3BJHA

Soft-sad crystal structure of a pheromone binding protein from the honeybee apis mellifera l.
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
117
structure length
117
Chain Sequence
DWVPPEVFDLVAEDKARCMSEHGTTQAQIDDVDKGNLVNEPSITCYMYCLLEAFSLVDDEANVDEDIMLGLLPDQLQERAQSVMGKCLPTSGSDNCNKIYNLAKCVQESAPDVWFVI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Pheromone binding protein
molecule keywords Pheromone-binding protein ASP1
publication title Sulfur single-wavelength anomalous diffraction crystal structure of a pheromone-binding protein from the honeybee Apis mellifera L.
pubmed doi rcsb
source organism Apis mellifera
total genus 45
structure length 117
sequence length 117
ec nomenclature
pdb deposition date 2007-12-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01395 PBP_GOBP PBP/GOBP family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.20 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 Pheromone/general odorant binding protein domain 3bjhA00
3CYZA 2L2CA 2WC5A 4OZDA 5DICA 4PT1A 1TWOA 1ORGA 1C3YA 3B87A 3B6XA 3FE9A 3NHIA 2KPHA 1QWVA 3S0BA 4FQTA 2WCMA 1LS8A 3BFHA 3N7HA 3FE8A 1OOHA 4INWA 2WCKA 1OOIX 2GTEA 3B86A 1GM0A 3R1OA 3L4LA 1OOGA 3D75A 2PQLA 3R1PA 3Q8IA 3BJHA 4F7FA 3QMEA 3V2LA 1OOFA 2QEOA 2WCJA 3OGNA 2WC6A 2H8VA 3CZ0A 2P71A 2WCLA 3S0DA 3NHTA 3CDNA 2JPOA 2FJYA 3D73A 1TUJA 2QEVA 2WCHA 1T14A 3DYEA 3D76A 3PJIA 1P28A 3DZTA 3B7AA 3BFAA 3FE6A 4JD9A 3BFBA 5EL2A 3D78A 3S0FA 3CZ2A 3L47A 2ERBA 4INXA 3K1EA 3RZSA 3CABA 3S0GA 3B88A 1XFRA 2QDIA 1DQEA 3DY9A 3R1VA 3S0EA 3D74A 3L4AA 3CZ1A 3DXLA 2P70A 1OW4A 1C3ZA 3R72A 2QEHA 3VB1A 3S0AA 3NGVA 3D77A 2QEBA
chains in the Genus database with same CATH superfamily
3CYZA 1J1EA 5TNCA 1LA0A 1EG4A 2L2CA 1S6JA 2DOQA 3ICBA 1XK4A 2LC5A 3LCPC 1A03A 1N0YA 1B47A 1KQMB 5HKWA 3TZ1A 1TWOA 2K2FA 1PSBA 3B87A 1K96A 4HREE 3B6XA 2MLEC 1EL4A 2M29A 3OX5A 1FBVA 4MRYA 3CS1A 2M97A 1UHIA 2PVBA 1AK8A 3TDZA 1LVCD 3O6BA 2KFFA 4JQ0D 2JWWA 1LS8A 3KO0A 2LVVA 3DD4A 4PE4A 2K7CA 1WDCC 4CLNA 2WCKA 1OOIX 4M2OA 3SG4A 2E6WA 4ICBA 1KFXS 3R1OA 2I94A 2KI4B 1RK9A 1UHHA 1IG5A 4GGNA 1XFVO 2PQLA 1YRTB 3PFVA 5DKRA 5PALA 3SG5A 1RECA 2LUXA 2KYCA 3R1PA 4PE1A 3Q8IA 1XFZO 2HPSA 4GAOA 3TS5C 3TUYB 5AERA 1BOCA 1K9PA 1UURA 5CSJA 2KBIA 2F3ZA 2K7DA 2H61A 2JT3A 2M49B 1AP4A 4JPZB 2F2OA 1DMOA 1YUUA 4JKTA 2KGRA 3KHEA 1C7VA 1X02A 3KF9A 1GGWA 1ZUZA 1TNXA 1AVSA 1DGVA 2I2RE 2F3YA 1VRKA 1LXFC 2KNEA 1Y0VH 3H4SE 1CDPA 3S0DA 2JT8A 3IQQA 3BYAA 3WNXB 3BUNB 