3BJHA

Soft-sad crystal structure of a pheromone binding protein from the honeybee apis mellifera l.
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
117
structure length
117
Chain Sequence
DWVPPEVFDLVAEDKARCMSEHGTTQAQIDDVDKGNLVNEPSITCYMYCLLEAFSLVDDEANVDEDIMLGLLPDQLQERAQSVMGKCLPTSGSDNCNKIYNLAKCVQESAPDVWFVI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pheromone-binding protein ASP1
publication title Sulfur single-wavelength anomalous diffraction crystal structure of a pheromone-binding protein from the honeybee Apis mellifera L.
pubmed doi rcsb
source organism Apis mellifera
molecule tags Pheromone binding protein
total genus 45
structure length 117
sequence length 117
ec nomenclature
pdb deposition date 2007-12-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01395 PBP_GOBP PBP/GOBP family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.20 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 Pheromone/general odorant binding protein domain 3bjhA00
3S0GA 3D76A 3NHIA 2QDIA 1TWOA 3L4AA 1T14A 1OOIX 2GTEA 3CZ2A 2WC5A 1GM0A 3BJHA 1TUJA 3Q8IA 1OOFA 2QEHA 3RZSA 3VB1A 2PQLA 1LS8A 2WCKA 3S0DA 1ORGA 3DZTA 4INWA 4F7FA 3B6XA 3NHTA 2ERBA 3R1VA 3D75A 3B7AA 1XFRA 4FQTA 3B87A 3PJIA 3K1EA 1QWVA 1OW4A 2KPHA 2WC6A 3DYEA 3R72A 1DQEA 3OGNA 3D78A 2QEVA 3CZ0A 3CDNA 3R1PA 3S0EA 2WCHA 3L47A 2P70A 3QMEA 4PT1A 3S0FA 2WCLA 2QEBA 3L4LA 3N7HA 3D77A 1P28A 2WCMA 3FE9A 3D73A 3BFBA 3FE8A 2H8VA 4INXA 5EL2A 2FJYA 2JPOA 5DICA 3NGVA 2QEOA 1C3YA 3R1OA 3B86A 1OOGA 3DY9A 3BFAA 2P71A 4OZDA 3S0BA 3CYZA 3S0AA 4JD9A 3D74A 3CABA 3FE6A 2WCJA 3DXLA 2L2CA 3CZ1A 3BFHA 3V2LA 3B88A 1OOHA 1C3ZA
chains in the Genus database with same CATH superfamily
1HQVA 5F6TA 1QLSA 4NDCA 1WRKA 3S0GA 2O60A 2SASA 1XFXO 3NSIA 4ORAB 4E68A 2HQ8A 1JFJA 1QIVA 2BL0B 2K7CA 1SR6C 1E8AA 1CM1A 5FYXA 1DJYA 5CSNA 1NP8A 2JC2A 3EVUA 1J7QA 1K9KA 2WC5A 3VRRA 1UHNA 1PSBA 2BCXA 2OS8C 1BODA 1YX8A 2BBMA 1RJVA 1R6PA 5G08A 2KGBC 1TUJA 4GBAA 4PHJA 1YVHA 3CWGA 1QJTA 2KFFA 1YUSA 1QX7A 2PQLA 1IGVA 2ZNEA 3O6BA 1YUUA 4QJ4B 2KI6C 1XVJA 2JT3A 4I5NB 1KFUS 2CXJA 3BOWA 3LLEA 4OV2A 1L7ZA 3TS5B 3M0WA 1PULA 3DZTA 5I2QA 1QX5B 2FCEA 3ZWHA 4ICBA 1CLMA 1XFRA 3B87A 5HLOA 1Z2CB 2NLNA 1A75B 1TRFA 3K1EA 4GGNA 1OSAA 3PSRA 1CKKA 2SCPA 3EKHA 2K7BA 1BJFA 2JT8A 2KPHA 2WC6A 3EK7A 2M3WA 1DQEA 2KGRA 3R72A 3TDIA 1FW4A 1UHKA 3OGNA 2ZN8A 1F55A 2OTGC 4YRUA 2JULA 1QS7A 2E30A 3CZ0A 2BNXA 1C07A 2LE9B 3PN7B 1B7TZ 1SKTA 3CZTX 1J1DA 1Y1AA 1SSEB 1NX0A 2NCOA 