3BJHA

Soft-sad crystal structure of a pheromone binding protein from the honeybee apis mellifera l.
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
117
structure length
117
Chain Sequence
b'DWVPPEVFDLVAEDKARCMSEHGTTQAQIDDVDKGNLVNEPSITCYMYCLLEAFSLVDDEANVDEDIMLGLLPDQLQERAQSVMGKCLPTSGSDNCNKIYNLAKCVQESAPDVWFVI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pheromone-binding protein ASP1
publication title Sulfur single-wavelength anomalous diffraction crystal structure of a pheromone-binding protein from the honeybee Apis mellifera L.
pubmed doi rcsb
source organism Apis mellifera
molecule tags Pheromone binding protein
total genus 45
structure length 117
sequence length 117
ec nomenclature
pdb deposition date 2007-12-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01395 PBP_GOBP PBP/GOBP family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.20 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 Pheromone/general odorant binding protein domain 3bjhA00
2QEOA 3DXLA 2H8VA 3CDNA 3R1PA 3DY9A 3S0EA 2L2CA 3NGVA 3DYEA 5DICA 2P70A 2JPOA 3CYZA 3DZTA 3FE6A 3K1EA 1TWOA 4PT1A 2WCMA 3BFHA 3N7HA 4FQTA 2P71A 1QWVA 1GM0A 3NHTA 2WCKA 3D73A 3Q8IA 3V2LA 2WCLA 2WC5A 3D74A 2QEVA 3CZ2A 2QEBA 3FE9A 3S0GA 2WC6A 3BFAA 3R72A 2GTEA 3L47A 2WCJA 5EL2A 3S0BA 3BFBA 3L4LA 3PJIA 3QMEA 1XFRA 1OOGA 3B6XA 1LS8A 2PQLA 3RZSA 2QDIA 1P28A 4INWA 3D78A 4JD9A 4INXA 3NHIA 3VB1A 2WCHA 1OOHA 3D77A 1OOFA 4F7FA 1T14A 3R1OA 3R1VA 3B7AA 3S0FA 3D75A 3D76A 2KPHA 3S0DA 1OOIX 2QEHA 1TUJA 3CABA 3B88A 3OGNA 3BJHA 1OW4A 2FJYA 3S0AA 1DQEA 3B86A 4OZDA 1ORGA 3FE8A 3B87A 2ERBA 3CZ0A 3CZ1A 1C3YA 1C3ZA 3L4AA
chains in the Genus database with same CATH superfamily
1QJTA 2QEOA 3PM2A 4NDCA 3SG6A 3BQ3A 2KLDA 3SJSA 1B8CA 1A4PA 2KQ6A 3DVJA 2OS8B 4MSPA 1OZOA 1NX1A 2EC6C 4ICBA 3VRRA 4YI8A 5D7FA 4JQ0D 4I5LB 4YGAA 2LE9B 1NCZA 1EXRA 2BCAA 5J3XA 1LXFC 1QIVA 2EGDA 2P70A 2O5GA 2HF5A 1CDMA 2WCMA 2JZIA 1DVIA 1YX8A 4ORCB 4YGDB 3BXKA 1V1FA 4DRWA 1CLLA 1N2DA 4PE0A 2BKHB 1YVHA 3PLFB 2LMTA 3LCPC 2FCDA 2KDHA 4OV2A 3NHTA 5CSJA 3HX4A 1QS7A 3D73A 4PHKA 2MLFC 3SS5A 1KSMA 1TNQA 1TUZA 2QEVA 3ZWHA 1KFXL 2H61A 4GFTA 2QEBA 2AAOA 2JXLA 2JT3A 3BUNB 2F2OA 5I2OA 1U5IA 2LVIA 4MLWA 5HKZA 4MBEA 2WC8A 1BOCA 1K95A 2BNXA 2LLSA 2Y4QA 2M7NA 2JWWA 2GTEA 3KHEA 1CMFA 4WRIA 2WCJA 4HREE 1AVSA 1DT7B 1A29A 1BR1B 3FIAA 5DKRA 3SG2A 3L4LA 2FOTA 3LL8B 3QMEA 1SMGA 1MQ1A 3WHUB 1OOGA 4C0KA 3EK4A 2BE6A 1NX0A 4ZCVA 1TIZA 5AEQA 2K7CA 1JF2A 4QJ4B 1EL4A 