JTTA 2K7OA 2WC8A 3JVTC 1EJ3A 1LVCD 4FQOA 1M63B 3I5IC 3SG7A 1QX2A 1RK9A 4PE4A 1XFZO 2WCEA 3F45A 1LXFC 1F4QA 1NPQA 2JRFA 4NDBA 2G9BA 1J7QA 5CSIA 3NSKA 5DKNA 1YURA 2K2AA 2BE4A 3RLZA 4QJ4B 2AMIA 3OB1B 2EC6C 3I5FC 1J1DA 1DTLA 1K90D 1S36A 5GQQC 1HQVA 4ORBB 4XJKB 2KYCA 3WHTB 3OX6A 1WLZA 3VGOA 3LK0A 1TTXA 2LLSA 1M39A 3EK8A 2GGMA 2OS8B 2PRUA 1TNQA 4I5LB 2M3WA 2MBXA 1UHIA 1F55A 1NIWA 2IS9A 1S3PA 1CDLA 4IL1A 3PN7B 3OP0A 1E8AA 1N0YA 4WQ2A 5D7FA 1MXEA 1KK8C 1TNXA 1JUOA 3KEVA 2JU0A 4AQIA 2H61C 2Y1MA 1L2OB 1LA3A 2PALA 1CLLA 2M7NA 1F71A 1JBAA 2KI6C 5I8NA 1LKJA 2H2KA 1R2UA 2FCEA 1IH0A 1NX1A 1S26D 3DVEA 1CLBA 1B8LA 2FCDA 4USLA 1S6CA 4PHMA 1NCZA 5KU1A 1J1EA 3VRRA 2KI4C 1TIZA 1B9AA 4E68A 2LCPA 4PE1A 1KCYA 4PHKA 5I2QA 2M97A 5AXIA 3CZTX 1SR6B 4GPLB 1UHNA 2JPTA 4ORAB 4AOMA 3CR2A 4UPGA 2SCPA 2NLNA 1PULA 4YBHB 3K21A 2CT9A 3TDIA 1XFVO 2L5XB 1KSOA 4MRXA 1B4CA 1QLSA 4GAOA 4WRIA 4C0JA 1MWNA 5K89A 1EXRA 1MF8B 1RJVA 1W7IB 1XFUO 1DJHA 1WLMA 3O6BA 5I2LA 1CFFA 3KPXA 1CB1A 3SIAA 3JTDB 4PHJA 2JQ6A 4YI9A 4OV2A 2RGIA 1V1GA 2WCBA 1CDMA 3CGAA 3O78A 4L9MA 4MZLA 1SCVA 4U8DA 3EVVA 4MRYA 1Y0VH 1J7OA 4PALA 4N1GA 2LHLA 1WRLA 1AK8A 1AP4A 3BUOB 4Q04A 3RM1A 1L7ZA 1JF2A 1TCFA 4OVNF 1BU3A 2L51A 1KQVA 1KSMA 3TS5C 1NX3A 2LHIA 3TDZA 4C0LA 1DJYA 1OMRA 2O60A 4M2PA 3CR5X 2HPSA 4OR9B 2F2PA 2I94A 1ALVA 1DVIA 3HCMA 1XFYO 3JVTB 2BCXA 1SL8A 2BKHB 4I5JA 1SKTA 2LUCA 1KQMC 2AUCA 3I5IB 3EK4A 3I5GC 5ER4X 2LV7A 3IQOA 2V53A 2M0RA 4QJ5B 4CIDA 1SCMC 2NXQA 4CFRA 3NSIA 4GGFC 4HSZA 3TUYC 2LMVA 3EKHA 2WOSA 2WORA 1KK7Y 2EC6B 4CFQA 3I5FB 3O2PA 1K9PA 3TZ1A 3ZWHA 2LMTA 1RWYA 2HQWA 1TN4A 1W7JB 1NP8A 2GGZA 4MN0A 1PVAA 1QV0A 2VRGA 1QVIY 4R1EA 2PASA 5DKQA 5D69A 1CNPA 2Y4QA 4MLWA 1K2HA 1SBJA 2KAYA 4GGNA 1VRKA 5CPVA 4A4BA 1SMGA 5JJGA 2PMYA 2LVIA 3LK1A 1DF0B 2JTZA 1UWOA 3QRXA 1D1OA 1SRAA 2ZRSA 1U5IA 2M1KB 3GK4X 2BCAA 1J55A 1KK8B 4CLNA 1NCYA 1CM1A 1Y1XA 1EG4A 3CTNA 4OCIA 1G4YR 3IQQA 1ZUZA 1UHHA 1NUBA 1YRTB 1BOCA 4I5KA 5FYXA 1SNLA 2LMUA 2PVBA 3LLEA 1KFXS 2LANA 1DJWA 2LAPA 2Q91A 1N65A 3KF9A 3D0YA 1QX5B 3VROA 2K7BA 2F3YA 2JT8A 2JNFA 1S6IA 1OMVA 1OZOA 1IGVA 1ZACA 2E6WA 3AKBA 3I5HC 2KI4B 3SG4A 1A75A 1QTXA 2LC5A 4NDDA 1XO5A 1DGVA 1QXPA 1IRJA 2K0JA 1QX7A 2EGDA 4DUQA 1F4OA 5B8IB 4BY5A 1ALWA 2ZNEA 4HREE 5KSZA 1FW4A 3BYAA 2CXJA 3HX4A 1J7RA 1MQ1A 1K93D 2HF5A 1U5IB 1FBVA 2Y1NA 3MSEB 1FI6A 2BBMA 2BKIB 1FPWA 1UURA 2JNXA 5JOLA 5AANA 1LINA 1PRWA 2MAZA 3BUMB 2NCOA 4MBEA 1DT7B 1IKUA 3DVMA 2LP2A 4HRGA 1ZOTB 2L4HA 3D0YB 1IQ3A 1PVBA 5ER5A 4MZJA 4PE7A 3BUXB 4GGFA 1A75B 1DGUA 4ZCUA 2BECA 2KYFA 4JWQA 3CLNA 5HYDA 2JOJA 2K8MB 1CLMA 4ICBA 2KQ6A 3CWGA 4YGAA 1DJXA 2AAOA 2MLEC 4MSPA 3TS5B 2M1UA 3DF0A 1J7PA 1JF0A 3H4SE 2KFHA 2F3ZA 3NSLA 3VRPA 5HKZA 2KHNA 4P2YB 2ZNDA 1FF1A 3SIBA 2LUXA 1NSHA 5AEQA 4P5OE 1BG1A 1ODBA 2BE6A 3C1VA 2JT3A 4JPZB 3AAKA 5CSFA 1SY9A 2HETA 1DJGA 4YI8A 1TNPA 1M31A 1XK4C 4ETOA 1XFXO 1BT6A 2OPOA 1KQMB 1H4BA 1V1FA 1A2XA 3I5GB 2JT0A 1B47A 1PSBA 3BXKA 1UHKA 2B1UA 1R6PA 2M49B 1SCMB 4BY4A 1NX0A 3TUYB 2K7CA 1QATA 1S5GY 1KFUS 1QLKA 1WY9A 2LNKA 1MR8A 4JQ0D 2JXLA 1A29A 4C0KA 1F70A 3VRNA 4YGEB 2K7DA 3DF0B 2FOTA 3LL8B 1CMGA 2GV5A 2L0PA 3SG3A 4CPVA 2BL0C 3O4YA 1YX7A 5PALA 5I2OA 1F54A 2JWWA 1IG5A 1G8IA 1OZSA 2JC2A 4WQ3A 1WRKA 1WRZA 1KWOC 1EL4A 4M2QA 4GFTA 1RROA 3NXAA 1YVHA 5CSJA 2K2FA 3EVUA 1N2DA 1H8BA 1MHOA 2KAXA 4M2OA 1IQ5A 1B7TY 1K94A 3FS7A 2R2IA 1JFJA 1CFDA 3TDUA 1K95A 2O5GA 2ZRTA 1CTRA 2D8NA 3FIAA 1CMFA 1Y1AA 2NCPA 3BOWA 1KK7Z 2ISDA 1AJ4A 1YTZC 1QASA 3E3RA 3SG6A 2LM5A 2KI6D 1CFPA 2KGBC 1QVIZ 1RTP1 3JTDC 2LE9B 3WXAA 1B8RA 2CNPA 1K8UA 5CSNA 1A4PA 2L2EA 3EKJA 4I5NB 2MRDA 2F33A 1IJ5A 4D1EA 3ZNIA 3AKAA 1BR4B 1OOJA 1X02A 2L50A 4ORCB 1PSRA 2COLB 