2WCHA 3L47A 2EC6B 2KAVA 4DS7A 1QV1A 1FI6A 1IRJA 1CFDA 1JWDA 1SYMA 4AQIA 2JOJA 4PE4A 1EJ3A 5FI6A 4PALA 3CTNA 3PATA 3KHEA 2ZRTA 4PHMA 5CSIA 1TCOB 2AMIA 3WHUB 4HRHA 4CFRA 3N7HA 3LCPC 2JXCA 5HKYA 1MUXA 1YX7A 1IKUA 4ORBB 3LL8B 4I5LB 2MBXA 5ER5A 1EG4A 2KAYA 2KQ6A 3BUNB 3D73A 3FE9A 4PHNA 3VRNA 3SG6A 4MBEA 2JWWA 3BFBA 5DKRA 3LK1A 1KSMA 1QIWA 3JVTB 3DF0A 1S26D 1NUBA 2H61C 2H8VA 2Y1NA 4PE0A 1JUOA 5KTYA 1M45A 5DICA 1C7VA 3D0YA 4FTGA 1TCFA 2FCDA 5AXIA 1W7JB 3EK8A 1K90D 2FJUB 4I5KA 3B86A 2LMVA 2WORA 2Q4UA 3RM1A 5IBWA 1H4BA 1UP5A 3QRXA 3PN7C 4CFQA 1SY9A 3IQOA 4OZDA 2LHLA 3S0BA 1NIWA 3CYZA 1JF0A 1CFFA 1IG5A 1G4YR 1ZOTB 2M0RA 1AHRA 2Y1MA 2LP2A 3DVEA 1WY9A 3OX6A 4OVNF 3EK4A 1LINA 3I5IB 3ZNIA 4GAOA 3GK1A 3A4UB 3BFHA 3V2LA 2L98A 1A03A 1JC2A 2KHNA 1TTXA 1K9UA 1SK6D 3NSLA 1C3ZA 2WC8A 4P5OE 1F70A 3D76A 2PRUA 2YGUA 3NHIA 2LVIA 3E3RA 1K8UA 1TWOA 2M7NA 1LA3A 1XFYO 2Y4QA 4YI8A 2BE6A 3HCMA 1CFPA 1Q80A 3WXAA 4GGFA 2GGMA 1QVIY 1SBJA 1T14A 5HLVA 1U5IB 1DGVA 3CZ2A 2JZIA 3PLFB 4NDBA 2F2PA 2KI4C 4YGEB 1GM0A 2F3ZA 1RTP1 4OCIA 4MSPA 1YTZC 1JSAA 4OR9B 4CPVA 1TUZA 5JJGA 3RZSA 1DJWA 1DJXA 1EG3A 1CDLA 1WRZA 4NQGA 1DVIA 4XYNA 3TDZA 1NX2A 1TNQA 2Y5IA 1KFXL 3MSEB 4MLWA 1F8HA 1LS8A 3I5FC 1Z4HA 2NXQA 1DF0B 2WNDA 4ZCUA 3S0DA 1QLKA 2QACA 3B6XA 1Y0VH 2ZKMX 3D75A 1M31A 1S36A 2WOSA 1KK7Y 2JXLA 1MF8B 1N65A 3CR5X 5DKQA 1BF5A 3PJIA 1M46A 3EVRA 4BY5A 1TNWA 1KQMC 4AQJA 2LUCA 2K0JA 2KBIA 1OW4A 2HPSA 2JPTA 4XJKB 3DYEA 3TUYB 2L2EA 3BUMB 1LVCD 2DOQA 2KLEA 5J3XA 3PM8A 5I2OA 4MRYA 1CDMA 1G8IA 3DD4A 1B8LA 5FI2A 1JBAA 1SCVA 2P70A 2F33A 4QJ5B 2KFGA 3A8RA 4PT1A 1UHIA 1B47A 1UUSA 4M2PA 1EH2A 4YGAA 1NYAA 4GNKB 4PE7A 2M97A 4MRXA 3GOFA 2IS9A 1K93D 1RECA 1RWYA 1V1FA 5AFPA 1KK8C 2ZN9A 4MVFA 2PSRA 2QEBA 3L4LA 2A4JA 1B8CA 4MZLA 2G9BA 1MWNA 4KYNA 1Y1XA 1EXRA 1P28A 2ISDA 4CIDA 2CT9A 3UO9A 3GK2A 2M29A 2BKIB 1F71A 2BCBA 1SMGA 1QATA 2QPTA 4PDZA 1W9ZA 4WQ2A 5B8IB 1CDPA 2CCMA 2JRFA 1J55A 1KSOA 1DEKA 2JPOA 2K7DA 4HRGA 4PE1A 1NCZA 2BL0C 1XFWO 2WCBA 1XA5A 2LCPA 3EG5B 2QEOA 1NX3A 3VRQA 1GJYA 1NWDA 2BECA 1HT9A 1BT6A 2M1UA 5D69A 1FF1A 1MHOA 1WDCB 2Q91A 2JTZA 1FBVA 1OOJA 4YGBB 4DRWA 1S6JA 1CMFA 1RFJA 3S0AA 3ICBA 4JD9A 1QTXA 3CABA 3JTDB 1J7PA 2I2RE 2WCJA 2PVBA 2F8PA 3TS5C 1BU3A 1GGZA 4A4CA 1L2OB 1SPYA 2L2CA 3NSOA 4C0LA 3CZ1A 1FI5A 3I5GB 3BUOB 2LLSA 1OOHA 1N0YA 1QX2A 1IIOA 1YURA 3OP0A 5HYDA 1YRTB 1OQPA 5D7FA 5ER4X 3WNXB 4YI9A 2K2AA 1ALWA 2KYFA 4HREE 4IL1A 3SG3A 2JT0A 3OB2B 5KU1A 1J1EA 4L9MA 1XO5A 2HF5A 1IJ6A 1OOIX 2NCPA 4P2YB 3O2PA 