2PMYA 4INWA 2DOQA 2JQ6A 3I5GC 2AMIA 4INXA 3GOFA 4OKHA 1DGUA 4XJKA 1SK6D 1PK0D 1SL8A 4ORBB 2PALA 1Y6WA 1NSHA 2CTNA 1RECA 1ALWA 1FF1A 2JT0A 2KAVA 4IL1A 1SW8A 4FTGA 2H2KA 1WDCC 3OX5A 3R1OA 1XFXO 3SG4A 1NP8A 2SCPA 1TNXA 3D75A 2WCFA 2CBLA 3CZTX 4GGFA 4U8DA 2CNPA 1B47A 4I5NB 3S0DA 2BBMA 2KFFA 4C0LA 1CB1A 1CM4A 1DMOA 1FBVA 2M49B 5D3OA 2E6WA 4Q04A 5FI7A 4KYNA 3OGNA 5KSZA 1M45A 1L7ZA 1QV0A 4L9MA 1ZOTB 3VRPA 1B8RA 4ZCUA 2LHIA 2MBXA 2KI6D 5FYXA 2HETA 2MHHA 3S0AA 1G33A 4XYNA 1HQVA 3EK7A 4P2YB 1CFCA 3ICBA 1PVAA 1RJVA 2LP3A 2EC6B 2HQ8A 2JXCA 1WLZA 2TN4A 2ZNDA 3CZ1A 4JPZB 5DKQA 5FI6A 2Q4UA 2LNKA 1S3PA 2JU0A 3EVRA 4MRYA 5FI2A 1MXEA 2OTGC 1J7PA 1A03A 1JFKA 1DC1A 5PALA 4YBHB 2HQWA 1NX3A 2BE4A 4OVNF 4IJ7A 3JVTB 2FJUB 3BUWB 2MAZA 2SASA 3O4XA 2M7LA 3TDIA 1FI5A 1CFDA 2M8UA 3BOWB 1B7TY 1OZSA 3SG5A 1EG3A 3DZTA 2JPOA 2JULA 1BG1A 1QX5B 3CR2A 2WCBA 2JTZA 3EVUA 4PT1A 3CLNA 3BUXB 1F54A 2ZN9A 3NSLA 1QASA 1QLKA 1QATA 2D8NA 2LUCA 3CTNA 1IG5A 3A8RA 4FQTA 3TS5B 2LMUA 2L5XB 4HRHA 5ER5A 1KSOA 2Y1NA 4AQIA 1GM0A 2KFGA 3SG3A 2WCKA 4P5OE 3D10A 1DJYA 1B1GA 3Q8IA 5HKYA 1FI6A 2GGMA 2BBNA 3RM1A 1PULA 3CZ2A 4BY4A 1ZMZA 4NDDA 1Y0VH 3MSEB 4N1FA 1R6PA 5CSNA 3CGAA 2JOJA 1CFPA 2O60A 4NDBA 3BYAA 3IQOA 3S0GA 4CIDA 2I94A 2I7AA 3BFAA 3SIAA 1CLMA 1E8AA 1SL7A 4R1EA 5B8IB 2ZFDA 1DJZA 1EH2A 1MHOA 1QXPA 3R72A 1S6JA 4I5KA 3JVTC 1K94A 3LLEA 1HT9A 1IQ3A 1Z2CB 1QVIY 4YRUA 1KCYA 2QPTA 3PM8A 3VRQA 4YI9A 4PE4A 2KI4C 3BFBA 1DF0B 3C1VA 5JOLA 3TDUA 3TZ1A 1SYMA 3IVTA 3GK4X 1M31A 2CT9A 3I5GB 5CPVA 1LKJA 1XK4A 3TUYC 3DVEA 4D1EA 1JUOA 1IGVA 1PRWA 2NCPA 2PQLA 2L2EA 2BL0C 3TS5C 1LVCD 1DEKA 1P28A 1JSAA 4AQJA 1EG4A 1J7RA 1KK8B 1WDCB 2LLTA 2WCHA 1MXLC 1NCYA 3VRNA 2ZN8A 3BUOB 4GPLB 1OOFA 2V53A 3K21A 2JRFA 1DJWA 4F7FA 4QJ5B 1OE9B 1CDPA 2CCMA 2E30A 2KHNA 2M97A 1SR6B 3I5IC 1XFUO 1IRJA 4JWQA 1F4OA 2LUXA 1S6IA 3D76A 2KAYA 2PRUA 2JT8A 3NSIA 4PALA 1JFJA 5I94A 2EHBA 2QEHA 2F3ZA 1TUJA 3A4UB 1YRTB 4PHJA 4AOMA 1YRUB 1S36A 2KFHA 3D0YB 2K0JA 3GK1A 1OSAA 1RROA 1F71A 4MEWA 1X02A 2KYFA 2LV7A 2AUCA 3CR4X 2G9BA 3PSRA 1KQMB 4N1GA 1KFUS 1LA3A 1DQEA 2OTGB 3KEVA 3PATA 4OZDA 3JTDC 2LVJA 1K2HA 3QRXA 1GQMA 5F6TA 3PN7C 3SIBA 2PYQA 1JWDA 1C3ZA 2LC5A 5AXIA 3L4AA 3DXLA 1WY9A 3R1PA 4PCWA 3AAJA 3S0EA 3I5FC 2LCPA 3UNWA 1FPWA 1SSEB 1SR6C 2MA2A 2LAPA 3TDZA 3WHTB 2KQYA 1PSRA 4GBAA 3VROA 4CFQA 1NUBA 1NPQA 4C0JA 3OBVA 5DICA 4M2PA 4BY5A 1NIWA 2M29A 4PHMA 1TN4A 3K1EA 4UPGA 1BMOA 1SY9A 1K96A 4MZJA 1OMRA 2K61A 2K8MB 1Q80A 3BFHA 1SCVA 3NSKA 2CXJA 3ZNIA 5CSFA 3LK1A 