2MLEC

Nmr structure of the c-domain of troponin c bound to the anchoring region of troponin i
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
72
structure length
72
Chain Sequence
MGKSEEELSDLFRMFDKNADGYIDLDELKIMLQATGETITEDDIEELMKDGDKNNDGRIDYDEFLEFMKGVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Troponin C, slow skeletal and cardiac muscles
publication title The dilated cardiomyopathy G159D mutation in cardiac troponin C weakens the anchoring interaction with troponin I.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal binding protein
total genus 22
structure length 72
sequence length 72
ec nomenclature
pdb deposition date 2014-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00036 EF-hand_1 EF hand
C PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2mleC00
2Y4QA 3SG3A 3C1VA 1YUTA 1M31A 1B8CA 3EKJA 5HKWA 3AAKA 1AUIB 1RJVA 2ZN9A 4BY5A 1YUUA 5B8IB 4OVNF 5HLOA 2PVBA 1F4OA 5I2QA 1G8IA 3KO0A 1MXEA 2Y1MA 3CR4X 1NX0A 1TNPA 2KDHA 1AK8A 1B9AA 1W7IB 1BF5A 2LHIA 1KK8C 1XFUO 1GGWA 1YVHA 1UURA 3SIBA 1BLQA 3KPXA 1QV0A 2BKHB 3I5FC 1B4CA 1CFFA 3HX4A 1WY9A 1SYMA 2KBMA 1CTRA 2K7OA 1IG5A 3CZTX 3DVJA 3VGOA 1ALWA 5JOLA 4DIRA 3LK0A 1TN4A 1XFVO 4MLWA 1XFXO 1TRFA 1CDLA 2TN4A 2LLSA 1PSBA 3CTNA 3CS1A 2BCAA 4FQOA 2A4JA 2M49B 3WXAA 1MF8B 1KQMB 2PALA 3TDZA 3FIAA 4MBEA 1V1GA 1KK7Y 1XVJA 1TNWA 1UP5A 1JWDA 3PLFB 3CLNA 4ORBB 1SK6D 1BG1A 3DVEA 2L4HA 4C0KA 4HREE 1CLBA 4XJKB 1CM1A 2JU0A 4CFQA 4XJKA 1IQ3A 1C7VA 3O2PA 2I7AA 1CM4A 3D10A 5K89A 2M7NA 1IJ6A 5AXIA 1IWQA 2MBXA 1NP8A 3IQQA 1SCVA 1XK4C 3FWBA 1SY9A 2L4IA 3SG6A 2B1UA 4MZKA 2QPTA 5KU1A 1KWOC 2JZIA 1NX3A 1E8AA 1OMVA 5KTYA 2AUCA 3WHTB 2H61A 1M45A 3EK8A 5F6TA 1N65A 4AQJA 2FJUB 3EVUA 1BT6A 4JWQA 2KAXA 2LP3A 1BJFA 2OPOA 2O60A 4PE0A 2OTGC 2M3WA 2KFFA 3BUXB 3GK1A 1S6JA 1KSMA 2HQ8A 1BR4B 2CNPA 1QJTA 1OE9B 3FWCA 2KI4C 1DJIA 3LK1A 4HRHA 3BUOB 1F4QA 2MJWB 4MN0A 1CDNA 2LAPA 1OZOA 2LCPA 3WNXB 4I5KA 1MQ1A 1TNQA 1TNXA 2HETA 3A8RA 2F8PA 1JFKA 1QIWA 4P5OE 4ZCUA 1K8UA 4QJ5B 3I5GB 3NSLA 3KHEA 4PE1A 1KFXL 1IGVA 1DJYA 2WORA 1X02A 4QJ3B 4YGEB 2OS8C 3O6BA 1KSOA 1Q80A 1CB1A 2BE6A 1K94A 5DKRA 2KNEA 4F0ZB 1IH0A 2M29A 1RK9A 1QXPA 1ZUZA 4L9MA 2EC6B 2LMVA 2EHBA 1KFUS 3I5HB 1NUBA 1ZOTB 1BMOA 3M0WA 4CLNA 2KFHA 3SIAA 1DTLA 2LVIA 5CSIA 1K93D 2KHNA 2LM5A 2PMYA 2L98A 2VRGA 1TCOB 1B8RA 5AFPA 1QLKA 3FS7A 1M63B 1YRTB 4ETOA 2JTZA 1L2OC 1U5IB 2JQ6A 3OB2B 1U5IA 1OSAA 1JUOA 2KI6C 4YI8A 3O78A 3PSRA 2KAYA 3DVMA 1QATA 1A75B 1KK7Z 1SR6C 1GGZA 1A75A 2K8MB 3PN7C 4Q04A 3SG2A 1S5GY 1FPWA 2JRFA 1W7JB 1J1DA 3JVTC 4E68A 1KK8B 2BL0C 4OR9B 4WQ2A 4M2QA 4CFRA 2O5GA 3I5FB 1M39A 2LUXA 2LP2A 3EK4A 5ER4X 3NSKA 4OKHA 1JSAA 2FCEA 5BPJA 3TZ1A 1YX7A 3JTDC 1B8LA 2WC8A 2NCPA 3F45A 1RTP1 1G4YR 1QTXA 2WCFA 4YGDB 2F2OA 1QASA 5DKQA 5I2LA 1CLMA 4BY4A 1K95A 2JNFA 4OV2A 5HLVA 4HRGA 1K9KA 4TNCA 5HKZA 3NSIA 4GUKA 1CMFA 1B7TY 2MAZA 2F2PA 4CIDA 2MHHA 4NDBA 1NWDA 1DF0B 1K9PA 1DF0A 1EG3A 2MA2A 5I8NA 2K0JA 4OCIA 2K2AA 5GQQC 5TNCA 1NIWA 2JPTA 4MRYA 2DOQA 2K2FA 3AKBA 2KI6D 2NZ0A 1LKJA 1PVBA 2JT0A 2MRDA 3LCPC 1F70A 3NSOA 2KQYA 2M8UA 1R2UA 3GK4X 2M7LA 2G2BA 1JF2A 1PRWA 1TOPA 5D69A 2KGRA 3AAJA 1UHNA 3LL8B 2KFGA 4MEWA 1QX2A 1NCYA 1C07A 1XK4A 3OX5A 2MLEC 4CPVA 1SNLA 1UHIA 2M97A 4N5XA 1SBJA 4GBAA 1F8HA 4PALA 1KWOB 3EVVA 1DJZA 2L2EA 2PSRA 1G33A 1MWNA 2LVVA 4YGBB 2BCBA 1NX2A 4AOMA 2M9GA 2CT9A 1J7OA 1BU3A 1DJXA 2KSPA 2BECA 4MSPA 1OQPA 2K7CA 1M46A 1RFJA 2CTNA 1YVLA 1TTXA 2FCDA 2LLTA 5G08A 3RM1A 1FF1A 2E30A 4A4BA 2JXCA 2OTGB 2WOSA 2HQWA 4UPGA 2LVKA 3VRQA 1ZACA 2ZRTA 1NX1A 1XYDA 1J55A 1NCXA 2ZN8A 3DF0B 2KI4B 1SL8A 3DF0A 2WCBA 2NLNA 1QX7A 1NSHA 1B47A 1J7PA 1Y1XA 1CLLA 1SL9A 1WDCB 4GGNA 2BBNA 4P2YB 4ZCVA 4DCKA 3H4SE 1SCMB 2Q91A 2NCOA 4C0JA 1IRJA 1IJ5A 1QX5B 2BKIB 5PALA 2GGZA 3I5IC 2SASA 1ALVA 1WDCC 1Y0VH 1EJ3A 2CBLA 1PALA 1Y6WA 2M0RA 2OS8B 5ER5A 1KQVA 1TIZA 2COLB 2L51A 1SCMC 1ZFSA 4I5LB 5D7FA 2JWWA 1QIVA 1MR8A 1S3PA 1SL7A 1SMGA 1V1FA 1WLMA 4M2PA 1CFPA 2JOJA 1QV1A 4GGFC 4YI9A 3TS5C 3E3RA 3LLEA 2V53A 1VRKA 1OOJA 1ZMZA 1UHJA 2BCXA 1AVSA 1LA3A 1L2OB 1Y1UA 2KBIA 2AMIA 4IL1A 1S6IA 1XFZO 5CSFA 3SG5A 4QJ4B 2HPSA 2LUCA 2P6BB 2F3YA 3DVKA 4N1FA 1SR6B 3EVRA 1IQ5A 4YGCB 2ZNDA 3PN7B 1XFYO 4JPZB 1OMRA 5AEQA 1D1OA 1FI6A 2JTTA 2LC5A 2PASA 4U8DA 1B1GA 2KOTA 1FW4A 2ZRSA 1CFDA 1MUXA 2FOTA 4WRIA 5FYXA 4JQ0D 1S6CA 1S26D 1YUSA 2BL0B 3JVTB 1K90D 1QVIY 1SRAA 1PSRA 1Y1AA 2JT8A 3OB1B 5J3XA 2JULA 1UHKA 3CR5X 1WLZA 2JXLA 1XA5A 5DKNA 3D0YB 4PHKA 4D1EA 1LXFC 3PFVA 4N1GA 3CGAA 3JTDB 4DRWA 3PALA 2CCMA 4USLA 1EG4A 1PVAA 1L7ZA 4DS7A 1CFCA 1DJWA 2JT3A 5AERA 1AHRA 3KEVA 3PM8A 3EKHA 5KSZA 1A03A 1DGVA 3GOFA 4MZJA 1JC2A 3BYAA 4M2OA 1YURA 3VROA 1DMOA 2LHLA 2L50A 1BODA 1IKUA 1MXLC 1OMDA 3VRNA 3PATA 1H8BA 1N2DA 2Q4UA 3GK2A 2R2IA 1BOCA 3RLZA 2I94A 3IQOA 2KGBC 1RWYA 1YRUB 3MSEB 4DUQA 1F71A 3WHUB 1SKTA 4PE7A 1A2XA 4ORAB 4C0LA 2M1KB 3BUMB 1EH2A 1K2HA 5HKYA 5IBWA 1DJGA 2NXQA 1TCFA 1J1EA 3BQ3A 1F54A 1N0YA 1JFJA 1WRZA 2KQ6A 3TUYB 4FTGA 5HYDA 2I18A 4MRXA 5JJGA 2HF5A 1A29A 3OX6A 1SW8A 3ICBA 3HCMA 2ISDA 1NYAA 4PDZA 4MVFA 1C7WA 1UHHA 3VRPA 4YGAA 4I5JA 4ORCB 2WNDA 2LANA 3SG4A 3TUYC 2K7BA 3ZWHA 1NPQA 4GAOA 1DT7B 5CPVA 1RROA 1SPYA 2LLUA 3O4YA 2F3ZA 3BXKA 4NDCA 5AANA 1WRKA 2K7DA 1UUSA 4MZLA 3ZNIA 4I5NB 1KQMC 1CDMA 3OHMB 2LMUA 1CDPA 2KYFA 2LMTA 1YTZC 2RGIA 3TDIA 1CKKA 1J7QA 1DGUA 1K9UA 3VRRA 3BUNB 4R1EA 2L0PA 1H4BA 3CR2A 2LV7A 2G9BA 3A4UB 3I5IB 1QVIZ 2M1UA 3BOWB 2F33A 1EXRA 3BOWA 2ZKMX 4PHMA 3TDUA 1CMGA 4PE4A 1NCZA 1OZSA 1S5GZ 1FBVA 2Y5IA 2LE9B 3TS5B 4GGFA 1XO5A 2GV5A 1S36A 1KFXS 2CXJA 1QLSA 1AJ4A 2EGDA 1S1EA 2GGMA 2L5XB 3BUWB 2ZFDA 3K21A 1WRLA 4PHJA 3NXAA 1K96A 4YRUA 2JNXA 1DJHA 3KF9A 3QRXA 1F55A 1XFWO 4PHNA 4AQIA 1A4PA 1ODBA 2H61C 2WCEA 4XYNA 3AKAA 1LINA 3SJSA 1YX8A 2Y1NA 1GQMA 1BR1B 1MHOA 1LA0A 1QS7A 2BE4A 2MLFC 1CNPA 4HSZA 1JBAA 1FI5A 2JC2A 3CWGA 3IF7A 4NDDA 4GNKB 3OP0A 3DD4A 2ZNEA 2K61A 2PRUA 3EK7A 1B7TZ 4PCWA 3SG7A 2QACA 2I2RE 4ICBA 1GJYA 4GFTA 2LVJA 5CSJA 1HQVA 4YBHB 2BBMA 4WQ3A 1LVCD 3D0YA 3I5GC 1AJ5A 1RECA 1PK0D 2AAOA 1AP4A 2SCPA 1R6PA 2E6WA 1EL4A 4GPLB 1HT9A 1PULA 2KAVA 4NQGA 2IS9A 1YR5A 2H2KA 2KYCA 4A4CA 1JF0A 5I2OA 1KFUL 1J7RA 2EC6C 1KCYA 3I5HC 2LNKA 5CSNA 1UWOA 2D8NA 1DVIA