3SS3A 3UNWA 1OZOA 1TNXA 2PMYA 4NDDA 1BG1A 1PK0D 2HQWA 3DVMA 2MJWB 5GQQC 2H61A 2M1KB 2QEHA 5FI7A 1G33A 3SG5A 3AKAA 2EC6C 2JNFA 3DVJA 3GK4X 4QJ3B 5HKWA 2LM5A 4C0JA 2LMUA 3SIAA 1KCYA 3KF9A 1A75A 1QVIZ 3PALA 1SL8A 4USLA 1ORGA 1DTLA 1K95A 3EKJA 2F3YA 1PALA 4INWA 3NHTA 1CM4A 2ERBA 2AAOA 1OZSA 3EVVA 1PVBA 4MEWA 4ZCVA 2KI6D 5PALA 2MLEC 3BOWB 1A2XA 1ZMZA 5CSFA 1BR1B 1AUIB 1A29A 1SR6B 3AAKA 3KO0A 4HSZA 1A4PA 3FWBA 3JVTC 1CLLA 3DVKA 3LK0A 3D78A 1UWOA 2QEVA 2NZ0A 3CR4X 1YRUB 1DMOA 5BPJA 2HETA 2JTTA 1KK7Z 2KSPA 2MA2A 3R1PA 1EL4A 2I94A 2M9GA 4GFTA 1CLBA 3QMEA 1SRAA 1DT7B 3IF7A 3VGOA 4AOMA 1Y1UA 1AVSA 1MXEA 1KFUL 1MQ1A 4UPGA 4N5XA 3BYAA 2B1UA 2CTNA 2GGZA 1LA0A 2O5GA 2WCLA 1D1OA 2L4HA 1F4QA 1OMRA 1YR5A 3SS5A 2ZRSA 1LKJA 2KLDA 4GUKA 4M2QA 5D3OA 2LP3A 1B9AA 2L4IA 3RLZA 2AUCA 5HKZA 3OB1B 4F0ZB 2M8UA 1XYDA 2KQYA 3I5IC 4MZKA 1YUTA 2MHHA 1QASA 2PALA 1CNPA 1IJ5A 3FE8A 4CLNA 2OTGB 2F2OA 1PRWA 4YGCB 1S5GY 3CLNA 4INXA 5EL2A 2FJYA 3TDUA 3PFVA 3FIAA 3NGVA 4JWQA 1KQVA 3O78A 2K8MB 3FS7A 3DF0B 3BUXB 4M2OA 2LMTA 4OKHA 1AJ5A 2BKHB 2R2IA 4YGDB 3R1OA 1ALVA 1ZFSA 2TN4A 5KSZA 1DJGA 3D0YB 3DY9A 4GPLB 2I18A 2M7LA 1BLQA 3BFAA 1V1GA 2ZFDA 4N1GA 2D8NA 2K61A 1SCMB 1X02A 1XK4C 1IWQA 1GQMA 2JQ6A 1KFXS 1R2UA 2MAZA 4JQ0D 4TNCA 1TOPA 4R1EA 3CS1A 1NCXA 3DXLA 2LNKA 3SG2A 1UHJA 2LVVA 2LVKA 2H2KA 4JPZB 2KBMA 3B88A 1SL9A 1U5IA 2KAXA 1M63B 2KFHA 1AP4A 1DJHA 4WQ3A 2QDIA 2P6BB 2LLTA 3NXAA 3FWCA 1BOCA 1B4CA 2LAPA 1AJ4A 3O4XA 3L4AA 2KDHA 1H8BA 3AKBA 3WHTB 2LC5A 3TUYC 3SG4A 3BXKA 2GTEA 1B1GA 3SJSA 1OE9B 1J7OA 1XK4A 2M49B 1OMDA 1K9PA 1DF0A 1NCYA 1TNPA 2G2BA 3BJHA 3SS4A 1DELA 1QV0A 1MXLC 1OOFA 3H4SE 3Q8IA 5DKNA 1KWOB 1LXFC 2MLFC 1GGWA 3VB1A 1JFKA 4WRIA 1IQ3A 1K2HA 1S6CA 3CGAA 2LV7A 2CNPA 1SW8A 1S6IA 2WCKA 1QXPA 1FPWA 2I7AA 4F7FA 1S3PA 3R1VA 3D10A 1B7TY 4PCWA 4XJKA 3B7AA 4FQTA 1XFVO 4Q04A 3BUWB 1N2DA 1QWVA 2L51A 2EHBA 1SCMC 3VRPA 2BCAA 5I94A 1ODBA 3O4YA 4MZJA 1M39A 1K96A 1CFCA 1DJIA 1W7IB 4N1FA 2LVJA 5CPVA 3SIBA 1F4OA 4BY4A 1MR8A 2KI4B 3NSKA 4MN0A 1SL7A 3TZ1A 3AAJA 3OHMB 1IH0A 2ZNDA 3CDNA 3BQ3A 5AEQA 3KPXA 1AK8A 3S0EA 1ZUZA 2RGIA 1YVLA 2VRGA 5JOLA 2K60A 3S0FA 3I5FB 5CSJA 1VRKA 3IQQA 5TNCA 1WLZA 2E6WA 3CR2A 4IJ7A 4DCKA 1WRLA 4ORCB 1WDCC 3I5HB 2PYQA 1ZACA 3D77A 5I2LA 4JKTA 4A4BA 5I8NA 2GV5A 4GGFC 2PASA 1KWOC 2WCMA 3JTDC 1KQMB 4C0KA 2FOTA 2CBLA 1RROA 2L50A 2OPOA 3C1VA 1L2OC 2L5XB 2JU0A 2OS8B 2LLUA 3F45A 2KOTA 2L0PA 1JF2A 3I5GC 1DGUA 1F54A 1OMVA 3PM2A 2JNXA 2KYCA 1DJZA 2WCFA 3K21A 4D1EA 1CMGA 1XFUO 2BAPA 4PHKA 4DIRA 