1K9PA 4YGEB 1VRKA 1WRLA 5K89A 2L50A 4OCIA 2FCEA 2MJWB 3BOWA 1QWVA 1NYAA 1S5GY 2LM5A 1KQMC 5JJGA 1BODA 1UHJA 1KK7Y 3M0WA 4TNCA 1AHRA 2L5YA 2LP2A 1N0YA 4CPVA 3I5HB 1SCMC 1BF5A 1C7VA 1ZACA 2H61C 3NSOA 1YR5A 1Y1XA 2KI4B 2PVBA 1CDNA 3CS1A 1OQPA 3O4YA 1S26D 2BKIB 1A75A 2QACA 1NWDA 2M3WA 3DVKA 3TUYB 1TCFA 3L47A 3E3RA 1IKUA 2L4IA 5EL2A 2BL0B 2KGBC 1BJFA 1CLBA 2NLNA 2YGUA 3PJIA 4ORAB 1PVBA 4PE1A 1XFRA 1F8HA 3O78A 3AKBA 3FS7A 3B6XA 5HLOA 1UHNA 1LS8A 2BCXA 2OPOA 1J7OA 1TOPA 2KYCA 1RTP1 2QDIA 3AAKA 3OB1B 3SG7A 3RZSA 2JTTA 1A75B 2KOTA 3OB2B 4JD9A 1DF0A 1UUSA 2JC2A 2ZRTA 3FWBA 3I5IB 1KWOB 4GGNA 1AJ4A 1CTRA 1YUSA 1SRAA 2L98A 3OX6A 1OOHA 1BU3A 1L2OC 2ZKMX 3EVVA 3I5HC 1XFYO 1K9KA 2JNFA 1KQVA 2JNXA 3O6BA 1T14A 1W9ZA 1CFFA 2F33A 2KLEA 1K8UA 1QIWA 1UP5A 1YUUA 2Y5IA 3KF9A 2LANA 5D69A 3S0FA 2KPHA 3DF0B 3SS3A 1AJ5A 4MZKA 1UHKA 4A4BA 1IWQA 2LHLA 2F3YA 2WNDA 1IH0A 3CWGA 4A4CA 2HPSA 5AANA 2MLEC 3SS4A 3CABA 1NX2A 1QX7A 2K2AA 2BAPA 3JTDB 1CMGA 1UWOA 1K90D 3H4SE 2WOSA 4GUKA 3BJHA 2RGIA 2NXQA 4DUQA 1H8BA 2L4HA 2MRDA 1SPYA 3PN7B 2LVKA 2M9GA 1J7QA 1PSBA 3IQQA 5HYDA 1RK9A 1QV1A 3OHMB 1NCXA 1FW4A 1DELA 1ORGA 3I5FB 4WQ3A 4E68A 1XVJA 1CNPA 2KAXA 3OP0A 1TRFA 3D0YA 1KWOC 2ERBA 2JPTA 4F0ZB 3CZ0A 3WNXB 1EJ3A 1TNPA 1TCOB 4I5JA 1C3YA 1F55A 1IIOA 3V2LA 3EK8A 2R2IA 5G08A 1PALA 2H8VA 3CDNA 4CLNA 3DY9A 4JKTA 1M39A 1SL9A 2L2CA 1N65A 2KNEA 1B8LA 3KPXA 3NGVA 2KI6C 4GAOA 1XFZO 3UO9A 1XFVO 3DYEA 5I2LA 1ODBA 1OOJA 2F2PA 1KFUL 5CSIA 1KK8C 2VRGA 1OMDA 2KBMA 1KFXS 1YURA 2M1KB 2WORA 4MRXA 3CYZA 3FE6A 3PFVA 5HLVA 1TWOA 2OS8C 1G4YR 3EG5B 3NXAA 3PALA 1QTXA 2K7OA 2G2BA 5I8NA 1BR4B 1K93D 1UHHA 1SCMB 2B1UA 2P71A 3DVMA 1S1EA 3N7HA 2K60A 1IJ6A 5GQQC 3DD4A 2L51A 2P6BB 3BUMB 2M1UA 1WRZA 1OMVA 2Q91A 2ZNEA 1J1DA 4OR9B 5TNCA 3KO0A 1F4QA 1U5IB 1UHIA 2WC5A 1M63B 2WCLA 2ISDA 3D74A 1GGWA 1JF0A 4YGBB 2LLUA 4DS7A 4GNKB 4ETOA 1XO5A 1YTZC 2ZRSA 1BLQA 1S5GZ 1M46A 1UURA 2IS9A 2K2FA 1ALVA 1KK7Z 2WC6A 3FE9A 4M2QA 4DCKA 2K7BA 1TTXA 1XYDA 5HL1A 5KTYA 3HCMA 2NCOA 1JBAA 1CDLA 2M0RA 5IBWA 4YGCB 4PDZA 1A2XA 4DIRA 1ZFSA 1YVLA 1ZUZA 1Y1UA 1DJIA 1AK8A 1SBJA 3S0BA 1B7TZ 2L0PA 3IF7A 1AUIB 1YUTA 2I2RE 1XK4C 4XJKB 1F70A 3GK2A 1YX7A 2COLB 1MR8A 1DJHA 1XFWO 2KGRA 3O2PA 4PHNA 1G8IA 1DTLA 1L2OB 2A4JA 2BCBA 4WQ2A 1H4BA 1DJXA 1C7WA 3D78A 1IQ5A 3CR5X 4N5XA 1LINA 2PSRA 3NHIA 2PASA 1TNWA 1GJYA 1WLMA 3VB1A 1WRKA 1V1GA 1Z4HA 1CM1A 1RFJA 1W7IB 1RWYA 3D77A 3EKJA 3LK0A 2WCEA 1DGVA 4PE7A 5I2QA 5KU1A 1LA0A 1K9UA 3F45A 4MVFA 5BPJA 1GGZA 1SNLA 3R1VA 3B7AA 1CKKA 