chains in the Genus database with same CATH superfamily
2KLDA 2Y4QA 3SG3A 3C1VA 1YUTA 1M31A 1B8CA 3EKJA 5HKWA 3AAKA 3CZ2A 1AUIB 3BFHA 1RJVA 4INXA 2ZN9A 4BY5A 1YUUA 5B8IB 4OVNF 5HLOA 2PVBA 1F4OA 5I2QA 1T14A 1G8IA 3KO0A 1MXEA 2Y1MA 3CR4X 1NX0A 1TNPA 2KDHA 1AK8A 1DELA 3JVTB 3N7HA 1B9AA 1W7IB 1BF5A 2LHIA 1KK8C 1XFUO 2GTEA 1YVHA 1UURA 3SIBA 1BLQA 1GGWA 3KPXA 1QV0A 2BKHB 3I5FC 1B4CA 1CFFA 3HX4A 3UNWA 1WY9A 1SYMA 2KBMA 1CTRA 2K7OA 1IG5A 3CZTX 3DVJA 3VGOA 1ALWA 5JOLA 4DIRA 3LK0A 1TN4A 1OOFA 1XFVO 1XFXO 1TRFA 1CDLA 4MLWA 2TN4A 4F7FA 2LLSA 1PSBA 3CTNA 3CS1A 2BCAA 4FQOA 2A4JA 2M49B 3WXAA 1MF8B 1KQMB 2PALA 3TDZA 3FIAA 4MBEA 1XVJA 1V1GA 1KK7Y 1TNWA 1UP5A 1JWDA 3PLFB 3CLNA 4ORBB 1SK6D 1BG1A 3DVEA 2L4HA 4C0KA 4HREE 2YGUA 1QWVA 1CLBA 4XJKB 1CM1A 2JU0A 4CFQA 4XJKA 3IVTA 1IQ3A 1C7VA 3O2PA 2I7AA 1CM4A 3D10A 5K89A 2M7NA 1IJ6A 5AXIA 1IWQA 2MBXA 1NP8A 3IQQA 1SCVA 1XK4C 2BAPA 3FWBA 5D3OA 1SY9A 2L4IA 3SG6A 2B1UA 4MZKA 2QPTA 5KU1A 1KWOC 2JZIA 1NX3A 1E8AA 1OMVA 5KTYA 2AUCA 3WHTB 2H61A 1M45A 2L5YA 3EK8A 5F6TA 1N65A 4AQJA 2FJUB 3EVUA 1BT6A 4JWQA 1XFRA 2KAXA 2LP3A 1BJFA 2OPOA 2O60A 4PE0A 2OTGC 2M3WA 2KFFA 2P71A 3BUXB 3GK1A 1DQEA 1S6JA 1KSMA 2HQ8A 1BR4B 2CNPA 1QJTA 1OE9B 3FWCA 2KI4C 3L4LA 1DJIA 3LK1A 4HRHA 3BUOB 3CDNA 3V2LA 4INWA 1F4QA 1OOHA 2MJWB 4MN0A 1CDNA 2LAPA 1OZOA 2LCPA 3WNXB 4I5KA 1MQ1A 1TNQA 1TNXA 2HETA 3A8RA 2F8PA 1JFKA 1QIWA 4P5OE 4ZCUA 1K8UA 3D73A 4QJ5B 3I5GB 3BFBA 3NSLA 3FE8A 3KHEA 4PE1A 1KFXL 1IGVA 1DJYA 2WORA 1X02A 4QJ3B 4YGEB 2OS8C 3O6BA 2WCHA 1KSOA 1Q80A 1CB1A 2BE6A 1K94A 5DKRA 2KNEA 4F0ZB 1IH0A 2M29A 1RK9A 1QXPA 1ZUZA 4L9MA 2EC6B 2LMVA 2EHBA 1KFUS 3I5HB 1NUBA 1ZOTB 1BMOA 3M0WA 4CLNA 2KFHA 2WCLA 3SIAA 1DTLA 2LVIA 5CSIA 1K93D 2KHNA 2LM5A 2PMYA 2L98A 2VRGA 1TCOB 1B8RA 5AFPA 1QLKA 3FS7A 1M63B 1YRTB 4ETOA 2JTZA 1L2OC 1U5IB 1ORGA 2JQ6A 3OB2B 1U5IA 1OSAA 2L2CA 1JUOA 2WC6A 2KI6C 3CYZA 4YI8A 3O78A 3PSRA 2KAYA 3DVMA 1QATA 1A75B 1KK7Z 1SR6C 1A75A 1GGZA 2K8MB 3PN7C 4Q04A 3SG2A 2QEBA 3D76A 1S5GY 1FPWA 2JRFA 1W7JB 1J1DA 3JVTC 4E68A 1KK8B 2BL0C 3BJHA 4OR9B 4WQ2A 3DXLA 4M2QA 4CFRA 2O5GA 3I5FB 1M39A 2LUXA 3CABA 3UO9A 2LP2A 3EK4A 5ER4X 3NSKA 4OKHA 1JSAA 2FCEA 5BPJA 3TZ1A 1YX7A 3JTDC 1B8LA 2WC8A 2NCPA 3F45A 1RTP1 1G4YR 1QTXA 2WCFA 4YGDB 2F2OA 2QDIA 1QASA 5FI6A 1DEKA 1OOIX 5DKQA 5EL2A 1CLMA 5I2LA 1DC1A 4BY4A 1K95A 2JNFA 4OV2A 5HLVA 4HRGA 1K9KA 3S0FA 4TNCA 5HKZA 3NSIA 4GUKA 1CMFA 1B7TY 2MAZA 2F2PA 4CIDA 2MHHA 4NDBA 1NWDA 1DF0B 1K9PA 3PJIA 1DF0A 1EG3A 2MA2A 5I8NA 2K0JA 4OCIA 2K2AA 5GQQC 5TNCA 1NIWA 2JPTA 3O4XA 4MRYA 2DOQA 2QEVA 2K2FA 3AKBA 3K1EA 2KI6D 2NZ0A 1LKJA 1PVBA 2JT0A 2MRDA 3LCPC 1F70A 3NSOA 2KQYA 2M8UA 1R2UA 3D74A 3GK4X 2M7LA 2G2BA 1JF2A 1PRWA 1TOPA 1Z4HA 1W9ZA 5D69A 5FI7A 2KGRA 3VB1A 3AAJA 1UHNA 3LL8B 2KFGA 4FQTA 2QEHA 3DZTA 4MEWA 1QX2A 1NCYA 1Z2CB 1C07A 1XK4A 3OX5A 2MLEC 4CPVA 1SNLA 1UHIA 2M97A 4N5XA 1SBJA 4GBAA 1F8HA 4PALA 2P70A 3Q8IA 1KWOB 3EVVA 1DJZA 2L2EA 2PSRA 1IIOA 1C3YA 1G33A 1MWNA 2LVVA 4YGBB 2BCBA 1NX2A 4OZDA 4AOMA 2M9GA 2CT9A 5DICA 3EG5B 1J7OA 1BU3A 1DJXA 2KSPA 2BECA 2WC5A 3FE9A 1OQPA 4MSPA 2K7CA 1M46A 1RFJA 2CTNA 1YVLA 1TTXA 2FCDA 2LLTA 5G08A 3RM1A 3R1OA 1FF1A 2E30A 4A4BA 2JXCA 2OTGB 2WOSA 2HQWA 4UPGA 2LVKA 3VRQA 1ZACA 2ZRTA 3S0EA 3B88A 1NX1A 1XYDA 1J55A 1NCXA 2ZN8A 3DF0B 2KI4B 1SL8A 2JPOA 2WCBA 3DF0A 2WCMA 2NLNA 1QX7A 1NSHA 1B47A 1J7PA 1Y1XA 1CLLA 1SL9A 1WDCB 4GGNA 2BBNA 4P2YB 4ZCVA 4DCKA 3H4SE 3OGNA 1SCMB 2Q91A 2NCOA 4C0JA 1IRJA 1IJ5A 2WCKA 1QX5B 2BKIB 5PALA 2GGZA 3I5IC 3S0GA 2SASA 1ALVA 1WDCC 1Y0VH 1EJ3A 2CBLA 1PALA 1Y6WA 2M0RA 2OS8B 5ER5A 1KQVA 1TIZA 2COLB 2L51A 3R72A 1SCMC 1ZFSA 4I5LB 5D7FA 2JWWA 1QIVA 1MR8A 1S3PA 1SL7A 1SMGA 1V1FA 1WLMA 4M2PA 1CFPA 2JOJA 1QV1A 4GGFC 4YI9A 3TS5C 4IJ7A 3E3RA 3LLEA 2V53A 5AEQA 1VRKA 1OOJA 1ZMZA 1UHJA 2BCXA 1AVSA 1LA3A 1L2OB 1Y1UA 2KBIA 2AMIA 4IL1A 1S6IA 1XFZO 5CSFA 3SG5A 1GM0A 4QJ4B 2FJYA 2HPSA 2LUCA 2P6BB 2F3YA 3DVKA 1TUZA 4N1FA 1SR6B 3EVRA 1IQ5A 4PT1A 2ZNDA 3PN7B 1XFYO 4JPZB 1OMRA 3D77A 1TWOA 1D1OA 1FI6A 2JTTA 2LC5A 2PASA 4U8DA 1B1GA 2KOTA 1FW4A 2ZRSA 1CFDA 1MUXA 2FOTA 4WRIA 5FYXA 4JQ0D 1S6CA 1S26D 1YUSA 2BL0B 3DY9A 1K90D 1QVIY 1SRAA 1PSRA 1Y1AA 2JT8A 3FE6A 3OB1B 5J3XA 2JULA 1UHKA 3CR5X 1WLZA 2JXLA 1XA5A 5DKNA 3D0YB 4PHKA 4D1EA 2H8VA 1LXFC 3PFVA 4N1GA 3CGAA 3JTDB 4DRWA 3PALA 2CCMA 4USLA 1EG4A 1PVAA 1L7ZA 3PM2A 4DS7A 1CFCA 3B6XA 1DJWA 2JT3A 3R1VA 1AHRA 4JKTA 5AERA 3KEVA 3PM8A 3EKHA 5KSZA 1A03A 1DGVA 4YGCB 3GOFA 4MZJA 5FI2A 3BYAA 1JC2A 4M2OA 1YURA 3VROA 1DMOA 2LHLA 2L50A 1BODA 1IKUA 1MXLC 1OMDA 3VRNA 3PATA 1H8BA 1N2DA 2Q4UA 3GK2A 2R2IA 1BOCA 3RLZA 2I94A 3IQOA 2KGBC 1RWYA 1YRUB 3MSEB 4DUQA 1F71A 3WHUB 1SKTA 4PE7A 1A2XA 1OOGA 4ORAB 4C0LA 2M1KB 3BUMB 