1PVAA 1IQ5A 1NPQA 1UURA 1SNLA 5AANA 1J7RA 2MRDA 1RK9A 1C3YA 2L5YA 4FQOA 1CTRA 1TN4A 3OBVA 2COLB 1NSHA 5HL1A 1OOGA 2BBNA 2LANA 2K7OA 3IVTA 4DUQA 1CDNA 1BMOA 1WLMA 1KK8B 4YBHB 4U8DA 5K89A 1C7WA 1S5GZ 1UHHA 2P71A 2WCEA 1DC1A 1TIZA 3SG7A 1Y6WA 1K94A 2LUXA 2K2FA 1CB1A 3D74A 2BE4A 1NX1A 1PSRA 2V53A 3FE6A 3VROA 1S1EA 1BR4B 2LHIA 1B8RA 2EGDA 3HX4A 4ETOA 2KNEA 4I5JA 3OX5A 1XFZO 5AERA 3I5HC 3KEVA
chains in the Genus database with same CATH topology
3S0GA 3D76A 3NHIA 2QDIA 1TWOA 3L4AA 1T14A 1OOIX 2GTEA 3CZ2A 2WC5A 1GM0A 3BJHA 1TUJA 3Q8IA 1OOFA 2QEHA 3RZSA 3VB1A 2PQLA 1LS8A 2WCKA 3S0DA 1ORGA 3DZTA 4INWA 4F7FA 3B6XA 3NHTA 2ERBA 3R1VA 3D75A 3B7AA 1XFRA 4FQTA 3B87A 3PJIA 3K1EA 1QWVA 1OW4A 2KPHA 2WC6A 3DYEA 3R72A 1DQEA 3OGNA 3D78A 2QEVA 3CZ0A 3CDNA 3R1PA 3S0EA 2WCHA 3L47A 2P70A 3QMEA 4PT1A 3S0FA 2WCLA 2QEBA 3L4LA 3N7HA 3D77A 1P28A 2WCMA 3FE9A 3D73A 3BFBA 3FE8A 2H8VA 4INXA 5EL2A 2FJYA 2JPOA 5DICA 3NGVA 2QEOA 1C3YA 3R1OA 3B86A 1OOGA 3DY9A 3BFAA 2P71A 4OZDA 3S0BA 3CYZA 3S0AA 4JD9A 3D74A 3CABA 3FE6A 2WCJA 3DXLA 2L2CA 3CZ1A 3BFHA 3V2LA 3B88A 1OOHA 1C3ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3S0G A;  3D76 A;  3NHI A;  2QDI A;  1TWO A;  3L4A A;  1T14 A;  1OOI X;  2GTE A;  3CZ2 A;  2WC5 A;  1GM0 A;  3BJH A;  1TUJ A;  3Q8I A;  1OOF A;  2QEH A;  3RZS A;  3VB1 A;  2PQL A;  1LS8 A;  2WCK A;  3S0D A;  1ORG A;  3DZT A;  4INW A;  4F7F A;  3B6X A;  3NHT A;  2ERB A;  3R1V A;  3D75 A;  3B7A A;  1XFR A;  4FQT A;  3B87 A;  3PJI A;  3K1E A;  1QWV A;  1OW4 A;  2KPH A;  2WC6 A;  3DYE A;  3R72 A;  1DQE A;  3OGN A;  3D78 A;  2QEV A;  3CZ0 A;  3CDN A;  3R1P A;  3S0E A;  2WCH A;  3L47 A;  2P70 A;  3QME A;  4PT1 A;  3S0F A;  2WCL A;  2QEB A;  3L4L A;  3N7H A;  3D77 A;  1P28 A;  2WCM A;  3FE9 A;  3D73 A;  3BFB A;  3FE8 A;  2H8V A;  4INX A;  5EL2 A;  2FJY A;  2JPO A;  5DIC A;  3NGV A;  2QEO A;  1C3Y A;  3R1O A;  3B86 A;  1OOG A;  3DY9 A;  3BFA A;  2P71 A;  4OZD A;  3S0B A;  3CYZ A;  3S0A A;  4JD9 A;  3D74 A;  3CAB A;  3FE6 A;  2WCJ A;  3DXL A;  2L2C A;  3CZ1 A;  3BFH A;  3V2L A;  3B88 A;  1OOH A;  1C3Z A; 
#chains in the Genus database with same CATH topology