4XJKA 4A4CA 1DJZA 1AHRA 1K96A 2KAVA 2LLUA 3OB2B 2M9GA 3ICBA 4N5XA 2NZ0A 2OTGC 2ZN9A 1C07A 2CBLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CR4 X;  2EHB A;  1NYA A;  4AQJ A;  1XK4 A;  3BOW B;  1XYD A;  2MJW B;  1CFC A;  4PHN A;  3OHM B;  1WDC C;  1YUU A;  2L98 A;  2JUL A;  4YRU A;  3A4U B;  3SJS A;  1GQM A;  1NX2 A;  4YGB B;  5F6T A;  2M8U A;  2DOQ A;  3PM8 A;  1FI5 A;  1C7W A;  2ZKM X;  4DRW A;  1TNW A;  1TRF A;  3NSO A;  5G08 A;  2KDH A;  1UP5 A;  1KFX L;  2KFF A;  3DVK A;  4GBA A;  2WCF A;  4MEW A;  4PDZ A;  1BOD A;  3KO0 A;  3EK7 A;  3DVJ A;  4NDC A;  2M7L A;  1GGZ A;  2I18 A;  3EVR A;  3D10 A;  2LVK A;  2MLF C;  4GUK A;  1BF5 A;  1AUI B;  2BBN A;  2JZI A;  2TN4 A;  5HLV A;  1Y1U A;  4DIR A;  2I7A A;  2FJU B;  1K9K A;  1BJF A;  5HLO A;  4NQG A;  1YVL A;  1F8H A;  1YUT A;  3CS1 A;  2KBI A;  5BPJ A;  3A8R A;  1CM4 A;  2ZFD A;  4XYN A;  2KNE A;  2LVV A;  1CKK A;  2F8P A;  4FTG A;  1YX8 A;  2LP3 A;  5HKW A;  2E30 A;  3FWC A;  2SAS A;  2F2O A;  5AFP A;  3KHE A;  1SK6 D;  2A4J A;  2BL0 B;  1A03 A;  1AJ5 A;  4YGD B;  2PSR A;  1KWO B;  2QAC A;  2ZN8 A;  2OS8 C;  1ZFS A;  1S6J A;  2LVJ A;  1PK0 D;  3BUN B;  4PE0 A;  3GK2 A;  1BLQ A;  2G2B A;  3PN7 C;  1JSA A;  4MZK A;  1MXL C;  4TNC A;  1IWQ A;  3SG2 A;  2KBM A;  3FWB A;  2K61 A;  1QS7 A;  5KTY A;  3PAL A;  3VRQ A;  1REC A;  2P6B B;  1CDN A;  1C7V A;  1SW8 A;  2Q4U A;  1S5G Z;  1L2O C;  4GNK B;  2KGR A;  1TCO B;  2KSP A;  3GOF A;  2LLT A;  3PAT A;  3PSR A;  1AVS A;  1Y6W A;  1M45 A;  2KQY A;  1OQP A;  3PFV A;  3DD4 A;  1SL7 A;  2CCM A;  1QIW A;  2JXC A;  1NWD A;  4OKH A;  3SG5 A;  3LCP C;  4F0Z B;  2M29 A;  1SR6 C;  3AAJ A;  1OSA A;  2MHH A;  1RFJ A;  4ZCV A;  4DCK A;  1JC2 A;  1KFU L;  1B7T Z;  5IBW A;  1QJT A;  1UHJ A;  2OTG B;  1GJY A;  1EH2 A;  2L4I A;  2WND A;  2CTN A;  1HT9 A;  4N1F A;  1DF0 A;  3WNX B;  2QPT A;  1YRU B;  1WDC B;  3I5H B;  1YR5 A;  1CDP A;  1G33 A;  3GK1 A;  1OE9 B;  1SL9 A;  4HRH A;  1EG3 A;  3BUW B;  3PLF B;  4YGC B;  1MUX A;  1GGW A;  1SYM A;  5HKY A;  1SPY A;  2H61 A;  1K9U A;  1NCX A;  2KOT A;  2Y5I A;  5DKR A;  1QIV A;  1JWD A;  5J3X A;  1DJI A;  2KFG A;  1DMO A;  3OX5 A;  1B8C A;  4QJ3 B;  2MA2 A;  5TNC A;  3M0W A;  2BCB A;  1QV1 A;  1XFW O;  1LA0 A;  1UUS A;  1XVJ A;  3WHU B;  1JFK A;  1TOP A;  4PCW A;  1ZMZ A;  1YUS A;  3BQ3 A;  3IF7 A;  4MVF A;  4DS7 A;  5AER A;  1Q80 A;  1OMD A;  1M46 A;  1BR1 B;  1XA5 A;  1B1G A;  2HQ8 A;  1PAL A;  1BMO A;  1IJ6 A;  1S1E A;  2I2R E;  2JTT A;  2K7O A;  2WC8 A;  3JVT C;  1EJ3 A;  1LVC D;  4FQO A;  1M63 B;  3I5I C;  3SG7 A;  1QX2 A;  1RK9 A;  4PE4 A;  1XFZ O;  2WCE A;  3F45 A;  1LXF C;  1F4Q A;  1NPQ A;  2JRF A;  4NDB A;  2G9B A;  1J7Q A;  5CSI A;  3NSK A;  5DKN A;  1YUR A;  2K2A A;  2BE4 A;  3RLZ A;  4QJ4 B;  2AMI A;  3OB1 B;  2EC6 C;  3I5F C;  1J1D A;  1DTL A;  1K90 D;  1S36 A;  5GQQ C;  1HQV A;  4ORB B;  4XJK B;  2KYC A;  3WHT B;  3OX6 A;  1WLZ A;  3VGO A;  3LK0 A;  1TTX A;  2LLS A;  1M39 A;  3EK8 A;  2GGM A;  2OS8 B;  2PRU A;  1TNQ A;  4I5L B;  2M3W A;  2MBX A;  1UHI A;  1F55 A;  1NIW A;  2IS9 A;  1S3P A;  1CDL A;  4IL1 A;  3PN7 B;  3OP0 A;  1E8A A;  1N0Y A;  4WQ2 A;  5D7F A;  1MXE A;  1KK8 C;  1TNX A;  1JUO A;  3KEV A;  2JU0 A;  4AQI A;  2H61 C;  2Y1M A;  1L2O B;  1LA3 A;  2PAL A;  1CLL A;  2M7N A;  1F71 A;  1JBA A;  2KI6 C;  5I8N A;  1LKJ A;  2H2K A;  1R2U A;  2FCE A;  1IH0 A;  1NX1 A;  1S26 D;  3DVE A;  1CLB A;  1B8L A;  2FCD A;  4USL A;  1S6C A;  4PHM A;  1NCZ A;  5KU1 A;  1J1E A;  3VRR A;  2KI4 C;  1TIZ A;  1B9A A;  4E68 A;  2LCP A;  4PE1 A;  1KCY A;  4PHK A;  5I2Q A;  2M97 A;  5AXI A;  3CZT X;  1SR6 B;  