2MLEC

Nmr structure of the c-domain of troponin c bound to the anchoring region of troponin i
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
72
structure length
72
Chain Sequence
MGKSEEELSDLFRMFDKNADGYIDLDELKIMLQATGETITEDDIEELMKDGDKNNDGRIDYDEFLEFMKGVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Troponin C, slow skeletal and cardiac muscles
publication title The dilated cardiomyopathy G159D mutation in cardiac troponin C weakens the anchoring interaction with troponin I.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal binding protein
total genus 22
structure length 72
sequence length 72
ec nomenclature
pdb deposition date 2014-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00036 EF-hand_1 EF hand
C PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2mleC00
4MZKA 1M45A 2K7DA 2WC8A 3KF9A 2KHNA 2LCPA 2SASA 1NSHA 4XJKA 1DGUA 4HRHA 4D1EA 1DMOA 4MVFA 2M0RA 4MRYA 1IH0A 2JWWA 3IQQA 3EVRA 1WRLA 3CR2A 3HX4A 4I5KA 1GGWA 1SRAA 3FWBA 2LE9B 4P5OE 1XK4C 1JFKA 1L2OB 2F3YA 4DUQA 2HQ8A 1XO5A 3GK4X 1CDNA 2LVVA 1MHOA 1XFUO 2L2EA 1NPQA 1Y1AA 3OB2B 3D0YB 4DS7A 1IKUA 1TNWA 1YR5A 4JPZB 3E3RA 4MRXA 1WLZA 1G33A 1WRZA 2R2IA 3EKHA 5KTYA 1J1EA 1SW8A 1JF2A 1EH2A 3DVMA 3EVUA 4N1FA 4PE0A 1PVAA 4AOMA 2M3WA 1WLMA 2LLSA 1SL8A 2CBLA 3DF0B 3I5FB 2L0PA 5KSZA 1TOPA 1DJHA 5BPJA 2BCAA 1U5IA 2I2RE 1BOCA 5I2QA 3TDIA 4ORAB 2JNFA 4JWQA 3ICBA 4M2PA 1QX2A 3EKJA 4PE1A 3CGAA 1L7ZA 1PSBA 4N1GA 2WCFA 4USLA 4WQ2A 4FTGA 1KWOC 4YGAA 3C1VA 3TZ1A 1UHJA 4TNCA 4OVNF 1S1EA 1QS7A 2BCXA 2CT9A 3AKAA 1FW4A 2LHLA 2LUXA 2L50A 4NDCA 4CIDA 3GK2A 3DVKA 1CM4A 2JC2A 5HKZA 2EHBA 1S26D 1W7JB 3KHEA 3SG7A 2WNDA 1SCMC 2K2FA 1SY9A 2V53A 3PFVA 1YUSA 1PK0D 3BUXB 1NUBA 4A4CA 1J1DA 1KFXS 5TNCA 1YVHA 2CNPA 1IQ3A 1E8AA 2LLTA 1AVSA 3CZTX 5IBWA 1PULA 1FI5A 2CCMA 1YTZC 2G9BA 1GQMA 2PASA 2KGBC 3CR4X 2KOTA 1YX7A 1PSRA 3AAKA 1FBVA 1IG5A 1Y1XA 1SK6D 2KYFA 2AMIA 3OX5A 4GGFC 2FCEA 3A4UB 1WDCC 1K95A 2EC6C 2FOTA 1M31A 4MN0A 5F6TA 2M1UA 3NSOA 2ZRSA 3TDUA 1DJYA 3O78A 2I7AA 1B8CA 1EL4A 2K0JA 2D8NA 3I5HB 5AANA 4AQJA 4L9MA 1R6PA 1SMGA 2WCEA 1EXRA 2JXLA 1LKJA 2F3ZA 3LL8B 3JVTB 1KK8C 1OE9B 1SBJA 1TNQA 2F33A 3TUYC 2MLEC 2KI4C 3PATA 2KDHA 3D0YA 4Q04A 3KPXA 3WXAA 5CSNA 1XFZO 2K61A 1CLMA 1NP8A 4PHJA 4HREE 2LP3A 3VRNA 4DIRA 1K9UA 3GK1A 1TIZA 1JWDA 2OS8C 4DRWA 4ETOA 1B8RA 1XA5A 2GGMA 4QJ5B 1YRTB 1CFDA 3DF0A 4NDDA 1RK9A 4PHNA 2LM5A 1TNPA 3NXAA 4CFQA 2KQ6A 2Q91A 3IQOA 1NWDA 2LMVA 3DVJA 2CXJA 5JJGA 2M7NA 5DKRA 1F54A 2EGDA 2FCDA 4GPLB 5ER4X 2MAZA 1A75B 1OQPA 3PN7B 4XYNA 1GJYA 4CFRA 2PSRA 4PALA 2LLUA 4UPGA 1OZSA 1S6IA 3WNXB 4GNKB 2M1KB 2WOSA 1QASA 1F4OA 2JNXA 2KFGA 3KEVA 3WHUB 2HPSA 1S5GY 2TN4A 5HKWA 1DJXA 3I5IB 2NZ0A 1KCYA 1XFVO 5DKNA 1NYAA 1K96A 1RTP1 4I5NB 1C7VA 3NSKA 1JFJA 1QIWA 5HLVA 3PM8A 1CB1A 1SCVA 2M97A 2FJUB 3JTDC 4JQ0D 3OHMB 1J7PA 1QATA 2F8PA 2L4IA 5ER5A 1CNPA 3GOFA 2H61C 4R1EA 4M2QA 5G08A 1MUXA 1FF1A 1SR6C 3TDZA 5CPVA 5K89A 1SNLA 4YGBB 1F4QA 2KI6D 3QRXA 1QXPA 2SCPA 1QX7A 1J7QA 1BJFA 2IS9A 3VRPA 3CWGA 1S6CA 1BF5A 3BUOB 3M0WA 1NX2A 3JTDB 1S5GZ 1RWYA 3IF7A 1LVCD 2ZNEA 3DD4A 1G8IA 1OZOA 1KFUL 1RJVA 1BT6A 1OMVA 4GBAA 5AXIA 1Y1UA 1J7OA 1L2OC 1IJ5A 1M39A 1NCYA 1SR6B 3MSEB 1QLSA 2MLFC 3HCMA 3H4SE 1VRKA 5GQQC 2O5GA 1QX5B 1HQVA 3PALA 3PSRA 4ORBB 1KK7Y 3BUMB 1PALA 1FI6A 2PALA 1BR4B 1S36A 1S3PA 2HETA 2WCBA 3BUNB 2LVJA 1B7TY 1AHRA 1IRJA 3ZNIA 5AEQA 1S6JA 4M2OA 4AQIA 1DJWA 1DF0B 4C0LA 2ISDA 3CLNA 5I8NA 2LHIA 3VROA 1KWOB 1ALWA 3FS7A 4PHKA 4XJKB 1ZFSA 1RFJA 2VRGA 1KQVA 1QJTA 3O6BA 3WHTB 1XFWO 2B1UA 4MZLA 1A03A 1TN4A 2I18A 2KSPA 4A4BA 4GUKA 3DVEA 1JUOA 1LA3A 1CLBA 1SCMB 3BYAA 1J55A 1IJ6A 1IQ5A 4QJ3B 2HQWA 2M7LA 3SJSA 1A29A 1KK7Z 2G2BA 2JPTA 2AUCA 2KNEA 2ZN8A 2BECA 2LMTA 1CDLA 1YUUA 4C0KA 4DCKA 3VRRA 1UURA 2M29A 3NSIA 4ZCVA 1ZACA 4HRGA 5PALA 1K9PA 2LC5A 1TCFA 3BOWB 1CFCA 1SKTA 2MHHA 3LK0A 2JQ6A 1MWNA 3O4YA 1UUSA 3BQ3A 1NCXA 4ZCUA 3VRQA 5CSIA 1BG1A 5CSFA 1WDCB 2BE4A 2EC6B 3AKBA 2BBNA 1B1GA 2KBIA 2LMUA 2LV7A 2KQYA 3I5GC 1YRUB 4YGDB 1UHKA 5KU1A 1UWOA 3EK4A 1AJ5A 2BL0C 4WRIA 1RROA 2E30A 1SL9A 1QIVA 1H8BA 1UHNA 1XK4A 2Y1NA 1N2DA 3BUWB 3KO0A 1XYDA 4GGNA 1KK8B 2KBMA 4N5XA 3TUYB 2QACA 2WORA 1LA0A 1AP4A 1BLQA 2JT0A 2KI4B 2L51A 3CTNA 1EG3A 1SL7A 2BKIB 1FPWA 2JT3A 4CLNA 5I2LA 4YI9A 2NXQA 1V1FA 2H2KA 1K93D 3SG5A 1KFXL 4F0ZB 1JBAA 1WY9A 2OS8B 4PDZA 1RECA 1YUTA 1OMRA 2JU0A 2L4HA 1NX0A 1QVIY 1KQMC 2K2AA 1KSMA 4HSZA 4OKHA 4PHMA 3LLEA 3K21A 1BU3A 4PE4A 1Y6WA 1N0YA 2JULA 1B8LA 1R2UA 1ZOTB 2BCBA 1NCZA 2KI6C 1NX1A 2RGIA 2CTNA 4NDBA 2I94A 2COLB 2K8MB 5HLOA 1LINA 1DVIA 2ZKMX 1CFPA 1N65A 1KQMB 1PRWA 2K7BA 3BXKA 1CDPA 1CM1A 4CPVA 4MLWA 1C07A 1YURA 5JOLA 1TRFA 1M63B 1QLKA 3A8RA 1KSOA 2Y5IA 3SIAA 5AFPA 2MBXA 4PCWA 1DT7B 1NX3A 1QVIZ 4ICBA 1V1GA 3SG4A 3I5FC 1F71A 4YGEB 2M49B 2O60A 1NIWA 4NQGA 1M46A 1TCOB 2KFHA 3PLFB 1EG4A 1AJ4A 4OV2A 2P6BB 1K8UA 4BY5A 3BOWA 1MXEA 2JTTA 1HT9A 4GGFA 3SG2A 2Y4QA 1MF8B 1K9KA 3SIBA 3ZWHA 1DTLA 2ZNDA 3FIAA 2AAOA 5FYXA 5HYDA 4I5LB 5HKYA 1JSAA 2JRFA 1SPYA 1CFFA 1UP5A 2BKHB 2DOQA 1CMGA 4IL1A 5J3XA 4E68A 4OR9B 1XFYO 1GGZA 1C7WA 1JC2A 2PRUA 3EK7A 3RM1A 1UHHA 2LUCA 3AAJA 3SG3A 2OTGC 1CMFA 1OSAA 2GGZA 1BODA 2KFFA 4MSPA 1YX8A 5I2OA 2HF5A 5DKQA 4P2YB 2KGRA 3LCPC 2BBMA 3RLZA 3CS1A 