2JPTA 1F71A 1KCYA 1RJVA 2LMVA 2BE4A 5I2OA 1QX5B 1BT6A 2JPOA 2A4JA 2MHHA 2FJYA 3D73A 2R2IA 4NDDA 4M2PA 3BXKA 1BG1A 1LKJA 1YVLA 1TNPA 2O60A 1DELA 1YUTA 3BUMB 3EG5B 1EJ3A 1P28A 1B1GA 3DVKA 1KFXL 1S6CA 2WCFA 3VGOA 4OR9B 3SS5A 1Q80A 5KTYA 2I7AA 2K2AA 2SASA 3BFBA 2ZN8A 1MUXA 3EK4A 1YURA 2K7OA 1LA3A 5EL2A 3D78A 4GGFC 3CZ2A 3EK7A 1Y1AA 2G2BA 2PSRA 3JTDB 1XFWO 3PALA 2PRUA 3EK8A 2KQYA 2MJWB 1IQ5A 3CWGA 2LAPA 2OS8C 1RROA 3A4UB 3RZSA 1J7QA 2L0PA 2AMIA 3PM2A 2EHBA 1KK8B 2BAPA 5CSNA 1F8HA 4ORCB 1Y6WA 2OPOA 1XFUO 3RLZA 1QIWA 3CZ1A 3E3RA 1BF5A 2JT0A 1IJ5A 1F70A 2HQ8A 4MEWA 5FYXA 2KOTA 2BCXA 1UHKA 1XK4C 3QRXA 3I5HB 4QJ5B 1J7PA 1K8UA 1EH2A 2JTZA 3FS7A 1K9KA 1JUOA 1F4QA 3DF0A 3VRNA 4CFQA 1C7WA 4PALA 1ZFSA 1NCZA 2L51A 2ZNEA 5DICA 3JVTC 3GK1A 3HX4A 1Z2CB 3TDIA 3DVEA 1YX7A 4MSPA 1CM4A 3SIBA 3TUYC 3MSEB 1C3YA 1TN4A 1L2OC 1CFFA 1ZOTB 1BR1B 1NUBA 4HSZA 2MAZA 1SCVA 1F54A 2EC6B 3FE9A 2YGUA 1CFCA 1GGZA 3FIAA 5D7FA 2PYQA 1J7RA 1SCMB 1CDNA 1XO5A 2FOTA 2LMUA 5BPJA 1IIOA 2WCMA 3C1VA 4DIRA 2IS9A 3BFHA 4WQ2A 4OCIA 3DF0B 1BR4B 1Y1UA 2KAYA 4INWA 3O2PA 3AKAA 1LINA 3CGAA 3I5IC 4MBEA 1OMRA 4ORBB 1OZOA 5JOLA 3B86A 3UNWA 4CIDA 1F55A 1BMOA 3PLFB 4XYNA 3OP0A 1CTRA 2BL0B 3LL8B 2M8UA 2G9BA 1CNPA 2EGDA 3D75A 1SL7A 1UUSA 4IJ7A 3SS4A 1SMGA 3BJHA 1SYMA 2M9GA 2WCEA 1SL8A 1OOFA 4FQOA 1ALVA 2WC6A 2M3WA 1WRZA 1CB1A 1KK7Z 2PALA 1SPYA 5G08A 4IL1A 4HRHA 1OZSA 1CM1A 3CZ0A 3JTDC 1JSAA 4M2QA 2K61A 2Y1MA 2TN4A 2WCLA 3BQ3A 2K8MB 2LLTA 2JNXA 2M7NA 1OOJA 1SR6B 5AFPA 1M39A 1W7IB 1RTP1 1IWQA 2LHIA 3PN7C 2F2PA 1NCYA 1ZACA 3O78A 2FCEA 1M31A 5F6TA 2Y5IA 2WC8A 1DJGA 2MLFC 3OX6A 4QJ4B 5I8NA 1H8BA 4D1EA 2LANA 5I2LA 2JU0A 1QX7A 1TCOB 2QEVA 2GGZA 1T14A 5I94A 4P5OE 2OTGC 1KSMA 2JTTA 2E30A 2ZRTA 3PJIA 2KBMA 2NCOA 1BLQA 2JULA 1QLSA 4CFRA 3FE6A 2QPTA 1XFXO 1K93D 2JOJA 1PSRA 2KLEA 4DCKA 3D0YA 1NX0A 2LM5A 1K2HA 4A4BA 1OE9B 1SRAA 2ERBA 2P6BB 3ZWHA 4INXA 4C0KA 2COLB 2Q91A 1JFJA 3RM1A 3KEVA 3CABA 4MZJA 2MBXA 1NWDA 4A4CA 1YTZC 4FTGA 2HF5A 3S0GA 1GQMA 1SCMC 3DVJA 1J55A 3CR5X 3NSOA 1TCFA 1IRJA 2LHLA 1QS7A 4F0ZB 1DQEA 2L2EA 1B8RA 3DY9A 3NXAA 4ZCUA 4NQGA 1S5GY 4AOMA 1CMGA 1D1OA 1CLLA 1XFYO 4C0JA 3O4YA 2WCBA 1NYAA 2P70A 2M1UA 1TOPA 1WRLA 1XA5A 2KGBC 3A8RA 4I5NB 3VB1A 1JF2A 1G4YR 3TDUA 2QEBA 3D0YB 1IQ3A 1J7OA 1S5GZ 4CPVA 3BOWA 4ORAB 1SSEB 1KWOB 4YGDB 1KQMC 2LP2A 5HL1A 2LLUA 4XJKB 2WC5A 1SY9A 3OBVA 1BU3A 1HT9A 1RFJA 4NDBA 4R1EA 4N1GA 3WHUB 1MXLC 4PE0A 2KFHA 4MLWA 5J3XA 1N65A 1MF8B 1TUZA 1V1FA 4MRXA 5FI7A 4PHJA 4N5XA 2L5XB 2KI6C 4WQ3A 1AJ5A 