3BJHA

Soft-sad crystal structure of a pheromone binding protein from the honeybee apis mellifera l.
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
117
structure length
117
Chain Sequence
DWVPPEVFDLVAEDKARCMSEHGTTQAQIDDVDKGNLVNEPSITCYMYCLLEAFSLVDDEANVDEDIMLGLLPDQLQERAQSVMGKCLPTSGSDNCNKIYNLAKCVQESAPDVWFVI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Sulfur single-wavelength anomalous diffraction crystal structure of a pheromone-binding protein from the honeybee Apis mellifera L.
pubmed doi rcsb
source organism Apis mellifera
molecule tags Pheromone binding protein
molecule keywords Pheromone-binding protein ASP1
total genus 45
structure length 117
sequence length 117
ec nomenclature
pdb deposition date 2007-12-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01395 PBP_GOBP PBP/GOBP family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.20 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 Pheromone/general odorant binding protein domain 3bjhA00
1C3ZA 3CZ2A 3CABA 3D74A 3CYZA 3B7AA 3RZSA 2WCLA 3D75A 1GM0A 1ORGA 2GTEA 4OZDA 3B6XA 1OOHA 3NGVA 3CZ1A 4FQTA 3R1VA 3VB1A 2PQLA 1OW4A 2WCKA 2H8VA 3QMEA 3S0FA 2WCHA 4INXA 1LS8A 2FJYA 3DXLA 2QEHA 3R1PA 4F7FA 4INWA 3FE6A 1XFRA 2ERBA 1DQEA 3K1EA 2P71A 2QDIA 4PT1A 2QEOA 1P28A 3B87A 3DZTA 3D76A 2QEBA 2WCJA 3S0EA 3NHIA 3B86A 1C3YA 1QWVA 3NHTA 5DICA 1OOGA 3D73A 1OOFA 2JPOA 2WC5A 3FE9A 3OGNA 3BJHA 3BFAA 1TWOA 3DY9A 2L2CA 3S0DA 2P70A 5EL2A 3BFBA 3D77A 3L4AA 3BFHA 3R72A 3S0AA 3B88A 2WCMA 1T14A 3CZ0A 3N7HA 2QEVA 3D78A 3R1OA 3S0GA 3DYEA 1OOIX 3Q8IA 3S0BA 2KPHA 3FE8A 3L4LA 2WC6A 1TUJA 3L47A 3V2LA 4JD9A 3CDNA 3PJIA
chains in the Genus database with same CATH superfamily
2JT0A 1YRTB 2LP2A 3CZ2A 3O4YA 1YUSA 4E68A 1K95A 1LXFC 4M2OA 2L98A 4ORBB 2WCLA 3KF9A 1JBAA 1GM0A 2AAOA 1NX0A 1YTZC 3EK8A 4MRYA 5HKWA 2F2PA 3TS5C 1KFUL 2KHNA 4OKHA 1OOHA 2K7BA 4FQTA 3R1VA 1AP4A 4OR9B 3VB1A 1IWQA 1SL9A 2F3YA 1OW4A 1ZOTB 3KEVA 2WCKA 1CNPA 1RROA 2L5YA 1B8LA 1SYMA 2H8VA 1B9AA 1J1DA 1X02A 1DJZA 1BG1A 2G2BA 1F55A 4JPZB 3JTDC 2EC6B 1CDPA 2SASA 5HYDA 4GPLB 2K2FA 3DXLA 2Y4QA 3CGAA 5FI7A 1Y1XA 3R1PA 4PE4A 5CSJA 3SG2A 4F7FA 4PHKA 2JC2A 2KQ6A 1NCZA 3FE6A 1GGWA 1XFRA 1ZFSA 2JRFA 2LUXA 2ERBA 3SG3A 1V1GA 3WHUB 2BL0B 3EK4A 5KSZA 1OMDA 2JU0A 1K90D 2MLEC 4GGFA 3B87A 1WDCC 3CWGA 4MN0A 1RWYA 1NYAA 2M97A 2ZN8A 1AJ4A 2CBLA 1HQVA 4MEWA 1YX8A 1F8HA 4JKTA 1UP5A 3OB2B 4GBAA 3PFVA 1WRLA 3LL8B 3DD4A 1YUTA 2M0RA 3LCPC 5FI6A 5I2LA 2KAYA 2LUCA 1JUOA 