1MWNA 2KSPA 2K7DA 1SKTA 2KBIA 4HSZA 1QLSA 4HRGA 1R2UA 5DKNA 1B9AA 1J1EA 1MF8B 1OOIX 2F8PA 2GV5A 1JC2A 4NQGA 1QVIZ 3FWCA 1BT6A 1W7JB 3B88A 2GGZA 3AKAA 3RLZA 1MUXA 2Y1MA 1XA5A 1QX2A 4QJ3B 3DF0A 5ER4X 3VGOA 2FJYA 2I18A 4M2OA 2NZ0A 1C07A 5AERA 4CFRA 3WXAA 1Y1AA 1D1OA 1IJ5A 3B86A 2BECA 4MZLA 4FQOA 3EKHA 1J55A 3FE8A 1DJGA 2LVVA 4MN0A 2LMVA 3B87A 5AFPA 1B4CA 4USLA 4GGFC 1S6CA 5HKWA 1OW4A 1AP4A
chains in the Genus database with same CATH topology
2QEOA 3DXLA 2H8VA 3CDNA 3R1PA 3DY9A 3S0EA 2L2CA 3NGVA 3DYEA 5DICA 2P70A 2JPOA 3CYZA 3DZTA 3FE6A 3K1EA 1TWOA 4PT1A 2WCMA 3BFHA 3N7HA 4FQTA 2P71A 1QWVA 1GM0A 3NHTA 2WCKA 3D73A 3Q8IA 3V2LA 2WCLA 2WC5A 3D74A 2QEVA 3CZ2A 2QEBA 3FE9A 3S0GA 2WC6A 3BFAA 3R72A 2GTEA 3L47A 2WCJA 5EL2A 3S0BA 3BFBA 3L4LA 3PJIA 3QMEA 1XFRA 1OOGA 3B6XA 1LS8A 2PQLA 3RZSA 2QDIA 1P28A 4INWA 3D78A 4JD9A 4INXA 3NHIA 3VB1A 2WCHA 1OOHA 3D77A 1OOFA 4F7FA 1T14A 3R1OA 3R1VA 3B7AA 3S0FA 3D75A 3D76A 2KPHA 3S0DA 1OOIX 2QEHA 1TUJA 3CABA 3B88A 3OGNA 3BJHA 1OW4A 2FJYA 3S0AA 1DQEA 3B86A 4OZDA 1ORGA 3FE8A 3B87A 2ERBA 3CZ0A 3CZ1A 1C3YA 1C3ZA 3L4AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QEO A;  3DXL A;  2H8V A;  3CDN A;  3R1P A;  3DY9 A;  3S0E A;  2L2C A;  3NGV A;  3DYE A;  5DIC A;  2P70 A;  2JPO A;  3CYZ A;  3DZT A;  3FE6 A;  3K1E A;  1TWO A;  4PT1 A;  2WCM A;  3BFH A;  3N7H A;  4FQT A;  2P71 A;  1QWV A;  1GM0 A;  3NHT A;  2WCK A;  3D73 A;  3Q8I A;  3V2L A;  2WCL A;  2WC5 A;  3D74 A;  2QEV A;  3CZ2 A;  2QEB A;  3FE9 A;  3S0G A;  2WC6 A;  3BFA A;  3R72 A;  2GTE A;  3L47 A;  2WCJ A;  5EL2 A;  3S0B A;  3BFB A;  3L4L A;  3PJI A;  3QME A;  1XFR A;  1OOG A;  3B6X A;  1LS8 A;  2PQL A;  3RZS A;  2QDI A;  1P28 A;  4INW A;  3D78 A;  4JD9 A;  4INX A;  3NHI A;  3VB1 A;  2WCH A;  1OOH A;  3D77 A;  1OOF A;  4F7F A;  1T14 A;  3R1O A;  3R1V A;  3B7A A;  3S0F A;  3D75 A;  3D76 A;  2KPH A;  3S0D A;  1OOI X;  2QEH A;  1TUJ A;  3CAB A;  3B88 A;  3OGN A;  3BJH A;  1OW4 A;  2FJY A;  3S0A A;  1DQE A;  3B86 A;  4OZD A;  1ORG A;  3FE8 A;  3B87 A;  2ERB A;  3CZ0 A;  3CZ1 A;  1C3Y A;  1C3Z A;  3L4A A; 
#chains in the Genus database with same CATH topology