2KPHA 1QLKA 4PHNA 2BBMA 3SS3A 3S0BA 2M7LA 1WY9A 4FQTA 4TNCA 2KYFA 1YX8A 1EG3A 2BKIB 1WRKA 3EVRA 3N7HA 1KFUS 1PK0D 2PMYA 4YGBB 4BY5A 1OOHA 1DJYA 1SK6D 3BOWB 2KI4C 2I18A 3EKHA 2MRDA 1F4OA 2GTEA 1DGUA 5HLVA 3EVUA 1AJ4A 1WDCB 1CLBA 1GM0A 1CFDA 1S6IA 3CZTX 4MZKA 1MWNA 4AQJA 1IH0A 3L4LA 1DVIA 1PULA 3IVTA 5HLOA 1DT7B 1IGVA 4F7FA 2JXLA 3QMEA 2WOSA 2LUCA 2JRFA 2QEOA 4ETOA 4JWQA 3FWCA 5FI2A 1ZMZA 3GOFA 4GPLB 2H8VA 3I5GB 4N1FA 1BODA 1FI6A 1S1EA 1C07A 3NSKA 1JBAA 5FI6A 2CNPA 1SKTA 1K90D 1SW8A 1QATA 1DEKA 1L7ZA 4GGFA 1A4PA 2ZFDA 3CDNA 3UO9A 5D69A 2M0RA 1DJHA 1QVIZ 2KFGA 1A2XA 1OMVA 3VRQA 1CLMA 2BNXA 4Q04A 1CDLA 1G33A 3SG6A 2L4IA 2HQWA 2KAXA 1UHNA 1IJ6A 4YRUA 2WCHA 1KK7Y 4I5JA 4PDZA 2LE9B 2K60A 2SCPA 3OB2B 4GFTA 2H61C 1DJZA 2Y1NA 3D76A 3DYEA 3IF7A 3SIAA 2JC2A 2LVJA 1CMFA 1MQ1A 3DZTA 1B8CA 2FCDA 3B7AA 1IKUA 2BKHB 2L50A 1KWOC 4JD9A 2WNDA 1J1DA 2NXQA 5DKNA 3S0FA 1PVAA 3HCMA 2KLDA 3LLEA 3O4XA 4GBAA 4E68A 2LVIA 2HETA 1NP8A 1QV0A 4OKHA 2CXJA 2VRGA 3PATA 3AAKA 2LLSA 1DJXA 1KK8C 5HKZA 1DC1A 2QACA 3VROA 5JJGA 1XFRA 2OS8B 2FJUB 3K21A 5DKQA 1TNWA 1WLMA 4PHKA 2MA2A 1SNLA 2LP3A 4U8DA 3F45A 3R1VA 2K7BA 1DJIA 3BUWB 3D74A 3KPXA 2CT9A 3L4AA 2K0JA 3DXLA 1JWDA 5AXIA 3EKJA 3I5HC 2KHNA 2ZRSA 2ZKMX 1JF0A 1C3ZA 1NX2A 3R72A 1UWOA 4GNKB 4YGCB 2NZ0A 1FPWA 3D77A 5CPVA 4DS7A 1W7JB 1MXEA 2AUCA 1NCXA 2L4HA 2L98A 3I5FB 3FWBA 4PE7A 2ISDA 1YR5A 3SG2A 3VRPA 4DUQA 1FI5A 4MVFA 1NX3A 4P2YB 3IQOA 4OZDA 4XJKA 1B4CA 1K95A 1A29A 1UHJA 4PT1A 3SJSA 4UPGA 2LMTA 4PHMA 1ORGA 2EC6C 2BE6A 1YUSA 3JVTB 4NDCA 1XYDA 5D3OA 2L5YA 2WORA 3I5GC 4YI9A 5KU1A 1OMDA 1L2OB 1TNQA 3NHIA 3OHMB 3ZNIA 1SL9A 1KQVA 2BECA 1QX2A 1B8LA 4I5LB 2JXCA 4DRWA 1QWVA 1R6PA 1PVBA 2Y4QA 1K94A 1MHOA 3DVMA 1A75A 1QTXA 1ALWA 5CSFA 4HRGA 1B7TY 3FE8A 3SG7A 4MN0A 2BL0C 1ODBA 4AQIA 3NSLA 5CSIA 2CCMA 1AHRA 2M1KB 2RGIA 2ZN9A 1CFPA 3CR4X 5AANA 3I5IB 1DJWA 1W9ZA 3PSRA 1B7TZ 2KQ6A 4GUKA 2D8NA 1OOGA 3AKBA 1NIWA 1R2UA 1XVJA 1G8IA 4YBHB 4OVNF 2F8PA 4USLA 2KDHA 1TTXA 3BUOB 3V2LA 2KSPA 3WHTB 1JFKA 3OGNA 2AAOA 2WCJA 3CR2A 4YGEB 1N2DA 1S36A 3GK4X 1EXRA 1PRWA 1JC2A 1GJYA 2JQ6A 1OSAA 1RWYA 1H4BA 4L9MA 1SR6C 1A75B 1FF1A 5I2QA 2P71A 3LK0A 4I5KA 4YI8A 1TRFA 4MZLA 5AEQA 1DTLA 3WXAA 1AUIB 3NHTA 2LV7A 2BCBA 2B1UA 2CBLA 1TIZA 5GQQC 2BBNA 1HQVA 4OV2A 5B8IB 3PN7B 2LCPA 1NPQA 1TUJA 2BCAA 4WRIA 1YVHA 4KYNA 1NX1A 1CDMA 1QXPA 1CKKA 1B9AA 3NSIA 1V1GA 5HKYA 1M63B 1S3PA 2V53A 3GK2A 2CTNA 2KI6D 2O5GA 1UP5A 4BY4A 5IBWA 3LK1A 1QASA 1U5IA 2F33A 2OTGB 3I5FC 3M0WA 4YGAA 3BFAA 3SG3A 