1EH2A 2ERBA 3B86A 5HKYA 1K2HA 5IBWA 1DJGA 2NXQA 1TCFA 1J1EA 3BQ3A 1F54A 1N0YA 3S0BA 1JFJA 1WRZA 2KQ6A 3TUYB 4FTGA 5HYDA 2I18A 3B87A 4MRXA 5JJGA 2WCJA 3B7AA 4KYNA 2HF5A 1A29A 3OX6A 3L4AA 1SW8A 3ICBA 3DYEA 3HCMA 2ISDA 1NYAA 4PDZA 3S0DA 4MVFA 2KLEA 1C7WA 1UHHA 3VRPA 4YGAA 4I5JA 4ORCB 2WNDA 2LANA 3SG4A 3TUYC 4JD9A 2K7BA 3ZWHA 1NPQA 3NHIA 4GAOA 1DT7B 5CPVA 3S0AA 1RROA 1SPYA 2LLUA 3O4YA 2F3ZA 3BXKA 4NDCA 5AANA 1WRKA 2K7DA 1UUSA 4MZLA 3ZNIA 4I5NB 2K60A 5I94A 1KQMC 1CDMA 3OHMB 2LMUA 1CDPA 2KYFA 2LMTA 1YTZC 2RGIA 3TDIA 3L47A 1CKKA 1J7QA 1DGUA 1K9UA 2PYQA 3VRRA 3BUNB 2BNXA 4R1EA 2L0PA 1H4BA 3CR2A 2LV7A 3SS5A 2G9BA 3A4UB 3I5IB 1QVIZ 2M1UA 3BOWB 2F33A 1EXRA 3BOWA 1P28A 2ZKMX 4PHMA 3TDUA 1CMGA 4PE4A 3R1PA 1NCZA 1OZSA 1S5GZ 1FBVA 2Y5IA 2LE9B 3TS5B 1SSEB 4GGFA 1XO5A 2GV5A 1S36A 1KFXS 2CXJA 3NHTA 1QLSA 1AJ4A 2EGDA 1S1EA 2GGMA 2L5XB 2QEOA 1OW4A 2ZFDA 3BFAA 3BUWB 3CZ1A 3CZ0A 3K21A 1WRLA 4PHJA 3NXAA 1K96A 4YRUA 2JNXA 1DJHA 3KF9A 3QRXA 1F55A 1XFWO 3QMEA 4PHNA 4AQIA 1A4PA 1ODBA 2H61C 2PQLA 2WCEA 4XYNA 3AKAA 1LINA 3SJSA 1YX8A 2Y1NA 1GQMA 1BR1B 1MHOA 1LA0A 3SS3A 1QS7A 2BE4A 2MLFC 1CNPA 4HSZA 1JBAA 1FI5A 2JC2A 3CWGA 3IF7A 4NDDA 5HL1A 4GNKB 3OP0A 3DD4A 2ZNEA 2K61A 2PRUA 3EK7A 1B7TZ 3OBVA 4PCWA 3SS4A 3NGVA 3SG7A 2QACA 2I2RE 4ICBA 1C3ZA 3RZSA 1GJYA 4GFTA 2LVJA 5CSJA 1HQVA 4YBHB 2BBMA 4WQ3A 1LVCD 1TUJA 3D0YA 3I5GC 1AJ5A 1RECA 1PK0D 2AAOA 2KPHA 1AP4A 2SCPA 1R6PA 2E6WA 1EL4A 4GPLB 1HT9A 1PULA 2KAVA 4NQGA 2IS9A 1YR5A 2H2KA 2KYCA 4A4CA 1JF0A 5I2OA 1KFUL 1J7RA 2EC6C 1LS8A 3I5HC 1KCYA 2LNKA 3D75A 5CSNA 3D78A 1UWOA 2D8NA 1DVIA
chains in the Genus database with same CATH topology
2Y4QA 3SG3A 3C1VA 1YUTA 1M31A 1B8CA 3EKJA 5HKWA 3AAKA 1AUIB 1RJVA 2ZN9A 4BY5A 1YUUA 5B8IB 4OVNF 5HLOA 2PVBA 1F4OA 5I2QA 1G8IA 3KO0A 1MXEA 2Y1MA 3CR4X 1NX0A 1TNPA 2KDHA 1AK8A 1B9AA 1W7IB 1BF5A 2LHIA 1KK8C 1XFUO 1GGWA 1YVHA 1UURA 3SIBA 1BLQA 3KPXA 1QV0A 2BKHB 3I5FC 1B4CA 1CFFA 3HX4A 1WY9A 1SYMA 2KBMA 1CTRA 2K7OA 1IG5A 3CZTX 3DVJA 3VGOA 1ALWA 5JOLA 4DIRA 3LK0A 1TN4A 1XFVO 4MLWA 1XFXO 1TRFA 1CDLA 2TN4A 2LLSA 1PSBA 3CTNA 3CS1A 2BCAA 4FQOA 2A4JA 2M49B 3WXAA 1MF8B 1KQMB 2PALA 3TDZA 3FIAA 4MBEA 1V1GA 1KK7Y 1XVJA 1TNWA 1UP5A 1JWDA 3PLFB 3CLNA 4ORBB 1SK6D 1BG1A 3DVEA 2L4HA 4C0KA 4HREE 1CLBA 4XJKB 1CM1A 2JU0A 4CFQA 4XJKA 1IQ3A 1C7VA 3O2PA 2I7AA 1CM4A 3D10A 5K89A 2M7NA 1IJ6A 5AXIA 1IWQA 2MBXA 1NP8A 3IQQA 1SCVA 1XK4C 3FWBA 1SY9A 2L4IA 3SG6A 2B1UA 4MZKA 2QPTA 5KU1A 1KWOC 2JZIA 1NX3A 1E8AA 1OMVA 5KTYA 2AUCA 3WHTB 2H61A 1M45A 3EK8A 5F6TA 1N65A 4AQJA 2FJUB 3EVUA 1BT6A 4JWQA 2KAXA 2LP3A 1BJFA 2OPOA 2O60A 4PE0A 2OTGC 2M3WA 2KFFA 3BUXB 3GK1A 1S6JA 1KSMA 2HQ8A 1BR4B 2CNPA 1QJTA 1OE9B 3FWCA 2KI4C 1DJIA 3LK1A 4HRHA 3BUOB 1F4QA 2MJWB 4MN0A 1CDNA 2LAPA 1OZOA 2LCPA 3WNXB 4I5KA 1MQ1A 1TNQA 1TNXA 2HETA 3A8RA 2F8PA 1JFKA 1QIWA 4P5OE 4ZCUA 1K8UA 4QJ5B 3I5GB 3NSLA 3KHEA 4PE1A 1KFXL 1IGVA 1DJYA 2WORA 1X02A 4QJ3B 4YGEB 2OS8C 3O6BA 1KSOA 1Q80A 1CB1A 2BE6A 1K94A 5DKRA 2KNEA 4F0ZB 1IH0A 2M29A 1RK9A 1QXPA 1ZUZA 4L9MA 2EC6B 2LMVA 2EHBA 1KFUS 3I5HB 1NUBA 1ZOTB 1BMOA 3M0WA 4CLNA 2KFHA 3SIAA 1DTLA 2LVIA 5CSIA 1K93D 2KHNA 2LM5A 2PMYA 2L98A 2VRGA 1TCOB 1B8RA 5AFPA 1QLKA 3FS7A 1M63B 1YRTB 4ETOA 2JTZA 1L2OC 1U5IB 2JQ6A 3OB2B 1U5IA 1OSAA 1JUOA 2KI6C 4YI8A 3O78A 3PSRA 2KAYA 3DVMA 1QATA 1A75B 1KK7Z 1SR6C 1GGZA 1A75A 2K8MB 3PN7C 4Q04A 3SG2A 1S5GY 1FPWA 2JRFA 1W7JB 1J1DA 3JVTC 4E68A 1KK8B 2BL0C 4OR9B 4WQ2A 4M2QA 4CFRA 2O5GA 3I5FB 1M39A 2LUXA 2LP2A 3EK4A 5ER4X 3NSKA 4OKHA 1JSAA 2FCEA 5BPJA 3TZ1A 1YX7A 3JTDC 1B8LA 2WC8A 2NCPA 3F45A 1RTP1 1G4YR 1QTXA 2WCFA 4YGDB 2F2OA 1QASA 5DKQA 5I2LA 1CLMA 4BY4A 1K95A 2JNFA 4OV2A 5HLVA 4HRGA 1K9KA 4TNCA 5HKZA 3NSIA 4GUKA 1CMFA 1B7TY 2MAZA 2F2PA 4CIDA 2MHHA 4NDBA 1NWDA 1DF0B 1K9PA 1DF0A 1EG3A 2MA2A 5I8NA 2K0JA 4OCIA 2K2AA 5GQQC 5TNCA 1NIWA 2JPTA 4MRYA 2DOQA 2K2FA 3AKBA 2KI6D 2NZ0A 1LKJA 1PVBA 2JT0A 2MRDA 3LCPC 1F70A 3NSOA 2KQYA 2M8UA 1R2UA 3GK4X 2M7LA 2G2BA 1JF2A 1PRWA 1TOPA 5D69A 2KGRA 3AAJA 1UHNA 3LL8B 2KFGA 4MEWA 1QX2A 1NCYA 1C07A 1XK4A 3OX5A 2MLEC 4CPVA 1SNLA 1UHIA 2M97A 4N5XA 1SBJA 4GBAA 1F8HA 4PALA 1KWOB 3EVVA 1DJZA 2L2EA 2PSRA 1G33A 1MWNA 2LVVA 4YGBB 2BCBA 1NX2A 4AOMA 2M9GA 2CT9A 1J7OA 1BU3A 1DJXA 2KSPA 2BECA 4MSPA 1OQPA 2K7CA 1M46A 1RFJA 2CTNA 1YVLA 1TTXA 2FCDA 2LLTA 5G08A 3RM1A 1FF1A 2E30A 4A4BA 2JXCA 2OTGB 2WOSA 2HQWA 4UPGA 2LVKA 3VRQA 1ZACA 2ZRTA 1NX1A 1XYDA 1J55A 1NCXA 2ZN8A 3DF0B 2KI4B 1SL8A 3DF0A 2WCBA 2NLNA 1QX7A 1NSHA 1B47A 1J7PA 1Y1XA 1CLLA 1SL9A 1WDCB 4GGNA 2BBNA 4P2YB 4ZCVA 4DCKA 3H4SE 1SCMB 2Q91A 2NCOA 4C0JA 1IRJA 1IJ5A 1QX5B 2BKIB 5PALA 2GGZA 3I5IC 2SASA 1ALVA 1WDCC 1Y0VH 1EJ3A 2CBLA 1PALA 1Y6WA 2M0RA 2OS8B 5ER5A 1KQVA 1TIZA 2COLB 2L51A 1SCMC 1ZFSA 4I5LB 5D7FA 2JWWA 1QIVA 1MR8A 1S3PA 1SL7A 1SMGA 1V1FA 1WLMA 4M2PA 1CFPA 2JOJA 1QV1A 4GGFC 4YI9A 3TS5C 3E3RA 3LLEA 2V53A 1VRKA 1OOJA 1ZMZA 1UHJA 2BCXA 1AVSA 1LA3A 1L2OB 1Y1UA 2KBIA 2AMIA 4IL1A 1S6IA 1XFZO 5CSFA 3SG5A 4QJ4B 2HPSA 2LUCA 2P6BB 2F3YA 3DVKA 4N1FA 1SR6B 3EVRA 1IQ5A 4YGCB 2ZNDA 3PN7B 1XFYO 4JPZB 1OMRA 5AEQA 1D1OA 1FI6A 2JTTA 2LC5A 2PASA 4U8DA 1B1GA 2KOTA 1FW4A 2ZRSA 1CFDA 1MUXA 2FOTA 4WRIA 5FYXA 4JQ0D 1S6CA 1S26D 1YUSA 2BL0B 3JVTB 1K90D 1QVIY 1SRAA 1PSRA 1Y1AA 2JT8A 3OB1B 5J3XA 2JULA 1UHKA 3CR5X 1WLZA 2JXLA 1XA5A 5DKNA 3D0YB 4PHKA 4D1EA 1LXFC 3PFVA 4N1GA 3CGAA 3JTDB 4DRWA 3PALA 2CCMA 4USLA 1EG4A 1PVAA 1L7ZA 4DS7A 1CFCA 1DJWA 2JT3A 5AERA 1AHRA 3KEVA 3PM8A 3EKHA 5KSZA 1A03A 1DGVA 