 1HQV A;  5F6T A;  1QLS A;  4NDC A;  1WRK A;  3S0G A;  2O60 A;  2SAS A;  1XFX O;  3NSI A;  4ORA B;  4E68 A;  2HQ8 A;  1JFJ A;  1QIV A;  2BL0 B;  2K7C A;  1SR6 C;  1E8A A;  1CM1 A;  5FYX A;  1DJY A;  5CSN A;  1NP8 A;  2JC2 A;  3EVU A;  1J7Q A;  1K9K A;  2WC5 A;  3VRR A;  1UHN A;  1PSB A;  2BCX A;  2OS8 C;  1BOD A;  1YX8 A;  2BBM A;  1RJV A;  1R6P A;  5G08 A;  2KGB C;  1TUJ A;  4GBA A;  4PHJ A;  1YVH A;  3CWG A;  1QJT A;  2KFF A;  1YUS A;  1QX7 A;  2PQL A;  1IGV A;  2ZNE A;  3O6B A;  1YUU A;  4QJ4 B;  2KI6 C;  1XVJ A;  2JT3 A;  4I5N B;  1KFU S;  2CXJ A;  3BOW A;  3LLE A;  4OV2 A;  1L7Z A;  3TS5 B;  3M0W A;  1PUL A;  3DZT A;  5I2Q A;  1QX5 B;  2FCE A;  3ZWH A;  4ICB A;  1CLM A;  1XFR A;  3B87 A;  5HLO A;  1Z2C B;  2NLN A;  1A75 B;  1TRF A;  3K1E A;  4GGN A;  1OSA A;  3PSR A;  1CKK A;  2SCP A;  3EKH A;  2K7B A;  1BJF A;  2JT8 A;  2KPH A;  2WC6 A;  3EK7 A;  2M3W A;  1DQE A;  2KGR A;  3R72 A;  3TDI A;  1FW4 A;  1UHK A;  3OGN A;  2ZN8 A;  1F55 A;  2OTG C;  4YRU A;  2JUL A;  1QS7 A;  2E30 A;  3CZ0 A;  2BNX A;  1C07 A;  2LE9 B;  3PN7 B;  1B7T Z;  1SKT A;  3CZT X;  1J1D A;  1Y1A A;  1SSE B;  1NX0 A;  2NCO A;  2WCH A;  3L47 A;  2EC6 B;  2KAV A;  4DS7 A;  1QV1 A;  1FI6 A;  1IRJ A;  1CFD A;  1JWD A;  1SYM A;  4AQI A;  2JOJ A;  4PE4 A;  1EJ3 A;  5FI6 A;  4PAL A;  3CTN A;  3PAT A;  3KHE A;  2ZRT A;  4PHM A;  5CSI A;  1TCO B;  2AMI A;  3WHU B;  4HRH A;  4CFR A;  3N7H A;  3LCP C;  2JXC A;  5HKY A;  1MUX A;  1YX7 A;  1IKU A;  4ORB B;  3LL8 B;  4I5L B;  2MBX A;  5ER5 A;  1EG4 A;  2KAY A;  2KQ6 A;  3BUN B;  3D73 A;  3FE9 A;  4PHN A;  3VRN A;  3SG6 A;  4MBE A;  2JWW A;  3BFB A;  5DKR A;  3LK1 A;  1KSM A;  1QIW A;  3JVT B;  3DF0 A;  1S26 D;  1NUB A;  2H61 C;  2H8V A;  2Y1N A;  4PE0 A;  1JUO A;  5KTY A;  1M45 A;  5DIC A;  1C7V A;  3D0Y A;  4FTG A;  1TCF A;  2FCD A;  5AXI A;  1W7J B;  3EK8 A;  1K90 D;  2FJU B;  4I5K A;  3B86 A;  2LMV A;  2WOR A;  2Q4U A;  3RM1 A;  5IBW A;  1H4B A;  1UP5 A;  3QRX A;  3PN7 C;  4CFQ A;  1SY9 A;  3IQO A;  4OZD A;  2LHL A;  3S0B A;  1NIW A;  3CYZ A;  1JF0 A;  1CFF A;  1IG5 A;  1G4Y R;  1ZOT B;  2M0R A;  1AHR A;  2Y1M A;  2LP2 A;  3DVE A;  1WY9 A;  3OX6 A;  4OVN F;  3EK4 A;  1LIN A;  3I5I B;  3ZNI A;  4GAO A;  3GK1 A;  3A4U B;  3BFH A;  3V2L A;  2L98 A;  1A03 A;  1JC2 A;  2KHN A;  1TTX A;  1K9U A;  1SK6 D;  3NSL A;  1C3Z A;  2WC8 A;  4P5O E;  1F70 A;  3D76 A;  2PRU A;  2YGU A;  3NHI A;  2LVI A;  3E3R A;  1K8U A;  1TWO A;  2M7N A;  1LA3 A;  1XFY O;  2Y4Q A;  4YI8 A;  2BE6 A;  3HCM A;  1CFP A;  1Q80 A;  3WXA A;  4GGF A;  2GGM A;  1QVI Y;  1SBJ A;  1T14 A;  5HLV A;  1U5I B;  1DGV A;  3CZ2 A;  2JZI A;  3PLF B;  4NDB A;  2F2P A;  2KI4 C;  4YGE B;  1GM0 A;  2F3Z A;  1RTP 1;  4OCI A;  4MSP A;  1YTZ C;  1JSA A;  4OR9 B;  4CPV A;  1TUZ A;  5JJG A;  3RZS A;  1DJW A;  1DJX A;  