4GPL B;  1UHN A;  2JPT A;  4ORA B;  4AOM A;  3CR2 A;  4UPG A;  2SCP A;  2NLN A;  1PUL A;  4YBH B;  3K21 A;  2CT9 A;  3TDI A;  1XFV O;  2L5X B;  1KSO A;  4MRX A;  1B4C A;  1QLS A;  4GAO A;  4WRI A;  4C0J A;  1MWN A;  5K89 A;  1EXR A;  1MF8 B;  1RJV A;  1W7I B;  1XFU O;  1DJH A;  1WLM A;  3O6B A;  5I2L A;  1CFF A;  3KPX A;  1CB1 A;  3SIA A;  3JTD B;  4PHJ A;  2JQ6 A;  4YI9 A;  4OV2 A;  2RGI A;  1V1G A;  2WCB A;  1CDM A;  3CGA A;  3O78 A;  4L9M A;  4MZL A;  1SCV A;  4U8D A;  3EVV A;  4MRY A;  1Y0V H;  1J7O A;  4PAL A;  4N1G A;  2LHL A;  1WRL A;  1AK8 A;  1AP4 A;  3BUO B;  4Q04 A;  3RM1 A;  1L7Z A;  1JF2 A;  1TCF A;  4OVN F;  1BU3 A;  2L51 A;  1KQV A;  1KSM A;  3TS5 C;  1NX3 A;  2LHI A;  3TDZ A;  4C0L A;  1DJY A;  1OMR A;  2O60 A;  4M2P A;  3CR5 X;  2HPS A;  4OR9 B;  2F2P A;  2I94 A;  1ALV A;  1DVI A;  3HCM A;  1XFY O;  3JVT B;  2BCX A;  1SL8 A;  2BKH B;  4I5J A;  1SKT A;  2LUC A;  1KQM C;  2AUC A;  3I5I B;  3EK4 A;  3I5G C;  5ER4 X;  2LV7 A;  3IQO A;  2V53 A;  2M0R A;  4QJ5 B;  4CID A;  1SCM C;  2NXQ A;  4CFR A;  3NSI A;  4GGF C;  4HSZ A;  3TUY C;  2LMV A;  3EKH A;  2WOS A;  2WOR A;  1KK7 Y;  2EC6 B;  4CFQ A;  3I5F B;  3O2P A;  1K9P A;  3TZ1 A;  3ZWH A;  2LMT A;  1RWY A;  2HQW A;  1TN4 A;  1W7J B;  1NP8 A;  2GGZ A;  4MN0 A;  1PVA A;  1QV0 A;  2VRG A;  1QVI Y;  4R1E A;  2PAS A;  5DKQ A;  5D69 A;  1CNP A;  2Y4Q A;  4MLW A;  1K2H A;  1SBJ A;  2KAY A;  4GGN A;  1VRK A;  5CPV A;  4A4B A;  1SMG A;  5JJG A;  2PMY A;  2LVI A;  3LK1 A;  1DF0 B;  2JTZ A;  1UWO A;  3QRX A;  1D1O A;  1SRA A;  2ZRS A;  1U5I A;  2M1K B;  3GK4 X;  2BCA A;  1J55 A;  1KK8 B;  4CLN A;  1NCY A;  1CM1 A;  1Y1X A;  1EG4 A;  3CTN A;  4OCI A;  1G4Y R;  3IQQ A;  1ZUZ A;  1UHH A;  1NUB A;  1YRT B;  1BOC A;  4I5K A;  5FYX A;  1SNL A;  2LMU A;  2PVB A;  3LLE A;  1KFX S;  2LAN A;  1DJW A;  2LAP A;  2Q91 A;  1N65 A;  3KF9 A;  3D0Y A;  1QX5 B;  3VRO A;  2K7B A;  2F3Y A;  2JT8 A;  2JNF A;  1S6I A;  1OMV A;  1OZO A;  1IGV A;  1ZAC A;  2E6W A;  3AKB A;  3I5H C;  2KI4 B;  3SG4 A;  1A75 A;  1QTX A;  2LC5 A;  4NDD A;  1XO5 A;  1DGV A;  1QXP A;  1IRJ A;  2K0J A;  1QX7 A;  2EGD A;  4DUQ A;  1F4O A;  5B8I B;  4BY5 A;  1ALW A;  2ZNE A;  4HRE E;  5KSZ A;  1FW4 A;  3BYA A;  2CXJ A;  3HX4 A;  1J7R A;  1MQ1 A;  1K93 D;  2HF5 A;  1U5I B;  1FBV A;  2Y1N A;  3MSE B;  1FI6 A;  2BBM A;  2BKI B;  1FPW A;  1UUR A;  2JNX A;  5JOL A;  5AAN A;  1LIN A;  1PRW A;  2MAZ A;  3BUM B;  2NCO A;  4MBE A;  1DT7 B;  1IKU A;  3DVM A;  2LP2 A;  4HRG A;  1ZOT B;  2L4H A;  3D0Y B;  1IQ3 A;  1PVB A;  5ER5 A;  4MZJ A;  4PE7 A;  3BUX B;  4GGF A;  1A75 B;  1DGU A;  4ZCU A;  2BEC A;  2KYF A;  4JWQ A;  3CLN A;  5HYD A;  2JOJ A;  2K8M B;  1CLM A;  4ICB A;  2KQ6 A;  3CWG A;  4YGA A;  1DJX A;  2AAO A;  2MLE C;  4MSP A;  3TS5 B;  2M1U A;  3DF0 A;  1J7P A;  1JF0 A;  3H4S E;  2KFH A;  2F3Z A;  3NSL A;  3VRP A;  5HKZ A;  2KHN A;  4P2Y B;  2ZND A;  1FF1 A;  3SIB A;  2LUX A;  1NSH A;  5AEQ A;  4P5O E;  1BG1 A;  1ODB A;  2BE6 A;  3C1V A;  2JT3 A;  4JPZ B;  3AAK A;  5CSF A;  1SY9 A;  2HET A;  1DJG A;  4YI8 A;  1TNP A;  1M31 A;  1XK4 C;  4ETO A;  1XFX O;  1BT6 A;  2OPO A;  1KQM B;  1H4B A;  1V1F A;  1A2X A;  3I5G B;  2JT0 A;  1B47 A;  1PSB A;  3BXK A;  1UHK A;  2B1U A;  1R6P A;  2M49 B;  1SCM B;  4BY4 A;  1NX0 A;  3TUY B;  2K7C A;  1QAT A;  1S5G Y;  1KFU S;  1QLK A;  1WY9 A;  2LNK A;  1MR8 A;  4JQ0 D;  2JXL A;  1A29 A;  4C0K A;  1F70 A;  3VRN A;  4YGE B;  2K7D A;  3DF0 B;  2FOT A;  3LL8 B;  1CMG A;  2GV5 A;  2L0P A;  3SG3 A;  4CPV A;  2BL0 C;  3O4Y A;  1YX7 A;  5PAL A;  5I2O A;  1F54 A;  2JWW A;  1IG5 A;  1G8I A;  1OZS A;  2JC2 A;  