1SR6B 1A75B 2JOJA 3DF0A 1NSHA 1RK9A 1OOGA 1ZACA 1K9KA 4XJKA 1TCOB 1UWOA 2JT3A 1NX1A 1OOFA 1WY9A 5GQQC 2OS8C 3AKBA 3SG4A 3SG5A 2GGMA 3BFAA 1C07A 1KFUS 2VRGA 3EK7A 3ZNIA 2KFFA 1DJXA 3HCMA 3ICBA 3VRRA 3A4UB 4YRUA 1N65A 2LVKA 1SL7A 4MBEA 5JJGA 1B8CA 1QV0A 4I5LB 3AAJA 2MHHA 2CXJA 3VRNA 4WQ2A 1AHRA 3GK1A 1QASA 2WC8A 1KSOA 2TN4A 4YI9A 2L50A 4YGCB 3S0DA 3NSKA 2Y1MA 2H61C 1KQMB 1YVHA 2HPSA 2M9GA 5EL2A 4NDDA 4ORAB 3S0AA 1KQVA 2M29A 5DKRA 2ZKMX 1AUIB 3TZ1A 3IVTA 1NCYA 1T14A 2M3WA 1BJFA 2KI6C 3VGOA 3MSEB 3N7HA 1M39A 3R1OA 4PE7A 1SK6D 1DVIA 2HQ8A 3O4XA 4PALA 1TOPA 5CPVA 1OOIX 2B1UA 3Q8IA 1CFDA 1J1EA 1DF0A 3D0YA 3IQOA 1EG4A 1XK4C 2JULA 4OVNF 1DGVA 1QIWA 1PSBA 1RFJA 1OSAA 1WLMA 2LLTA 4NQGA 5B8IB 5I2QA 3L47A 3GOFA 4JD9A 1S6CA 1MWNA 1XFXO 2BE6A 3CDNA 4PE1A 1U5IB 1C3ZA 1QTXA 2JTTA 4GAOA 3CABA 3GK4X 1Y6WA 1EJ3A 3E3RA 3RZSA 1CFPA 1UHNA 4KYNA 2LMTA 3BYAA 4XJKB 3TUYC 1J7PA 4D1EA 2I94A 1ORGA 4HSZA 1N2DA 4MLWA 1JFJA 5FYXA 1BOCA 1JWDA 3FWCA 2L4IA 1SR6C 2CCMA 1F4OA 3CZ1A 3EVUA 3NGVA 2MBXA 2M49B 1IG5A 1J7OA 2KFGA 4YBHB 1ALWA 5AXIA 1CTRA 2FCEA 4A4CA 2KBIA 1XFUO 1YR5A 4YGAA 1WDCB 1S36A 2QPTA 1KFXS 2MRDA 2KLDA 1WRZA 3KPXA 1QXPA 4GUKA 1NP8A 1F70A 1KWOC 1UHKA 1VRKA 2BL0C 2KI4B 3SS5A 4DRWA 1PULA 3CZTX 2G9BA 1EG3A 2LHIA 4IJ7A 2ISDA 2AUCA 4PHNA 1K2HA 2PASA 1CM1A 4I5KA 1DJIA 2ZFDA 2H2KA 2JXCA 1TN4A 3VROA 4OCIA 1U5IA 2JTZA 1AJ5A 1DQEA 1HT9A 1PVAA 4MRXA 5CSFA 1F54A 2M7LA 2HQWA 2QDIA 1TNXA 4PHJA 1XO5A 2LE9B 1DC1A 1K93D 1B47A 2YGUA 3I5FC 5AFPA 3FIAA 4ORCB 2PRUA 3JVTB 2LVIA 1TUZA 2WCJA 3NHIA 1ALVA 4BY4A 1CLBA 1KK7Y 2MAZA 3VRQA 4R1EA 3LK1A 2KAXA 4FTGA 3SIAA 1DJWA 1BR4B 2BKIB 1SSEB 3TDUA 1C3YA 1MXLC 3DVJA 1OQPA 1EXRA 2I7AA 3NHTA 3CR4X 4USLA 4ZCVA 4A4BA 1B7TZ 3BUWB 3D73A 2WC5A 2BCXA 1FPWA 2KFHA 1WLZA 3PM2A 1RJVA 1OMRA 1NIWA 2LHLA 3FWBA 1PSRA 3QRXA 4HREE 2L2CA 4M2PA 1OOJA 1E8AA 1TIZA 3CS1A 3SG7A 3O6BA 3UO9A 1SMGA 2LMUA 3PATA 1C7VA 1LINA 4BY5A 2F3ZA 3DVEA 3WHTB 3I5FB 4GFTA 4HRGA 1QLSA 1QVIZ 1QVIY 2LVVA 1KK7Z 1TTXA 2WORA 5CSNA 4MZLA 4GGNA 2F8PA 1K9PA 1W9ZA 1M45A 2LC5A 3L4AA 2NCPA 1B7TY 2LV7A 4YI8A 3OP0A 1KCYA 1UUSA 2SCPA 2LP3A 2PVBA 1YX7A 2L0PA 3B88A 1PK0D 2R2IA 2ZNDA 1NPQA 1ZMZA 1Z2CB 2HETA 3CZ0A 3LLEA 3D78A 1IRJA 2LNKA 3DVMA 1Y1AA 3OB1B 3PN7B 2BE4A 3DYEA 1CB1A 1G4YR 1XFWO 4ZCUA 1IQ5A 1K8UA 4XYNA 2ZRTA 1NWDA 2PYQA 4OV2A 5FI2A 4QJ4B 2KAVA 4L9MA 2KPHA 2MJWB 3S0BA 1S5GY 2K61A 1R2UA 3EVRA 4WQ3A 1CMGA 2AMIA 1TUJA 3SS3A 3V2LA 5F6TA 1DJYA 3DF0B 3PJIA 1L7ZA 2H61A 2K8MB 4JQ0D 1PALA 1SL8A 3D0YB 1QX5B 2BCBA 