1EG3 A;  1CDL A;  1WRZ A;  4NQG A;  1DVI A;  4XYN A;  3TDZ A;  1NX2 A;  1TNQ A;  2Y5I A;  1KFX L;  3MSE B;  4MLW A;  1F8H A;  1LS8 A;  3I5F C;  1Z4H A;  2NXQ A;  1DF0 B;  2WND A;  4ZCU A;  3S0D A;  1QLK A;  2QAC A;  3B6X A;  1Y0V H;  2ZKM X;  3D75 A;  1M31 A;  1S36 A;  2WOS A;  1KK7 Y;  2JXL A;  1MF8 B;  1N65 A;  3CR5 X;  5DKQ A;  1BF5 A;  3PJI A;  1M46 A;  3EVR A;  4BY5 A;  1TNW A;  1KQM C;  4AQJ A;  2LUC A;  2K0J A;  2KBI A;  1OW4 A;  2HPS A;  2JPT A;  4XJK B;  3DYE A;  3TUY B;  2L2E A;  3BUM B;  1LVC D;  2DOQ A;  2KLE A;  5J3X A;  3PM8 A;  5I2O A;  4MRY A;  1CDM A;  1G8I A;  3DD4 A;  1B8L A;  5FI2 A;  1JBA A;  1SCV A;  2P70 A;  2F33 A;  4QJ5 B;  2KFG A;  3A8R A;  4PT1 A;  1UHI A;  1B47 A;  1UUS A;  4M2P A;  1EH2 A;  4YGA A;  1NYA A;  4GNK B;  4PE7 A;  2M97 A;  4MRX A;  3GOF A;  2IS9 A;  1K93 D;  1REC A;  1RWY A;  1V1F A;  5AFP A;  1KK8 C;  2ZN9 A;  4MVF A;  2PSR A;  2QEB A;  3L4L A;  2A4J A;  1B8C A;  4MZL A;  2G9B A;  1MWN A;  4KYN A;  1Y1X A;  1EXR A;  1P28 A;  2ISD A;  4CID A;  2CT9 A;  3UO9 A;  3GK2 A;  2M29 A;  2BKI B;  1F71 A;  2BCB A;  1SMG A;  1QAT A;  2QPT A;  4PDZ A;  1W9Z A;  4WQ2 A;  5B8I B;  1CDP A;  2CCM A;  2JRF A;  1J55 A;  1KSO A;  1DEK A;  2JPO A;  2K7D A;  4HRG A;  4PE1 A;  1NCZ A;  2BL0 C;  1XFW O;  2WCB A;  1XA5 A;  2LCP A;  3EG5 B;  2QEO A;  1NX3 A;  3VRQ A;  1GJY A;  1NWD A;  2BEC A;  1HT9 A;  1BT6 A;  2M1U A;  5D69 A;  1FF1 A;  1MHO A;  1WDC B;  2Q91 A;  2JTZ A;  1FBV A;  1OOJ A;  4YGB B;  4DRW A;  1S6J A;  1CMF A;  1RFJ A;  3S0A A;  3ICB A;  4JD9 A;  1QTX A;  3CAB A;  3JTD B;  1J7P A;  2I2R E;  2WCJ A;  2PVB A;  2F8P A;  3TS5 C;  1BU3 A;  1GGZ A;  4A4C A;  1L2O B;  1SPY A;  2L2C A;  3NSO A;  4C0L A;  3CZ1 A;  1FI5 A;  3I5G B;  3BUO B;  2LLS A;  1OOH A;  1N0Y A;  1QX2 A;  1IIO A;  1YUR A;  3OP0 A;  5HYD A;  1YRT B;  1OQP A;  5D7F A;  5ER4 X;  3WNX B;  4YI9 A;  2K2A A;  1ALW A;  2KYF A;  4HRE E;  4IL1 A;  3SG3 A;  2JT0 A;  3OB2 B;  5KU1 A;  1J1E A;  4L9M A;  1XO5 A;  2HF5 A;  1IJ6 A;  1OOI X;  2NCP A;  4P2Y B;  3O2P A;  3SS3 A;  3UNW A;  1OZO A;  1TNX A;  2PMY A;  4NDD A;  1BG1 A;  1PK0 D;  2HQW A;  3DVM A;  2MJW B;  5GQQ C;  2H61 A;  2M1K B;  2QEH A;  5FI7 A;  1G33 A;  3SG5 A;  3AKA A;  2EC6 C;  2JNF A;  3DVJ A;  3GK4 X;  4QJ3 B;  5HKW A;  2LM5 A;  4C0J A;  2LMU A;  3SIA A;  1KCY A;  3KF9 A;  1A75 A;  1QVI Z;  3PAL A;  1SL8 A;  4USL A;  1ORG A;  1DTL A;  1K95 A;  3EKJ A;  2F3Y A;  1PAL A;  4INW A;  3NHT A;  1CM4 A;  2ERB