2JZIA 3TS5B 3PM8A 5KSZA 1SBJA 3AAJA 1M45A 1QVIY 2GGMA 1S26D 2GV5A 1DF0A 3CLNA 3BUXB 3L47A 1M46A 1NSHA 4ZCVA 1FW4A 1OQPA 2NLNA 1BJFA 2LNKA 3EVVA 1WLZA 2PASA 3K1EA 2NCPA 5K89A 2JNFA 3B88A 2Q4UA 1Y1XA 2QDIA 1KFUL 1Z4HA 4C0LA 1PALA 5ER5A 2KAVA 3S0EA 2ZNDA 1KSOA 3CTNA 5HYDA 3D10A 4QJ3B 2H2KA 1U5IB 1QJTA 1OW4A 4PCWA 1QV1A 2QEHA 3VRRA 3S0AA 3NGVA 2LVKA 1K9UA 1MR8A 1QIVA 5ER4X 1E8AA 1DF0B 3OB1B 1YRUB
chains in the Genus database with same CATH topology
3CYZA 2L2CA 2WC5A 4OZDA 5DICA 4PT1A 1TWOA 1ORGA 1C3YA 3B87A 3B6XA 3FE9A 3NHIA 2KPHA 1QWVA 3S0BA 4FQTA 2WCMA 1LS8A 3BFHA 3N7HA 3FE8A 1OOHA 4INWA 2WCKA 1OOIX 2GTEA 3B86A 1GM0A 3R1OA 3L4LA 1OOGA 3D75A 2PQLA 3R1PA 3Q8IA 3BJHA 4F7FA 3QMEA 3V2LA 1OOFA 2QEOA 2WCJA 3OGNA 2WC6A 2H8VA 3CZ0A 2P71A 2WCLA 3S0DA 3NHTA 3CDNA 2JPOA 2FJYA 3D73A 1TUJA 2QEVA 2WCHA 1T14A 3DYEA 3D76A 3PJIA 1P28A 3DZTA 3B7AA 3BFAA 3FE6A 4JD9A 3BFBA 5EL2A 3D78A 3S0FA 3CZ2A 3L47A 2ERBA 4INXA 3K1EA 3RZSA 3CABA 3S0GA 3B88A 1XFRA 2QDIA 1DQEA 3DY9A 3R1VA 3S0EA 3D74A 3L4AA 3CZ1A 3DXLA 2P70A 1OW4A 1C3ZA 3R72A 2QEHA 3VB1A 3S0AA 3NGVA 3D77A 2QEBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CYZ A;  2L2C A;  2WC5 A;  4OZD A;  5DIC A;  4PT1 A;  1TWO A;  1ORG A;  1C3Y A;  3B87 A;  3B6X A;  3FE9 A;  3NHI A;  2KPH A;  1QWV A;  3S0B A;  4FQT A;  2WCM A;  1LS8 A;  3BFH A;  3N7H A;  3FE8 A;  1OOH A;  4INW A;  2WCK A;  1OOI X;  2GTE A;  3B86 A;  1GM0 A;  3R1O A;  3L4L A;  1OOG A;  3D75 A;  2PQL A;  3R1P A;  3Q8I A;  3BJH A;  4F7F A;  3QME A;  3V2L A;  1OOF A;  2QEO A;  2WCJ A;  3OGN A;  2WC6 A;  2H8V A;  3CZ0 A;  2P71 A;  2WCL A;  3S0D A;  3NHT A;  3CDN A;  2JPO A;  2FJY A;  3D73 A;  1TUJ A;  2QEV A;  2WCH A;  1T14 A;  3DYE A;  3D76 A;  3PJI A;  1P28 A;  3DZT A;  3B7A A;  3BFA A;  3FE6 A;  4JD9 A;  3BFB A;  5EL2 A;  3D78 A;  3S0F A;  3CZ2 A;  3L47 A;  2ERB A;  4INX A;  3K1E A;  3RZS A;  3CAB A;  3S0G A;  3B88 A;  1XFR A;  2QDI A;  1DQE A;  3DY9 A;  3R1V A;  3S0E A;  3D74 A;  3L4A A;  3CZ1 A;  3DXL A;  2P70 A;  1OW4 A;  1C3Z A;  3R72 A;  2QEH A;  3VB1 A;  3S0A A;  3NGV A;  3D77 A;  2QEB A; 
#chains in the Genus database with same CATH topology