5I94A 1SY9A 2EC6C 4ICBA 3VRPA 3CYZA 3B7AA 2CNPA 1BT6A 3EKHA 3TDZA 1QV1A 2PALA 1A2XA 3CR2A 1BODA 2GTEA 3PLFB 1CDNA 1NUBA 3JTDB 3AAKA 1QJTA 1XFYO 5J3XA 4QJ3B 5D69A 2I18A 2KQYA 5I8NA 3UNWA 1S5GZ 5D3OA 1L2OB 1BR1B 1SBJA 1IH0A 4YGBB 1XFZO 3I5IB 1CFCA 1G8IA 3SIBA 2WCFA 3OBVA 5HLVA 2WCHA 1BMOA 1CM4A 4YGDB 2FJYA 4PDZA 3SG6A 2I2RE 2QEHA 3I5IC 3FS7A 1L2OC 2JT8A 1M46A 2K60A 3BUOB 4INWA 2ZN9A 2E30A 3O2PA 1JFKA 1MXEA 4FQOA 1OZSA 2KGBC 3K1EA 2P71A 3KHEA 2Q91A 4PT1A 1FF1A 2LMVA 2OPOA 3I5HC 2BAPA 3DZTA 3D76A 4CFQA 2NZ0A 1IIOA 3EG5B 2M7NA 1WRKA 2QEBA 4NDCA 1SNLA 2HF5A 3NSIA 1S1EA 1SRAA 4MSPA 2LLUA 3B86A 1BU3A 2CT9A 2O60A 2M1UA 3IF7A 2BBNA 1EL4A 1KK8C 1QLKA 1YURA 2FJUB 3I5HB 1QWVA 1CKKA 2K7CA 1DMOA 1PRWA 5DICA 2Y5IA 3NXAA 1DEKA 1YUUA 2JPOA 3FE9A 1F4QA 3OGNA 1PVBA 3AKAA 1B8RA 1JSAA 1F71A 1Q80A 1S3PA 3PN7C 3SJSA 3DY9A 2BCAA 4C0JA 1TNPA 2JXLA 3I5GC 1W7IB 1JF0A 2KYFA 4AOMA 1B4CA 3K21A 3CR5X 2K2AA 3H4SE 4N1GA 1LA3A 1QATA 3CLNA 4JWQA 4M2QA 1DT7B 1A03A 5DKNA 3BFBA 4YGEB 1TNQA 3BQ3A 2DOQA 1C7WA 2JNXA 2K7DA 1UURA 3BFHA 1A29A 3R72A 1SKTA 1NX2A 2QACA 3F45A 4CPVA 3WXAA 1CLMA 3EVVA 3PALA 4GGFC 5KTYA 2KDHA 3BOWA 3WNXB 2IS9A 3CTNA 1J7RA 1CMFA 1QX7A 2QEVA 1NX3A 1SW8A 1FW4A 2L4HA 1TNWA 3BXKA 5HKYA 1CLLA 1XFVO 2F2OA 2LLSA 2F33A 1CDMA 2KLEA 2L2EA 4NDBA 1LA0A 3C1VA 5D7FA 2WNDA 3TS5B 4CIDA 3L4LA 4IL1A 2WC6A 4C0LA 1UHHA 3I5GB 2LVJA 2JWWA 5G08A 3A8RA 1XK4A 2GGZA 5BPJA 4DIRA 3D10A 1FI5A 1DTLA 3JVTC 2M8UA 1SCMB 3IQQA 3TDIA 1RTP1 2ZRSA 3D74A 1IKUA 5HLOA 3LK0A 2GV5A 1N0YA 1QS7A 2P6BB 4N5XA 5AEQA 4UPGA 3D75A 1GQMA 3TUYB 1AK8A 4ETOA 3OX5A 2KOTA 4GNKB 4OZDA 3B6XA 4PCWA 1JF2A 3BOWB 3NSLA 2JPTA 1D1OA 2PQLA 1YRUB 3KO0A 1XVJA 4I5JA 4DCKA 3ZWHA 1DELA 2M1KB 4DUQA 1NCXA 3QMEA 2KBMA 5I2OA 1OMVA 4I5NB 2K0JA 3S0FA 2ZNEA 4N1FA 4INXA 1LS8A 2BECA 2KSPA 5ER4X 1LVCD 1MF8B 1AVSA 2FOTA 2JZIA 4QJ5B 4PHMA 4DS7A 1H4BA 3HX4A 3OX6A 1SPYA 1S26D 1YVLA 5HL1A 1UHJA 1BF5A 2Q4UA 1Z4HA 1K96A 2LCPA 1DJGA 1K94A 4MZKA 1IJ6A 2QEOA 1P28A 1S6IA 2V53A 5KU1A 1MHOA 4P5OE 1CDLA 4AQIA 2E6WA 1LKJA 4F0ZB 1A4PA 1KFXL 1H8BA 3S0EA 1BLQA 4C0KA 1KK8B 1QX2A 1IJ5A 1GGZA 1CFFA 1IGVA 1OZOA 2WCEA 2PSRA 1RECA 2LAPA 2BKHB 5DKQA 2CTNA 2LM5A 1EH2A 2BBMA 2FCDA 2KNEA 4P2YB 4WRIA 5K89A 2PMYA 3BJHA 5JOLA 1DJHA 2KGRA 1J7QA 2RGIA 1ZUZA 1M63B 2L5XB 2OS8B 2KI4C 1XYDA 5CSIA 1K9UA 1FI6A 1TWOA 1QIVA 4MVFA 3NSOA 1IQ3A 1JC2A 5TNCA 2EHBA 1KWOB 4U8DA 2EGDA 2KYCA 1G33A 4Q04A 2P70A 1Y0VH 2L51A 2NXQA 1DGUA 1MR8A 2LANA 5ER5A 3D77A 1UHIA 2WCBA 2COLB 2KI6D 3RLZA 1M31A 