1OOJA 1YVLA 3NSLA 1A75A 1W7IB 1Q80A 1BR1B 1QTXA 1LXFC 1B7TZ 2NCOA 4QJ4B 1MQ1A 1X02A 2F2OA 1G4YR 2KAXA 1MXLC 2M8UA 2OTGB 2PVBA 2QPTA 4I5JA 1QV0A 1D1OA 2JXCA 1SYMA 3EK8A 3I5HC 3O2PA 1CDMA 2L98A 1XVJA 3CR5X 4C0JA 2LNKA 5B8IB 2JTZA 2Q4UA 2ZN9A 1B9AA 1A2XA 2LP2A 1H4BA 2LVKA 1TNXA 2Y1MA 2LAPA 2A4JA 4YGCB 2NLNA 5D69A 2BE6A 1IWQA 3JVTC 2E6WA 2KYCA 4MEWA 1UHIA 3SG6A 3VGOA 1U5IB 1Y0VH 1CTRA 1CLLA 1F8HA 1B4CA 1ZUZA 2KAYA 1EJ3A 1K2HA 1A4PA 2ZRTA 2JZIA 1AUIB 2KAVA 3OP0A 3EVVA 3TS5C 1QV1A 4WQ3A 1CKKA 2OPOA 4MBEA 1JF0A 4YBHB 3OB1B 1AK8A 4GFTA 1DJZA 4ORCB 2H61A 1K94A 5AERA 1XFXO 3I5GB 4FQOA 1KFUS 1K90D 1MR8A 3LK1A 4YI8A 2MA2A 4OCIA 1TTXA 1DJGA 1B47A 1ALVA 3FWCA 1IGVA 1WRKA 2BL0B 2JT8A 3PN7C 4GAOA 4YRUA 1PVBA 1F55A 1J7RA 2M9GA 3OX6A 3TS5B 1BMOA 1DJIA 1ODBA 2NCPA 3F45A 4PE7A 2K7CA 3I5IC 4MZJA 2L5XB 2K7OA 2ZFDA 2MJWB 2LANA 1OMDA 2LVIA 4U8DA 5D7FA 4BY4A 1F70A 3D10A 1DF0A 5CSJA 1DGVA 2F2PA 2GV5A 1ZMZA 2PMYA 2JOJA 2MRDA
chains in the Genus database with same CATH superfamily
4MZKA 2KLEA 1M45A 2K7DA 2PYQA 2WC8A 2KHNA 2LCPA 3KF9A 2SASA 1NSHA 4XJKA 1DGUA 2QEVA 4HRHA 4D1EA 1DMOA 4MVFA 3S0GA 2M0RA 4MRYA 1IH0A 2JWWA 3IQQA 3EVRA 1WRLA 3CR2A 3HX4A 4I5KA 1GGWA 1SRAA 3FWBA 2LE9B 4P5OE 1XK4C 1JFKA 1L2OB 2F3YA 4DUQA 2HQ8A 1XO5A 2K60A 3GK4X 5HL1A 1CDNA 2LVVA 1MHOA 1XFUO 2L2EA 1NPQA 1Y1AA 3OB2B 3D0YB 4DS7A 1IKUA 1TNWA 3S0AA 1YR5A 2L5YA 4JPZB 3E3RA 4MRXA 1WLZA 1G33A 1WRZA 2R2IA 3EKHA 5KTYA 1J1EA 1SW8A 3CDNA 1JF2A 3UO9A 1EH2A 3DVMA 3EVUA 4N1FA 4PE0A 1PVAA 4AOMA 2M3WA 1WLMA 2LLSA 1SL8A 2CBLA 3DF0B 3I5FB 2L0PA 5FI7A 5KSZA 1TOPA 3BFAA 1DJHA 5BPJA 2BCAA 3CZ1A 1U5IA 3S0DA 2I2RE 3L47A 1BOCA 5I2QA 1Z4HA 3TDIA 4ORAB 3B87A 2ERBA 2JNFA 4JWQA 3ICBA 4M2PA 1QX2A 1P28A 3EKJA 4PE1A 3CGAA 1L7ZA 1PSBA 4N1GA 2WCFA 4USLA 4WQ2A 4FTGA 1KWOC 4YGAA 3C1VA 3TZ1A 1UHJA 4TNCA 3IVTA 4OVNF 1S1EA 3V2LA 1QS7A 2BCXA 2CT9A 3AKAA 1FW4A 2LHLA 2LUXA 3SS3A 2L50A 4NDCA 3B7AA 3RZSA 4CIDA 3GK2A 3DVKA 2WCLA 1CM4A 2JC2A 5HKZA 2EHBA 1S26D 1W7JB 3KHEA 2JPOA 3SG7A 2WNDA 1SCMC 2K2FA 1SY9A 2WC6A 2V53A 3D75A 3DY9A 3PFVA 1YUSA 1PK0D 3BUXB 3PM2A 1NUBA 4A4CA 1J1DA 1KFXS 5TNCA 1YVHA 2CNPA 1IQ3A 1E8AA 2LLTA 3NGVA 1AVSA 3CZTX 5IBWA 1PULA 1FI5A 2CCMA 1YTZC 2G9BA 1GQMA 2PASA 2KGBC 3CR4X 2KOTA 1YX7A 1PSRA 3AAKA 1FBVA 1IG5A 1Y1XA 1SK6D 2KYFA 4JKTA 2AMIA 3O4XA 3OX5A 4GGFC 2FCEA 3A4UB 1WDCC 1K95A 2EC6C 2BNXA 2FOTA 1M31A 3S0BA 4MN0A 1TWOA 5F6TA 2M1UA 3NSOA 2ZRSA 1TUJA 3TDUA 1QWVA 1DJYA 3O78A 2I7AA 1B8CA 1EL4A 2K0JA 2D8NA 3I5HB 5AANA 4AQJA 4L9MA 1R6PA 1SMGA 2WCEA 2H8VA 1EXRA 2JXLA 2WCHA 1LKJA 2F3ZA 3LL8B 3JVTB 1KK8C 3NHIA 1OE9B 1SBJA 1TNQA 2F33A 3TUYC 2MLEC 2KI4C 3PATA 2KDHA 3D0YA 4Q04A 3KPXA 3WXAA 5CSNA 1XFZO 2K61A 1CLMA 1NP8A 4IJ7A 4HREE 2LP3A 4PHJA 3VRNA 1K9UA 3GK1A 4DIRA 1TIZA 1JWDA 2OS8C 4DRWA 4ETOA 1B8RA 1XA5A 2GGMA 4QJ5B 1YRTB 1CFDA 3DF0A 4NDDA 1DEKA 1RK9A 4PHNA 2LM5A 1TNPA 3NXAA 4CFQA 2KQ6A 2Q91A 3B6XA 3IQOA 1NWDA 2LMVA 3DVJA 2CXJA 3OBVA 5JJGA 2M7NA 1SSEB 5DKRA 1F54A 2EGDA 2FCDA 4GPLB 1IIOA 5ER4X 2MAZA 1A75B 1OQPA 3PN7B 4XYNA 1GJYA 4CFRA 2PSRA 3DXLA 2LLUA 4PALA 4UPGA 1OZSA 1S6IA 3WNXB 4GNKB 2M1KB 2WOSA 1QASA 1F4OA 2JNXA 2KFGA 3KEVA 4KYNA 2HPSA 1S5GY 2TN4A 5HKWA 1DJXA 3I5IB 2NZ0A 3Q8IA 1XFVO 5DKNA 1NYAA 1KCYA 1K96A 2KLDA 1RTP1 4I5NB 1C7VA 3NSKA 1JFJA 1QIWA 3D76A 3PM8A 5HLVA 1SCVA 1CB1A 2M97A 2FJUB 3JTDC 3WHUB 4JQ0D 3OHMB 1J7PA 1QATA 2F8PA 2L4IA 5ER5A 1XFRA 2P71A 1OOFA 2P70A 1CNPA 3GOFA 5FI2A 2H61C 4R1EA 4M2QA 1Z2CB 5G08A 1MUXA 1FF1A 1SR6C 4JD9A 3TDZA 5CPVA 5K89A 1SNLA 2QEBA 4YGBB 1F4QA 2KI6D 3QRXA 1QXPA 2KPHA 1QX7A 2SCPA 1BJFA 2IS9A 3BFBA 3VRPA 3CWGA 1S6CA 1BF5A 1J7QA 3BUOB 3M0WA 1NX2A 3JTDB 1S5GZ 1C3ZA 1RWYA 2YGUA 1LVCD 3IF7A 2ZNEA 3DD4A 4PT1A 3BJHA 1G8IA 1OZOA 4F7FA 1KFUL 1RJVA 1BT6A 1OMVA 4GBAA 5AXIA 1Y1UA 1J7OA 1L2OC 1IJ5A 1M39A 1NCYA 1SR6B 3MSEB 1QLSA 2MLFC 3HCMA 3H4SE 3D73A 1VRKA 5GQQC 2O5GA 3BFHA 5EL2A 1QX5B 1HQVA 3D77A 3PALA 3PSRA 1KK7Y 3BUMB 1PALA 4ORBB 2PALA 1BR4B 1S36A 1S3PA 3SS4A 1FI6A 2HETA 2WCBA 3BUNB 2LVJA 1B7TY 1AHRA 1IRJA 3ZNIA 5AEQA 1S6JA 4M2OA 4AQIA 1DJWA 1DF0B 4C0LA 2ISDA 3CLNA 5I8NA 2LHIA 3VROA 1KWOB 1ALWA 3FS7A 4OZDA 5FI6A 4PHKA 3DZTA 4XJKB 1ZFSA 1RFJA 2VRGA 1KQVA 1QJTA 3L4LA 3O6BA 3WHTB 1XFWO 2B1UA 4MZLA 1A03A 1TN4A 2I18A 2KSPA 4A4BA 2WC5A 4GUKA 3DVEA 1JUOA 1LA3A 1CLBA 1SCMB 3BYAA 1J55A 1IJ6A 1IQ5A 4QJ3B 2HQWA 2M7LA 3SJSA 1A29A 1KK7Z 2G2BA 2JPTA 2AUCA 2KNEA 2ZN8A 2BECA 2LMTA 1CDLA 1YUUA 4C0KA 4DCKA 3VRRA 1UURA 2M29A 3CYZA 3NSIA 3CZ2A 4ZCVA 1ZACA 4HRGA 5DICA 5PALA 1K9PA 1OOIX 2LC5A 1TCFA 3BOWB 1CFCA 1SKTA 2MHHA 1ORGA 3LK0A 2JQ6A 1MWNA 3O4YA 1UUSA 3BQ3A 1NCXA 4ZCUA 3VRQA 5CSIA 1BG1A 5CSFA 1WDCB 1GM0A 2BE4A 2EC6B 2WCKA 3AKBA 2BBNA 1B1GA 2KBIA 2LMUA 2LV7A 2KQYA 3CZ0A 3I5GC 1YRUB 1LS8A 1C3YA 4YGDB 1UHKA 3CABA 1UWOA 3EK4A 5KU1A 1AJ5A 2BL0C 3VB1A 4WRIA 1RROA 2E30A 1SL9A 1QIVA 1H8BA 1UHNA 1XK4A 2Y1NA 1N2DA 3BUWB 3OGNA 4FQTA 2BAPA 3KO0A 1XYDA 4GGNA 1KK8B 2KBMA 3FE9A 4N5XA 3TUYB 2QACA 2WORA 1LA0A 1AP4A 1BLQA 2JT0A 2KI4B 3R1PA 2L51A 3CTNA 1EG3A 1SL7A 2BKIB 1FPWA 2JT3A 3EG5B 3NHTA 4CLNA 5I2LA 4YI9A 2NXQA 1OOHA 1V1FA 2H2KA 1K93D 3SG5A 1KFXL 2QDIA 4F0ZB 1JBAA 1WY9A 2OS8B 4PDZA 1RECA 1YUTA 1OMRA 2JU0A 2L4HA 1NX0A 1QVIY 1KQMC 2K2AA 1KSMA 4HSZA 1W9ZA 4OKHA 3LLEA 4PHMA 