 3CYZ A;  1J1E A;  5TNC A;  1LA0 A;  1EG4 A;  2L2C A;  1S6J A;  2DOQ A;  3ICB A;  1XK4 A;  2LC5 A;  3LCP C;  1A03 A;  1N0Y A;  1B47 A;  1KQM B;  5HKW A;  3TZ1 A;  1TWO A;  2K2F A;  1PSB A;  3B87 A;  1K96 A;  4HRE E;  3B6X A;  2MLE C;  1EL4 A;  2M29 A;  3OX5 A;  1FBV A;  4MRY A;  3CS1 A;  2M97 A;  1UHI A;  2PVB A;  1AK8 A;  3TDZ A;  1LVC D;  3O6B A;  2KFF A;  4JQ0 D;  2JWW A;  1LS8 A;  3KO0 A;  2LVV A;  3DD4 A;  4PE4 A;  2K7C A;  1WDC C;  4CLN A;  2WCK A;  1OOI X;  4M2O A;  3SG4 A;  2E6W A;  4ICB A;  1KFX S;  3R1O A;  2I94 A;  2KI4 B;  1RK9 A;  1UHH A;  1IG5 A;  4GGN A;  1XFV O;  2PQL A;  1YRT B;  3PFV A;  5DKR A;  5PAL A;  3SG5 A;  1REC A;  2LUX A;  2KYC A;  3R1P A;  4PE1 A;  3Q8I A;  1XFZ O;  2HPS A;  4GAO A;  3TS5 C;  3TUY B;  5AER A;  1BOC A;  1K9P A;  1UUR A;  5CSJ A;  2KBI A;  2F3Z A;  2K7D A;  2H61 A;  2JT3 A;  2M49 B;  1AP4 A;  4JPZ B;  2F2O A;  1DMO A;  1YUU A;  4JKT A;  2KGR A;  3KHE A;  1C7V A;  1X02 A;  3KF9 A;  1GGW A;  1ZUZ A;  1TNX A;  1AVS A;  1DGV A;  2I2R E;  2F3Y A;  1VRK A;  1LXF C;  2KNE A;  1Y0V H;  3H4S E;  1CDP A;  3S0D A;  2JT8 A;  3IQQ A;  3BYA A;  3WNX B;  3BUN B;  2JPT A;  1F71 A;  1KCY A;  1RJV A;  2LMV A;  2BE4 A;  5I2O A;  1QX5 B;  1BT6 A;  2JPO A;  2A4J A;  2MHH A;  2FJY A;  3D73 A;  2R2I A;  4NDD A;  4M2P A;  3BXK A;  1BG1 A;  1LKJ A;  1YVL A;  1TNP A;  2O60 A;  1DEL A;  1YUT A;  3BUM B;  3EG5 B;  1EJ3 A;  1P28 A;  1B1G A;  3DVK A;  1KFX L;  1S6C A;  2WCF A;  3VGO A;  4OR9 B;  3SS5 A;  1Q80 A;  5KTY A;  2I7A A;  2K2A A;  2SAS A;  3BFB A;  2ZN8 A;  1MUX A;  3EK4 A;  1YUR A;  2K7O A;  1LA3 A;  5EL2 A;  3D78 A;  4GGF C;  3CZ2 A;  3EK7 A;  1Y1A A;  2G2B A;  2PSR A;  3JTD B;  1XFW O;  3PAL A;  2PRU A;  3EK8 A;  2KQY A;  2MJW B;  1IQ5 A;  3CWG A;  2LAP A;  2OS8 C;  1RRO A;  3A4U B;  3RZS A;  1J7Q A;  2L0P A;  2AMI A;  3PM2 A;  2EHB A;  1KK8 B;  2BAP A;  5CSN A;  1F8H A;  4ORC B;  1Y6W A;  2OPO A;  1XFU O;  3RLZ A;  1QIW A;  3CZ1 A;  3E3R A;  1BF5 A;  2JT0 A;  1IJ5 A;  1F70 A;  2HQ8 A;  4MEW A;  5FYX A;  2KOT A;  2BCX A;  1UHK A;  1XK4 C;  3QRX A;  3I5H B;  4QJ5 B;  1J7P A;  1K8U A;  1EH2 A;  2JTZ A;  3FS7 A;  1K9K A;  1JUO A;  1F4Q A;  3DF0 A;  3VRN A;  4CFQ A;  1C7W A;  4PAL A;  1ZFS A;  1NCZ A;  2L51 A;  2ZNE A;  5DIC A;  3JVT C;  3GK1 A;  3HX4 A;  1Z2C B;  3TDI A;  3DVE A;  1YX7 A;  4MSP A;  1CM4 A;  3SIB A;  3TUY C;  3MSE B;  1C3Y A;  1TN4 A;  1L2O C;  1CFF A;  1ZOT B;  1BR1 B;  1NUB A;  4HSZ A;  2MAZ A;  1SCV A;  1F54 A;  2EC6 B;  3FE9 A;  2YGU A;  1CFC A;  1GGZ A;  3FIA A;  5D7F A;  2PYQ A;  1J7R A;  1SCM B;  1CDN A;  1XO5 A;  2FOT A;  2LMU A;  5BPJ A;  1IIO A;  2WCM A;  3C1V A;  4DIR A;  2IS9 A;  3BFH A;  4WQ2 A;  4OCI A;  3DF0 B;  1BR4 B;  1Y1U A;  2KAY A;  4INW A;  3O2P A;  3AKA A;  1LIN A;  3CGA A;  3I5I C;  4MBE A;  1OMR A;  4ORB