2MA2A 3PSRA 1SCVA 3SS4A 4TNCA 5HKZA 1MQ1A 2A4JA 3DVKA 3RM1A 1DF0B 5AANA 2WCMA 4AQJA 2OTGC 1KQMC 3BUMB 1TCFA 5AERA 1S6JA 1KSMA 1W7JB 2JNFA 1OE9B 1MUXA 1J55A 3S0GA 2NLNA 2JQ6A 1FBVA 2D8NA 4MZJA 4CLNA 1R6PA 2WOSA 3OHMB 3BUXB 2O5GA 2BNXA 3EKJA 3O78A 3BUNB 5PALA 4PE0A 1ODBA 3FE8A 2MLFC 4HRHA 3PM8A 1V1FA 5IBWA 2OTGB 1GJYA 1A75A 3M0WA 1B1GA 1TRFA 1Y1UA 4CFRA 2Y1NA 3GK2A 2K7OA 1XA5A 2NCOA 1SCMC
chains in the Genus database with same CATH topology
1C3ZA 3CZ2A 3CABA 3D74A 3CYZA 3B7AA 3RZSA 2WCLA 3D75A 1GM0A 1ORGA 2GTEA 4OZDA 3B6XA 1OOHA 3NGVA 3CZ1A 4FQTA 3R1VA 3VB1A 2PQLA 1OW4A 2WCKA 2H8VA 3QMEA 3S0FA 2WCHA 4INXA 1LS8A 2FJYA 3DXLA 2QEHA 3R1PA 4F7FA 4INWA 3FE6A 1XFRA 2ERBA 1DQEA 3K1EA 2P71A 2QDIA 4PT1A 2QEOA 1P28A 3B87A 3DZTA 3D76A 2QEBA 2WCJA 3S0EA 3NHIA 3B86A 1C3YA 1QWVA 3NHTA 5DICA 1OOGA 3D73A 1OOFA 2JPOA 2WC5A 3FE9A 3OGNA 3BJHA 3BFAA 1TWOA 3DY9A 2L2CA 3S0DA 2P70A 5EL2A 3BFBA 3D77A 3L4AA 3BFHA 3R72A 3S0AA 3B88A 2WCMA 1T14A 3CZ0A 3N7HA 2QEVA 3D78A 3R1OA 3S0GA 3DYEA 1OOIX 3Q8IA 3S0BA 2KPHA 3FE8A 3L4LA 2WC6A 1TUJA 3L47A 3V2LA 4JD9A 3CDNA 3PJIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1C3Z A;  3CZ2 A;  3CAB A;  3D74 A;  3CYZ A;  3B7A A;  3RZS A;  2WCL A;  3D75 A;  1GM0 A;  1ORG A;  2GTE A;  4OZD A;  3B6X A;  1OOH A;  3NGV A;  3CZ1 A;  4FQT A;  3R1V A;  3VB1 A;  2PQL A;  1OW4 A;  2WCK A;  2H8V A;  3QME A;  3S0F A;  2WCH A;  4INX A;  1LS8 A;  2FJY A;  3DXL A;  2QEH A;  3R1P A;  4F7F A;  4INW A;  3FE6 A;  1XFR A;  2ERB A;  1DQE A;  3K1E A;  2P71 A;  2QDI A;  4PT1 A;  2QEO A;  1P28 A;  3B87 A;  3DZT A;  3D76 A;  2QEB A;  2WCJ A;  3S0E A;  3NHI A;  3B86 A;  1C3Y A;  1QWV A;  3NHT A;  5DIC A;  1OOG A;  3D73 A;  1OOF A;  2JPO A;  2WC5 A;  3FE9 A;  3OGN A;  3BJH A;  3BFA A;  1TWO A;  3DY9 A;  2L2C A;  3S0D A;  2P70 A;  5EL2 A;  3BFB A;  3D77 A;  3L4A A;  3BFH A;  3R72 A;  3S0A A;  3B88 A;  2WCM A;  1T14 A;  3CZ0 A;  3N7H A;  2QEV A;  3D78 A;  3R1O A;  3S0G A;  3DYE A;  1OOI X;  3Q8I A;  3S0B A;  2KPH A;  3FE8 A;  3L4L A;  2WC6 A;  1TUJ A;  3L47 A;  3V2L A;  4JD9 A;  3CDN A;  3PJI A; 
#chains in the Genus database with same CATH topology