3GOFA 4MZJA 1JC2A 3BYAA 4M2OA 1YURA 3VROA 1DMOA 2LHLA 2L50A 1BODA 1IKUA 1MXLC 1OMDA 3VRNA 3PATA 1H8BA 1N2DA 2Q4UA 3GK2A 2R2IA 1BOCA 3RLZA 2I94A 3IQOA 2KGBC 1RWYA 1YRUB 3MSEB 4DUQA 1F71A 3WHUB 1SKTA 4PE7A 1A2XA 4ORAB 4C0LA 2M1KB 3BUMB 1EH2A 1K2HA 5HKYA 5IBWA 1DJGA 2NXQA 1TCFA 1J1EA 3BQ3A 1F54A 1N0YA 1JFJA 1WRZA 2KQ6A 3TUYB 4FTGA 5HYDA 2I18A 4MRXA 5JJGA 2HF5A 1A29A 3OX6A 1SW8A 3ICBA 3HCMA 2ISDA 1NYAA 4PDZA 4MVFA 1C7WA 1UHHA 3VRPA 4YGAA 4I5JA 4ORCB 2WNDA 2LANA 3SG4A 3TUYC 2K7BA 3ZWHA 1NPQA 4GAOA 1DT7B 5CPVA 1RROA 1SPYA 2LLUA 3O4YA 2F3ZA 3BXKA 4NDCA 5AANA 1WRKA 2K7DA 1UUSA 4MZLA 3ZNIA 4I5NB 1KQMC 1CDMA 3OHMB 2LMUA 1CDPA 2KYFA 2LMTA 1YTZC 2RGIA 3TDIA 1CKKA 1J7QA 1DGUA 1K9UA 3VRRA 3BUNB 4R1EA 2L0PA 1H4BA 3CR2A 2LV7A 2G9BA 3A4UB 3I5IB 1QVIZ 2M1UA 3BOWB 2F33A 1EXRA 3BOWA 2ZKMX 4PHMA 3TDUA 1CMGA 4PE4A 1NCZA 1OZSA 1S5GZ 1FBVA 2Y5IA 2LE9B 3TS5B 4GGFA 1XO5A 2GV5A 1S36A 1KFXS 2CXJA 1QLSA 1AJ4A 2EGDA 1S1EA 2GGMA 2L5XB 3BUWB 2ZFDA 3K21A 1WRLA 4PHJA 3NXAA 1K96A 4YRUA 2JNXA 1DJHA 3KF9A 3QRXA 1F55A 1XFWO 4PHNA 4AQIA 1A4PA 1ODBA 2H61C 2WCEA 4XYNA 3AKAA 1LINA 3SJSA 1YX8A 2Y1NA 1GQMA 1BR1B 1MHOA 1LA0A 1QS7A 2BE4A 2MLFC 1CNPA 4HSZA 1JBAA 1FI5A 2JC2A 3CWGA 3IF7A 4NDDA 4GNKB 3OP0A 3DD4A 2ZNEA 2K61A 2PRUA 3EK7A 1B7TZ 4PCWA 3SG7A 2QACA 2I2RE 4ICBA 1GJYA 4GFTA 2LVJA 5CSJA 1HQVA 4YBHB 2BBMA 4WQ3A 1LVCD 3D0YA 3I5GC 1AJ5A 1RECA 1PK0D 2AAOA 1AP4A 2SCPA 1R6PA 2E6WA 1EL4A 4GPLB 1HT9A 1PULA 2KAVA 4NQGA 2IS9A 1YR5A 2H2KA 2KYCA 4A4CA 1JF0A 5I2OA 1KFUL 1J7RA 2EC6C 1KCYA 3I5HC 2LNKA 5CSNA 1UWOA 2D8NA 1DVIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Y4Q A;  3SG3 A;  3C1V A;  1YUT A;  1M31 A;  1B8C A;  3EKJ A;  5HKW A;  3AAK A;  1AUI B;  1RJV A;  2ZN9 A;  4BY5 A;  1YUU A;  5B8I B;  4OVN F;  5HLO A;  2PVB A;  1F4O A;  5I2Q A;  1G8I A;  3KO0 A;  1MXE A;  2Y1M A;  3CR4 X;  1NX0 A;  1TNP A;  2KDH A;  1AK8 A;  1B9A A;  1W7I B;  1BF5 A;  2LHI A;  1KK8 C;  1XFU O;  1GGW A;  1YVH A;  1UUR A;  3SIB A;  1BLQ A;  3KPX A;  1QV0 A;  2BKH B;  3I5F C;  1B4C A;  1CFF A;  3HX4 A;  1WY9 A;  1SYM A;  2KBM A;  1CTR A;  2K7O A;  1IG5 A;  3CZT X;  3DVJ A;  3VGO A;  1ALW A;  5JOL A;  4DIR A;  3LK0 A;  1TN4 A;  1XFV O;  4MLW A;  1XFX O;  1TRF A;  1CDL A;  2TN4 A;  2LLS A;  1PSB A;  3CTN A;  3CS1 A;  2BCA A;  4FQO A;  2A4J A;  2M49 B;  3WXA A;  1MF8 B;  1KQM B;  2PAL A;  3TDZ A;  3FIA A;  4MBE A;  1V1G A;  1KK7 Y;  1XVJ A;  1TNW A;  1UP5 A;  1JWD A;  3PLF B;  3CLN A;  4ORB B;  1SK6 D;  1BG1 A;  3DVE A;  2L4H A;  4C0K A;  4HRE E;  1CLB A;  4XJK B;  1CM1 A;  2JU0 A;  4CFQ A;  4XJK A;  1IQ3 A;  1C7V A;  3O2P A;  2I7A A;  1CM4 A;  3D10 A;  5K89 A;  2M7N A;  1IJ6 A;  5AXI A;  1IWQ A;  2MBX A;  1NP8 A;  3IQQ A;  1SCV A;  1XK4 C;  3FWB A;  1SY9 A;  2L4I A;  3SG6 A;  2B1U A;  4MZK A;  2QPT A;  5KU1 A;  1KWO C;  2JZI A;  1NX3 A;  1E8A A;  1OMV A;  5KTY A;  2AUC A;  3WHT B;  2H61 A;  1M45 A;  3EK8 A;  5F6T A;  1N65 A;  4AQJ A;  2FJU B;  3EVU A;  1BT6 A;  4JWQ A;  2KAX A;  2LP3 A;  1BJF A;  2OPO A;  2O60 A;  4PE0 A;  2OTG C;  2M3W A;  2KFF A;  3BUX B;  3GK1 A;  1S6J A;  1KSM A;  2HQ8 A;  1BR4 B;  2CNP A;  1QJT A;  1OE9 B;  3FWC A;  2KI4 C;  1DJI A;  3LK1 A;  4HRH A;  3BUO B;  1F4Q A;  2MJW B;  4MN0 A;  1CDN A;  2LAP A;  1OZO A;  2LCP A;  3WNX B;  4I5K A;  1MQ1 A;  1TNQ A;  1TNX A;  2HET A;  3A8R A;  2F8P A;  1JFK A;  1QIW A;  4P5O E;  4ZCU A;  1K8U A;  4QJ5 B;  3I5G B;  3NSL A;  3KHE A;  4PE1 A;  1KFX L;  1IGV A;  1DJY A;  2WOR A;  1X02 A;  4QJ3 B;  4YGE B;  2OS8 C;  3O6B A;  1KSO A;  1Q80 A;  1CB1 A;  2BE6 A;  1K94 A;  5DKR A;  2KNE A;  4F0Z B;  1IH0 A;  2M29 A;  1RK9 A;  1QXP A;  1ZUZ A;  4L9M A;  2EC6 B;  2LMV A;  2EHB A;  1KFU S;  3I5H B;  1NUB A;  1ZOT B;  1BMO A;  3M0W A;  4CLN A;  2KFH A;  3SIA A;  1DTL A;  2LVI A;  5CSI A;  1K93 D;  2KHN A;  2LM5 A;  2PMY A;  2L98 A;  2VRG A;  1TCO B;  1B8R A;  5AFP A;  1QLK A;  3FS7 A;  1M63 B;  1YRT B;  4ETO A;  2JTZ A;  1L2O C;  1U5I B;  2JQ6 A;  3OB2 B;  1U5I A;  1OSA A;  1JUO A;  2KI6 C;  4YI8 A;  3O78 A;  3PSR A;  2KAY A;  3DVM A;  1QAT A;  1A75 B;  1KK7 Z;  1SR6 C;  1GGZ A;  1A75 A;  2K8M B;  3PN7 C;  4Q04 A;  3SG2 A;  1S5G Y;  1FPW A;  2JRF A;  1W7J B;  1J1D A;  3JVT C;  4E68 A;  1KK8 B;  2BL0 C;  4OR9 B;  4WQ2 A;  4M2Q A;  4CFR A;  2O5G A;  3I5F B;  1M39 A;  2LUX A;  2LP2 A;  3EK4 A;  5ER4 X;  3NSK A;  4OKH A;  1JSA A;  2FCE A;  5BPJ A;  3TZ1 A;  1YX7 A;  3JTD C;  1B8L A;  2WC8 A;  2NCP A;  3F45 A;  1RTP 1;  1G4Y R;  1QTX A;  2WCF A;  4YGD B;  2F2O A;  1QAS A;  5DKQ A;  5I2L A;  1CLM A;  4BY4 A;  1K95 A;  2JNF A;  4OV2 A;  5HLV A;  4HRG A;  1K9K A;  4TNC A;  5HKZ A;  3NSI A;  4GUK A;  1CMF A;  1B7T Y;  2MAZ A;  2F2P A;  4CID A;  2MHH A;  4NDB A;  1NWD A;  1DF0 B;  1K9P A;  1DF0 A;  1EG3 A;  2MA2 A;  5I8N A;  2K0J A;  4OCI A;  2K2A A;  5GQQ C;  5TNC A;  1NIW A;  2JPT A;  4MRY A;  2DOQ A;  2K2F A;  3AKB A;  2KI6 D;  2NZ0 A;  1LKJ A;  1PVB A;  2JT0 A;  2MRD A;  3LCP C;  1F70 A;  3NSO A;  2KQY A;  2M8U A;  1R2U A;  3GK4 X;  2M7L A;  2G2B A;  1JF2 A;  1PRW A;  1TOP A;  5D69 A;  2KGR A;  3AAJ A;  1UHN A;  3LL8 B;  2KFG A;  4MEW A;  1QX2 A;  1NCY A;  1C07 A;  1XK4 A;  3OX5 A;  2MLE C;  4CPV A;  1SNL A;  1UHI A;  2M97 A;  4N5X A;  1SBJ A;  4GBA A;  1F8H A;  4PAL A;  1KWO B;  3EVV A;  1DJZ A;  2L2E A;  2PSR A;  1G33 A;  1MWN A;  2LVV A;  4YGB B;  2BCB A;  1NX2 A;  4AOM A;  2M9G A;  2CT9 A;  1J7O A;  