B;  1OZO A;  5JOL A;  3B86 A;  3UNW A;  4CID A;  1F55 A;  1BMO A;  3PLF B;  4XYN A;  3OP0 A;  1CTR A;  2BL0 B;  3LL8 B;  2M8U A;  2G9B A;  1CNP A;  2EGD A;  3D75 A;  1SL7 A;  1UUS A;  4IJ7 A;  3SS4 A;  1SMG A;  3BJH A;  1SYM A;  2M9G A;  2WCE A;  1SL8 A;  1OOF A;  4FQO A;  1ALV A;  2WC6 A;  2M3W A;  1WRZ A;  1CB1 A;  1KK7 Z;  2PAL A;  1SPY A;  5G08 A;  4IL1 A;  4HRH A;  1OZS A;  1CM1 A;  3CZ0 A;  3JTD C;  1JSA A;  4M2Q A;  2K61 A;  2Y1M A;  2TN4 A;  2WCL A;  3BQ3 A;  2K8M B;  2LLT A;  2JNX A;  2M7N A;  1OOJ A;  1SR6 B;  5AFP A;  1M39 A;  1W7I B;  1RTP 1;  1IWQ A;  2LHI A;  3PN7 C;  2F2P A;  1NCY A;  1ZAC A;  3O78 A;  2FCE A;  1M31 A;  5F6T A;  2Y5I A;  2WC8 A;  1DJG A;  2MLF C;  3OX6 A;  4QJ4 B;  5I8N A;  1H8B A;  4D1E A;  2LAN A;  5I2L A;  2JU0 A;  1QX7 A;  1TCO B;  2QEV A;  2GGZ A;  1T14 A;  5I94 A;  4P5O E;  2OTG C;  1KSM A;  2JTT A;  2E30 A;  2ZRT A;  3PJI A;  2KBM A;  2NCO A;  1BLQ A;  2JUL A;  1QLS A;  4CFR A;  3FE6 A;  2QPT A;  1XFX O;  1K93 D;  2JOJ A;  1PSR A;  2KLE A;  4DCK A;  3D0Y A;  1NX0 A;  2LM5 A;  1K2H A;  4A4B A;  1OE9 B;  1SRA A;  2ERB A;  2P6B B;  3ZWH A;  4INX A;  4C0K A;  2COL B;  2Q91 A;  1JFJ A;  3RM1 A;  3KEV A;  3CAB A;  4MZJ A;  2MBX A;  1NWD A;  4A4C A;  1YTZ C;  4FTG A;  2HF5 A;  3S0G A;  1GQM A;  1SCM C;  3DVJ A;  1J55 A;  3CR5 X;  3NSO A;  1TCF A;  1IRJ A;  2LHL A;  1QS7 A;  4F0Z B;  1DQE A;  2L2E A;  1B8R A;  3DY9 A;  3NXA A;  4ZCU A;  4NQG A;  1S5G Y;  4AOM A;  1CMG A;  1D1O A;  1CLL A;  1XFY O;  4C0J A;  3O4Y A;  2WCB A;  1NYA A;  2P70 A;  2M1U A;  1TOP A;  1WRL A;  1XA5 A;  2KGB C;  3A8R A;  4I5N B;  3VB1 A;  1JF2 A;  1G4Y R;  3TDU A;  2QEB A;  3D0Y B;  1IQ3 A;  1J7O A;  1S5G Z;  4CPV A;  3BOW A;  4ORA B;  1SSE B;  1KWO B;  4YGD B;  1KQM C;  2LP2 A;  5HL1 A;  2LLU A;  4XJK B;  2WC5 A;  1SY9 A;  3OBV A;  1BU3 A;  1HT9 A;  1RFJ A;  4NDB A;  4R1E A;  4N1G A;  3WHU B;  1MXL C;  4PE0 A;  2KFH A;  4MLW A;  5J3X A;  1N65 A;  1MF8 B;  1TUZ A;  1V1F A;  4MRX A;  5FI7 A;  4PHJ A;  4N5X A;  2L5X B;  2KI6 C;  4WQ3 A;  1AJ5 A;  2KPH A;  1QLK A;  4PHN A;  2BBM A;  3SS3 A;  3S0B A;  2M7L A;  1WY9 A;  4FQT A;  4TNC A;  2KYF A;  1YX8 A;  1EG3 A;  2BKI B;  1WRK A;  3EVR A;  3N7H A;  1KFU S;  1PK0 D;  2PMY A;  4YGB B;  4BY5 A;  1OOH A;  1DJY A;  1SK6 D;  3BOW B;  2KI4 C;  2I18 A;  3EKH A;  2MRD A;  1F4O A;  2GTE A;  1DGU A;  5HLV A;  3EVU A;  1AJ4 A;  1WDC B;  1CLB A;  1GM0 A;  1CFD A;  1S6I A;  3CZT X;  4MZK A;  1MWN A;  4AQJ A;  1IH0 