 1QJT A;  2QEO A;  3PM2 A;  4NDC A;  3SG6 A;  3BQ3 A;  2KLD A;  3SJS A;  1B8C A;  1A4P A;  2KQ6 A;  3DVJ A;  2OS8 B;  4MSP A;  1OZO A;  1NX1 A;  2EC6 C;  4ICB A;  3VRR A;  4YI8 A;  5D7F A;  4JQ0 D;  4I5L B;  4YGA A;  2LE9 B;  1NCZ A;  1EXR A;  2BCA A;  5J3X A;  1LXF C;  1QIV A;  2EGD A;  2P70 A;  2O5G A;  2HF5 A;  1CDM A;  2WCM A;  2JZI A;  1DVI A;  1YX8 A;  4ORC B;  4YGD B;  3BXK A;  1V1F A;  4DRW A;  1CLL A;  1N2D A;  4PE0 A;  2BKH B;  1YVH A;  3PLF B;  2LMT A;  3LCP C;  2FCD A;  2KDH A;  4OV2 A;  3NHT A;  5CSJ A;  3HX4 A;  1QS7 A;  3D73 A;  4PHK A;  2MLF C;  3SS5 A;  1KSM A;  1TNQ A;  1TUZ A;  2QEV A;  3ZWH A;  1KFX L;  2H61 A;  4GFT A;  2QEB A;  2AAO A;  2JXL A;  2JT3 A;  3BUN B;  2F2O A;  5I2O A;  1U5I A;  2LVI A;  4MLW A;  5HKZ A;  4MBE A;  2WC8 A;  1BOC A;  1K95 A;  2BNX A;  2LLS A;  2Y4Q A;  2M7N A;  2JWW A;  2GTE A;  3KHE A;  1CMF A;  4WRI A;  2WCJ A;  4HRE E;  1AVS A;  1DT7 B;  1A29 A;  1BR1 B;  3FIA A;  5DKR A;  3SG2 A;  3L4L A;  2FOT A;  3LL8 B;  3QME A;  1SMG A;  1MQ1 A;  3WHU B;  1OOG A;  4C0K A;  3EK4 A;  2BE6 A;  1NX0 A;  4ZCV A;  1TIZ A;  5AEQ A;  2K7C A;  1JF2 A;  4QJ4 B;  1EL4 A;  2PMY A;  4INW A;  2DOQ A;  2JQ6 A;  3I5G C;  2AMI A;  4INX A;  3GOF A;  4OKH A;  1DGU A;  4XJK A;  1SK6 D;  1PK0 D;  1SL8 A;  4ORB B;  2PAL A;  1Y6W A;  1NSH A;  2CTN A;  1REC A;  1ALW A;  1FF1 A;  2JT0 A;  2KAV A;  4IL1 A;  1SW8 A;  4FTG A;  2H2K A;  1WDC C;  3OX5 A;  3R1O A;  1XFX O;  3SG4 A;  1NP8 A;  2SCP A;  1TNX A;  3D75 A;  2WCF A;  2CBL A;  3CZT X;  4GGF A;  4U8D A;  2CNP A;  1B47 A;  4I5N B;  3S0D A;  2BBM A;  2KFF A;  4C0L A;  1CB1 A;  1CM4 A;  1DMO A;  1FBV A;  2M49 B;  5D3O A;  2E6W A;  4Q04 A;  5FI7 A;  4KYN A;  3OGN A;  5KSZ A;  1M45 A;  1L7Z A;  1QV0 A;  4L9M A;  1ZOT B;  3VRP A;  1B8R A;  4ZCU A;  2LHI A;  2MBX A;  2KI6 D;  5FYX A;  2HET A;  2MHH A;  3S0A A;  1G33 A;  4XYN A;  1HQV A;  3EK7 A;  4P2Y B;  1CFC A;  3ICB A;  1PVA A;  1RJV A;  2LP3 A;  2EC6 B;  2HQ8 A;  2JXC A;  1WLZ A;  2TN4 A;  2ZND A;  3CZ1 A;  4JPZ B;  5DKQ A;  5FI6 A;  2Q4U A;  2LNK A;  1S3P A;  2JU0 A;  3EVR A;  4MRY A;  5FI2 A;  1MXE A;  2OTG C;  1J7P A;  1A03 A;  1JFK A;  1DC1 A;  5PAL A;  4YBH B;  2HQW A;  1NX3 A;  2BE4 A;  4OVN F;  4IJ7 A;  3JVT B;  2FJU B;  3BUW B;  2MAZ A;  2SAS A;  3O4X A;  2M7L A;  3TDI A;  1FI5 A;  1CFD A;  2M8U A;  3BOW B;  1B7T Y;  1OZS A;  3SG5 A;  1EG3 A;  3DZT A;  2JPO A;  2JUL A;  1BG1 A;  1QX5 B;  3CR2 A;  2WCB A;  2JTZ A;  3EVU A;  4PT1 A;  3CLN A;  3BUX B;  1F54 A;  2ZN9 A;  3NSL A;  1QAS A;  1QLK A;  1QAT A;  2D8N A;  2LUC A;  3CTN A;  1IG5 A;  3A8R A;  4FQT A;  3TS5 B;  2LMU A;  2L5X B;  4HRH A;  5ER5 A;  1KSO A;  2Y1N A;  4AQI A;  1GM0 A;  2KFG A;  3SG3 A;  2WCK A;  4P5O E;  3D10 A;  1DJY A;  1B1G A;  3Q8I A;  5HKY A;  1FI6 A;  2GGM A;  2BBN A;  3RM1 A;  