4WQ3 A;  1WRK A;  1WRZ A;  1KWO C;  1EL4 A;  4M2Q A;  4GFT A;  1RRO A;  3NXA A;  1YVH A;  5CSJ A;  2K2F A;  3EVU A;  1N2D A;  1H8B A;  1MHO A;  2KAX A;  4M2O A;  1IQ5 A;  1B7T Y;  1K94 A;  3FS7 A;  2R2I A;  1JFJ A;  1CFD A;  3TDU A;  1K95 A;  2O5G A;  2ZRT A;  1CTR A;  2D8N A;  3FIA A;  1CMF A;  1Y1A A;  2NCP A;  3BOW A;  1KK7 Z;  2ISD A;  1AJ4 A;  1YTZ C;  1QAS A;  3E3R A;  3SG6 A;  2LM5 A;  2KI6 D;  1CFP A;  2KGB C;  1QVI Z;  1RTP 1;  3JTD C;  2LE9 B;  3WXA A;  1B8R A;  2CNP A;  1K8U A;  5CSN A;  1A4P A;  2L2E A;  3EKJ A;  4I5N B;  2MRD A;  2F33 A;  1IJ5 A;  4D1E A;  3ZNI A;  3AKA A;  1BR4 B;  1OOJ A;  1X02 A;  2L50 A;  4ORC B;  1PSR A;  2COL B;  4XJK A;  4A4C A;  1DJZ A;  1AHR A;  1K96 A;  2KAV A;  2LLU A;  3OB2 B;  2M9G A;  3ICB A;  4N5X A;  2NZ0 A;  2OTG C;  2ZN9 A;  1C07 A;  2CBL A; 
#chains in the Genus database with same CATH topology
 2H8V A;  3CR4 X;  2EHB A;  3S0F A;  2L2C A;  1NYA A;  4AQJ A;  1XK4 A;  3BOW B;  1XYD A;  2MJW B;  1CFC A;  4JD9 A;  4PHN A;  3OHM B;  1WDC C;  1YUU A;  2L98 A;  2JUL A;  4YRU A;  3A4U B;  3SJS A;  1GQM A;  1NX2 A;  4YGB B;  5F6T A;  2M8U A;  3O4X A;  2DOQ A;  3PM8 A;  3NHT A;  1FI5 A;  1C7W A;  2ZKM X;  4DRW A;  3R1P A;  1TNW A;  1TRF A;  3NSO A;  3R1V A;  5G08 A;  2KDH A;  1UP5 A;  1KFX L;  2KFF A;  3CZ0 A;  5FYX A;  3DVK A;  4GBA A;  2WCF A;  4MEW A;  1OOH A;  4PDZ A;  1BOD A;  3KO0 A;  3EK7 A;  3DVJ A;  4NDC A;  2M7L A;  1GGZ A;  2I18 A;  3EVR A;  3D10 A;  3OBV A;  2LVK A;  2MLF C;  4GUK A;  1BF5 A;  1AUI B;  2BBN A;  2JZI A;  2TN4 A;  2YGU A;  1Y1U A;  5HLV A;  2I7A A;  4DIR A;  2FJU B;  3DXL A;  1K9K A;  1BJF A;  5HLO A;  4NQG A;  1YVL A;  1F8H A;  1YUT A;  3CS1 A;  2KBI A;  5BPJ A;  3A8R A;  1CM4 A;  2ZFD A;  4XYN A;  2KNE A;  2LVV A;  1CKK A;  2KLD A;  2F8P A;  4FTG A;  3CYZ A;  1YX8 A;  2QEV A;  2LP3 A;  5HKW A;  2WCJ A;  2E30 A;  3RZS A;  3FWC A;  2SAS A;  2F2O A;  5AFP A;  3KHE A;  1SK6 D;  2A4J A;  2BL0 B;  1A03 A;  1AJ5 A;  4YGD B;  2PSR A;  1KWO B;  2QAC A;  2ZN8 A;  2OS8 C;  1ZFS A;  1S6J A;  2LVJ A;  1PK0 D;  3BUN B;  4PE0 A;  3BFA A;  3GK2 A;  3FE6 A;  2G2B A;  3PN7 C;  1BLQ A;  4MZK A;  1MXL C;  4TNC A;  1JSA A;  1IWQ A;  3SG2 A;  2KBM A;  2KPH A;  3FWB A;  2K61 A;  1QS7 A;  5KTY A;  3PAL A;  3UO9 A;  3VRQ A;  1REC A;  2P6B B;  1CDN A;  1C7V A;  1SW8 A;  2Q4U A;  1S5G Z;  1L2O C;  3SS4 A;  4GNK B;  2KGR A;  1TCO B;  2KSP A;  3GOF A;  2LLT A;  3PAT A;  3OGN A;  3PSR A;  1AVS A;  1Y6W A;  1M45 A;  2KQY A;  1OQP A;  3VB1 A;  1TUJ A;  3PFV A;  2P71 A;  3DD4 A;  1SL7 A;  2CCM A;  1QIW A;  2JXC A;  1NWD A;  4OKH A;  1T14 A;  3SG5 A;  3LCP C;  4F0Z B;  2M29 A;  1SR6 C;  3AAJ A;  1OSA A;  2MHH A;  1RFJ A;  4ZCV A;  4DCK A;  1JC2 A;  1KFU L;  1B7T Z;  2WCM A;  3NGV A;  5IBW A;  1QJT A;  1UHJ A;  2OTG B;  1GJY A;  3D78 A;  1EH2 A;  2L4I A;  5FI7 A;  2WND A;  2CTN A;  1HT9 A;  4N1F A;  3B86 A;  1DF0 A;  3WNX B;  2QPT A;  1YRU B;  1WDC B;  3I5H B;  1YR5 A;  1CDP A;  1G33 A;  3GK1 A;  1OE9 B;  2QEO A;  1SL9 A;  4HRH A;  1EG3 A;  3BUW B;  3IVT A;  3PLF B;  1MUX A;  4YGC B;  1GGW A;  1SYM A;  5HKY A;  1SPY A;  2H61 A;  1K9U A;  1NCX A;  2KOT A;  2Y5I A;  5DKR A;  1QIV A;  1JWD A;  5J3X A;  1DJI A;  2KFG A;  2QEB A;  1DMO A;  3OX5 A;  1B8C A;  4QJ3 B;  2MA2 A;  3CZ1 A;  2PQL A;  5TNC A;  3M0W A;  2BCB A;  1QV1 A;  1XFW O;  1LA0 A;  1UUS A;  1XVJ A;  3WHU B;  3B6X A;  1JFK A;  1TOP A;  4PCW A;  1ZMZ A;  1YUS A;  3BQ3 A;  3IF7 A;  4MVF A;  2QDI A;  4DS7 A;  5AER A;  1Q80 A;  1OMD A;  1M46 A;  1BR1 B;  1XA5 A;  1B1G A;  2HQ8 A;  1PAL A;  1BMO A;  1IJ6 A;  1S1E A;  2I2R E;  2JTT A;  2K7O A;  2WC8 