3K21A 1BU3A 4PE4A 1Y6WA 1N0YA 2JULA 2PQLA 1B8LA 1R2UA 3S0FA 1ZOTB 2BCBA 1NCZA 2KI6C 1NX1A 2RGIA 2CTNA 2L2CA 4NDBA 3SS5A 2I94A 2COLB 2K8MB 5HLOA 1LINA 1DVIA 3FE6A 2ZKMX 1CFPA 1N65A 1KQMB 3QMEA 1PRWA 2K7BA 3BXKA 1CDPA 1CM1A 4CPVA 4MLWA 1C07A 1YURA 5JOLA 1TRFA 1M63B 1QLKA 3A8RA 1KSOA 2Y5IA 3SIAA 5AFPA 2MBXA 4PCWA 1DT7B 1NX3A 1QVIZ 4ICBA 1V1GA 3SG4A 3I5FC 1F71A 4YGEB 2M49B 2O60A 1NIWA 4NQGA 1M46A 1TCOB 2KFHA 3PLFB 1EG4A 3R72A 1AJ4A 2WCMA 4OV2A 2P6BB 1K8UA 4BY5A 3BOWA 1MXEA 2JTTA 1HT9A 3B88A 3R1VA 4GGFA 3SG2A 2Y4QA 1MF8B 1K9KA 1TUZA 3SIBA 3ZWHA 1DTLA 2FJYA 2ZNDA 3FIAA 2AAOA 5FYXA 5HYDA 4I5LB 5HKYA 1JSAA 2JRFA 1SPYA 1CFFA 1UP5A 2BKHB 2DOQA 1CMGA 4IL1A 5J3XA 4E68A 4OR9B 1XFYO 1GGZA 1OOGA 1C7WA 1JC2A 2PRUA 3EK7A 3RM1A 5D3OA 1DELA 1UHHA 2LUCA 3AAJA 3SG3A 3K1EA 2OTGC 1CMFA 3UNWA 1OSAA 2GGZA 1BODA 2KFFA 4MSPA 1YX8A 5I2OA 2HF5A 5DKQA 4P2YB 2KGRA 3LCPC 2BBMA 3RLZA 3CS1A 1DQEA 1OOJA 1YVLA 3NSLA 4INXA 1A75A 1W7IB 1Q80A 3N7HA 1BR1B 1QTXA 3D78A 1LXFC 1B7TZ 2NCOA 4QJ4B 1MQ1A 1X02A 2F2OA 1G4YR 2KAXA 1MXLC 2M8UA 2OTGB 2PVBA 2QPTA 3FE8A 1QV0A 2GTEA 4I5JA 1D1OA 2JXCA 1SYMA 2WCJA 3S0EA 3EK8A 3I5HC 3O2PA 1CDMA 2L98A 1XVJA 3CR5X 4C0JA 2LNKA 5B8IB 2JTZA 2Q4UA 2ZN9A 1B9AA 1A2XA 2LP2A 1H4BA 2LVKA 1TNXA 2Y1MA 2LAPA 2A4JA 4YGCB 2NLNA 5D69A 2BE6A 1IWQA 3JVTC 2E6WA 2KYCA 4MEWA 1UHIA 3SG6A 3VGOA 1U5IB 3DYEA 5I94A 1Y0VH 1CTRA 1CLLA 1F8HA 1B4CA 1ZUZA 2KAYA 1EJ3A 4INWA 1K2HA 1A4PA 2ZRTA 2JZIA 1AUIB 2KAVA 3OP0A 3EVVA 3TS5C 1QV1A 4WQ3A 1CKKA 2OPOA 4MBEA 1JF0A 2QEHA 4YBHB 3OB1B 1T14A 1AK8A 2QEOA 4GFTA 1DJZA 4ORCB 2H61A 1K94A 5AERA 1XFXO 3I5GB 4FQOA 1KFUS 1K90D 1MR8A 3LK1A 3PJIA 4YI8A 2MA2A 4OCIA 1TTXA 1DJGA 1B47A 3B86A 1ALVA 3FWCA 1IGVA 1WRKA 2BL0B 2JT8A 3PN7C 3R1OA 4GAOA 4YRUA 1PVBA 1F55A 1J7RA 2M9GA 3OX6A 3TS5B 1BMOA 1DJIA 1ODBA 2NCPA 3F45A 1OW4A 4PE7A 2K7CA 1DC1A 3I5IC 4MZJA 2L5XB 2K7OA 2ZFDA 2MJWB 2LANA 1OMDA 2LVIA 4U8DA 5D7FA 4BY4A 3D74A 1F70A 3D10A 3L4AA 1DF0A 5CSJA 1DGVA 2F2PA 2GV5A 1ZMZA 2PMYA 2JOJA 2MRDA
chains in the Genus database with same CATH topology
4MZKA 1M45A 2K7DA 2WC8A 3KF9A 2KHNA 2LCPA 2SASA 1NSHA 4XJKA 1DGUA 4HRHA 4D1EA 1DMOA 4MVFA 2M0RA 4MRYA 1IH0A 2JWWA 3IQQA 3EVRA 1WRLA 3CR2A 3HX4A 4I5KA 1GGWA 1SRAA 3FWBA 2LE9B 4P5OE 1XK4C 1JFKA 1L2OB 2F3YA 4DUQA 2HQ8A 1XO5A 3GK4X 1CDNA 2LVVA 1MHOA 1XFUO 2L2EA 1NPQA 1Y1AA 3OB2B 3D0YB 4DS7A 1IKUA 1TNWA 1YR5A 4JPZB 3E3RA 4MRXA 1WLZA 1G33A 1WRZA 2R2IA 3EKHA 5KTYA 1J1EA 1SW8A 1JF2A 1EH2A 3DVMA 3EVUA 4N1FA 4PE0A 1PVAA 4AOMA 2M3WA 1WLMA 2LLSA 1SL8A 2CBLA 3DF0B 3I5FB 2L0PA 5KSZA 1TOPA 1DJHA 5BPJA 2BCAA 1U5IA 2I2RE 1BOCA 5I2QA 3TDIA 4ORAB 2JNFA 4JWQA 3ICBA 4M2PA 1QX2A 3EKJA 4PE1A 3CGAA 1L7ZA 1PSBA 4N1GA 2WCFA 4USLA 4WQ2A 4FTGA 1KWOC 4YGAA 3C1VA 3TZ1A 1UHJA 4TNCA 4OVNF 1S1EA 1QS7A 2BCXA 2CT9A 3AKAA 1FW4A 2LHLA 2LUXA 2L50A 4NDCA 4CIDA 3GK2A 3DVKA 1CM4A 2JC2A 5HKZA 2EHBA 1S26D 1W7JB 3KHEA 3SG7A 2WNDA 1SCMC 2K2FA 1SY9A 2V53A 3PFVA 1YUSA 1PK0D 3BUXB 1NUBA 4A4CA 1J1DA 1KFXS 5TNCA 1YVHA 2CNPA 1IQ3A 1E8AA 2LLTA 1AVSA 3CZTX 5IBWA 1PULA 1FI5A 2CCMA 1YTZC 2G9BA 1GQMA 2PASA 2KGBC 3CR4X 2KOTA 1YX7A 1PSRA 3AAKA 1FBVA 1IG5A 1Y1XA 1SK6D 2KYFA 2AMIA 3OX5A 4GGFC 2FCEA 3A4UB 1WDCC 1K95A 2EC6C 2FOTA 1M31A 4MN0A 5F6TA 2M1UA 3NSOA 2ZRSA 3TDUA 1DJYA 3O78A 2I7AA 1B8CA 1EL4A 2K0JA 2D8NA 3I5HB 5AANA 4AQJA 4L9MA 1R6PA 1SMGA 2WCEA 1EXRA 2JXLA 1LKJA 2F3ZA 3LL8B 3JVTB 1KK8C 1OE9B 1SBJA 1TNQA 2F33A 3TUYC 2MLEC 2KI4C 3PATA 2KDHA 3D0YA 4Q04A 3KPXA 3WXAA 5CSNA 1XFZO 2K61A 1CLMA 1NP8A 4PHJA 4HREE 2LP3A 3VRNA 4DIRA 1K9UA 3GK1A 1TIZA 1JWDA 2OS8C 4DRWA 4ETOA 1B8RA 1XA5A 2GGMA 4QJ5B 1YRTB 1CFDA 3DF0A 4NDDA 1RK9A 4PHNA 2LM5A 1TNPA 3NXAA 4CFQA 2KQ6A 2Q91A 3IQOA 1NWDA 2LMVA 3DVJA 2CXJA 5JJGA 2M7NA 5DKRA 1F54A 2EGDA 2FCDA 4GPLB 5ER4X 2MAZA 1A75B 1OQPA 3PN7B 4XYNA 1GJYA 4CFRA 2PSRA 4PALA 2LLUA 4UPGA 1OZSA 1S6IA 3WNXB 4GNKB 2M1KB 2WOSA 1QASA 1F4OA 2JNXA 2KFGA 3KEVA 3WHUB 2HPSA 1S5GY 2TN4A 5HKWA 1DJXA 3I5IB 2NZ0A 1KCYA 1XFVO 5DKNA 1NYAA 1K96A 1RTP1 4I5NB 1C7VA 3NSKA 1JFJA 1QIWA 5HLVA 3PM8A 1CB1A 1SCVA 2M97A 2FJUB 3JTDC 4JQ0D 3OHMB 1J7PA 1QATA 2F8PA 2L4IA 5ER5A 1CNPA 3GOFA 2H61C 4R1EA 4M2QA 5G08A 1MUXA 1FF1A 1SR6C 3TDZA 5CPVA 5K89A 1SNLA 4YGBB 1F4QA 2KI6D 3QRXA 1QXPA 2SCPA 1QX7A 1J7QA 1BJFA 2IS9A 3VRPA 3CWGA 1S6CA 1BF5A 3BUOB 3M0WA 1NX2A 3JTDB 1S5GZ 1RWYA 3IF7A 1LVCD 2ZNEA 3DD4A 1G8IA 1OZOA 1KFUL 1RJVA 1BT6A 1OMVA 4GBAA 5AXIA 1Y1UA 1J7OA 1L2OC 1IJ5A 1M39A 1NCYA 1SR6B 3MSEB 1QLSA 2MLFC 3HCMA 3H4SE 1VRKA 5GQQC 2O5GA 1QX5B 1HQVA 3PALA 3PSRA 4ORBB 1KK7Y 3BUMB 1PALA 1FI6A 2PALA 1BR4B 1S36A 1S3PA 2HETA 2WCBA 3BUNB 2LVJA 1B7TY 1AHRA 1IRJA 3ZNIA 5AEQA 1S6JA 4M2OA 4AQIA 1DJWA 1DF0B 4C0LA 2ISDA 3CLNA 5I8NA 2LHIA 3VROA 1KWOB 1ALWA 3FS7A 4PHKA 4XJKB 1ZFSA 1RFJA 2VRGA 1KQVA 1QJTA 3O6BA 3WHTB 1XFWO 2B1UA 4MZLA 1A03A 1TN4A 2I18A 2KSPA 4A4BA 4GUKA 3DVEA 1JUOA 1LA3A 1CLBA 1SCMB 3BYAA 1J55A 1IJ6A 1IQ5A 4QJ3B 2HQWA 2M7LA 3SJSA 1A29A 1KK7Z 2G2BA 2JPTA 2AUCA 2KNEA 2ZN8A 2BECA 2LMTA 1CDLA 1YUUA 4C0KA 4DCKA 3VRRA 1UURA 2M29A 3NSIA 4ZCVA 1ZACA 4HRGA 5PALA 1K9PA 2LC5A 1TCFA 3BOWB 1CFCA 1SKTA 2MHHA 3LK0A 2JQ6A 1MWNA 3O4YA 1UUSA 3BQ3A 1NCXA 4ZCUA 3VRQA 5CSIA 1BG1A 5CSFA 1WDCB 2BE4A 2EC6B 3AKBA 2BBNA 1B1GA 2KBIA 2LMUA 2LV7A 2KQYA 3I5GC 1YRUB 4YGDB 