A;  2AAO A;  1OZS A;  3EVV A;  1PVB A;  4MEW A;  4ZCV A;  2KI6 D;  5PAL A;  2MLE C;  3BOW B;  1A2X A;  1ZMZ A;  5CSF A;  1BR1 B;  1AUI B;  1A29 A;  1SR6 B;  3AAK A;  3KO0 A;  4HSZ A;  1A4P A;  3FWB A;  3JVT C;  1CLL A;  3DVK A;  3LK0 A;  3D78 A;  1UWO A;  2QEV A;  2NZ0 A;  3CR4 X;  1YRU B;  1DMO A;  5BPJ A;  2HET A;  2JTT A;  1KK7 Z;  2KSP A;  2MA2 A;  3R1P A;  1EL4 A;  2I94 A;  2M9G A;  4GFT A;  1CLB A;  3QME A;  1SRA A;  1DT7 B;  3IF7 A;  3VGO A;  4AOM A;  1Y1U A;  1AVS A;  1MXE A;  1KFU L;  1MQ1 A;  4UPG A;  4N5X A;  3BYA A;  2B1U A;  2CTN A;  2GGZ A;  1LA0 A;  2O5G A;  2WCL A;  1D1O A;  2L4H A;  1F4Q A;  1OMR A;  1YR5 A;  3SS5 A;  2ZRS A;  1LKJ A;  2KLD A;  4GUK A;  4M2Q A;  5D3O A;  2LP3 A;  1B9A A;  2L4I A;  3RLZ A;  2AUC A;  5HKZ A;  3OB1 B;  4F0Z B;  2M8U A;  1XYD A;  2KQY A;  3I5I C;  4MZK A;  1YUT A;  2MHH A;  1QAS A;  2PAL A;  1CNP A;  1IJ5 A;  3FE8 A;  4CLN A;  2OTG B;  2F2O A;  1PRW A;  4YGC B;  1S5G Y;  3CLN A;  4INX A;  5EL2 A;  2FJY A;  3TDU A;  3PFV A;  3FIA A;  3NGV A;  4JWQ A;  1KQV A;  3O78 A;  2K8M B;  3FS7 A;  3DF0 B;  3BUX B;  4M2O A;  2LMT A;  4OKH A;  1AJ5 A;  2BKH B;  2R2I A;  4YGD B;  3R1O A;  1ALV A;  1ZFS A;  2TN4 A;  5KSZ A;  1DJG A;  3D0Y B;  3DY9 A;  4GPL B;  2I18 A;  2M7L A;  1BLQ A;  3BFA A;  1V1G A;  2ZFD A;  4N1G A;  2D8N A;  2K61 A;  1SCM B;  1X02 A;  1XK4 C;  1IWQ A;  1GQM A;  2JQ6 A;  1KFX S;  1R2U A;  2MAZ A;  4JQ0 D;  4TNC A;  1TOP A;  4R1E A;  3CS1 A;  1NCX A;  3DXL A;  2LNK A;  3SG2 A;  1UHJ A;  2LVV A;  2LVK A;  2H2K A;  4JPZ B;  2KBM A;  3B88 A;  1SL9 A;  1U5I A;  2KAX A;  1M63 B;  2KFH A;  1AP4 A;  1DJH A;  4WQ3 A;  2QDI A;  2P6B B;  2LLT A;  3NXA A;  3FWC A;  1BOC A;  1B4C A;  2LAP A;  1AJ4 A;  3O4X A;  3L4A A;  2KDH A;  1H8B A;  3AKB A;  3WHT B;  2LC5 A;  3TUY C;  3SG4 A;  3BXK A;  2GTE A;  1B1G A;  3SJS A;  1OE9 B;  1J7O A;  1XK4 A;  2M49 B;  1OMD A;  1K9P A;  1DF0 A;  1NCY A;  1TNP A;  2G2B A;  3BJH A;  3SS4 A;  1DEL A;  1QV0 A;  1MXL C;  1OOF A;  3H4S E;  3Q8I A;  5DKN A;  1KWO B;  1LXF C;  2MLF C;  1GGW A;  3VB1 A;  1JFK A;  4WRI A;  1IQ3 A;  1K2H A;  1S6C A;  3CGA A;  2LV7 A;  2CNP A;  1SW8 A;  1S6I A;  2WCK A;  1QXP A;  1FPW A;  2I7A A;  4F7F A;  1S3P A;  3R1V A;  3D10 A;  1B7T Y;  4PCW A;  4XJK A;  3B7A A;  4FQT A;  1XFV O;  4Q04 A;  3BUW B;  1N2D A;  1QWV A;  2L51 A;  2EHB A;  1SCM C;  3VRP A;  2BCA A;  5I94 A;  1ODB A;  3O4Y A;  4MZJ A;  1M39 A;  1K96 A;  1CFC A;  1DJI A;  1W7I B;  4N1F A;  