 2JT0 A;  1YRT B;  2LP2 A;  3CZ2 A;  3O4Y A;  1YUS A;  4E68 A;  1K95 A;  1LXF C;  4M2O A;  2L98 A;  4ORB B;  2WCL A;  3KF9 A;  1JBA A;  1GM0 A;  2AAO A;  1NX0 A;  1YTZ C;  3EK8 A;  4MRY A;  5HKW A;  2F2P A;  3TS5 C;  1KFU L;  2KHN A;  4OKH A;  1OOH A;  2K7B A;  4FQT A;  3R1V A;  1AP4 A;  4OR9 B;  3VB1 A;  1IWQ A;  1SL9 A;  2F3Y A;  1OW4 A;  1ZOT B;  3KEV A;  2WCK A;  1CNP A;  1RRO A;  2L5Y A;  1B8L A;  1SYM A;  2H8V A;  1B9A A;  1J1D A;  1X02 A;  1DJZ A;  1BG1 A;  2G2B A;  1F55 A;  4JPZ B;  3JTD C;  2EC6 B;  1CDP A;  2SAS A;  5HYD A;  4GPL B;  2K2F A;  3DXL A;  2Y4Q A;  3CGA A;  5FI7 A;  1Y1X A;  3R1P A;  4PE4 A;  5CSJ A;  3SG2 A;  4F7F A;  4PHK A;  2JC2 A;  2KQ6 A;  1NCZ A;  3FE6 A;  1GGW A;  1XFR A;  1ZFS A;  2JRF A;  2LUX A;  2ERB A;  3SG3 A;  1V1G A;  3WHU B;  2BL0 B;  3EK4 A;  5KSZ A;  1OMD A;  2JU0 A;  1K90 D;  2MLE C;  4GGF A;  3B87 A;  1WDC C;  3CWG A;  4MN0 A;  1RWY A;  1NYA A;  2M97 A;  2ZN8 A;  1AJ4 A;  2CBL A;  1HQV A;  4MEW A;  1YX8 A;  1F8H A;  4JKT A;  1UP5 A;  3OB2 B;  4GBA A;  3PFV A;  1WRL A;  3LL8 B;  3DD4 A;  1YUT A;  2M0R A;  3LCP C;  5FI6 A;  5I2L A;  2KAY A;  2LUC A;  1JUO A;  1SR6 B;  1A75 B;  2JOJ A;  3DF0 A;  1NSH A;  1RK9 A;  1OOG A;  1ZAC A;  1K9K A;  4XJK A;  1TCO B;  1UWO A;  2JT3 A;  1NX1 A;  1OOF A;  1WY9 A;  5GQQ C;  2OS8 C;  3AKB A;  3SG4 A;  3SG5 A;  2GGM A;  3BFA A;  1C07 A;  1KFU S;  2VRG A;  3EK7 A;  3ZNI A;  2KFF A;  1DJX A;  3HCM A;  3ICB A;  3VRR A;  3A4U B;  4YRU A;  1N65 A;  2LVK A;  1SL7 A;  4MBE A;  5JJG A;  1B8C A;  1QV0 A;  4I5L B;  3AAJ A;  2MHH A;  2CXJ A;  3VRN A;  4WQ2 A;  1AHR A;  3GK1 A;  1QAS A;  2WC8 A;  1KSO A;  2TN4 A;  4YI9 A;  2L50 A;  4YGC B;  3S0D A;  3NSK A;  2Y1M A;  2H61 C;  1KQM B;  1YVH A;  2HPS A;  2M9G A;  5EL2 A;  4NDD A;  4ORA B;  3S0A A;  1KQV A;  2M29 A;  5DKR A;  2ZKM X;  1AUI B;  3TZ1 A;  3IVT A;  1NCY A;  1T14 A;  2M3W A;  1BJF A;  2KI6 C;  3VGO A;  3MSE B;  3N7H A;  1M39 A;  3R1O A;  4PE7 A;  1SK6 D;  1DVI A;  2HQ8 A;  3O4X A;  4PAL A;  1TOP A;  5CPV A;  1OOI X;  2B1U A;  3Q8I A;  1CFD A;  1J1E A;  1DF0 A;  3D0Y A;  3IQO A;  1EG4 A;  1XK4 C;  2JUL A;  4OVN F;  1DGV A;  1QIW A;  1PSB A;  1RFJ A;  1OSA A;  1WLM A;  2LLT A;  4NQG A;  5B8I B;  5I2Q A;  3L47 A;  3GOF A;  4JD9 A;  1S6C A;  1MWN A;  1XFX O;  2BE6 A;  3CDN A;  4PE1 A;  1U5I B;  1C3Z A;  1QTX A;  2JTT A;  4GAO A;  3CAB A;  3GK4 X;  1Y6W A;  1EJ3 A;  3E3R A;  3RZS A;  1CFP A;  1UHN A;  4KYN A;  2LMT A;  3BYA A;  4XJK B;  3TUY C;  1J7P A;  4D1E A;  2I94 A;  1ORG A;  4HSZ A;  1N2D A;  4MLW A;  1JFJ A;  5FYX A;  1BOC A;  1JWD A;  3FWC A;  2L4I A;  1SR6 C;  2CCM A;  1F4O A;  3CZ1 A;  3EVU A;  3NGV A;  2MBX A;  2M49 B;  1IG5 A;  1J7O A;  2KFG A;  4YBH B;  1ALW A;  5AXI A;  1CTR A;  2FCE A;  4A4C A;  2KBI A;  1XFU O;  1YR5 A;  4YGA A;  1WDC B;  