1PUL A;  3CZ2 A;  4BY4 A;  1ZMZ A;  4NDD A;  1Y0V H;  3MSE B;  4N1F A;  1R6P A;  5CSN A;  3CGA A;  2JOJ A;  1CFP A;  2O60 A;  4NDB A;  3BYA A;  3IQO A;  3S0G A;  4CID A;  2I94 A;  2I7A A;  3BFA A;  3SIA A;  1CLM A;  1E8A A;  1SL7 A;  4R1E A;  5B8I B;  2ZFD A;  1DJZ A;  1EH2 A;  1MHO A;  1QXP A;  3R72 A;  1S6J A;  4I5K A;  3JVT C;  1K94 A;  3LLE A;  1HT9 A;  1IQ3 A;  1Z2C B;  1QVI Y;  4YRU A;  1KCY A;  2QPT A;  3PM8 A;  3VRQ A;  4YI9 A;  4PE4 A;  2KI4 C;  3BFB A;  1DF0 B;  3C1V A;  5JOL A;  3TDU A;  3TZ1 A;  1SYM A;  3IVT A;  3GK4 X;  1M31 A;  2CT9 A;  3I5G B;  5CPV A;  1LKJ A;  1XK4 A;  3TUY C;  3DVE A;  4D1E A;  1JUO A;  1IGV A;  1PRW A;  2NCP A;  2PQL A;  2L2E A;  2BL0 C;  3TS5 C;  1LVC D;  1DEK A;  1P28 A;  1JSA A;  4AQJ A;  1EG4 A;  1J7R A;  1KK8 B;  1WDC B;  2LLT A;  2WCH A;  1MXL C;  1NCY A;  3VRN A;  2ZN8 A;  3BUO B;  4GPL B;  1OOF A;  2V53 A;  3K21 A;  2JRF A;  1DJW A;  4F7F A;  4QJ5 B;  1OE9 B;  1CDP A;  2CCM A;  2E30 A;  2KHN A;  2M97 A;  1SR6 B;  3I5I C;  1XFU O;  1IRJ A;  4JWQ A;  1F4O A;  2LUX A;  1S6I A;  3D76 A;  2KAY A;  2PRU A;  2JT8 A;  3NSI A;  4PAL A;  1JFJ A;  5I94 A;  2EHB A;  2QEH A;  2F3Z A;  1TUJ A;  3A4U B;  1YRT B;  4PHJ A;  4AOM A;  1YRU B;  1S36 A;  2KFH A;  3D0Y B;  2K0J A;  3GK1 A;  1OSA A;  1RRO A;  1F71 A;  4MEW A;  1X02 A;  2KYF A;  2LV7 A;  2AUC A;  3CR4 X;  2G9B A;  3PSR A;  1KQM B;  4N1G A;  1KFU S;  1LA3 A;  1DQE A;  2OTG B;  3KEV A;  3PAT A;  4OZD A;  3JTD C;  2LVJ A;  1K2H A;  3QRX A;  1GQM A;  5F6T A;  3PN7 C;  3SIB A;  2PYQ A;  1JWD A;  1C3Z A;  2LC5 A;  5AXI A;  3L4A A;  3DXL A;  1WY9 A;  3R1P A;  4PCW A;  3AAJ A;  3S0E A;  3I5F C;  2LCP A;  3UNW A;  1FPW A;  1SSE B;  1SR6 C;  2MA2 A;  2LAP A;  3TDZ A;  3WHT B;  2KQY A;  1PSR A;  4GBA A;  3VRO A;  4CFQ A;  1NUB A;  1NPQ A;  4C0J A;  3OBV A;  5DIC A;  4M2P A;  4BY5 A;  1NIW A;  2M29 A;  4PHM A;  1TN4 A;  3K1E A;  4UPG A;  1BMO A;  1SY9 A;  1K96 A;  4MZJ A;  1OMR A;  2K61 A;  2K8M B;  1Q80 A;  3BFH A;  1SCV A;  3NSK A;  2CXJ A;  3ZNI A;  5CSF A;  3LK1 A;  1K9P A;  4YGE B;  1VRK A;  1WRL A;  5K89 A;  2L50 A;  4OCI A;  2FCE A;  2MJW B;  3BOW A;  1QWV A;  1NYA A;  1S5G Y;  2LM5 A;  1KQM C;  5JJG A;  1BOD A;  1UHJ A;  1KK7 Y;  3M0W A;  4TNC A;  1AHR A;  2L5Y A;  2LP2 A;  1N0Y A;  4CPV A;  3I5H B;  1SCM C;  1BF5 A;  1C7V A;  1ZAC A;  2H61 C;  3NSO A;  1YR5 A;  1Y1X A;  2KI4 B;  2PVB A;  1CDN A;  3CS1 A;  1OQP A;  3O4Y A;  1S26 D;  2BKI B;  1A75 A;  2QAC A;  1NWD