2LVJ A;  5CPV A;  3SIB A;  1F4O A;  4BY4 A;  1MR8 A;  2KI4 B;  3NSK A;  4MN0 A;  1SL7 A;  3TZ1 A;  3AAJ A;  3OHM B;  1IH0 A;  2ZND A;  3CDN A;  3BQ3 A;  5AEQ A;  3KPX A;  1AK8 A;  3S0E A;  1ZUZ A;  2RGI A;  1YVL A;  2VRG A;  5JOL A;  2K60 A;  3S0F A;  3I5F B;  5CSJ A;  1VRK A;  3IQQ A;  5TNC A;  1WLZ A;  2E6W A;  3CR2 A;  4IJ7 A;  4DCK A;  1WRL A;  4ORC B;  1WDC C;  3I5H B;  2PYQ A;  1ZAC A;  3D77 A;  5I2L A;  4JKT A;  4A4B A;  5I8N A;  2GV5 A;  4GGF C;  2PAS A;  1KWO C;  2WCM A;  3JTD C;  1KQM B;  4C0K A;  2FOT A;  2CBL A;  1RRO A;  2L50 A;  2OPO A;  3C1V A;  1L2O C;  2L5X B;  2JU0 A;  2OS8 B;  2LLU A;  3F45 A;  2KOT A;  2L0P A;  1JF2 A;  3I5G C;  1DGU A;  1F54 A;  1OMV A;  3PM2 A;  2JNX A;  2KYC A;  1DJZ A;  2WCF A;  3K21 A;  4D1E A;  1CMG A;  1XFU O;  2BAP A;  4PHK A;  4DIR A;  1PVA A;  1IQ5 A;  1NPQ A;  1UUR A;  1SNL A;  5AAN A;  1J7R A;  2MRD A;  1RK9 A;  1C3Y A;  2L5Y A;  4FQO A;  1CTR A;  1TN4 A;  3OBV A;  2COL B;  1NSH A;  5HL1 A;  1OOG A;  2BBN A;  2LAN A;  2K7O A;  3IVT A;  4DUQ A;  1CDN A;  1BMO A;  1WLM A;  1KK8 B;  4YBH B;  4U8D A;  5K89 A;  1C7W A;  1S5G Z;  1UHH A;  2P71 A;  2WCE A;  1DC1 A;  1TIZ A;  3SG7 A;  1Y6W A;  1K94 A;  2LUX A;  2K2F A;  1CB1 A;  3D74 A;  2BE4 A;  1NX1 A;  1PSR A;  2V53 A;  3FE6 A;  3VRO A;  1S1E A;  1BR4 B;  2LHI A;  1B8R A;  2EGD A;  3HX4 A;  4ETO A;  2KNE A;  4I5J A;  3OX5 A;  1XFZ O;  5AER A;  3I5H C;  3KEV A; 
#chains in the Genus database with same CATH homology
 3S0G A;  3D76 A;  3NHI A;  2QDI A;  1TWO A;  3L4A A;  1T14 A;  1OOI X;  2GTE A;  3CZ2 A;  2WC5 A;  1GM0 A;  3BJH A;  1TUJ A;  3Q8I A;  1OOF A;  2QEH A;  3RZS A;  3VB1 A;  2PQL A;  1LS8 A;  2WCK A;  3S0D A;  1ORG A;  3DZT A;  4INW A;  4F7F A;  3B6X A;  3NHT A;  2ERB A;  3R1V A;  3D75 A;  3B7A A;  1XFR A;  4FQT A;  3B87 A;  3PJI A;  3K1E A;  1QWV A;  1OW4 A;  2KPH A;  2WC6 A;  3DYE A;  3R72 A;  1DQE A;  3OGN A;  3D78 A;  2QEV A;  3CZ0 A;  3CDN A;  3R1P A;  3S0E A;  2WCH A;  3L47 A;  2P70 A;  3QME A;  4PT1 A;  3S0F A;  2WCL A;  2QEB A;  3L4L A;  3N7H A;  3D77 A;  1P28 A;  2WCM A;  3FE9 A;  3D73 A;  3BFB A;  3FE8 A;  2H8V A;  4INX A;  5EL2 A;  2FJY A;  2JPO A;  5DIC A;  3NGV A;  2QEO A;  1C3Y A;  3R1O A;  3B86 A;  1OOG A;  3DY9 A;  3BFA A;  2P71 A;  4OZD A;  3S0B A;  3CYZ A;  3S0A A;  4JD9 A;  3D74 A;  3CAB A;  3FE6 A;  2WCJ A;  3DXL A;  2L2C A;  3CZ1 A;  3BFH A;  3V2L A;  3B88 A;  1OOH A;  1C3Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...