1S36 A;  2QPT A;  1KFX S;  2MRD A;  2KLD A;  1WRZ A;  3KPX A;  1QXP A;  4GUK A;  1NP8 A;  1F70 A;  1KWO C;  1UHK A;  1VRK A;  2BL0 C;  2KI4 B;  3SS5 A;  4DRW A;  1PUL A;  3CZT X;  2G9B A;  1EG3 A;  2LHI A;  4IJ7 A;  2ISD A;  2AUC A;  4PHN A;  1K2H A;  2PAS A;  1CM1 A;  4I5K A;  1DJI A;  2ZFD A;  2H2K A;  2JXC A;  1TN4 A;  3VRO A;  4OCI A;  1U5I A;  2JTZ A;  1AJ5 A;  1DQE A;  1HT9 A;  1PVA A;  4MRX A;  5CSF A;  1F54 A;  2M7L A;  2HQW A;  2QDI A;  1TNX A;  4PHJ A;  1XO5 A;  2LE9 B;  1DC1 A;  1K93 D;  1B47 A;  2YGU A;  3I5F C;  5AFP A;  3FIA A;  4ORC B;  2PRU A;  3JVT B;  2LVI A;  1TUZ A;  2WCJ A;  3NHI A;  1ALV A;  4BY4 A;  1CLB A;  1KK7 Y;  2MAZ A;  3VRQ A;  4R1E A;  3LK1 A;  2KAX A;  4FTG A;  3SIA A;  1DJW A;  1BR4 B;  2BKI B;  1SSE B;  3TDU A;  1C3Y A;  1MXL C;  3DVJ A;  1OQP A;  1EXR A;  2I7A A;  3NHT A;  3CR4 X;  4USL A;  4ZCV A;  4A4B A;  1B7T Z;  3BUW B;  3D73 A;  2WC5 A;  2BCX A;  1FPW A;  2KFH A;  1WLZ A;  3PM2 A;  1RJV A;  1OMR A;  1NIW A;  2LHL A;  3FWB A;  1PSR A;  3QRX A;  4HRE E;  2L2C A;  4M2P A;  1OOJ A;  1E8A A;  1TIZ A;  3CS1 A;  3SG7 A;  3O6B A;  3UO9 A;  1SMG A;  2LMU A;  3PAT A;  1C7V A;  1LIN A;  4BY5 A;  2F3Z A;  3DVE A;  3WHT B;  3I5F B;  4GFT A;  4HRG A;  1QLS A;  1QVI Z;  1QVI Y;  2LVV A;  1KK7 Z;  1TTX A;  2WOR A;  5CSN A;  4MZL A;  4GGN A;  2F8P A;  1K9P A;  1W9Z A;  1M45 A;  2LC5 A;  3L4A A;  2NCP A;  1B7T Y;  2LV7 A;  4YI8 A;  3OP0 A;  1KCY A;  1UUS A;  2SCP A;  2LP3 A;  2PVB A;  1YX7 A;  2L0P A;  3B88 A;  1PK0 D;  2R2I A;  2ZND A;  1NPQ A;  1ZMZ A;  1Z2C B;  2HET A;  3CZ0 A;  3LLE A;  3D78 A;  1IRJ A;  2LNK A;  3DVM A;  1Y1A A;  3OB1 B;  3PN7 B;  2BE4 A;  3DYE A;  1CB1 A;  1G4Y R;  1XFW O;  4ZCU A;  1IQ5 A;  1K8U A;  4XYN A;  2ZRT A;  1NWD A;  2PYQ A;  4OV2 A;  5FI2 A;  4QJ4 B;  2KAV A;  4L9M A;  2KPH A;  2MJW B;  3S0B A;  1S5G Y;  2K61 A;  1R2U A;  3EVR A;  4WQ3 A;  1CMG A;  2AMI A;  1TUJ A;  3SS3 A;  3V2L A;  5F6T A;  1DJY A;  3DF0 B;  3PJI A;  1L7Z A;  2H61 A;  2K8M B;  4JQ0 D;  1PAL A;  1SL8 A;  3D0Y B;  1QX5 B;  2BCB A;  5I94 A;  1SY9 A;  2EC6 C;  4ICB A;  3VRP A;  3CYZ A;  3B7A A;  2CNP A;  1BT6 A;  3EKH A;  3TDZ A;  1QV1 A;  2PAL A;  1A2X A;  3CR2 A;  1BOD A;  2GTE A;  3PLF B;  1CDN A;  1NUB A;  3JTD B;  3AAK A;  1QJT A;  1XFY O;  5J3X A;  4QJ3 B;  5D69 A;  2I18 A;  2KQY A;  5I8N A;  3UNW A;  1S5G Z;  5D3O A;  1L2O B;  1BR1 B;  1SBJ A;  1IH0 A;  4YGB B;  1XFZ O;  3I5I B;  1CFC A;  1G8I A;  3SIB A;  2WCF A;  3OBV