A;  3JVT C;  3V2L A;  1EJ3 A;  1IIO A;  1LVC D;  4FQO A;  1M63 B;  3I5I C;  3SG7 A;  1QX2 A;  1RK9 A;  4PE4 A;  1XFZ O;  2WCE A;  3F45 A;  1LXF C;  1F4Q A;  1NPQ A;  2JRF A;  1TUZ A;  4NDB A;  2G9B A;  1J7Q A;  5CSI A;  3NSK A;  5DKN A;  1YUR A;  2K2A A;  2BE4 A;  3RLZ A;  4QJ4 B;  2AMI A;  3OB1 B;  2EC6 C;  1P28 A;  3FE9 A;  3I5F C;  1J1D A;  1DTL A;  1K90 D;  1S36 A;  5GQQ C;  1HQV A;  4ORB B;  4XJK B;  2KYC A;  3WHT B;  5D3O A;  3OX6 A;  1WLZ A;  3VGO A;  3LK0 A;  1TTX A;  2LLS A;  3PM2 A;  1M39 A;  2P70 A;  3EK8 A;  2GGM A;  2OS8 B;  2PRU A;  1TWO A;  1DEK A;  1TNQ A;  4I5L B;  2M3W A;  2MBX A;  1UHI A;  1F55 A;  1NIW A;  2IS9 A;  1S3P A;  1CDL A;  4IL1 A;  5DIC A;  3PN7 B;  3OP0 A;  1E8A A;  1N0Y A;  4WQ2 A;  5D7F A;  1MXE A;  1KK8 C;  1TNX A;  1JUO A;  3KEV A;  2JU0 A;  4AQI A;  2H61 C;  2Y1M A;  1L2O B;  1LA3 A;  2PAL A;  3S0E A;  3EG5 B;  1CLL A;  2M7N A;  1F71 A;  1JBA A;  2KI6 C;  5I8N A;  1LKJ A;  2H2K A;  1R2U A;  2FCE A;  4F7F A;  1NX1 A;  3S0D A;  1IH0 A;  1S26 D;  1SSE B;  3DVE A;  1CLB A;  1B8L A;  2FCD A;  3D73 A;  4USL A;  1S6C A;  4PHM A;  1NCZ A;  5EL2 A;  5KU1 A;  1J1E A;  3VRR A;  2KI4 C;  3PJI A;  1TIZ A;  1B9A A;  4IJ7 A;  4E68 A;  2LCP A;  4PE1 A;  1KCY A;  4PHK A;  5I2Q A;  2M97 A;  5AXI A;  3CZT X;  1SR6 B;  4GPL B;  1UHN A;  2JPT A;  4ORA B;  4AOM A;  3CR2 A;  4UPG A;  2SCP A;  2NLN A;  3D74 A;  1PUL A;  4YBH B;  3BFB A;  3K21 A;  2CT9 A;  3TDI A;  1XFV O;  2L5X B;  1KSO A;  4MRX A;  1B4C A;  1QLS A;  4GAO A;  4WRI A;  3S0G A;  4C0J A;  1MWN A;  2FJY A;  5K89 A;  1EXR A;  1MF8 B;  1RJV A;  1W7I B;  1XFU O;  1DJH A;  1WLM A;  3O6B A;  2L5Y A;  5I2L A;  1DC1 A;  1CFF A;  3KPX A;  1CB1 A;  3SIA A;  3JTD B;  4PHJ A;  4KYN A;  2JQ6 A;  4YI9 A;  4OV2 A;  2RGI A;  1V1G A;  2WCB A;  1CDM A;  3CGA A;  3O78 A;  4L9M A;  4MZL A;  1SCV A;  3B7A A;  3EVV A;  4MRY A;  1Y0V H;  4U8D A;  1J7O A;  4PAL A;  4N1G A;  2LHL A;  1WRL A;  3DZT A;  1AK8 A;  1AP4 A;  3BUO B;  4Q04 A;  3RM1 A;  1L7Z A;  1JF2 A;  1TCF A;  4OVN F;  1BU3 A;  2L51 A;  1KQV A;  1KSM A;  3TS5 C;  3D75 A;  2JPO A;  1NX3 A;  2LHI A;  3TDZ A;  4C0L A;  1DJY A;  1OMR A;  2O60 A;  3L47 A;  4M2P A;  1Z2C B;  4INX A;  3CR5 X;  2HPS A;  4OR9 B;  2F2P A;  2I94 A;  1ALV A;  1DVI A;  2K60 A;  1XFY O;  3HCM A;  3JVT B;  2BCX A;  1SL8 A;  2BKH B;  4I5J A;  1SKT A;  2LUC A;  4FQT A;  1KQM C;  2AUC A;  3I5I B;  3EK4 A;  3I5G C;  5ER4 X;  2LV7 A;  1OW4 A;  3N7H A;  3IQO A;  4OZD A;  2V53 A;  2M0R A;  2PYQ A;  4QJ5 B;  4CID A;  1SCM C;  2NXQ A;  4CFR A;  3NSI A;  4GGF C;  4HSZ A;  3TUY C;  2LMV A;  3EKH A;  2WOS A;  2WOR A;  1KK7 Y;  2EC6 B;  3FE8 A;  4CFQ A;  3I5F B;  3O2P A;  1K9P A;  3TZ1 A;  3ZWH A;  2LMT A;  1RWY A;  5HL1 A;  2HQW A;  1TN4 A;  1W7J B;  3B87 A;  1NP8 A;  2GGZ A;  4MN0 A;  1PVA A;  1QV0 A;  2VRG A;  1QVI Y;  4R1E A;  2PAS A;  5DKQ A;  1W9Z A;  5D69 A;  1CNP A;  2Y4Q A;  4MLW A;  1K2H A;  1SBJ A;  2KAY A;  4GGN A;  1VRK A;  5CPV A;  4A4B A;  1SMG A;  2ERB A;  5JJG A;  2PMY A;  3D76 A;  2LVI A;  3LK1 A;  1QWV A;  1DF0 B;  2GTE A;  5FI6 A;  2JTZ A;  1UWO A;  3QRX A;  1D1O A;  1SRA A;  2WC6 A;  2ZRS A;  1U5I A;  2M1K B;  3GK4 X;  2BCA A;  1J55 A;  4JKT A;  1KK8 B;  4CLN A;  1NCY A;  1CM1 A;  1Y1X A;  1EG4 A;  3CTN A;  3R72 A;  4OCI A;  1G4Y R;  3R1O A;  3IQQ A;  1ZUZ A;  1UHH A;  1NUB A;  1YRT B;  1BOC A;  1DQE A;  3DYE A;  1OOF A;  4I5K A;  2BAP A;  1SNL A;  2LMU A;  2PVB A;  3LLE A;  1KFX S;  2LAN A;  1DJW A;  2LAP A;  2Q91 A;  1N65 A;  3KF9 A;  3D0Y A;  1QX5 B;  4PT1 A;  3VRO A;  2K7B A;  3CAB A;  2F3Y A;  2JT8 A;  2JNF A;  1S6I A;  1OMV A;  1OZO