1BU3 A;  1DJX A;  2KSP A;  2BEC A;  4MSP A;  1OQP A;  2K7C A;  1M46 A;  1RFJ A;  2CTN A;  1YVL A;  1TTX A;  2FCD A;  2LLT A;  5G08 A;  3RM1 A;  1FF1 A;  2E30 A;  4A4B A;  2JXC A;  2OTG B;  2WOS A;  2HQW A;  4UPG A;  2LVK A;  3VRQ A;  1ZAC A;  2ZRT A;  1NX1 A;  1XYD A;  1J55 A;  1NCX A;  2ZN8 A;  3DF0 B;  2KI4 B;  1SL8 A;  3DF0 A;  2WCB A;  2NLN A;  1QX7 A;  1NSH A;  1B47 A;  1J7P A;  1Y1X A;  1CLL A;  1SL9 A;  1WDC B;  4GGN A;  2BBN A;  4P2Y B;  4ZCV A;  4DCK A;  3H4S E;  1SCM B;  2Q91 A;  2NCO A;  4C0J A;  1IRJ A;  1IJ5 A;  1QX5 B;  2BKI B;  5PAL A;  2GGZ A;  3I5I C;  2SAS A;  1ALV A;  1WDC C;  1Y0V H;  1EJ3 A;  2CBL A;  1PAL A;  1Y6W A;  2M0R A;  2OS8 B;  5ER5 A;  1KQV A;  1TIZ A;  2COL B;  2L51 A;  1SCM C;  1ZFS A;  4I5L B;  5D7F A;  2JWW A;  1QIV A;  1MR8 A;  1S3P A;  1SL7 A;  1SMG A;  1V1F A;  1WLM A;  4M2P A;  1CFP A;  2JOJ A;  1QV1 A;  4GGF C;  4YI9 A;  3TS5 C;  3E3R A;  3LLE A;  2V53 A;  1VRK A;  1OOJ A;  1ZMZ A;  1UHJ A;  2BCX A;  1AVS A;  1LA3 A;  1L2O B;  1Y1U A;  2KBI A;  2AMI A;  4IL1 A;  1S6I A;  1XFZ O;  5CSF A;  3SG5 A;  4QJ4 B;  2HPS A;  2LUC A;  2P6B B;  2F3Y A;  3DVK A;  4N1F A;  1SR6 B;  3EVR A;  1IQ5 A;  4YGC B;  2ZND A;  3PN7 B;  1XFY O;  4JPZ B;  1OMR A;  5AEQ A;  1D1O A;  1FI6 A;  2JTT A;  2LC5 A;  2PAS A;  4U8D A;  1B1G A;  2KOT A;  1FW4 A;  2ZRS A;  1CFD A;  1MUX A;  2FOT A;  4WRI A;  5FYX A;  4JQ0 D;  1S6C A;  1S26 D;  1YUS A;  2BL0 B;  3JVT B;  1K90 D;  1QVI Y;  1SRA A;  1PSR A;  1Y1A A;  2JT8 A;  3OB1 B;  5J3X A;  2JUL A;  1UHK A;  3CR5 X;  1WLZ A;  2JXL A;  1XA5 A;  5DKN A;  3D0Y B;  4PHK A;  4D1E A;  1LXF C;  3PFV A;  4N1G A;  3CGA A;  3JTD B;  4DRW A;  3PAL A;  2CCM A;  4USL A;  1EG4 A;  1PVA A;  1L7Z A;  4DS7 A;  1CFC A;  1DJW A;  2JT3 A;  5AER A;  1AHR A;  3KEV A;  3PM8 A;  3EKH A;  5KSZ A;  1A03 A;  1DGV A;  3GOF A;  4MZJ A;  1JC2 A;  3BYA A;  4M2O A;  1YUR A;  3VRO A;  1DMO A;  2LHL A;  2L50 A;  1BOD A;  1IKU A;  1MXL C;  1OMD A;  3VRN A;  3PAT A;  1H8B A;  1N2D A;  2Q4U A;  3GK2 A;  2R2I A;  1BOC A;  3RLZ A;  2I94 A;  3IQO A;  2KGB C;  1RWY A;  1YRU B;  3MSE B;  4DUQ A;  1F71 A;  3WHU B;  1SKT A;  4PE7 A;  1A2X A;  4ORA B;  4C0L A;  2M1K B;  3BUM B;  1EH2 A;  1K2H A;  5HKY A;  5IBW A;  1DJG A;  2NXQ A;  1TCF A;  1J1E A;  3BQ3 A;  1F54 A;  1N0Y A;  1JFJ A;  1WRZ A;  2KQ6 A;  3TUY B;  4FTG A;  5HYD A;  2I18 A;  4MRX A;  5JJG A;  2HF5 A;  1A29 A;  3OX6 A;  1SW8 A;  3ICB A;  3HCM A;  2ISD A;  1NYA A;  4PDZ A;  4MVF A;  1C7W A;  1UHH A;  3VRP A;  4YGA A;  4I5J A;  4ORC B;  2WND A;  2LAN A;  3SG4 A;  3TUY C;  2K7B A;  3ZWH A;  1NPQ A;  4GAO A;  1DT7 B;  5CPV A;  1RRO A;  1SPY A;  2LLU A;  3O4Y A;  2F3Z A;  3BXK A;  4NDC A;  5AAN A;  1WRK A;  2K7D A;  1UUS A;  4MZL A;  3ZNI A;  4I5N B;  1KQM C;  1CDM A;  3OHM B;  2LMU A;  1CDP A;  2KYF A;  2LMT A;  1YTZ C;  2RGI A;  3TDI A;  1CKK A;  1J7Q A;  1DGU A;  1K9U A;  3VRR A;  3BUN B;  4R1E A;  2L0P A;  1H4B A;  3CR2 A;  2LV7 A;  2G9B A;  3A4U B;  3I5I B;  1QVI Z;  2M1U A;  3BOW B;  2F33 A;  1EXR A;  3BOW A;  2ZKM X;  4PHM A;  3TDU A;  1CMG A;  4PE4 A;  1NCZ A;  1OZS A;  1S5G Z;  1FBV A;  2Y5I A;  2LE9 B;  3TS5 B;  4GGF A;  1XO5 A;  2GV5 A;  1S36 A;  1KFX S;  2CXJ A;  1QLS A;  1AJ4 A;  2EGD A;  1S1E A;  2GGM A;  2L5X B;  3BUW B;  2ZFD A;  3K21 A;  1WRL A;  4PHJ A;  3NXA A;  1K96 A;  4YRU A;  2JNX A;  1DJH A;  3KF9 A;  3QRX A;  1F55 A;  1XFW O;  4PHN A;  4AQI A;  1A4P A;  1ODB A;  2H61 C;  2WCE A;  4XYN A;  3AKA A;  1LIN A;  3SJS A;  1YX8 A;  2Y1N A;  1GQM A;  1BR1 B;  1MHO A;  1LA0 A;  1QS7 A;  2BE4 A;  2MLF C;  1CNP A;  4HSZ A;  1JBA A;  1FI5 A;  2JC2 A;  3CWG A;  3IF7 A;  4NDD A;  4GNK B;  3OP0 A;  3DD4 A;  2ZNE A;  2K61 A;  2PRU A;  3EK7 A;  1B7T Z;  4PCW A;  3SG7 A;  2QAC A;  2I2R E;  4ICB A;  1GJY A;  4GFT A;  2LVJ A;  5CSJ A;  1HQV A;  4YBH B;  2BBM A;  4WQ3 A;  1LVC D;  3D0Y A;  3I5G C;  1AJ5 A;  1REC A;  1PK0 D;  2AAO A;  1AP4 A;  2SCP A;  1R6P A;  2E6W A;  1EL4 A;  4GPL B;  1HT9 A;  1PUL A;  2KAV A;  4NQG A;  2IS9 A;  1YR5 A;  2H2K A;  2KYC A;  4A4C A;  1JF0 A;  5I2O A;  1KFU L;  1J7R A;  2EC6 C;  1KCY A;  3I5H C;  2LNK A;  5CSN A;  1UWO A;  2D8N A;  1DVI A; 
#chains in the Genus database with same CATH topology
 2KLD A;  2Y4Q A;  3SG3 A;  3C1V A;  1YUT A;  1M31 A;  1B8C A;  3EKJ A;  5HKW A;  3AAK A;  3CZ2 A;  1AUI B;  3BFH A;  1RJV A;  4INX A;  2ZN9 A;  4BY5 A;  1YUU A;  5B8I B;  4OVN F;  5HLO A;  2PVB A;  1F4O A;  5I2Q A;  1T14 A;  1G8I A;  3KO0 A;  1MXE A;  2Y1M A;  3CR4 X;  1NX0 A;  1TNP A;  2KDH A;  1AK8 A;  1DEL A;  3JVT B;  3N7H A;  1B9A A;  1W7I B;  1BF5 A;  2LHI A;  1KK8 C;  1XFU O;  2GTE A;  1YVH A;  1UUR A;  3SIB A;  1BLQ A;  1GGW A;  3KPX A;  1QV0 A;  2BKH B;  3I5F C;  1B4C A;  1CFF A;  3HX4 A;  3UNW A;  1WY9 A;  1SYM A;  2KBM A;  1CTR A;  2K7O A;  1IG5 A;  3CZT X;  3DVJ A;  3VGO A;  1ALW A;  5JOL A;  4DIR A;  3LK0 A;  1TN4 A;  1OOF A;  1XFV O;  1XFX O;  1TRF A;  1CDL A;  4MLW A;  2TN4 A;  4F7F A;  2LLS A;  1PSB A;  3CTN A;  3CS1 A;  2BCA A;  4FQO A;  2A4J A;  2M49 B;  3WXA A;  1MF8 B;  1KQM B;  2PAL A;  3TDZ A;  3FIA A;  4MBE A;  1XVJ A;  1V1G A;  1KK7 Y;  1TNW A;  1UP5 A;  1JWD A;  3PLF B;  3CLN A;  4ORB B;  1SK6 D;  1BG1 A;  3DVE A;  2L4H A;  4C0K A;  4HRE E;  2YGU A;  1QWV A;  1CLB A;  4XJK B;  1CM1 A;  2JU0 A;  4CFQ A;  4XJK A;  3IVT A;  1IQ3 A;  1C7V A;  3O2P A;  2I7A A;  1CM4 