A;  2M3W A;  3DVK A;  3TUY B;  1TCF A;  3L47 A;  3E3R A;  1IKU A;  2L4I A;  5EL2 A;  2BL0 B;  2KGB C;  1BJF A;  1CLB A;  2NLN A;  2YGU A;  3PJI A;  4ORA B;  1PVB A;  4PE1 A;  1XFR A;  1F8H A;  3O78 A;  3AKB A;  3FS7 A;  3B6X A;  5HLO A;  1UHN A;  1LS8 A;  2BCX A;  2OPO A;  1J7O A;  1TOP A;  2KYC A;  1RTP 1;  2QDI A;  3AAK A;  3OB1 B;  3SG7 A;  3RZS A;  2JTT A;  1A75 B;  2KOT A;  3OB2 B;  4JD9 A;  1DF0 A;  1UUS A;  2JC2 A;  2ZRT A;  3FWB A;  3I5I B;  1KWO B;  4GGN A;  1AJ4 A;  1CTR A;  1YUS A;  1SRA A;  2L98 A;  3OX6 A;  1OOH A;  1BU3 A;  1L2O C;  2ZKM X;  3EVV A;  3I5H C;  1XFY O;  1K9K A;  2JNF A;  1KQV A;  2JNX A;  3O6B A;  1T14 A;  1W9Z A;  1CFF A;  2F33 A;  2KLE A;  1K8U A;  1QIW A;  1UP5 A;  1YUU A;  2Y5I A;  3KF9 A;  2LAN A;  5D69 A;  3S0F A;  2KPH A;  3DF0 B;  3SS3 A;  1AJ5 A;  4MZK A;  1UHK A;  4A4B A;  1IWQ A;  2LHL A;  2F3Y A;  2WND A;  1IH0 A;  3CWG A;  4A4C A;  2HPS A;  5AAN A;  2MLE C;  3SS4 A;  3CAB A;  1NX2 A;  1QX7 A;  2K2A A;  2BAP A;  3JTD B;  1CMG A;  1UWO A;  1K90 D;  3H4S E;  2WOS A;  4GUK A;  3BJH A;  2RGI A;  2NXQ A;  4DUQ A;  1H8B A;  2L4H A;  2MRD A;  1SPY A;  3PN7 B;  2LVK A;  2M9G A;  1J7Q A;  1PSB A;  3IQQ A;  5HYD A;  1RK9 A;  1QV1 A;  3OHM B;  1NCX A;  1FW4 A;  1DEL A;  1ORG A;  3I5F B;  4WQ3 A;  4E68 A;  1XVJ A;  1CNP A;  2KAX A;  3OP0 A;  1TRF A;  3D0Y A;  1KWO C;  2ERB A;  2JPT A;  4F0Z B;  3CZ0 A;  3WNX B;  1EJ3 A;  1TNP A;  1TCO B;  4I5J A;  1C3Y A;  1F55 A;  1IIO A;  3V2L A;  3EK8 A;  2R2I A;  5G08 A;  1PAL A;  2H8V A;  3CDN A;  4CLN A;  3DY9 A;  4JKT A;  1M39 A;  1SL9 A;  2L2C A;  1N65 A;  2KNE A;  1B8L A;  3KPX A;  3NGV A;  2KI6 C;  4GAO A;  1XFZ O;  3UO9 A;  1XFV O;  3DYE A;  5I2L A;  1ODB A;  1OOJ A;  2F2P A;  1KFU L;  5CSI A;  1KK8 C;  2VRG A;  1OMD A;  2KBM A;  1KFX S;  1YUR A;  2M1K B;  2WOR A;  4MRX A;  3CYZ A;  3FE6 A;  3PFV A;  5HLV A;  1TWO A;  2OS8 C;  1G4Y R;  3EG5 B;  3NXA A;  3PAL A;  1QTX A;  2K7O A;  2G2B A;  5I8N A;  1BR4 B;  1K93 D;  1UHH A;  1SCM B;  2B1U A;  2P71 A;  3DVM A;  1S1E A;  3N7H A;  2K60 A;  1IJ6 A;  5GQQ C;  3DD4 A;  2L51 A;  2P6B B;  3BUM B;  2M1U A;  1WRZ A;  1OMV A;  2Q91 A;  2ZNE A;  1J1D A;  4OR9 B;  5TNC A;  3KO0 A;  1F4Q A;  1U5I B;  1UHI A;  2WC5 A;  1M63 B;  2WCL A;  2ISD A;  3D74 A;  1GGW A;  1JF0 A;  4YGB B;  2LLU A;  4DS7 A;  4GNK B;  4ETO A;  1XO5 A;  1YTZ C;  2ZRS A;  1BLQ A;  1S5G Z;  1M46 A;  1UUR A;  2IS9 A;  2K2F A;  1ALV A;  1KK7 Z;  2WC6 A;  3FE9 A;  4M2Q A;  