A;  1IGV A;  1ZAC A;  2E6W A;  3AKB A;  2WC5 A;  2KI4 B;  3I5H C;  3Q8I A;  3SG4 A;  1A75 A;  1QTX A;  2LC5 A;  3L4A A;  4NDD A;  1XO5 A;  2WCK A;  1DGV A;  1QXP A;  1IRJ A;  2K0J A;  1QX7 A;  2EGD A;  4DUQ A;  1F4O A;  5B8I B;  4BY5 A;  1ALW A;  2ZNE A;  4HRE E;  5KSZ A;  1FW4 A;  1XFR A;  3BYA A;  1C3Z A;  2CXJ A;  3HX4 A;  1J7R A;  1MQ1 A;  1K93 D;  2HF5 A;  1U5I B;  1FBV A;  2Y1N A;  3MSE B;  3S0B A;  3CZ2 A;  1FI6 A;  2BBM A;  2BKI B;  5I94 A;  1FPW A;  1UUR A;  2JNX A;  5JOL A;  5AAN A;  1LIN A;  1PRW A;  2MAZ A;  3BUM B;  2NCO A;  4MBE A;  1DT7 B;  1IKU A;  3DVM A;  2LP2 A;  4HRG A;  1ZOT B;  3SS3 A;  2L4H A;  1ORG A;  3D0Y B;  1IQ3 A;  1PVB A;  5ER5 A;  4MZJ A;  4PE7 A;  3BUX B;  3S0A A;  4GGF A;  1A75 B;  1DGU A;  4ZCU A;  2BEC A;  2KYF A;  4JWQ A;  3CLN A;  5HYD A;  2JOJ A;  2K8M B;  1CLM A;  4ICB A;  2KQ6 A;  3BFH A;  3CWG A;  4YGA A;  1DJX A;  2AAO A;  2MLE C;  3B88 A;  4MSP A;  3TS5 B;  2M1U A;  3DF0 A;  1J7P A;  1JF0 A;  3H4S E;  2KFH A;  2F3Z A;  3NSL A;  3VRP A;  5HKZ A;  2KHN A;  4P2Y B;  2ZND A;  1FF1 A;  3SIB A;  2LUX A;  1NSH A;  5AEQ A;  4P5O E;  1BG1 A;  1ODB A;  2BE6 A;  3C1V A;  2JT3 A;  4JPZ B;  3AAK A;  5CSF A;  1SY9 A;  2HET A;  1DJG A;  3CDN A;  1TNP A;  1M31 A;  1XK4 C;  4YI8 A;  4ETO A;  1XFX O;  1BT6 A;  2OPO A;  1KQM B;  1H4B A;  1V1F A;  1A2X A;  3I5G B;  2JT0 A;  1B47 A;  1PSB A;  3K1E A;  3BXK A;  1UHK A;  2B1U A;  1R6P A;  2M49 B;  3NHI A;  5FI2 A;  1SCM B;  4BY4 A;  1NX0 A;  3TUY B;  2K7C A;  3DY9 A;  1QAT A;  1S5G Y;  1KFU S;  1QLK A;  1WY9 A;  2LNK A;  1MR8 A;  3D77 A;  4JQ0 D;  1GM0 A;  2JXL A;  1A29 A;  4C0K A;  1F70 A;  3VRN A;  4YGE B;  3UNW A;  2K7D A;  3DF0 B;  2FOT A;  3LL8 B;  1CMG A;  2GV5 A;  2L0P A;  2WCH A;  3SG3 A;  4CPV A;  2BL0 C;  3O4Y A;  1YX7 A;  5PAL A;  1Z4H A;  5I2O A;  2JWW A;  1F54 A;  1IG5 A;  1OOI X;  1G8I A;  1OZS A;  2JC2 A;  4WQ3 A;  1WRK A;  1WRZ A;  1KWO C;  1EL4 A;  4M2Q A;  4GFT A;  1RRO A;  2KLE A;  1YVH A;  3NXA A;  2K2F A;  5CSJ A;  3EVU A;  1N2D A;  1H8B A;  1MHO A;  2KAX A;  4M2O A;  1IQ5 A;  1B7T Y;  1K94 A;  3FS7 A;  2R2I A;  1JFJ A;  1CFD A;  3TDU A;  1K95 A;  2O5G A;  2ZRT A;  1CTR A;  2D8N A;  3FIA A;  1CMF A;  1Y1A A;  2NCP A;  2QEH A;  3BOW A;  1KK7 Z;  2BNX A;  2ISD A;  1AJ4 A;  1YTZ C;  1DEL A;  1QAS A;  3E3R A;  3SG6 A;  2LM5 A;  2KI6 D;  4INW A;  1CFP A;  2KGB C;  1QVI Z;  1RTP 1;  3JTD C;  2WCL A;  3SS5 A;  2LE9 B;  3WXA A;  1B8R A;  2CNP A;  1K8U A;  5CSN A;  1A4P A;  2L2E A;  3EKJ A;  3L4L A;  4I5N B;  2MRD A;  3BJH A;  2F33 A;  1IJ5 A;  4D1E A;  3ZNI A;  3AKA A;  1BR4 B;  1OOJ A;  1X02 A;  2L50 A;  4ORC B;  1PSR A;  2COL B;  4XJK A;  4A4C A;  1DJZ A;  1AHR A;  1K96 A;  2KAV A;  2LLU A;  3OB2 B;  1C3Y A;  1OOG A;  2M9G A;  3ICB A;  4N5X A;  2NZ0 A;  2OTG C;  1LS8 A;  3QME A;  2ZN9 A;  1C07 A;  2CBL A; 
#chains in the Genus database with same CATH homology
 3CR4 X;  2EHB A;  1NYA A;  4AQJ A;  1XK4 A;  3BOW B;  1XYD A;  2MJW B;  1CFC A;  4PHN A;  3OHM B;  1WDC C;  1YUU A;  2L98 A;  2JUL A;  4YRU A;  3A4U B;  3SJS A;  1GQM A;  1NX2 A;  4YGB B;  5F6T A;  2M8U A;  2DOQ A;  3PM8 A;  1FI5 A;  1C7W A;  2ZKM X;  4DRW A;  1TNW A;  1TRF A;  3NSO A;  5G08 A;  2KDH A;  1UP5 A;  1KFX L;  2KFF A;  3DVK A;  4GBA A;  2WCF A;  4MEW A;  4PDZ A;  1BOD A;  3KO0 A;  3EK7 A;  3DVJ A;  4NDC A;  2M7L A;  1GGZ A;  2I18 A;  3EVR A;  3D10 A;  2LVK A;  2MLF C;  4GUK A;  1BF5 A;  1AUI B;  2BBN A;  2JZI A;  2TN4 A;  5HLV A;  1Y1U A;  4DIR A;  2I7A A;  2FJU B;  1K9K A;  1BJF A;  5HLO A;  4NQG A;  1YVL A;  1F8H A;  1YUT A;  3CS1 A;  2KBI A;  5BPJ A;  3A8R A;  1CM4 A;  2ZFD A;  