1UHKA 5KU1A 1UWOA 3EK4A 1AJ5A 2BL0C 4WRIA 1RROA 2E30A 1SL9A 1QIVA 1H8BA 1UHNA 1XK4A 2Y1NA 1N2DA 3BUWB 3KO0A 1XYDA 4GGNA 1KK8B 2KBMA 4N5XA 3TUYB 2QACA 2WORA 1LA0A 1AP4A 1BLQA 2JT0A 2KI4B 2L51A 3CTNA 1EG3A 1SL7A 2BKIB 1FPWA 2JT3A 4CLNA 5I2LA 4YI9A 2NXQA 1V1FA 2H2KA 1K93D 3SG5A 1KFXL 4F0ZB 1JBAA 1WY9A 2OS8B 4PDZA 1RECA 1YUTA 1OMRA 2JU0A 2L4HA 1NX0A 1QVIY 1KQMC 2K2AA 1KSMA 4HSZA 4OKHA 4PHMA 3LLEA 3K21A 1BU3A 4PE4A 1Y6WA 1N0YA 2JULA 1B8LA 1R2UA 1ZOTB 2BCBA 1NCZA 2KI6C 1NX1A 2RGIA 2CTNA 4NDBA 2I94A 2COLB 2K8MB 5HLOA 1LINA 1DVIA 2ZKMX 1CFPA 1N65A 1KQMB 1PRWA 2K7BA 3BXKA 1CDPA 1CM1A 4CPVA 4MLWA 1C07A 1YURA 5JOLA 1TRFA 1M63B 1QLKA 3A8RA 1KSOA 2Y5IA 3SIAA 5AFPA 2MBXA 4PCWA 1DT7B 1NX3A 1QVIZ 4ICBA 1V1GA 3SG4A 3I5FC 1F71A 4YGEB 2M49B 2O60A 1NIWA 4NQGA 1M46A 1TCOB 2KFHA 3PLFB 1EG4A 1AJ4A 4OV2A 2P6BB 1K8UA 4BY5A 3BOWA 1MXEA 2JTTA 1HT9A 4GGFA 3SG2A 2Y4QA 1MF8B 1K9KA 3SIBA 3ZWHA 1DTLA 2ZNDA 3FIAA 2AAOA 5FYXA 5HYDA 4I5LB 5HKYA 1JSAA 2JRFA 1SPYA 1CFFA 1UP5A 2BKHB 2DOQA 1CMGA 4IL1A 5J3XA 4E68A 4OR9B 1XFYO 1GGZA 1C7WA 1JC2A 2PRUA 3EK7A 3RM1A 1UHHA 2LUCA 3AAJA 3SG3A 2OTGC 1CMFA 1OSAA 2GGZA 1BODA 2KFFA 4MSPA 1YX8A 5I2OA 2HF5A 5DKQA 4P2YB 2KGRA 3LCPC 2BBMA 3RLZA 3CS1A 1OOJA 1YVLA 3NSLA 1A75A 1W7IB 1Q80A 1BR1B 1QTXA 1LXFC 1B7TZ 2NCOA 4QJ4B 1MQ1A 1X02A 2F2OA 1G4YR 2KAXA 1MXLC 2M8UA 2OTGB 2PVBA 2QPTA 4I5JA 1QV0A 1D1OA 2JXCA 1SYMA 3EK8A 3I5HC 3O2PA 1CDMA 2L98A 1XVJA 3CR5X 4C0JA 2LNKA 5B8IB 2JTZA 2Q4UA 2ZN9A 1B9AA 1A2XA 2LP2A 1H4BA 2LVKA 1TNXA 2Y1MA 2LAPA 2A4JA 4YGCB 2NLNA 5D69A 2BE6A 1IWQA 3JVTC 2E6WA 2KYCA 4MEWA 1UHIA 3SG6A 3VGOA 1U5IB 1Y0VH 1CTRA 1CLLA 1F8HA 1B4CA 1ZUZA 2KAYA 1EJ3A 1K2HA 1A4PA 2ZRTA 2JZIA 1AUIB 2KAVA 3OP0A 3EVVA 3TS5C 1QV1A 4WQ3A 1CKKA 2OPOA 4MBEA 1JF0A 4YBHB 3OB1B 1AK8A 4GFTA 1DJZA 4ORCB 2H61A 1K94A 5AERA 1XFXO 3I5GB 4FQOA 1KFUS 1K90D 1MR8A 3LK1A 4YI8A 2MA2A 4OCIA 1TTXA 1DJGA 1B47A 1ALVA 3FWCA 1IGVA 1WRKA 2BL0B 2JT8A 3PN7C 4GAOA 4YRUA 1PVBA 1F55A 1J7RA 2M9GA 3OX6A 3TS5B 1BMOA 1DJIA 1ODBA 2NCPA 3F45A 4PE7A 2K7CA 3I5IC 4MZJA 2L5XB 2K7OA 2ZFDA 2MJWB 2LANA 1OMDA 2LVIA 4U8DA 5D7FA 4BY4A 1F70A 3D10A 1DF0A 5CSJA 1DGVA 2F2PA 2GV5A 1ZMZA 2PMYA 2JOJA 2MRDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MZK A;  1M45 A;  2K7D A;  2WC8 A;  3KF9 A;  2KHN A;  2LCP A;  2SAS A;  1NSH A;  4XJK A;  1DGU A;  4HRH A;  4D1E A;  1DMO A;  4MVF A;  2M0R A;  4MRY A;  1IH0 A;  2JWW A;  3IQQ A;  3EVR A;  1WRL A;  3CR2 A;  3HX4 A;  4I5K A;  1GGW A;  1SRA A;  3FWB A;  2LE9 B;  4P5O E;  1XK4 C;  1JFK A;  1L2O B;  2F3Y A;  4DUQ A;  2HQ8 A;  1XO5 A;  3GK4 X;  1CDN A;  2LVV A;  1MHO A;  1XFU O;  2L2E A;  1NPQ A;  1Y1A A;  3OB2 B;  3D0Y B;  4DS7 A;  1IKU A;  1TNW A;  1YR5 A;  4JPZ B;  3E3R A;  4MRX A;  1WLZ A;  1G33 A;  1WRZ A;  2R2I A;  3EKH A;  5KTY A;  1J1E A;  1SW8 A;  1JF2 A;  1EH2 A;  3DVM A;  3EVU A;  4N1F A;  4PE0 A;  1PVA A;  4AOM A;  2M3W A;  1WLM A;  2LLS A;  1SL8 A;  2CBL A;  3DF0 B;  3I5F B;  2L0P A;  5KSZ A;  1TOP A;  1DJH A;  5BPJ A;  2BCA A;  1U5I A;  2I2R E;  1BOC A;  5I2Q A;  3TDI A;  4ORA B;  2JNF A;  4JWQ A;  3ICB A;  4M2P A;  1QX2 A;  3EKJ A;  4PE1 A;  3CGA A;  1L7Z A;  1PSB A;  4N1G A;  2WCF A;  4USL A;  4WQ2 A;  4FTG A;  1KWO C;  4YGA A;  3C1V A;  3TZ1 A;  1UHJ A;  4TNC A;  4OVN F;  1S1E A;  1QS7 A;  2BCX A;  2CT9 A;  3AKA A;  1FW4 A;  2LHL A;  2LUX A;  2L50 A;  4NDC A;  4CID A;  3GK2 A;  3DVK A;  1CM4 A;  2JC2 A;  5HKZ A;  2EHB A;  1S26 D;  1W7J B;  3KHE A;  3SG7 A;  2WND A;  1SCM C;  2K2F A;  1SY9 A;  2V53 A;  3PFV A;  1YUS A;  1PK0 D;  3BUX B;  1NUB A;  4A4C A;  1J1D A;  1KFX S;  5TNC A;  1YVH A;  2CNP A;  1IQ3 A;  1E8A A;  2LLT A;  1AVS A;  3CZT X;  5IBW A;  1PUL A;  1FI5 A;  2CCM A;  1YTZ C;  2G9B A;  1GQM A;  2PAS A;  2KGB C;  3CR4 X;  2KOT A;  1YX7 A;  1PSR A;  3AAK A;  1FBV A;  1IG5 A;  1Y1X A;  1SK6 D;  2KYF A;  2AMI A;  3OX5 A;  4GGF C;  2FCE A;  3A4U B;  1WDC C;  1K95 A;  2EC6 C;  2FOT A;  1M31 A;  4MN0 A;  5F6T A;  2M1U A;  3NSO A;  2ZRS A;  3TDU A;  1DJY A;  3O78 A;  2I7A A;  1B8C A;  1EL4 A;  2K0J A;  2D8N A;  3I5H B;  5AAN A;  4AQJ A;  4L9M A;  1R6P A;  1SMG A;  2WCE A;  1EXR A;  2JXL A;  1LKJ A;  2F3Z A;  3LL8 B;  3JVT B;  1KK8 C;  1OE9 B;  1SBJ A;  1TNQ A;  2F33 A;  3TUY C;  2MLE C;  2KI4 C;  3PAT A;  2KDH A;  3D0Y A;  4Q04 A;  3KPX A;  3WXA A;  5CSN A;  1XFZ O;  2K61 A;  1CLM A;  1NP8 A;  4PHJ A;  4HRE E;  2LP3 A;  3VRN A;  4DIR A;  1K9U A;  3GK1 A;  1TIZ A;  1JWD A;  2OS8 C;  4DRW A;  4ETO A;  1B8R A;  1XA5 A;  2GGM A;  4QJ5 B;  1YRT B;  1CFD A;  3DF0 A;  4NDD A;  1RK9 A;  4PHN A;  2LM5 A;  1TNP A;  3NXA A;  4CFQ A;  2KQ6 A;  2Q91 A;  3IQO A;  1NWD A;  2LMV A;  3DVJ A;  2CXJ A;  5JJG A;  2M7N A;  5DKR A;  1F54 A;  2EGD A;  2FCD A;  4GPL B;  5ER4 X;  2MAZ A;  1A75 B;  1OQP A;  3PN7 B;  4XYN A;  1GJY A;  4CFR A;  2PSR A;  4PAL A;  2LLU A;  4UPG A;  1OZS A;  1S6I A;  3WNX B;  4GNK B;  2M1K B;  2WOS A;  1QAS A;  1F4O A;  2JNX A;  2KFG A;  3KEV A;  3WHU B;  2HPS A;  1S5G Y;  2TN4 A;  5HKW A;  1DJX A;  3I5I B;  2NZ0 A;  1KCY A;  1XFV O;  5DKN A;  1NYA A;  1K96 A;  1RTP 1;  4I5N B;  1C7V A;  3NSK A;  1JFJ A;  1QIW A;  5HLV A;  3PM8 A;  1CB1 A;  1SCV A;  2M97 A;  2FJU B;  3JTD C;  4JQ0 