A;  3D10 A;  5K89 A;  2M7N A;  1IJ6 A;  5AXI A;  1IWQ A;  2MBX A;  1NP8 A;  3IQQ A;  1SCV A;  1XK4 C;  2BAP A;  3FWB A;  5D3O A;  1SY9 A;  2L4I A;  3SG6 A;  2B1U A;  4MZK A;  2QPT A;  5KU1 A;  1KWO C;  2JZI A;  1NX3 A;  1E8A A;  1OMV A;  5KTY A;  2AUC A;  3WHT B;  2H61 A;  1M45 A;  2L5Y A;  3EK8 A;  5F6T A;  1N65 A;  4AQJ A;  2FJU B;  3EVU A;  1BT6 A;  4JWQ A;  1XFR A;  2KAX A;  2LP3 A;  1BJF A;  2OPO A;  2O60 A;  4PE0 A;  2OTG C;  2M3W A;  2KFF A;  2P71 A;  3BUX B;  3GK1 A;  1DQE A;  1S6J A;  1KSM A;  2HQ8 A;  1BR4 B;  2CNP A;  1QJT A;  1OE9 B;  3FWC A;  2KI4 C;  3L4L A;  1DJI A;  3LK1 A;  4HRH A;  3BUO B;  3CDN A;  3V2L A;  4INW A;  1F4Q A;  1OOH A;  2MJW B;  4MN0 A;  1CDN A;  2LAP A;  1OZO A;  2LCP A;  3WNX B;  4I5K A;  1MQ1 A;  1TNQ A;  1TNX A;  2HET A;  3A8R A;  2F8P A;  1JFK A;  1QIW A;  4P5O E;  4ZCU A;  1K8U A;  3D73 A;  4QJ5 B;  3I5G B;  3BFB A;  3NSL A;  3FE8 A;  3KHE A;  4PE1 A;  1KFX L;  1IGV A;  1DJY A;  2WOR A;  1X02 A;  4QJ3 B;  4YGE B;  2OS8 C;  3O6B A;  2WCH A;  1KSO A;  1Q80 A;  1CB1 A;  2BE6 A;  1K94 A;  5DKR A;  2KNE A;  4F0Z B;  1IH0 A;  2M29 A;  1RK9 A;  1QXP A;  1ZUZ A;  4L9M A;  2EC6 B;  2LMV A;  2EHB A;  1KFU S;  3I5H B;  1NUB A;  1ZOT B;  1BMO A;  3M0W A;  4CLN A;  2KFH A;  2WCL A;  3SIA A;  1DTL A;  2LVI A;  5CSI A;  1K93 D;  2KHN A;  2LM5 A;  2PMY A;  2L98 A;  2VRG A;  1TCO B;  1B8R A;  5AFP A;  1QLK A;  3FS7 A;  1M63 B;  1YRT B;  4ETO A;  2JTZ A;  1L2O C;  1U5I B;  1ORG A;  2JQ6 A;  3OB2 B;  1U5I A;  1OSA A;  2L2C A;  1JUO A;  2WC6 A;  2KI6 C;  3CYZ A;  4YI8 A;  3O78 A;  3PSR A;  2KAY A;  3DVM A;  1QAT A;  1A75 B;  1KK7 Z;  1SR6 C;  1A75 A;  1GGZ A;  2K8M B;  3PN7 C;  4Q04 A;  3SG2 A;  2QEB A;  3D76 A;  1S5G Y;  1FPW A;  2JRF A;  1W7J B;  1J1D A;  3JVT C;  4E68 A;  1KK8 B;  2BL0 C;  3BJH A;  4OR9 B;  4WQ2 A;  3DXL A;  4M2Q A;  4CFR A;  2O5G A;  3I5F B;  1M39 A;  2LUX A;  3CAB A;  3UO9 A;  2LP2 A;  3EK4 A;  5ER4 X;  3NSK A;  4OKH A;  1JSA A;  2FCE A;  5BPJ A;  3TZ1 A;  1YX7 A;  3JTD C;  1B8L A;  2WC8 A;  2NCP A;  3F45 A;  1RTP 1;  1G4Y R;  1QTX A;  2WCF A;  4YGD B;  2F2O A;  2QDI A;  1QAS A;  5FI6 A;  1DEK A;  1OOI X;  5DKQ A;  5EL2 A;  1CLM A;  5I2L A;  1DC1 A;  4BY4 A;  1K95 A;  2JNF A;  4OV2 A;  5HLV A;  4HRG A;  1K9K A;  3S0F A;  4TNC A;  5HKZ A;  3NSI A;  4GUK A;  1CMF A;  1B7T Y;  2MAZ A;  2F2P A;  4CID A;  2MHH A;  4NDB A;  1NWD A;  1DF0 B;  1K9P A;  3PJI A;  1DF0 A;  1EG3 A;  2MA2 A;  5I8N A;  2K0J A;  4OCI A;  2K2A A;  5GQQ C;  5TNC A;  1NIW A;  2JPT A;  3O4X A;  4MRY A;  2DOQ A;  2QEV A;  2K2F A;  3AKB A;  3K1E A;  2KI6 D;  2NZ0 A;  1LKJ A;  1PVB A;  2JT0 A;  2MRD A;  3LCP C;  1F70 A;  3NSO A;  2KQY A;  2M8U A;  1R2U A;  3D74 A;  3GK4 X;  2M7L A;  2G2B A;  1JF2 A;  1PRW A;  1TOP A;  1Z4H A;  1W9Z A;  5D69 A;  5FI7 A;  2KGR A;  3VB1 A;  3AAJ A;  1UHN A;  3LL8 B;  2KFG A;  4FQT A;  2QEH A;  3DZT A;  4MEW A;  1QX2 A;  1NCY A;  1Z2C B;  1C07 A;  1XK4 A;  3OX5 A;  2MLE C;  4CPV A;  1SNL A;  1UHI A;  2M97 A;  4N5X A;  1SBJ A;  4GBA A;  1F8H A;  4PAL A;  2P70 A;  3Q8I A;  1KWO B;  3EVV A;  1DJZ A;  2L2E A;  2PSR A;  1IIO A;  1C3Y A;  1G33 A;  1MWN A;  2LVV A;  4YGB B;  2BCB A;  1NX2 A;  4OZD A;  4AOM A;  2M9G A;  2CT9 A;  5DIC A;  3EG5 B;  1J7O A;  1BU3 A;  1DJX A;  2KSP A;  2BEC A;  2WC5 A;  3FE9 A;  1OQP A;  4MSP A;  2K7C A;  1M46 A;  1RFJ A;  2CTN A;  1YVL A;  1TTX A;  2FCD A;  2LLT A;  5G08 A;  3RM1 A;  3R1O A;  1FF1 A;  2E30 A;  4A4B A;  2JXC A;  2OTG B;  2WOS A;  2HQW A;  4UPG A;  2LVK A;  3VRQ A;  1ZAC A;  2ZRT A;  3S0E A;  3B88 A;  1NX1 A;  1XYD A;  1J55 A;  1NCX A;  2ZN8 A;  3DF0 B;  2KI4 B;  1SL8 A;  2JPO A;  2WCB A;  3DF0 A;  2WCM A;  2NLN A;  1QX7 A;  1NSH A;  1B47 A;  1J7P A;  1Y1X A;  1CLL A;  1SL9 A;  1WDC B;  4GGN A;  2BBN A;  4P2Y B;  4ZCV A;  4DCK A;  3H4S E;  3OGN A;  1SCM B;  2Q91 A;  2NCO A;  4C0J A;  1IRJ A;  1IJ5 A;  2WCK A;  1QX5 B;  2BKI B;  5PAL A;  2GGZ A;  3I5I C;  3S0G A;  2SAS A;  1ALV A;  1WDC C;  1Y0V H;  1EJ3 A;  2CBL A;  1PAL A;  1Y6W A;  2M0R A;  2OS8 B;  5ER5 A;  1KQV A;  1TIZ A;  2COL B;  2L51 A;  3R72 A;  1SCM C;  1ZFS A;  4I5L B;  5D7F A;  2JWW A;  1QIV A;  1MR8 A;  1S3P A;  1SL7 A;  1SMG A;  1V1F A;  1WLM A;  4M2P A;  1CFP A;  2JOJ A;  1QV1 A;  4GGF C;  4YI9 A;  3TS5 C;  4IJ7 A;  3E3R A;  3LLE A;  2V53 A;  5AEQ A;  1VRK A;  1OOJ A;  1ZMZ A;  1UHJ A;  2BCX A;  1AVS A;  1LA3 A;  1L2O B;  1Y1U A;  2KBI A;  2AMI A;  4IL1 A;  1S6I A;  1XFZ O;  5CSF A;  3SG5 A;  1GM0 A;  4QJ4 B;  2FJY A;  2HPS A;  2LUC A;  2P6B B;  2F3Y A;  3DVK A;  1TUZ A;  4N1F A;  1SR6 B;  3EVR A;  1IQ5 A;  4PT1 A;  2ZND A;  3PN7 B;  1XFY O;  4JPZ B;  1OMR A;  3D77 A;  1TWO A;  1D1O A;  1FI6 A;  2JTT A;  2LC5 A;  2PAS A;  4U8D A;  1B1G A;  2KOT A;  1FW4 A;  2ZRS A;  1CFD A;  1MUX A;  2FOT A;  4WRI A;  5FYX A;  4JQ0 D;  1S6C A;  1S26 D;  1YUS A;  2BL0 B;  3DY9 A;  1K90 D;  1QVI Y;  1SRA A;  1PSR A;  1Y1A A;  2JT8 A;  3FE6 A;  3OB1 B;  5J3X A;  2JUL A;  1UHK A;  3CR5 X;  1WLZ A;  2JXL A;  1XA5 A;  5DKN A;  3D0Y B;  4PHK A;  4D1E A;  2H8V A;  1LXF C;  3PFV A;  4N1G A;  3CGA A;  3JTD B;  4DRW A;  3PAL A;  2CCM A;  4USL A;  1EG4 A;  1PVA A;  1L7Z A;  3PM2 A;  4DS7 A;  1CFC A;  3B6X A;  1DJW A;  2JT3 A;  3R1V A;  1AHR A;  4JKT A;  5AER A;  3KEV A;  3PM8 A;  3EKH A;  5KSZ A;  1A03 A;  1DGV A;  4YGC B;  3GOF A;  4MZJ A;  5FI2 A;  3BYA A;  1JC2 A;  4M2O