A;  3L4L A;  1DVI A;  1PUL A;  3IVT A;  5HLO A;  1DT7 B;  1IGV A;  4F7F A;  2JXL A;  3QME A;  2WOS A;  2LUC A;  2JRF A;  2QEO A;  4ETO A;  4JWQ A;  3FWC A;  5FI2 A;  1ZMZ A;  3GOF A;  4GPL B;  2H8V A;  3I5G B;  4N1F A;  1BOD A;  1FI6 A;  1S1E A;  1C07 A;  3NSK A;  1JBA A;  5FI6 A;  2CNP A;  1SKT A;  1K90 D;  1SW8 A;  1QAT A;  1DEK A;  1L7Z A;  4GGF A;  1A4P A;  2ZFD A;  3CDN A;  3UO9 A;  5D69 A;  2M0R A;  1DJH A;  1QVI Z;  2KFG A;  1A2X A;  1OMV A;  3VRQ A;  1CLM A;  2BNX A;  4Q04 A;  1CDL A;  1G33 A;  3SG6 A;  2L4I A;  2HQW A;  2KAX A;  1UHN A;  1IJ6 A;  4YRU A;  2WCH A;  1KK7 Y;  4I5J A;  4PDZ A;  2LE9 B;  2K60 A;  2SCP A;  3OB2 B;  4GFT A;  2H61 C;  1DJZ A;  2Y1N A;  3D76 A;  3DYE A;  3IF7 A;  3SIA A;  2JC2 A;  2LVJ A;  1CMF A;  1MQ1 A;  3DZT A;  1B8C A;  2FCD A;  3B7A A;  1IKU A;  2BKH B;  2L50 A;  1KWO C;  4JD9 A;  2WND A;  1J1D A;  2NXQ A;  5DKN A;  3S0F A;  1PVA A;  3HCM A;  2KLD A;  3LLE A;  3O4X A;  4GBA A;  4E68 A;  2LVI A;  2HET A;  1NP8 A;  1QV0 A;  4OKH A;  2CXJ A;  2VRG A;  3PAT A;  3AAK A;  2LLS A;  1DJX A;  1KK8 C;  5HKZ A;  1DC1 A;  2QAC A;  3VRO A;  5JJG A;  1XFR A;  2OS8 B;  2FJU B;  3K21 A;  5DKQ A;  1TNW A;  1WLM A;  4PHK A;  2MA2 A;  1SNL A;  2LP3 A;  4U8D A;  3F45 A;  3R1V A;  2K7B A;  1DJI A;  3BUW B;  3D74 A;  3KPX A;  2CT9 A;  3L4A A;  2K0J A;  3DXL A;  1JWD A;  5AXI A;  3EKJ A;  3I5H C;  2KHN A;  2ZRS A;  2ZKM X;  1JF0 A;  1C3Z A;  1NX2 A;  3R72 A;  1UWO A;  4GNK B;  4YGC B;  2NZ0 A;  1FPW A;  3D77 A;  5CPV A;  4DS7 A;  1W7J B;  1MXE A;  2AUC A;  1NCX A;  2L4H A;  2L98 A;  3I5F B;  3FWB A;  4PE7 A;  2ISD A;  1YR5 A;  3SG2 A;  3VRP A;  4DUQ A;  1FI5 A;  4MVF A;  1NX3 A;  4P2Y B;  3IQO A;  4OZD A;  4XJK A;  1B4C A;  1K95 A;  1A29 A;  1UHJ A;  4PT1 A;  3SJS A;  4UPG A;  2LMT A;  4PHM A;  1ORG A;  2EC6 C;  2BE6 A;  1YUS A;  3JVT B;  4NDC A;  1XYD A;  5D3O A;  2L5Y A;  2WOR A;  3I5G C;  4YI9 A;  5KU1 A;  1OMD A;  1L2O B;  1TNQ A;  3NHI A;  3OHM B;  3ZNI A;  1SL9 A;  1KQV A;  2BEC A;  1QX2 A;  1B8L A;  4I5L B;  2JXC A;  4DRW A;  1QWV A;  1R6P A;  1PVB A;  2Y4Q A;  1K94 A;  1MHO A;  3DVM A;  1A75 A;  1QTX A;  1ALW A;  5CSF A;  4HRG A;  1B7T Y;  3FE8 A;  3SG7 A;  4MN0 A;  2BL0 C;  1ODB A;  4AQI A;  3NSL A;  5CSI A;  2CCM A;  1AHR A;  2M1K B;  2RGI A;  2ZN9 A;  1CFP A;  3CR4 X;  5AAN A;  3I5I B;  1DJW A;  1W9Z A;  3PSR A;  1B7T Z;  2KQ6 A;  4GUK A;  2D8N A;  1OOG A;  3AKB A;  1NIW A;  1R2U A;  1XVJ A;  1G8I A;  4YBH B;  4OVN F;  