D;  3OHM B;  1J7P A;  1QAT A;  2F8P A;  2L4I A;  5ER5 A;  1CNP A;  3GOF A;  2H61 C;  4R1E A;  4M2Q A;  5G08 A;  1MUX A;  1FF1 A;  1SR6 C;  3TDZ A;  5CPV A;  5K89 A;  1SNL A;  4YGB B;  1F4Q A;  2KI6 D;  3QRX A;  1QXP A;  2SCP A;  1QX7 A;  1J7Q A;  1BJF A;  2IS9 A;  3VRP A;  3CWG A;  1S6C A;  1BF5 A;  3BUO B;  3M0W A;  1NX2 A;  3JTD B;  1S5G Z;  1RWY A;  3IF7 A;  1LVC D;  2ZNE A;  3DD4 A;  1G8I A;  1OZO A;  1KFU L;  1RJV A;  1BT6 A;  1OMV A;  4GBA A;  5AXI A;  1Y1U A;  1J7O A;  1L2O C;  1IJ5 A;  1M39 A;  1NCY A;  1SR6 B;  3MSE B;  1QLS A;  2MLF C;  3HCM A;  3H4S E;  1VRK A;  5GQQ C;  2O5G A;  1QX5 B;  1HQV A;  3PAL A;  3PSR A;  4ORB B;  1KK7 Y;  3BUM B;  1PAL A;  1FI6 A;  2PAL A;  1BR4 B;  1S36 A;  1S3P A;  2HET A;  2WCB A;  3BUN B;  2LVJ A;  1B7T Y;  1AHR A;  1IRJ A;  3ZNI A;  5AEQ A;  1S6J A;  4M2O A;  4AQI A;  1DJW A;  1DF0 B;  4C0L A;  2ISD A;  3CLN A;  5I8N A;  2LHI A;  3VRO A;  1KWO B;  1ALW A;  3FS7 A;  4PHK A;  4XJK B;  1ZFS A;  1RFJ A;  2VRG A;  1KQV A;  1QJT A;  3O6B A;  3WHT B;  1XFW O;  2B1U A;  4MZL A;  1A03 A;  1TN4 A;  2I18 A;  2KSP A;  4A4B A;  4GUK A;  3DVE A;  1JUO A;  1LA3 A;  1CLB A;  1SCM B;  3BYA A;  1J55 A;  1IJ6 A;  1IQ5 A;  4QJ3 B;  2HQW A;  2M7L A;  3SJS A;  1A29 A;  1KK7 Z;  2G2B A;  2JPT A;  2AUC A;  2KNE A;  2ZN8 A;  2BEC A;  2LMT A;  1CDL A;  1YUU A;  4C0K A;  4DCK A;  3VRR A;  1UUR A;  2M29 A;  3NSI A;  4ZCV A;  1ZAC A;  4HRG A;  5PAL A;  1K9P A;  2LC5 A;  1TCF A;  3BOW B;  1CFC A;  1SKT A;  2MHH A;  3LK0 A;  2JQ6 A;  1MWN A;  3O4Y A;  1UUS A;  3BQ3 A;  1NCX A;  4ZCU A;  3VRQ A;  5CSI A;  1BG1 A;  5CSF A;  1WDC B;  2BE4 A;  2EC6 B;  3AKB A;  2BBN A;  1B1G A;  2KBI A;  2LMU A;  2LV7 A;  2KQY A;  3I5G C;  1YRU B;  4YGD B;  1UHK A;  5KU1 A;  1UWO A;  3EK4 A;  1AJ5 A;  2BL0 C;  4WRI A;  1RRO A;  2E30 A;  1SL9 A;  1QIV A;  1H8B A;  1UHN A;  1XK4 A;  2Y1N A;  1N2D A;  3BUW B;  3KO0 A;  1XYD A;  4GGN A;  1KK8 B;  2KBM A;  4N5X A;  3TUY B;  2QAC A;  2WOR A;  1LA0 A;  1AP4 A;  1BLQ A;  2JT0 A;  2KI4 B;  2L51 A;  3CTN A;  1EG3 A;  1SL7 A;  2BKI B;  1FPW A;  2JT3 A;  4CLN A;  5I2L A;  4YI9 A;  2NXQ A;  1V1F A;  2H2K A;  1K93 D;  3SG5 A;  1KFX L;  4F0Z B;  1JBA A;  1WY9 A;  2OS8 B;  4PDZ A;  1REC A;  1YUT A;  1OMR A;  2JU0 A;  2L4H A;  1NX0 A;  1QVI Y;  1KQM C;  2K2A A;  1KSM A;  4HSZ A;  4OKH A;  4PHM A;  3LLE A;  3K21 A;  1BU3 A;  4PE4 A;  1Y6W A;  1N0Y A;  2JUL A;  1B8L A;  1R2U A;  1ZOT B;  2BCB A;  1NCZ A;  2KI6 C;  1NX1 A;  2RGI A;  2CTN A;  4NDB A;  2I94 A;  2COL B;  2K8M B;  5HLO A;  1LIN A;  1DVI A;  2ZKM X;  1CFP A;  1N65 A;  1KQM B;  1PRW A;  2K7B A;  3BXK A;  1CDP A;  1CM1 A;  4CPV A;  4MLW A;  1C07 A;  1YUR A;  5JOL A;  1TRF A;  1M63 B;  1QLK A;  3A8R A;  1KSO A;  2Y5I A;  3SIA A;  5AFP A;  2MBX A;  4PCW A;  1DT7 B;  1NX3 A;  1QVI Z;  4ICB A;  1V1G A;  3SG4 A;  3I5F C;  1F71 A;  4YGE B;  2M49 B;  2O60 A;  1NIW A;  4NQG A;  1M46 A;  1TCO B;  2KFH A;  3PLF B;  1EG4 A;  1AJ4 A;  4OV2 A;  2P6B B;  1K8U A;  4BY5 A;  3BOW A;  1MXE A;  2JTT A;  1HT9 A;  4GGF A;  3SG2 A;  2Y4Q A;  1MF8 B;  1K9K A;  3SIB A;  3ZWH A;  1DTL A;  2ZND A;  3FIA A;  2AAO A;  5FYX A;  5HYD A;  4I5L B;  5HKY A;  1JSA A;  2JRF A;  1SPY A;  1CFF A;  1UP5 A;  2BKH B;  2DOQ A;  1CMG A;  4IL1 A;  5J3X A;  4E68 A;  4OR9 B;  1XFY O;  1GGZ A;  1C7W A;  1JC2 A;  2PRU A;  3EK7 A;  3RM1 A;  1UHH A;  2LUC A;  3AAJ A;  3SG3 A;  2OTG C;  1CMF A;  1OSA A;  2GGZ A;  1BOD A;  2KFF A;  4MSP A;  1YX8 A;  5I2O A;  2HF5 A;  5DKQ A;  4P2Y B;  2KGR A;  3LCP C;  2BBM A;  3RLZ A;  3CS1 A;  1OOJ A;  1YVL A;  3NSL A;  1A75 A;  1W7I B;  1Q80 A;  1BR1 B;  1QTX A;  1LXF C;  1B7T Z;  2NCO A;  4QJ4 B;  1MQ1 A;  1X02 A;  2F2O A;  1G4Y R;  2KAX A;  1MXL C;  2M8U A;  2OTG B;  2PVB A;  2QPT A;  4I5J A;  1QV0 A;  1D1O A;  2JXC A;  1SYM A;  3EK8 A;  3I5H C;  3O2P A;  1CDM A;  2L98 A;  1XVJ A;  3CR5 X;  4C0J A;  2LNK A;  5B8I B;  2JTZ A;  2Q4U A;  2ZN9 A;  1B9A A;  1A2X A;  2LP2 A;  1H4B A;  2LVK A;  1TNX A;  2Y1M A;  2LAP A;  2A4J A;  4YGC B;  2NLN A;  5D69 A;  2BE6 A;  1IWQ A;  3JVT C;  2E6W A;  2KYC A;  4MEW A;  1UHI A;  3SG6 A;  3VGO A;  1U5I B;  1Y0V H;  1CTR A;  1CLL A;  1F8H A;  1B4C A;  1ZUZ A;  2KAY A;  1EJ3 A;  1K2H A;  1A4P A;  2ZRT A;  2JZI A;  1AUI B;  2KAV A;  3OP0 A;  3EVV A;  3TS5 C;  1QV1 A;  4WQ3 A;  1CKK A;  2OPO A;  4MBE A;  1JF0 A;  4YBH B;  3OB1 B;  1AK8 A;  4GFT A;  1DJZ A;  4ORC B;  2H61 A;  1K94 A;  5AER A;  1XFX O;  3I5G B;  4FQO A;  1KFU S;  1K90 D;  1MR8 A;  3LK1 A;  4YI8 A;  2MA2 A;  4OCI A;  1TTX A;  1DJG A;  1B47 A;  1ALV A;  3FWC A;  1IGV A;  1WRK A;  2BL0 B;  2JT8 A;  3PN7 C;  4GAO A;  4YRU A;  1PVB A;  1F55 A;  1J7R A;  2M9G A;  3OX6 A;  3TS5 B;  1BMO A;  1DJI A;  1ODB A;  2NCP A;  3F45 A;  4PE7 A;  2K7C A;  3I5I C;  4MZJ A;  2L5X B;  2K7O A;  2ZFD A;  2MJW B;  2LAN A;  1OMD A;  2LVI A;  4U8D A;  5D7F A;  4BY4 A;  1F70 A;  3D10 A;  1DF0 A;  5CSJ A;  1DGV A;  2F2P A;  2GV5 A;  1ZMZ A;  2PMY A;  2JOJ A;  2MRD A; 
#chains in the Genus database with same CATH topology