A;  1YUR A;  3VRO A;  1DMO A;  2LHL A;  2L50 A;  1BOD A;  1IKU A;  1MXL C;  1OMD A;  3VRN A;  3PAT A;  1H8B A;  1N2D A;  2Q4U A;  3GK2 A;  2R2I A;  1BOC A;  3RLZ A;  2I94 A;  3IQO A;  2KGB C;  1RWY A;  1YRU B;  3MSE B;  4DUQ A;  1F71 A;  3WHU B;  1SKT A;  4PE7 A;  1A2X A;  1OOG A;  4ORA B;  4C0L A;  2M1K B;  3BUM B;  1EH2 A;  2ERB A;  3B86 A;  5HKY A;  1K2H A;  5IBW A;  1DJG A;  2NXQ A;  1TCF A;  1J1E A;  3BQ3 A;  1F54 A;  1N0Y A;  3S0B A;  1JFJ A;  1WRZ A;  2KQ6 A;  3TUY B;  4FTG A;  5HYD A;  2I18 A;  3B87 A;  4MRX A;  5JJG A;  2WCJ A;  3B7A A;  4KYN A;  2HF5 A;  1A29 A;  3OX6 A;  3L4A A;  1SW8 A;  3ICB A;  3DYE A;  3HCM A;  2ISD A;  1NYA A;  4PDZ A;  3S0D A;  4MVF A;  2KLE A;  1C7W A;  1UHH A;  3VRP A;  4YGA A;  4I5J A;  4ORC B;  2WND A;  2LAN A;  3SG4 A;  3TUY C;  4JD9 A;  2K7B A;  3ZWH A;  1NPQ A;  3NHI A;  4GAO A;  1DT7 B;  5CPV A;  3S0A A;  1RRO A;  1SPY A;  2LLU A;  3O4Y A;  2F3Z A;  3BXK A;  4NDC A;  5AAN A;  1WRK A;  2K7D A;  1UUS A;  4MZL A;  3ZNI A;  4I5N B;  2K60 A;  5I94 A;  1KQM C;  1CDM A;  3OHM B;  2LMU A;  1CDP A;  2KYF A;  2LMT A;  1YTZ C;  2RGI A;  3TDI A;  3L47 A;  1CKK A;  1J7Q A;  1DGU A;  1K9U A;  2PYQ A;  3VRR A;  3BUN B;  2BNX A;  4R1E A;  2L0P A;  1H4B A;  3CR2 A;  2LV7 A;  3SS5 A;  2G9B A;  3A4U B;  3I5I B;  1QVI Z;  2M1U A;  3BOW B;  2F33 A;  1EXR A;  3BOW A;  1P28 A;  2ZKM X;  4PHM A;  3TDU A;  1CMG A;  4PE4 A;  3R1P A;  1NCZ A;  1OZS A;  1S5G Z;  1FBV A;  2Y5I A;  2LE9 B;  3TS5 B;  1SSE B;  4GGF A;  1XO5 A;  2GV5 A;  1S36 A;  1KFX S;  2CXJ A;  3NHT A;  1QLS A;  1AJ4 A;  2EGD A;  1S1E A;  2GGM A;  2L5X B;  2QEO A;  1OW4 A;  2ZFD A;  3BFA A;  3BUW B;  3CZ1 A;  3CZ0 A;  3K21 A;  1WRL A;  4PHJ A;  3NXA A;  1K96 A;  4YRU A;  2JNX A;  1DJH A;  3KF9 A;  3QRX A;  1F55 A;  1XFW O;  3QME A;  4PHN A;  4AQI A;  1A4P A;  1ODB A;  2H61 C;  2PQL A;  2WCE A;  4XYN A;  3AKA A;  1LIN A;  3SJS A;  1YX8 A;  2Y1N A;  1GQM A;  1BR1 B;  1MHO A;  1LA0 A;  3SS3 A;  1QS7 A;  2BE4 A;  2MLF C;  1CNP A;  4HSZ A;  1JBA A;  1FI5 A;  2JC2 A;  3CWG A;  3IF7 A;  4NDD A;  5HL1 A;  4GNK B;  3OP0 A;  3DD4 A;  2ZNE A;  2K61 A;  2PRU A;  3EK7 A;  1B7T Z;  3OBV A;  4PCW A;  3SS4 A;  3NGV A;  3SG7 A;  2QAC A;  2I2R E;  4ICB A;  1C3Z A;  3RZS A;  1GJY A;  4GFT A;  2LVJ A;  5CSJ A;  1HQV A;  4YBH B;  2BBM A;  4WQ3 A;  1LVC D;  1TUJ A;  3D0Y A;  3I5G C;  1AJ5 A;  1REC A;  1PK0 D;  2AAO A;  2KPH A;  1AP4 A;  2SCP A;  1R6P A;  2E6W A;  1EL4 A;  4GPL B;  1HT9 A;  1PUL A;  2KAV A;  4NQG A;  2IS9 A;  1YR5 A;  2H2K A;  2KYC A;  4A4C A;  1JF0 A;  5I2O A;  1KFU L;  1J7R A;  2EC6 C;  1LS8 A;  3I5H C;  1KCY A;  2LNK A;  3D75 A;  5CSN A;  3D78 A;  1UWO A;  2D8N A;  1DVI A; 
#chains in the Genus database with same CATH homology
 2Y4Q A;  3SG3 A;  3C1V A;  1YUT A;  1M31 A;  1B8C A;  3EKJ A;  5HKW A;  3AAK A;  1AUI B;  1RJV A;  2ZN9 A;  4BY5 A;  1YUU A;  5B8I B;  4OVN F;  5HLO A;  2PVB A;  1F4O A;  5I2Q A;  1G8I A;  3KO0 A;  1MXE A;  2Y1M A;  3CR4 X;  1NX0 A;  1TNP A;  2KDH A;  1AK8 A;  1B9A A;  1W7I B;  1BF5 A;  2LHI A;  1KK8 C;  1XFU O;  1GGW A;  1YVH A;  1UUR A;  3SIB A;  1BLQ A;  3KPX A;  1QV0 A;  2BKH B;  3I5F C;  1B4C A;  1CFF A;  3HX4 A;  1WY9 A;  1SYM A;  2KBM A;  1CTR A;  2K7O A;  1IG5 A;  3CZT X;  3DVJ A;  3VGO A;  1ALW A;  5JOL A;  4DIR A;  3LK0 A;  1TN4 A;  1XFV O;  4MLW A;  1XFX O;  1TRF A;  1CDL A;  2TN4 A;  2LLS A;  1PSB A;  3CTN A;  3CS1 A;  2BCA A;  4FQO A;  2A4J A;  2M49 B;  3WXA A;  1MF8 B;  1KQM B;  2PAL A;  3TDZ A;  3FIA A;  4MBE A;  1V1G A;  1KK7 Y;  1XVJ A;  1TNW A;  1UP5 A;  1JWD A;  3PLF B;  3CLN A;  4ORB B;  1SK6 D;  1BG1 A;  3DVE A;  2L4H A;  4C0K A;  4HRE E;  1CLB A;  4XJK B;  1CM1 A;  2JU0 A;  4CFQ A;  4XJK A;  1IQ3 A;  1C7V A;  3O2P A;  2I7A A;  1CM4 A;  3D10 A;  5K89 A;  2M7N A;  1IJ6 A;  5AXI A;  1IWQ A;  2MBX A;  1NP8 A;  3IQQ A;  1SCV A;  1XK4 C;  3FWB A;  1SY9 A;  2L4I A;  3SG6 A;  2B1U A;  4MZK A;  2QPT A;  5KU1 A;  1KWO C;  2JZI A;  1NX3 A;  1E8A A;  1OMV A;  5KTY A;  2AUC A;  3WHT B;  2H61 A;  1M45 A;  3EK8 A;  5F6T A;  1N65 A;  4AQJ A;  2FJU B;  3EVU A;  1BT6 A;  4JWQ A;  2KAX A;  2LP3 A;  1BJF A;  2OPO A;  2O60 A;  4PE0 A;  2OTG C;  2M3W A;  2KFF A;  3BUX B;  3GK1 A;  1S6J A;  1KSM A;  2HQ8 A;  1BR4 B;  2CNP A;  1QJT A;  1OE9 B;  3FWC A;  2KI4 C;  1DJI A;  3LK1 A;  4HRH A;  3BUO B;  1F4Q A;  2MJW B;  4MN0 A;  1CDN A;  2LAP A;  1OZO A;  2LCP A;  3WNX B;  4I5K A;  1MQ1 A;  1TNQ A;  1TNX A;  2HET A;  3A8R A;  2F8P A;  1JFK A;  1QIW A;  4P5O E;  4ZCU A;  1K8U A;  4QJ5 B;  3I5G B;  3NSL A;  3KHE A;  4PE1 A;  1KFX L;  1IGV A;  1DJY A;  2WOR A;  1X02 A;  4QJ3 B;  4YGE B;  2OS8 C;  3O6B A;  1KSO A;  1Q80 A;  1CB1 A;  2BE6 A;  1K94 A;  5DKR A;  2KNE A;  4F0Z B;  1IH0 A;  2M29 A;  1RK9 A;  1QXP A;  1ZUZ A;  4L9M A;  2EC6 B;  2LMV A;  2EHB A;  1KFU S;  3I5H B;  1NUB A;  1ZOT B;  1BMO A;  3M0W A;  4CLN A;  2KFH A;  3SIA A;  1DTL A;  2LVI A;  5CSI A;  1K93 D;  2KHN A;  2LM5 A;  2PMY A;  2L98 A;  2VRG A;  1TCO B;  1B8R A;  5AFP A;  1QLK A;  3FS7 A;  1M63 B;  1YRT B;  4ETO A;  2JTZ A;  1L2O C;  1U5I B;  2JQ6 A;  3OB2 B;  1U5I A;  1OSA A;  1JUO A;  2KI6 C;  4YI8 A;  3O78 A;  3PSR A;  2KAY A;  3DVM A;  1QAT A;  1A75 B;  1KK7 Z;  1SR6 C;  1GGZ A;  1A75 A;  2K8M B;  3PN7 C;  4Q04 A;  3SG2 A;  1S5G Y;  1FPW A;  2JRF A;  1W7J B;  1J1D A;  3JVT C;  4E68 A;  1KK8 B;  2BL0 C;  4OR9 B;  