2F8P A;  4USL A;  2KDH A;  1TTX A;  3BUO B;  3V2L A;  2KSP A;  3WHT B;  1JFK A;  3OGN A;  2AAO A;  2WCJ A;  3CR2 A;  4YGE B;  1N2D A;  1S36 A;  3GK4 X;  1EXR A;  1PRW A;  1JC2 A;  1GJY A;  2JQ6 A;  1OSA A;  1RWY A;  1H4B A;  4L9M A;  1SR6 C;  1A75 B;  1FF1 A;  5I2Q A;  2P71 A;  3LK0 A;  4I5K A;  4YI8 A;  1TRF A;  4MZL A;  5AEQ A;  1DTL A;  3WXA A;  1AUI B;  3NHT A;  2LV7 A;  2BCB A;  2B1U A;  2CBL A;  1TIZ A;  5GQQ C;  2BBN A;  1HQV A;  4OV2 A;  5B8I B;  3PN7 B;  2LCP A;  1NPQ A;  1TUJ A;  2BCA A;  4WRI A;  1YVH A;  4KYN A;  1NX1 A;  1CDM A;  1QXP A;  1CKK A;  1B9A A;  3NSI A;  1V1G A;  5HKY A;  1M63 B;  1S3P A;  2V53 A;  3GK2 A;  2CTN A;  2KI6 D;  2O5G A;  1UP5 A;  4BY4 A;  5IBW A;  3LK1 A;  1QAS A;  1U5I A;  2F33 A;  2OTG B;  3I5F C;  3M0W A;  4YGA A;  3BFA A;  3SG3 A;  2JZI A;  3TS5 B;  3PM8 A;  5KSZ A;  1SBJ A;  3AAJ A;  1M45 A;  1QVI Y;  2GGM A;  1S26 D;  2GV5 A;  1DF0 A;  3CLN A;  3BUX B;  3L47 A;  1M46 A;  1NSH A;  4ZCV A;  1FW4 A;  1OQP A;  2NLN A;  1BJF A;  2LNK A;  3EVV A;  1WLZ A;  2PAS A;  3K1E A;  2NCP A;  5K89 A;  2JNF A;  3B88 A;  2Q4U A;  1Y1X A;  2QDI A;  1KFU L;  1Z4H A;  4C0L A;  1PAL A;  5ER5 A;  2KAV A;  3S0E A;  2ZND A;  1KSO A;  3CTN A;  5HYD A;  3D10 A;  4QJ3 B;  2H2K A;  1U5I B;  1QJT A;  1OW4 A;  4PCW A;  1QV1 A;  2QEH A;  3VRR A;  3S0A A;  3NGV A;  2LVK A;  1K9U A;  1MR8 A;  1QIV A;  5ER4 X;  1E8A A;  1DF0 B;  3OB1 B;  1YRU B; 
#chains in the Genus database with same CATH homology
 3CYZ A;  2L2C A;  2WC5 A;  4OZD A;  5DIC A;  4PT1 A;  1TWO A;  1ORG A;  1C3Y A;  3B87 A;  3B6X A;  3FE9 A;  3NHI A;  2KPH A;  1QWV A;  3S0B A;  4FQT A;  2WCM A;  1LS8 A;  3BFH A;  3N7H A;  3FE8 A;  1OOH A;  4INW A;  2WCK A;  1OOI X;  2GTE A;  3B86 A;  1GM0 A;  3R1O A;  3L4L A;  1OOG A;  3D75 A;  2PQL A;  3R1P A;  3Q8I A;  3BJH A;  4F7F A;  3QME A;  3V2L A;  1OOF A;  2QEO A;  2WCJ A;  3OGN A;  2WC6 A;  2H8V A;  3CZ0 A;  2P71 A;  2WCL A;  3S0D A;  3NHT A;  3CDN A;  2JPO A;  2FJY A;  3D73 A;  1TUJ A;  2QEV A;  2WCH A;  1T14 A;  3DYE A;  3D76 A;  3PJI A;  1P28 A;  3DZT A;  3B7A A;  3BFA A;  3FE6 A;  4JD9 A;  3BFB A;  5EL2 A;  3D78 A;  3S0F A;  3CZ2 A;  3L47 A;  2ERB A;  4INX A;  3K1E A;  3RZS A;  3CAB A;  3S0G A;  3B88 A;  1XFR A;  2QDI A;  1DQE A;  3DY9 A;  3R1V A;  3S0E A;  3D74 A;  3L4A A;  3CZ1 A;  3DXL A;  2P70 A;  1OW4 A;  1C3Z A;  3R72 A;  2QEH A;  3VB1 A;  3S0A A;  3NGV A;  3D77 A;  2QEB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...