A;  5HLV A;  2WCH A;  1BMO A;  1CM4 A;  4YGD B;  2FJY A;  4PDZ A;  3SG6 A;  2I2R E;  2QEH A;  3I5I C;  3FS7 A;  1L2O C;  2JT8 A;  1M46 A;  2K60 A;  3BUO B;  4INW A;  2ZN9 A;  2E30 A;  3O2P A;  1JFK A;  1MXE A;  4FQO A;  1OZS A;  2KGB C;  3K1E A;  2P71 A;  3KHE A;  2Q91 A;  4PT1 A;  1FF1 A;  2LMV A;  2OPO A;  3I5H C;  2BAP A;  3DZT A;  3D76 A;  4CFQ A;  2NZ0 A;  1IIO A;  3EG5 B;  2M7N A;  1WRK A;  2QEB A;  4NDC A;  1SNL A;  2HF5 A;  3NSI A;  1S1E A;  1SRA A;  4MSP A;  2LLU A;  3B86 A;  1BU3 A;  2CT9 A;  2O60 A;  2M1U A;  3IF7 A;  2BBN A;  1EL4 A;  1KK8 C;  1QLK A;  1YUR A;  2FJU B;  3I5H B;  1QWV A;  1CKK A;  2K7C A;  1DMO A;  1PRW A;  5DIC A;  2Y5I A;  3NXA A;  1DEK A;  1YUU A;  2JPO A;  3FE9 A;  1F4Q A;  3OGN A;  1PVB A;  3AKA A;  1B8R A;  1JSA A;  1F71 A;  1Q80 A;  1S3P A;  3PN7 C;  3SJS A;  3DY9 A;  2BCA A;  4C0J A;  1TNP A;  2JXL A;  3I5G C;  1W7I B;  1JF0 A;  2KYF A;  4AOM A;  1B4C A;  3K21 A;  3CR5 X;  2K2A A;  3H4S E;  4N1G A;  1LA3 A;  1QAT A;  3CLN A;  4JWQ A;  4M2Q A;  1DT7 B;  1A03 A;  5DKN A;  3BFB A;  4YGE B;  1TNQ A;  3BQ3 A;  2DOQ A;  1C7W A;  2JNX A;  2K7D A;  1UUR A;  3BFH A;  1A29 A;  3R72 A;  1SKT A;  1NX2 A;  2QAC A;  3F45 A;  4CPV A;  3WXA A;  1CLM A;  3EVV A;  3PAL A;  4GGF C;  5KTY A;  2KDH A;  3BOW A;  3WNX B;  2IS9 A;  3CTN A;  1J7R A;  1CMF A;  1QX7 A;  2QEV A;  1NX3 A;  1SW8 A;  1FW4 A;  2L4H A;  1TNW A;  3BXK A;  5HKY A;  1CLL A;  1XFV O;  2F2O A;  2LLS A;  2F33 A;  1CDM A;  2KLE A;  2L2E A;  4NDB A;  1LA0 A;  3C1V A;  5D7F A;  2WND A;  3TS5 B;  4CID A;  3L4L A;  4IL1 A;  2WC6 A;  4C0L A;  1UHH A;  3I5G B;  2LVJ A;  2JWW A;  5G08 A;  3A8R A;  1XK4 A;  2GGZ A;  5BPJ A;  4DIR A;  3D10 A;  1FI5 A;  1DTL A;  3JVT C;  2M8U A;  1SCM B;  3IQQ A;  3TDI A;  1RTP 1;  2ZRS A;  3D74 A;  1IKU A;  5HLO A;  3LK0 A;  2GV5 A;  1N0Y A;  1QS7 A;  2P6B B;  4N5X A;  5AEQ A;  4UPG A;  3D75 A;  1GQM A;  3TUY B;  1AK8 A;  4ETO A;  3OX5 A;  2KOT A;  4GNK B;  4OZD A;  3B6X A;  4PCW A;  1JF2 A;  3BOW B;  3NSL A;  2JPT A;  1D1O A;  2PQL A;  1YRU B;  3KO0 A;  1XVJ A;  4I5J A;  4DCK A;  3ZWH A;  1DEL A;  2M1K B;  4DUQ A;  1NCX A;  3QME A;  2KBM A;  5I2O A;  1OMV A;  4I5N B;  2K0J A;  3S0F A;  2ZNE A;  4N1F A;  4INX A;  1LS8 A;  2BEC A;  2KSP A;  5ER4 X;  1LVC D;  1MF8 B;  1AVS A;  2FOT A;  2JZI A;  4QJ5 B;  4PHM A;  4DS7 A;  1H4B A;  3HX4 A;  3OX6 A;  1SPY A;  1S26 D;  1YVL A;  5HL1 A;  1UHJ A;  1BF5 A;  2Q4U A;  1Z4H A;  1K96 A;  2LCP A;  1DJG A;  