4XYN A;  2KNE A;  2LVV A;  1CKK A;  2F8P A;  4FTG A;  1YX8 A;  2LP3 A;  5HKW A;  2E30 A;  3FWC A;  2SAS A;  2F2O A;  5AFP A;  3KHE A;  1SK6 D;  2A4J A;  2BL0 B;  1A03 A;  1AJ5 A;  4YGD B;  2PSR A;  1KWO B;  2QAC A;  2ZN8 A;  2OS8 C;  1ZFS A;  1S6J A;  2LVJ A;  1PK0 D;  3BUN B;  4PE0 A;  3GK2 A;  1BLQ A;  2G2B A;  3PN7 C;  1JSA A;  4MZK A;  1MXL C;  4TNC A;  1IWQ A;  3SG2 A;  2KBM A;  3FWB A;  2K61 A;  1QS7 A;  5KTY A;  3PAL A;  3VRQ A;  1REC A;  2P6B B;  1CDN A;  1C7V A;  1SW8 A;  2Q4U A;  1S5G Z;  1L2O C;  4GNK B;  2KGR A;  1TCO B;  2KSP A;  3GOF A;  2LLT A;  3PAT A;  3PSR A;  1AVS A;  1Y6W A;  1M45 A;  2KQY A;  1OQP A;  3PFV A;  3DD4 A;  1SL7 A;  2CCM A;  1QIW A;  2JXC A;  1NWD A;  4OKH A;  3SG5 A;  3LCP C;  4F0Z B;  2M29 A;  1SR6 C;  3AAJ A;  1OSA A;  2MHH A;  1RFJ A;  4ZCV A;  4DCK A;  1JC2 A;  1KFU L;  1B7T Z;  5IBW A;  1QJT A;  1UHJ A;  2OTG B;  1GJY A;  1EH2 A;  2L4I A;  2WND A;  2CTN A;  1HT9 A;  4N1F A;  1DF0 A;  3WNX B;  2QPT A;  1YRU B;  1WDC B;  3I5H B;  1YR5 A;  1CDP A;  1G33 A;  3GK1 A;  1OE9 B;  1SL9 A;  4HRH A;  1EG3 A;  3BUW B;  3PLF B;  4YGC B;  1MUX A;  1GGW A;  1SYM A;  5HKY A;  1SPY A;  2H61 A;  1K9U A;  1NCX A;  2KOT A;  2Y5I A;  5DKR A;  1QIV A;  1JWD A;  5J3X A;  1DJI A;  2KFG A;  1DMO A;  3OX5 A;  1B8C A;  4QJ3 B;  2MA2 A;  5TNC A;  3M0W A;  2BCB A;  1QV1 A;  1XFW O;  1LA0 A;  1UUS A;  1XVJ A;  3WHU B;  1JFK A;  1TOP A;  4PCW A;  1ZMZ A;  1YUS A;  3BQ3 A;  3IF7 A;  4MVF A;  4DS7 A;  5AER A;  1Q80 A;  1OMD A;  1M46 A;  1BR1 B;  1XA5 A;  1B1G A;  2HQ8 A;  1PAL A;  1BMO A;  1IJ6 A;  1S1E A;  2I2R E;  2JTT A;  2K7O A;  2WC8 A;  3JVT C;  1EJ3 A;  1LVC D;  4FQO A;  1M63 B;  3I5I C;  3SG7 A;  1QX2 A;  1RK9 A;  4PE4 A;  1XFZ O;  2WCE A;  3F45 A;  1LXF C;  1F4Q A;  1NPQ A;  2JRF A;  4NDB A;  2G9B A;  1J7Q A;  5CSI A;  3NSK A;  5DKN A;  1YUR A;  2K2A A;  2BE4 A;  3RLZ A;  4QJ4 B;  2AMI A;  3OB1 B;  2EC6 C;  3I5F C;  1J1D A;  1DTL A;  1K90 D;  1S36 A;  5GQQ C;  1HQV A;  4ORB B;  4XJK B;  2KYC A;  3WHT B;  3OX6 A;  1WLZ A;  3VGO A;  3LK0 A;  1TTX A;  2LLS A;  1M39 A;  3EK8 A;  2GGM A;  2OS8 B;  2PRU A;  1TNQ A;  4I5L B;  2M3W A;  2MBX A;  1UHI A;  1F55 A;  1NIW A;  2IS9 A;  1S3P A;  1CDL A;  4IL1 A;  3PN7 B;  3OP0 A;  1E8A A;  1N0Y A;  4WQ2 A;  5D7F A;  1MXE A;  1KK8 C;  1TNX A;  1JUO A;  3KEV A;  2JU0 A;  4AQI A;  2H61 C;  2Y1M A;  1L2O B;  1LA3 A;  2PAL A;  1CLL A;  2M7N A;  1F71 A;  1JBA A;  2KI6 C;  5I8N A;  1LKJ A;  2H2K A;  1R2U A;  2FCE A;  1IH0 A;  1NX1 A;  1S26 D;  3DVE A;  1CLB A;  1B8L A;  2FCD A;  4USL A;  1S6C A;  4PHM A;  1NCZ A;  5KU1 A;  1J1E A;  3VRR A;  2KI4 C;  1TIZ A;  1B9A A;  4E68 A;  2LCP A;  4PE1 A;  1KCY A;  4PHK A;  5I2Q A;  2M97 A;  5AXI A;  3CZT X;  1SR6 B;  4GPL B;  1UHN A;  2JPT A;  4ORA B;  4AOM A;  3CR2 A;  4UPG A;  2SCP A;  2NLN A;  1PUL A;  4YBH B;  3K21 A;  2CT9 A;  3TDI A;  1XFV O;  2L5X B;  1KSO A;  4MRX A;  1B4C A;  1QLS A;  4GAO A;  4WRI A;  4C0J A;  1MWN A;  5K89 A;  1EXR A;  1MF8 B;  1RJV A;  1W7I B;  1XFU O;  1DJH A;  1WLM A;  3O6B A;  5I2L A;  1CFF A;  3KPX A;  1CB1 A;  3SIA A;  3JTD B;  4PHJ A;  2JQ6 A;  4YI9 A;  4OV2 A;  2RGI A;  1V1G A;  2WCB A;  1CDM A;  3CGA A;  3O78 A;  4L9M A;  4MZL A;  1SCV A;  4U8D A;  3EVV A;  4MRY A;  1Y0V H;  1J7O A;  4PAL A;  4N1G A;  2LHL A;  1WRL A;  1AK8 A;  1AP4 A;  3BUO B;  4Q04 A;  3RM1 A;  1L7Z A;  1JF2 A;  1TCF A;  4OVN F;  1BU3 A;  2L51 A;  1KQV A;  1KSM A;  3TS5 C;  1NX3 A;  2LHI A;  3TDZ A;  4C0L A;  1DJY A;  1OMR A;  2O60 A;  4M2P A;  3CR5 X;  2HPS A;  4OR9 B;  2F2P A;  2I94 A;  1ALV A;  1DVI A;  3HCM A;  1XFY O;  3JVT B;  2BCX A;  1SL8 