4WQ2 A;  4M2Q A;  4CFR A;  2O5G A;  3I5F B;  1M39 A;  2LUX A;  2LP2 A;  3EK4 A;  5ER4 X;  3NSK A;  4OKH A;  1JSA A;  2FCE A;  5BPJ A;  3TZ1 A;  1YX7 A;  3JTD C;  1B8L A;  2WC8 A;  2NCP A;  3F45 A;  1RTP 1;  1G4Y R;  1QTX A;  2WCF A;  4YGD B;  2F2O A;  1QAS A;  5DKQ A;  5I2L A;  1CLM A;  4BY4 A;  1K95 A;  2JNF A;  4OV2 A;  5HLV A;  4HRG A;  1K9K A;  4TNC A;  5HKZ A;  3NSI A;  4GUK A;  1CMF A;  1B7T Y;  2MAZ A;  2F2P A;  4CID A;  2MHH A;  4NDB A;  1NWD A;  1DF0 B;  1K9P A;  1DF0 A;  1EG3 A;  2MA2 A;  5I8N A;  2K0J A;  4OCI A;  2K2A A;  5GQQ C;  5TNC A;  1NIW A;  2JPT A;  4MRY A;  2DOQ A;  2K2F A;  3AKB A;  2KI6 D;  2NZ0 A;  1LKJ A;  1PVB A;  2JT0 A;  2MRD A;  3LCP C;  1F70 A;  3NSO A;  2KQY A;  2M8U A;  1R2U A;  3GK4 X;  2M7L A;  2G2B A;  1JF2 A;  1PRW A;  1TOP A;  5D69 A;  2KGR A;  3AAJ A;  1UHN A;  3LL8 B;  2KFG A;  4MEW A;  1QX2 A;  1NCY A;  1C07 A;  1XK4 A;  3OX5 A;  2MLE C;  4CPV A;  1SNL A;  1UHI A;  2M97 A;  4N5X A;  1SBJ A;  4GBA A;  1F8H A;  4PAL A;  1KWO B;  3EVV A;  1DJZ A;  2L2E A;  2PSR A;  1G33 A;  1MWN A;  2LVV A;  4YGB B;  2BCB A;  1NX2 A;  4AOM A;  2M9G A;  2CT9 A;  1J7O A;  1BU3 A;  1DJX A;  2KSP A;  2BEC A;  4MSP A;  1OQP A;  2K7C A;  1M46 A;  1RFJ A;  2CTN A;  1YVL A;  1TTX A;  2FCD A;  2LLT A;  5G08 A;  3RM1 A;  1FF1 A;  2E30 A;  4A4B A;  2JXC A;  2OTG B;  2WOS A;  2HQW A;  4UPG A;  2LVK A;  3VRQ A;  1ZAC A;  2ZRT A;  1NX1 A;  1XYD A;  1J55 A;  1NCX A;  2ZN8 A;  3DF0 B;  2KI4 B;  1SL8 A;  3DF0 A;  2WCB A;  2NLN A;  1QX7 A;  1NSH A;  1B47 A;  1J7P A;  1Y1X A;  1CLL A;  1SL9 A;  1WDC B;  4GGN A;  2BBN A;  4P2Y B;  4ZCV A;  4DCK A;  3H4S E;  1SCM B;  2Q91 A;  2NCO A;  4C0J A;  1IRJ A;  1IJ5 A;  1QX5 B;  2BKI B;  5PAL A;  2GGZ A;  3I5I C;  2SAS A;  1ALV A;  1WDC C;  1Y0V H;  1EJ3 A;  2CBL A;  1PAL A;  1Y6W A;  2M0R A;  2OS8 B;  5ER5 A;  1KQV A;  1TIZ A;  2COL B;  2L51 A;  1SCM C;  1ZFS A;  4I5L B;  5D7F A;  2JWW A;  1QIV A;  1MR8 A;  1S3P A;  1SL7 A;  1SMG A;  1V1F A;  1WLM A;  4M2P A;  1CFP A;  2JOJ A;  1QV1 A;  4GGF C;  4YI9 A;  3TS5 C;  3E3R A;  3LLE A;  2V53 A;  1VRK A;  1OOJ A;  1ZMZ A;  1UHJ A;  2BCX A;  1AVS A;  1LA3 A;  1L2O B;  1Y1U A;  2KBI A;  2AMI A;  4IL1 A;  1S6I A;  1XFZ O;  5CSF A;  3SG5 A;  4QJ4 B;  2HPS A;  2LUC A;  2P6B B;  2F3Y A;  3DVK A;  4N1F A;  1SR6 B;  3EVR A;  1IQ5 A;  4YGC B;  2ZND A;  3PN7 B;  1XFY O;  4JPZ B;  1OMR A;  5AEQ A;  1D1O A;  1FI6 A;  2JTT A;  2LC5 A;  2PAS A;  4U8D A;  1B1G A;  2KOT A;  1FW4 A;  2ZRS A;  1CFD A;  1MUX A;  2FOT A;  4WRI A;  5FYX A;  4JQ0 D;  1S6C A;  1S26 D;  1YUS A;  2BL0 B;  3JVT B;  1K90 D;  1QVI Y;  1SRA A;  1PSR A;  1Y1A A;  2JT8 A;  3OB1 B;  5J3X A;  2JUL A;  1UHK A;  3CR5 X;  1WLZ A;  2JXL A;  1XA5 A;  5DKN A;  3D0Y B;  4PHK A;  4D1E A;  1LXF C;  3PFV A;  4N1G A;  3CGA A;  3JTD B;  4DRW A;  3PAL A;  2CCM A;  4USL A;  1EG4 A;  1PVA A;  1L7Z A;  4DS7 A;  1CFC A;  1DJW A;  2JT3 A;  5AER A;  1AHR A;  3KEV A;  3PM8 A;  3EKH A;  5KSZ A;  1A03 A;  1DGV A;  3GOF A;  4MZJ A;  1JC2 A;  3BYA A;  4M2O A;  1YUR A;  3VRO A;  1DMO A;  2LHL A;  2L50 A;  1BOD A;  1IKU A;  1MXL C;  1OMD A;  3VRN A;  3PAT A;  1H8B A;  1N2D A;  2Q4U A;  3GK2 A;  2R2I A;  1BOC A;  3RLZ A;  2I94 A;  3IQO A;  2KGB C;  1RWY A;  1YRU B;  3MSE B;  4DUQ A;  1F71 A;  3WHU B;  1SKT A;  4PE7 A;  1A2X A;  4ORA B;  4C0L A;  2M1K B;  3BUM B;  1EH2 A;  1K2H A;  5HKY A;  5IBW A;  1DJG A;  2NXQ A;  1TCF A;  1J1E A;  3BQ3 A;  1F54 A;  1N0Y A;  1JFJ A;  1WRZ A;  2KQ6 A;  3TUY B;  4FTG A;  5HYD A;  2I18 A;  4MRX A;  5JJG A;  2HF5 A;  1A29 A;  3OX6 A;  1SW8 A;  3ICB A;  3HCM A;  2ISD A;  1NYA A;  4PDZ A;  4MVF A;  1C7W A;  1UHH A;  3VRP A;  4YGA A;  4I5J A;  4ORC B;  2WND A;  2LAN A;  3SG4 A;  3TUY C;  2K7B A;  3ZWH A;  1NPQ A;  4GAO A;  1DT7 B;  5CPV A;  1RRO A;  1SPY A;  2LLU A;  3O4Y A;  2F3Z A;  3BXK A;  4NDC A;  5AAN A;  1WRK A;  2K7D A;  1UUS A;  4MZL A;  3ZNI A;  4I5N B;  1KQM C;  1CDM A;  3OHM B;  2LMU A;  1CDP A;  2KYF A;  2LMT A;  1YTZ C;  2RGI A;  3TDI A;  1CKK A;  1J7Q A;  1DGU A;  1K9U A;  3VRR A;  3BUN B;  4R1E A;  2L0P A;  1H4B A;  3CR2 A;  2LV7 A;  2G9B A;  3A4U B;  3I5I B;  1QVI Z;  2M1U A;  3BOW B;  2F33 A;  1EXR A;  3BOW A;  2ZKM X;  4PHM A;  3TDU A;  1CMG A;  4PE4 A;  1NCZ A;  1OZS A;  1S5G Z;  1FBV A;  2Y5I A;  2LE9 B;  3TS5 B;  4GGF A;  1XO5 A;  2GV5 A;  1S36 A;  1KFX S;  2CXJ A;  1QLS A;  1AJ4 A;  2EGD A;  1S1E A;  2GGM A;  2L5X B;  3BUW B;  2ZFD A;  3K21 A;  1WRL A;  4PHJ A;  3NXA A;  1K96 A;  4YRU A;  2JNX A;  1DJH A;  3KF9 A;  3QRX A;  1F55 A;  1XFW O;  4PHN A;  4AQI A;  1A4P A;  1ODB A;  2H61 C;  2WCE A;  4XYN A;  3AKA A;  1LIN A;  3SJS A;  1YX8 A;  2Y1N A;  1GQM A;  1BR1 B;  1MHO A;  1LA0 A;  1QS7 A;  2BE4 A;  2MLF C;  1CNP A;  4HSZ A;  1JBA A;  1FI5 A;  2JC2 A;  3CWG A;  3IF7 A;  4NDD A;  4GNK B;  3OP0 A;  3DD4 A;  2ZNE A;  2K61 A;  2PRU A;  3EK7 A;  1B7T Z;  4PCW A;  3SG7 A;  2QAC A;  2I2R E;  4ICB A;  1GJY A;  4GFT A;  2LVJ A;  5CSJ A;  1HQV A;  4YBH B;  2BBM A;  4WQ3 A;  1LVC D;  3D0Y A;  3I5G C;  1AJ5 A;  1REC A;  1PK0 D;  2AAO A;  1AP4 A;  2SCP A;  1R6P A;  2E6W A;  1EL4 A;  4GPL B;  1HT9 A;  1PUL A;  2KAV A;  4NQG A;  2IS9 A;  1YR5 A;  2H2K A;  2KYC A;  4A4C A;  1JF0 A;  5I2O A;  1KFU L;  1J7R A;  2EC6 C;  1KCY A;  3I5H C;  2LNK A;  5CSN A;  1UWO A;  2D8N A;  1DVI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...