1K94 A;  4MZK A;  1IJ6 A;  2QEO A;  1P28 A;  1S6I A;  2V53 A;  5KU1 A;  1MHO A;  4P5O E;  1CDL A;  4AQI A;  2E6W A;  1LKJ A;  4F0Z B;  1A4P A;  1KFX L;  1H8B A;  3S0E A;  1BLQ A;  4C0K A;  1KK8 B;  1QX2 A;  1IJ5 A;  1GGZ A;  1CFF A;  1IGV A;  1OZO A;  2WCE A;  2PSR A;  1REC A;  2LAP A;  2BKH B;  5DKQ A;  2CTN A;  2LM5 A;  1EH2 A;  2BBM A;  2FCD A;  2KNE A;  4P2Y B;  4WRI A;  5K89 A;  2PMY A;  3BJH A;  5JOL A;  1DJH A;  2KGR A;  1J7Q A;  2RGI A;  1ZUZ A;  1M63 B;  2L5X B;  2OS8 B;  2KI4 C;  1XYD A;  5CSI A;  1K9U A;  1FI6 A;  1TWO A;  1QIV A;  4MVF A;  3NSO A;  1IQ3 A;  1JC2 A;  5TNC A;  2EHB A;  1KWO B;  4U8D A;  2EGD A;  2KYC A;  1G33 A;  4Q04 A;  2P70 A;  1Y0V H;  2L51 A;  2NXQ A;  1DGU A;  1MR8 A;  2LAN A;  5ER5 A;  3D77 A;  1UHI A;  2WCB A;  2COL B;  2KI6 D;  3RLZ A;  1M31 A;  2MA2 A;  3PSR A;  1SCV A;  3SS4 A;  4TNC A;  5HKZ A;  1MQ1 A;  2A4J A;  3DVK A;  3RM1 A;  1DF0 B;  5AAN A;  2WCM A;  4AQJ A;  2OTG C;  1KQM C;  3BUM B;  1TCF A;  5AER A;  1S6J A;  1KSM A;  1W7J B;  2JNF A;  1OE9 B;  1MUX A;  1J55 A;  3S0G A;  2NLN A;  2JQ6 A;  1FBV A;  2D8N A;  4MZJ A;  4CLN A;  1R6P A;  2WOS A;  3OHM B;  3BUX B;  2O5G A;  2BNX A;  3EKJ A;  3O78 A;  3BUN B;  5PAL A;  4PE0 A;  1ODB A;  3FE8 A;  2MLF C;  4HRH A;  3PM8 A;  1V1F A;  5IBW A;  2OTG B;  1GJY A;  1A75 A;  3M0W A;  1B1G A;  1TRF A;  1Y1U A;  4CFR A;  2Y1N A;  3GK2 A;  2K7O A;  1XA5 A;  2NCO A;  1SCM C; 
#chains in the Genus database with same CATH homology
 1C3Z A;  3CZ2 A;  3CAB A;  3D74 A;  3CYZ A;  3B7A A;  3RZS A;  2WCL A;  3D75 A;  1GM0 A;  1ORG A;  2GTE A;  4OZD A;  3B6X A;  1OOH A;  3NGV A;  3CZ1 A;  4FQT A;  3R1V A;  3VB1 A;  2PQL A;  1OW4 A;  2WCK A;  2H8V A;  3QME A;  3S0F A;  2WCH A;  4INX A;  1LS8 A;  2FJY A;  3DXL A;  2QEH A;  3R1P A;  4F7F A;  4INW A;  3FE6 A;  1XFR A;  2ERB A;  1DQE A;  3K1E A;  2P71 A;  2QDI A;  4PT1 A;  2QEO A;  1P28 A;  3B87 A;  3DZT A;  3D76 A;  2QEB A;  2WCJ A;  3S0E A;  3NHI A;  3B86 A;  1C3Y A;  1QWV A;  3NHT A;  5DIC A;  1OOG A;  3D73 A;  1OOF A;  2JPO A;  2WC5 A;  3FE9 A;  3OGN A;  3BJH A;  3BFA A;  1TWO A;  3DY9 A;  2L2C A;  3S0D A;  2P70 A;  5EL2 A;  3BFB A;  3D77 A;  3L4A A;  3BFH A;  3R72 A;  3S0A A;  3B88 A;  2WCM A;  1T14 A;  3CZ0 A;  3N7H A;  2QEV A;  3D78 A;  3R1O A;  3S0G A;  3DYE A;  1OOI X;  3Q8I A;  3S0B A;  2KPH A;  3FE8 A;  3L4L A;  2WC6 A;  1TUJ A;  3L47 A;  3V2L A;  4JD9 A;  3CDN A;  3PJI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...