A;  2BKH B;  4I5J A;  1SKT A;  2LUC A;  1KQM C;  2AUC A;  3I5I B;  3EK4 A;  3I5G C;  5ER4 X;  2LV7 A;  3IQO A;  2V53 A;  2M0R A;  4QJ5 B;  4CID A;  1SCM C;  2NXQ A;  4CFR A;  3NSI A;  4GGF C;  4HSZ A;  3TUY C;  2LMV A;  3EKH A;  2WOS A;  2WOR A;  1KK7 Y;  2EC6 B;  4CFQ A;  3I5F B;  3O2P A;  1K9P A;  3TZ1 A;  3ZWH A;  2LMT A;  1RWY A;  2HQW A;  1TN4 A;  1W7J B;  1NP8 A;  2GGZ A;  4MN0 A;  1PVA A;  1QV0 A;  2VRG A;  1QVI Y;  4R1E A;  2PAS A;  5DKQ A;  5D69 A;  1CNP A;  2Y4Q A;  4MLW A;  1K2H A;  1SBJ A;  2KAY A;  4GGN A;  1VRK A;  5CPV A;  4A4B A;  1SMG A;  5JJG A;  2PMY A;  2LVI A;  3LK1 A;  1DF0 B;  2JTZ A;  1UWO A;  3QRX A;  1D1O A;  1SRA A;  2ZRS A;  1U5I A;  2M1K B;  3GK4 X;  2BCA A;  1J55 A;  1KK8 B;  4CLN A;  1NCY A;  1CM1 A;  1Y1X A;  1EG4 A;  3CTN A;  4OCI A;  1G4Y R;  3IQQ A;  1ZUZ A;  1UHH A;  1NUB A;  1YRT B;  1BOC A;  4I5K A;  5FYX A;  1SNL A;  2LMU A;  2PVB A;  3LLE A;  1KFX S;  2LAN A;  1DJW A;  2LAP A;  2Q91 A;  1N65 A;  3KF9 A;  3D0Y A;  1QX5 B;  3VRO A;  2K7B A;  2F3Y A;  2JT8 A;  2JNF A;  1S6I A;  1OMV A;  1OZO A;  1IGV A;  1ZAC A;  2E6W A;  3AKB A;  3I5H C;  2KI4 B;  3SG4 A;  1A75 A;  1QTX A;  2LC5 A;  4NDD A;  1XO5 A;  1DGV A;  1QXP A;  1IRJ A;  2K0J A;  1QX7 A;  2EGD A;  4DUQ A;  1F4O A;  5B8I B;  4BY5 A;  1ALW A;  2ZNE A;  4HRE E;  5KSZ A;  1FW4 A;  3BYA A;  2CXJ A;  3HX4 A;  1J7R A;  1MQ1 A;  1K93 D;  2HF5 A;  1U5I B;  1FBV A;  2Y1N A;  3MSE B;  1FI6 A;  2BBM A;  2BKI B;  1FPW A;  1UUR A;  2JNX A;  5JOL A;  5AAN A;  1LIN A;  1PRW A;  2MAZ A;  3BUM B;  2NCO A;  4MBE A;  1DT7 B;  1IKU A;  3DVM A;  2LP2 A;  4HRG A;  1ZOT B;  2L4H A;  3D0Y B;  1IQ3 A;  1PVB A;  5ER5 A;  4MZJ A;  4PE7 A;  3BUX B;  4GGF A;  1A75 B;  1DGU A;  4ZCU A;  2BEC A;  2KYF A;  4JWQ A;  3CLN A;  5HYD A;  2JOJ A;  2K8M B;  1CLM A;  4ICB A;  2KQ6 A;  3CWG A;  4YGA A;  1DJX A;  2AAO A;  2MLE C;  4MSP A;  3TS5 B;  2M1U A;  3DF0 A;  1J7P A;  1JF0 A;  3H4S E;  2KFH A;  2F3Z A;  3NSL A;  3VRP A;  5HKZ A;  2KHN A;  4P2Y B;  2ZND A;  1FF1 A;  3SIB A;  2LUX A;  1NSH A;  5AEQ A;  4P5O E;  1BG1 A;  1ODB A;  2BE6 A;  3C1V A;  2JT3 A;  4JPZ B;  3AAK A;  5CSF A;  1SY9 A;  2HET A;  1DJG A;  4YI8 A;  1TNP A;  1M31 A;  1XK4 C;  4ETO A;  1XFX O;  1BT6 A;  2OPO A;  1KQM B;  1H4B A;  1V1F A;  1A2X A;  3I5G B;  2JT0 A;  1B47 A;  1PSB A;  3BXK A;  1UHK A;  2B1U A;  1R6P A;  2M49 B;  1SCM B;  4BY4 A;  1NX0 A;  3TUY B;  2K7C A;  1QAT A;  1S5G Y;  1KFU S;  1QLK A;  1WY9 A;  2LNK A;  1MR8 A;  4JQ0 D;  2JXL A;  1A29 A;  4C0K A;  1F70 A;  3VRN A;  4YGE B;  2K7D A;  3DF0 B;  2FOT A;  3LL8 B;  1CMG A;  2GV5 A;  2L0P A;  3SG3 A;  4CPV A;  2BL0 C;  3O4Y A;  1YX7 A;  5PAL A;  5I2O A;  1F54 A;  2JWW A;  1IG5 A;  1G8I A;  1OZS A;  2JC2 A;  4WQ3 A;  1WRK A;  1WRZ A;  1KWO C;  1EL4 A;  4M2Q A;  4GFT A;  1RRO A;  3NXA A;  1YVH A;  5CSJ A;  2K2F A;  3EVU A;  1N2D A;  1H8B A;  1MHO A;  2KAX A;  4M2O A;  1IQ5 A;  1B7T Y;  1K94 A;  3FS7 A;  2R2I A;  1JFJ A;  1CFD A;  3TDU A;  1K95 A;  2O5G A;  2ZRT A;  1CTR A;  2D8N A;  3FIA A;  1CMF A;  1Y1A A;  2NCP A;  3BOW A;  1KK7 Z;  2ISD A;  1AJ4 A;  1YTZ C;  1QAS A;  3E3R A;  3SG6 A;  2LM5 A;  2KI6 D;  1CFP A;  2KGB C;  1QVI Z;  1RTP 1;  3JTD C;  2LE9 B;  3WXA A;  1B8R A;  2CNP A;  1K8U A;  5CSN A;  1A4P A;  2L2E A;  3EKJ A;  4I5N B;  2MRD A;  2F33 A;  1IJ5 A;  4D1E A;  3ZNI A;  3AKA A;  1BR4 B;  1OOJ A;  1X02 A;  2L50 A;  4ORC B;  1PSR A;  2COL B;  4XJK A;  4A4C A;  1DJZ A;  1AHR A;  1K96 A;  2KAV A;  2LLU A;  3OB2 B;  2M9G A;  3ICB A;  4N5X A;  2NZ0 A;  2OTG C;  2ZN9 A;  1C07 A;  2CBL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...