 4MZK A;  2KLE A;  1M45 A;  2K7D A;  2PYQ A;  2WC8 A;  2KHN A;  2LCP A;  3KF9 A;  2SAS A;  1NSH A;  4XJK A;  1DGU A;  2QEV A;  4HRH A;  4D1E A;  1DMO A;  4MVF A;  3S0G A;  2M0R A;  4MRY A;  1IH0 A;  2JWW A;  3IQQ A;  3EVR A;  1WRL A;  3CR2 A;  3HX4 A;  4I5K A;  1GGW A;  1SRA A;  3FWB A;  2LE9 B;  4P5O E;  1XK4 C;  1JFK A;  1L2O B;  2F3Y A;  4DUQ A;  2HQ8 A;  1XO5 A;  2K60 A;  3GK4 X;  5HL1 A;  1CDN A;  2LVV A;  1MHO A;  1XFU O;  2L2E A;  1NPQ A;  1Y1A A;  3OB2 B;  3D0Y B;  4DS7 A;  1IKU A;  1TNW A;  3S0A A;  1YR5 A;  2L5Y A;  4JPZ B;  3E3R A;  4MRX A;  1WLZ A;  1G33 A;  1WRZ A;  2R2I A;  3EKH A;  5KTY A;  1J1E A;  1SW8 A;  3CDN A;  1JF2 A;  3UO9 A;  1EH2 A;  3DVM A;  3EVU A;  4N1F A;  4PE0 A;  1PVA A;  4AOM A;  2M3W A;  1WLM A;  2LLS A;  1SL8 A;  2CBL A;  3DF0 B;  3I5F B;  2L0P A;  5FI7 A;  5KSZ A;  1TOP A;  3BFA A;  1DJH A;  5BPJ A;  2BCA A;  3CZ1 A;  1U5I A;  3S0D A;  2I2R E;  3L47 A;  1BOC A;  5I2Q A;  1Z4H A;  3TDI A;  4ORA B;  3B87 A;  2ERB A;  2JNF A;  4JWQ A;  3ICB A;  4M2P A;  1QX2 A;  1P28 A;  3EKJ A;  4PE1 A;  3CGA A;  1L7Z A;  1PSB A;  4N1G A;  2WCF A;  4USL A;  4WQ2 A;  4FTG A;  1KWO C;  4YGA A;  3C1V A;  3TZ1 A;  1UHJ A;  4TNC A;  3IVT A;  4OVN F;  1S1E A;  3V2L A;  1QS7 A;  2BCX A;  2CT9 A;  3AKA A;  1FW4 A;  2LHL A;  2LUX A;  3SS3 A;  2L50 A;  4NDC A;  3B7A A;  3RZS A;  4CID A;  3GK2 A;  3DVK A;  2WCL A;  1CM4 A;  2JC2 A;  5HKZ A;  2EHB A;  1S26 D;  1W7J B;  3KHE A;  2JPO A;  3SG7 A;  2WND A;  1SCM C;  2K2F A;  1SY9 A;  2WC6 A;  2V53 A;  3D75 A;  3DY9 A;  3PFV A;  1YUS A;  1PK0 D;  3BUX B;  3PM2 A;  1NUB A;  4A4C A;  1J1D A;  1KFX S;  5TNC A;  1YVH A;  2CNP A;  1IQ3 A;  1E8A A;  2LLT A;  3NGV A;  1AVS A;  3CZT X;  5IBW A;  1PUL A;  1FI5 A;  2CCM A;  1YTZ C;  2G9B A;  1GQM A;  2PAS A;  2KGB C;  3CR4 X;  2KOT A;  1YX7 A;  1PSR A;  3AAK A;  1FBV A;  1IG5 A;  1Y1X A;  1SK6 D;  2KYF A;  4JKT A;  2AMI A;  3O4X A;  3OX5 A;  4GGF C;  2FCE A;  3A4U B;  1WDC C;  1K95 A;  2EC6 C;  2BNX A;  2FOT A;  1M31 A;  3S0B A;  4MN0 A;  1TWO A;  5F6T A;  2M1U A;  3NSO A;  2ZRS A;  1TUJ A;  3TDU A;  1QWV A;  1DJY A;  3O78 A;  2I7A A;  1B8C A;  1EL4 A;  2K0J A;  2D8N A;  3I5H B;  5AAN A;  4AQJ A;  4L9M A;  1R6P A;  1SMG A;  2WCE A;  2H8V A;  1EXR A;  2JXL A;  2WCH A;  1LKJ A;  2F3Z A;  3LL8 B;  3JVT B;  1KK8 C;  3NHI A;  1OE9 B;  1SBJ A;  1TNQ A;  2F33 A;  3TUY C;  2MLE C;  2KI4 C;  3PAT A;  2KDH A;  3D0Y A;  4Q04 A;  3KPX A;  3WXA A;  5CSN A;  1XFZ O;  2K61 A;  1CLM A;  1NP8 A;  4IJ7 A;  4HRE E;  2LP3 A;  4PHJ A;  3VRN A;  1K9U A;  3GK1 A;  4DIR A;  1TIZ A;  1JWD A;  2OS8 C;  4DRW A;  4ETO A;  1B8R A;  1XA5 A;  2GGM A;  4QJ5 B;  1YRT B;  1CFD A;  3DF0 A;  4NDD A;  1DEK A;  1RK9 A;  4PHN A;  2LM5 A;  1TNP A;  3NXA A;  4CFQ A;  2KQ6 A;  2Q91 A;  3B6X A;  3IQO A;  1NWD A;  2LMV A;  3DVJ A;  2CXJ A;  3OBV A;  5JJG A;  2M7N A;  1SSE B;  5DKR A;  1F54 A;  2EGD A;  2FCD A;  4GPL B;  1IIO A;  5ER4 X;  2MAZ A;  1A75 B;  1OQP A;  3PN7 B;  4XYN A;  1GJY A;  4CFR A;  2PSR A;  3DXL A;  2LLU A;  4PAL A;  4UPG A;  1OZS A;  1S6I A;  3WNX B;  4GNK B;  2M1K B;  2WOS A;  1QAS A;  1F4O A;  2JNX A;  2KFG A;  3KEV A;  4KYN A;  2HPS A;  1S5G Y;  2TN4 A;  5HKW A;  1DJX A;  3I5I B;  2NZ0 A;  3Q8I A;  1XFV O;  5DKN A;  1NYA A;  1KCY A;  1K96 A;  2KLD A;  1RTP 1;  4I5N B;  1C7V A;  3NSK A;  1JFJ A;  1QIW A;  3D76 A;  3PM8 A;  5HLV A;  1SCV A;  1CB1 A;  2M97 A;  2FJU B;  3JTD C;  3WHU B;  4JQ0 D;  3OHM B;  1J7P A;  1QAT A;  2F8P A;  2L4I A;  5ER5 A;  1XFR A;  2P71 A;  1OOF A;  2P70 A;  1CNP A;  3GOF A;  5FI2 A;  2H61 C;  4R1E A;  4M2Q A;  1Z2C B;  5G08 A;  1MUX A;  1FF1 A;  1SR6 C;  4JD9 A;  3TDZ A;  5CPV A;  5K89 A;  1SNL A;  2QEB A;  4YGB B;  1F4Q A;  2KI6 D;  3QRX A;  1QXP A;  2KPH A;  1QX7 A;  2SCP A;  1BJF A;  2IS9 A;  3BFB A;  3VRP A;  3CWG A;  1S6C A;  1BF5 A;  1J7Q A;  3BUO B;  3M0W A;  1NX2 A;  3JTD B;  1S5G Z;  1C3Z A;  1RWY A;  2YGU A;  1LVC D;  3IF7 A;  2ZNE A;  3DD4 A;  4PT1 A;  3BJH A;  1G8I A;  1OZO A;  4F7F A;  1KFU L;  1RJV A;  1BT6 A;  1OMV A;  4GBA A;  5AXI A;  1Y1U A;  1J7O A;  1L2O C;  1IJ5 A;  1M39 A;  1NCY A;  1SR6 B;  3MSE B;  1QLS A;  2MLF C;  3HCM A;  3H4S E;  3D73 A;  1VRK A;  5GQQ C;  2O5G A;  3BFH A;  5EL2 A;  1QX5 B;  1HQV A;  3D77 A;  3PAL A;  3PSR A;  1KK7 Y;  3BUM B;  1PAL A;  4ORB B;  2PAL A;  1BR4 B;  1S36 A;  1S3P A;  3SS4 A;  1FI6 A;  2HET A;  2WCB A;  3BUN B;  2LVJ A;  1B7T Y;  1AHR A;  1IRJ A;  3ZNI A;  5AEQ A;  1S6J A;  4M2O A;  4AQI A;  1DJW A;  1DF0 B;  4C0L A;  2ISD A;  3CLN A;  5I8N A;  2LHI A;  3VRO A;  1KWO B;  1ALW A;  3FS7 A;  4OZD A;  5FI6 A;  4PHK A;  3DZT A;  4XJK B;  1ZFS A;  1RFJ A;  2VRG A;  1KQV A;  1QJT A;  3L4L A;  3O6B A;  3WHT B;  1XFW O;  2B1U A;  4MZL A;  1A03 A;  1TN4 A;  2I18 A;  2KSP A;  4A4B A;  2WC5 A;  4GUK A;  3DVE A;  1JUO A;  1LA3 A;  1CLB A;  1SCM B;  3BYA A;  1J55 A;  1IJ6 A;  1IQ5 A;  4QJ3 B;  2HQW A;  2M7L A;  3SJS A;  1A29 A;  1KK7 Z;  2G2B A;  2JPT A;  2AUC A;  2KNE A;  2ZN8 A;  2BEC A;  2LMT A;  1CDL A;  1YUU A;  4C0K A;  4DCK A;  3VRR A;  1UUR A;  2M29 A;  3CYZ A;  3NSI A;  3CZ2 A;  4ZCV A;  1ZAC A;  4HRG A;  5DIC A;  5PAL A;  1K9P A;  1OOI X;  2LC5 A;  1TCF A;  3BOW B;  1CFC A;  1SKT A;  2MHH A;  1ORG A;  3LK0 A;  2JQ6 A;  1MWN A;  3O4Y A;  1UUS A;  3BQ3 A;  1NCX A;  4ZCU