4DCK A;  2K7B A;  1TTX A;  1XYD A;  5HL1 A;  5KTY A;  3HCM A;  2NCO A;  1JBA A;  1CDL A;  2M0R A;  5IBW A;  4YGC B;  4PDZ A;  1A2X A;  4DIR A;  1ZFS A;  1YVL A;  1ZUZ A;  1Y1U A;  1DJI A;  1AK8 A;  1SBJ A;  3S0B A;  1B7T Z;  2L0P A;  3IF7 A;  1AUI B;  1YUT A;  2I2R E;  1XK4 C;  4XJK B;  1F70 A;  3GK2 A;  1YX7 A;  2COL B;  1MR8 A;  1DJH A;  1XFW O;  2KGR A;  3O2P A;  4PHN A;  1G8I A;  1DTL A;  1L2O B;  2A4J A;  2BCB A;  4WQ2 A;  1H4B A;  1DJX A;  1C7W A;  3D78 A;  1IQ5 A;  3CR5 X;  4N5X A;  1LIN A;  2PSR A;  3NHI A;  2PAS A;  1TNW A;  1GJY A;  1WLM A;  3VB1 A;  1WRK A;  1V1G A;  1Z4H A;  1CM1 A;  1RFJ A;  1W7I B;  1RWY A;  3D77 A;  3EKJ A;  3LK0 A;  2WCE A;  1DGV A;  4PE7 A;  5I2Q A;  5KU1 A;  1LA0 A;  1K9U A;  3F45 A;  4MVF A;  5BPJ A;  1GGZ A;  1SNL A;  3R1V A;  3B7A A;  1CKK A;  1MWN A;  2KSP A;  2K7D A;  1SKT A;  2KBI A;  4HSZ A;  1QLS A;  4HRG A;  1R2U A;  5DKN A;  1B9A A;  1J1E A;  1MF8 B;  1OOI X;  2F8P A;  2GV5 A;  1JC2 A;  4NQG A;  1QVI Z;  3FWC A;  1BT6 A;  1W7J B;  3B88 A;  2GGZ A;  3AKA A;  3RLZ A;  1MUX A;  2Y1M A;  1XA5 A;  1QX2 A;  4QJ3 B;  3DF0 A;  5ER4 X;  3VGO A;  2FJY A;  2I18 A;  4M2O A;  2NZ0 A;  1C07 A;  5AER A;  4CFR A;  3WXA A;  1Y1A A;  1D1O A;  1IJ5 A;  3B86 A;  2BEC A;  4MZL A;  4FQO A;  3EKH A;  1J55 A;  3FE8 A;  1DJG A;  2LVV A;  4MN0 A;  2LMV A;  3B87 A;  5AFP A;  1B4C A;  4USL A;  4GGF C;  1S6C A;  5HKW A;  1OW4 A;  1AP4 A; 
#chains in the Genus database with same CATH homology
 2QEO A;  3DXL A;  2H8V A;  3CDN A;  3R1P A;  3DY9 A;  3S0E A;  2L2C A;  3NGV A;  3DYE A;  5DIC A;  2P70 A;  2JPO A;  3CYZ A;  3DZT A;  3FE6 A;  3K1E A;  1TWO A;  4PT1 A;  2WCM A;  3BFH A;  3N7H A;  4FQT A;  2P71 A;  1QWV A;  1GM0 A;  3NHT A;  2WCK A;  3D73 A;  3Q8I A;  3V2L A;  2WCL A;  2WC5 A;  3D74 A;  2QEV A;  3CZ2 A;  2QEB A;  3FE9 A;  3S0G A;  2WC6 A;  3BFA A;  3R72 A;  2GTE A;  3L47 A;  2WCJ A;  5EL2 A;  3S0B A;  3BFB A;  3L4L A;  3PJI A;  3QME A;  1XFR A;  1OOG A;  3B6X A;  1LS8 A;  2PQL A;  3RZS A;  2QDI A;  1P28 A;  4INW A;  3D78 A;  4JD9 A;  4INX A;  3NHI A;  3VB1 A;  2WCH A;  1OOH A;  3D77 A;  1OOF A;  4F7F A;  1T14 A;  3R1O A;  3R1V A;  3B7A A;  3S0F A;  3D75 A;  3D76 A;  2KPH A;  3S0D A;  1OOI X;  2QEH A;  1TUJ A;  3CAB A;  3B88 A;  3OGN A;  3BJH A;  1OW4 A;  2FJY A;  3S0A A;  1DQE A;  3B86 A;  4OZD A;  1ORG A;  3FE8 A;  3B87 A;  2ERB A;  3CZ0 A;  3CZ1 A;  1C3Y A;  1C3Z A;  3L4A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...