A;  3VRQ A;  5CSI A;  1BG1 A;  5CSF A;  1WDC B;  1GM0 A;  2BE4 A;  2EC6 B;  2WCK A;  3AKB A;  2BBN A;  1B1G A;  2KBI A;  2LMU A;  2LV7 A;  2KQY A;  3CZ0 A;  3I5G C;  1YRU B;  1LS8 A;  1C3Y A;  4YGD B;  1UHK A;  3CAB A;  1UWO A;  3EK4 A;  5KU1 A;  1AJ5 A;  2BL0 C;  3VB1 A;  4WRI A;  1RRO A;  2E30 A;  1SL9 A;  1QIV A;  1H8B A;  1UHN A;  1XK4 A;  2Y1N A;  1N2D A;  3BUW B;  3OGN A;  4FQT A;  2BAP A;  3KO0 A;  1XYD A;  4GGN A;  1KK8 B;  2KBM A;  3FE9 A;  4N5X A;  3TUY B;  2QAC A;  2WOR A;  1LA0 A;  1AP4 A;  1BLQ A;  2JT0 A;  2KI4 B;  3R1P A;  2L51 A;  3CTN A;  1EG3 A;  1SL7 A;  2BKI B;  1FPW A;  2JT3 A;  3EG5 B;  3NHT A;  4CLN A;  5I2L A;  4YI9 A;  2NXQ A;  1OOH A;  1V1F A;  2H2K A;  1K93 D;  3SG5 A;  1KFX L;  2QDI A;  4F0Z B;  1JBA A;  1WY9 A;  2OS8 B;  4PDZ A;  1REC A;  1YUT A;  1OMR A;  2JU0 A;  2L4H A;  1NX0 A;  1QVI Y;  1KQM C;  2K2A A;  1KSM A;  4HSZ A;  1W9Z A;  4OKH A;  3LLE A;  4PHM A;  3K21 A;  1BU3 A;  4PE4 A;  1Y6W A;  1N0Y A;  2JUL A;  2PQL A;  1B8L A;  1R2U A;  3S0F A;  1ZOT B;  2BCB A;  1NCZ A;  2KI6 C;  1NX1 A;  2RGI A;  2CTN A;  2L2C A;  4NDB A;  3SS5 A;  2I94 A;  2COL B;  2K8M B;  5HLO A;  1LIN A;  1DVI A;  3FE6 A;  2ZKM X;  1CFP A;  1N65 A;  1KQM B;  3QME A;  1PRW A;  2K7B A;  3BXK A;  1CDP A;  1CM1 A;  4CPV A;  4MLW A;  1C07 A;  1YUR A;  5JOL A;  1TRF A;  1M63 B;  1QLK A;  3A8R A;  1KSO A;  2Y5I A;  3SIA A;  5AFP A;  2MBX A;  4PCW A;  1DT7 B;  1NX3 A;  1QVI Z;  4ICB A;  1V1G A;  3SG4 A;  3I5F C;  1F71 A;  4YGE B;  2M49 B;  2O60 A;  1NIW A;  4NQG A;  1M46 A;  1TCO B;  2KFH A;  3PLF B;  1EG4 A;  3R72 A;  1AJ4 A;  2WCM A;  4OV2 A;  2P6B B;  1K8U A;  4BY5 A;  3BOW A;  1MXE A;  2JTT A;  1HT9 A;  3B88 A;  3R1V A;  4GGF A;  3SG2 A;  2Y4Q A;  1MF8 B;  1K9K A;  1TUZ A;  3SIB A;  3ZWH A;  1DTL A;  2FJY A;  2ZND A;  3FIA A;  2AAO A;  5FYX A;  5HYD A;  4I5L B;  5HKY A;  1JSA A;  2JRF A;  1SPY A;  1CFF A;  1UP5 A;  2BKH B;  2DOQ A;  1CMG A;  4IL1 A;  5J3X A;  4E68 A;  4OR9 B;  1XFY O;  1GGZ A;  1OOG A;  1C7W A;  1JC2 A;  2PRU A;  3EK7 A;  3RM1 A;  5D3O A;  1DEL A;  1UHH A;  2LUC A;  3AAJ A;  3SG3 A;  3K1E A;  2OTG C;  1CMF A;  3UNW A;  1OSA A;  2GGZ A;  1BOD A;  2KFF A;  4MSP A;  1YX8 A;  5I2O A;  2HF5 A;  5DKQ A;  4P2Y B;  2KGR A;  3LCP C;  2BBM A;  3RLZ A;  3CS1 A;  1DQE A;  1OOJ A;  1YVL A;  3NSL A;  4INX A;  1A75 A;  1W7I B;  1Q80 A;  3N7H A;  1BR1 B;  1QTX A;  3D78 A;  1LXF C;  1B7T Z;  2NCO A;  4QJ4 B;  1MQ1 A;  1X02 A;  2F2O A;  1G4Y R;  2KAX A;  1MXL C;  2M8U A;  2OTG B;  2PVB A;  2QPT A;  3FE8 A;  1QV0 A;  2GTE A;  4I5J A;  1D1O A;  2JXC A;  1SYM A;  2WCJ A;  3S0E A;  3EK8 A;  3I5H C;  3O2P A;  1CDM A;  2L98 A;  1XVJ A;  3CR5 X;  4C0J A;  2LNK A;  5B8I B;  2JTZ A;  2Q4U A;  2ZN9 A;  1B9A A;  1A2X A;  2LP2 A;  1H4B A;  2LVK A;  1TNX A;  2Y1M A;  2LAP A;  2A4J A;  4YGC B;  2NLN A;  5D69 A;  2BE6 A;  1IWQ A;  3JVT C;  2E6W A;  2KYC A;  4MEW A;  1UHI A;  3SG6 A;  3VGO A;  1U5I B;  3DYE A;  5I94 A;  1Y0V H;  1CTR A;  1CLL A;  1F8H A;  1B4C A;  1ZUZ A;  2KAY A;  1EJ3 A;  4INW A;  1K2H A;  1A4P A;  2ZRT A;  2JZI A;  1AUI B;  2KAV A;  3OP0 A;  3EVV A;  3TS5 C;  1QV1 A;  4WQ3 A;  1CKK A;  2OPO A;  4MBE A;  1JF0 A;  2QEH A;  4YBH B;  3OB1 B;  1T14 A;  1AK8 A;  2QEO A;  4GFT A;  1DJZ A;  4ORC B;  2H61 A;  1K94 A;  5AER A;  1XFX O;  3I5G B;  4FQO A;  1KFU S;  1K90 D;  1MR8 A;  3LK1 A;  3PJI A;  4YI8 A;  2MA2 A;  4OCI A;  1TTX A;  1DJG A;  1B47 A;  3B86 A;  1ALV A;  3FWC A;  1IGV A;  1WRK A;  2BL0 B;  2JT8 A;  3PN7 C;  3R1O A;  4GAO A;  4YRU A;  1PVB A;  1F55 A;  1J7R A;  2M9G A;  3OX6 A;  3TS5 B;  1BMO A;  1DJI A;  1ODB A;  2NCP A;  3F45 A;  1OW4 A;  4PE7 A;  2K7C A;  1DC1 A;  3I5I C;  4MZJ A;  2L5X B;  2K7O A;  2ZFD A;  2MJW B;  2LAN A;  1OMD A;  2LVI A;  4U8D A;  5D7F A;  4BY4 A;  3D74 A;  1F70 A;  3D10 A;  3L4A A;  1DF0 A;  5CSJ A;  1DGV A;  2F2P A;  2GV5 A;  1ZMZ A;  2PMY A;  2JOJ A;  2MRD A; 
#chains in the Genus database with same CATH homology
 4MZK A;  1M45 A;  2K7D A;  2WC8 A;  3KF9 A;  2KHN A;  2LCP A;  2SAS A;  1NSH A;  4XJK A;  1DGU A;  4HRH A;  4D1E A;  1DMO A;  4MVF A;  2M0R A;  4MRY A;  1IH0 A;  2JWW A;  3IQQ A;  3EVR A;  1WRL A;  3CR2 A;  3HX4 A;  4I5K A;  1GGW A;  1SRA A;  3FWB A;  2LE9 B;  4P5O E;  1XK4 C;  1JFK A;  1L2O B;  2F3Y A;  4DUQ A;  2HQ8 A;  1XO5 A;  3GK4 X;  1CDN A;  2LVV A;  1MHO A;  1XFU O;  2L2E A;  1NPQ A;  1Y1A A;  3OB2 B;  3D0Y B;  4DS7 A;  1IKU A;  1TNW A;  1YR5 A;  4JPZ B;  3E3R A;  4MRX A;  1WLZ A;  1G33 A;  1WRZ A;  2R2I A;  3EKH A;  5KTY A;  1J1E A;  1SW8 A;  1JF2 A;  1EH2 A;  3DVM A;  3EVU A;  4N1F A;  4PE0 A;  1PVA A;  4AOM A;  2M3W A;  1WLM A;  2LLS A;  1SL8 A;  2CBL A;  3DF0 B;  3I5F B;  2L0P A;  5KSZ A;  1TOP A;  1DJH A;  5BPJ A;  2BCA A;  1U5I A;  2I2R E;  1BOC A;  5I2Q A;  3TDI A;  4ORA B;  2JNF A;  4JWQ A;  3ICB A;  4M2P A;  1QX2 A;  3EKJ A;  4PE1 A;  3CGA A;  1L7Z A;  1PSB A;  4N1G A;  2WCF A;  4USL A;  4WQ2 A;  4FTG A;  1KWO C;  4YGA A;  3C1V A;  3TZ1 A;  1UHJ A;  4TNC A;  4OVN F;  1S1E A;  1QS7 A;  2BCX A;  2CT9 A;  3AKA A;  1FW4 A;  2LHL A;  2LUX A;  2L50 A;  4NDC A;  4CID A;  3GK2 A;  3DVK A;  1CM4 A;  2JC2 A;  5HKZ A;  2EHB A;  1S26 D;  1W7J B;  3KHE A;  3SG7 A;  2WND A;  1SCM C;  2K2F A;  1SY9 A;  2V53 A;  3PFV A;  1YUS A;  1PK0 D;  3BUX B;  1NUB A;  4A4C A;  1J1D A;  1KFX S;  5TNC A;  1YVH A;  2CNP A;  1IQ3 A;  1E8A A;  2LLT A;  1AVS A;  3CZT X;  5IBW A;  1PUL A;  1FI5 A;  2CCM A;  1YTZ C;  2G9B A;  1GQM A;  2PAS A;  2KGB C;  3CR4 X;  2KOT A;  1YX7 A;  1PSR A;  3AAK A;  1FBV A;  1IG5 A;  1Y1X A;  1SK6 D;  2KYF A;  2AMI A;  3OX5 A;  4GGF C;  2FCE A;  3A4U B;  1WDC C;  1K95 A;  2EC6 C;  2FOT A;  1M31 A;  4MN0 A;  5F6T A;  2M1U A;  3NSO A;  2ZRS A;  3TDU A;  1DJY A;  3O78 A;  2I7A A;  1B8C A;  1EL4 A;  2K0J A;  2D8N A;  3I5H B;  5AAN A;  4AQJ A;  4L9M A;  1R6P A;  1SMG A;  2WCE A;  1EXR A;  2JXL A;  1LKJ A;  2F3Z A;  3LL8 B;  3JVT B;  1KK8 C;  1OE9 B;  1SBJ A;  1TNQ A;  2F33 A;  3TUY C;  2MLE C;  2KI4 C;  3PAT A;  2KDH A;  3D0Y A;  4Q04 A;  3KPX A;  3WXA A;  5CSN A;  1XFZ O;  2K61 A;  1CLM A;  1NP8 A;  4PHJ A;  4HRE E;  2LP3 A;  3VRN A;  4DIR A;  1K9U A;  3GK1 A;  1TIZ A;  1JWD A;  2OS8 C;  4DRW A;  4ETO A;  1B8R A;  1XA5 A;  2GGM A;  4QJ5 B;  1YRT B;  1CFD A;  3DF0 A;  4NDD A;  1RK9 A;  4PHN A;  2LM5 A;  1TNP A;  3NXA A;  4CFQ A;  2KQ6 A;  2Q91 A;  3IQO A;  1NWD A;  2LMV A;  3DVJ A;  2CXJ A;  5JJG A;  2M7N A;  5DKR A;  1F54 A;  2EGD A;  2FCD A;  4GPL B;  5ER4 X;  2MAZ A;  1A75 B;  1OQP A;  3PN7 B;  4XYN A;  1GJY A;  4CFR A;  2PSR A;  4PAL A;  2LLU A;  4UPG A;  1OZS A;  1S6I A;  3WNX B;  4GNK B;  2M1K B;  2WOS A;  1QAS A;  1F4O A;  2JNX A;  2KFG A;  3KEV A;  3WHU B;  2HPS A;  1S5G Y;  2TN4 A;  5HKW A;  1DJX A;  3I5I B;  2NZ0 A;  1KCY A;  1XFV O;  5DKN A;  1NYA A;  1K96 A;  1RTP 1;  4I5N B;  1C7V A;  3NSK A;  1JFJ A;  1QIW A;  5HLV A;  3PM8 A;  1CB1 A;  1SCV A;  2M97 A;  2FJU B;  3JTD C;  4JQ0 D;  3OHM B;  1J7P A;  1QAT A;  2F8P A;  2L4I A;  5ER5 A;  1CNP A;  3GOF A;  2H61 C;  4R1E A;  4M2Q A;  5G08 A;  1MUX A;  1FF1 A;  1SR6 C;  3TDZ A;  5CPV A;  5K89 A;  1SNL A;  4YGB B;  1F4Q A;  2KI6 D;  3QRX A;  1QXP A;  2SCP A;  1QX7 A;  1J7Q A;  1BJF A;  2IS9 A;  3VRP A;  3CWG A;  1S6C A;  1BF5 A;  3BUO B;  3M0W A;  1NX2 A;  3JTD B;  1S5G Z;  1RWY A;  3IF7 A;  1LVC D;  2ZNE A;  3DD4 A;  1G8I A;  1OZO A;  1KFU L;  1RJV A;  1BT6 A;  1OMV A;  4GBA A;  5AXI A;  1Y1U A;  1J7O A;  1L2O C;  1IJ5 A;  1M39 A;  1NCY A;  1SR6 B;  3MSE B;  1QLS A;  2MLF C;  3HCM A;  3H4S E;  1VRK A;  5GQQ C;  2O5G A;  1QX5 B;  1HQV A;  3PAL A;  3PSR A;  4ORB B;  1KK7 Y;  3BUM B;  1PAL A;  1FI6 A;  2PAL A;  1BR4 B;  1S36 A;  1S3P A;  2HET A;  2WCB A;  3BUN B;  2LVJ A;  1B7T Y;  1AHR A;  1IRJ A;  3ZNI A;  5AEQ A;  1S6J A;  4M2O A;  4AQI A;  1DJW A;  1DF0 B;  4C0L A;  2ISD A;  3CLN A;  5I8N A;  2LHI A;  3VRO A;  1KWO B;  1ALW A;  3FS7 A;  4PHK A;  4XJK B;  1ZFS A;  1RFJ A;  2VRG A;  1KQV A;  1QJT A;  3O6B A;  3WHT B;  1XFW O;  2B1U A;  4MZL A;  1A03 A;  1TN4 A;  2I18 A;  2KSP A;  4A4B A;  4GUK A;  3DVE A;  1JUO A;  1LA3 A;  1CLB A;  1SCM B;  3BYA A;  1J55 A;  1IJ6 A;  1IQ5 A;  4QJ3 B;  2HQW A;  2M7L A;  3SJS A;  1A29 A;  1KK7 Z;  2G2B A;  2JPT A;  2AUC A;  2KNE A;  2ZN8 A;  2BEC A;  2LMT A;  1CDL A;  1YUU A;  4C0K A;  4DCK A;  3VRR A;  1UUR A;  2M29 A;  3NSI A;  4ZCV A;  1ZAC A;  4HRG A;  5PAL A;  1K9P A;  2LC5 A;  1TCF A;  3BOW B;  1CFC A;  1SKT A;  2MHH A;  3LK0 A;  2JQ6 A;  1MWN A;  3O4Y A;  1UUS A;  3BQ3 A;  1NCX A;  4ZCU A;  3VRQ A;  5CSI A;  1BG1 A;  5CSF A;  1WDC B;  2BE4 A;  2EC6 B;  3AKB A;  2BBN A;  1B1G A;  2KBI A;  2LMU A;  2LV7 A;  2KQY A;  3I5G C;  1YRU B;  4YGD B;  1UHK A;  5KU1 A;  1UWO A;  3EK4 A;  1AJ5 A;  2BL0 C;  4WRI A;  1RRO A;  2E30 A;  1SL9 A;  1QIV A;  1H8B A;  1UHN A;  1XK4 A;  2Y1N A;  1N2D A;  3BUW B;  3KO0 A;  1XYD A;  4GGN A;  1KK8 B;  2KBM A;  4N5X A;  3TUY B;  2QAC A;  2WOR A;  1LA0 A;  1AP4 A;  1BLQ A;  2JT0 A;  2KI4 B;  2L51 A;  3CTN A;  1EG3 A;  1SL7 A;  2BKI B;  1FPW A;  2JT3 A;  4CLN A;  5I2L A;  4YI9 A;  2NXQ A;  1V1F A;  2H2K A;  1K93 D;  3SG5 A;  1KFX L;  4F0Z B;  1JBA A;  1WY9 A;  2OS8 B;  4PDZ A;  1REC A;  1YUT A;  1OMR A;  2JU0 A;  2L4H A;  1NX0 A;  1QVI Y;  1KQM C;  2K2A A;  1KSM A;  4HSZ A;  4OKH A;  4PHM A;  3LLE A;  3K21 A;  1BU3 A;  4PE4 A;  1Y6W A;  1N0Y A;  2JUL A;  1B8L A;  1R2U A;  1ZOT B;  2BCB A;  1NCZ A;  2KI6 C;  1NX1 A;  2RGI A;  2CTN A;  4NDB A;  2I94 A;  2COL B;  2K8M B;  5HLO A;  1LIN A;  1DVI A;  2ZKM X;  1CFP A;  1N65 A;  1KQM B;  1PRW A;  2K7B A;  3BXK A;  1CDP A;  1CM1 A;  4CPV A;  4MLW A;  1C07 A;  1YUR A;  5JOL A;  1TRF A;  1M63 B;  1QLK A;  3A8R A;  1KSO A;  2Y5I A;  3SIA A;  5AFP A;  2MBX A;  4PCW A;  1DT7 B;  1NX3 A;  1QVI Z;  4ICB A;  1V1G A;  3SG4 A;  3I5F C;  1F71 A;  4YGE B;  2M49 B;  2O60 A;  1NIW A;  4NQG A;  1M46 A;  1TCO B;  2KFH A;  3PLF B;  1EG4 A;  1AJ4 A;  4OV2 A;  2P6B B;  1K8U A;  4BY5 A;  3BOW A;  1MXE A;  2JTT A;  1HT9 A;  4GGF A;  3SG2 A;  2Y4Q A;  1MF8 B;  1K9K A;  3SIB A;  3ZWH A;  1DTL A;  2ZND A;  3FIA A;  2AAO A;  5FYX A;  5HYD A;  4I5L B;  5HKY A;  1JSA A;  2JRF A;  1SPY A;  1CFF A;  1UP5 A;  2BKH B;  2DOQ A;  1CMG A;  4IL1 A;  5J3X A;  4E68 A;  4OR9 B;  1XFY O;  1GGZ A;  1C7W A;  1JC2 A;  2PRU A;  3EK7 A;  3RM1 A;  1UHH A;  2LUC A;  3AAJ A;  3SG3 A;  2OTG C;  1CMF A;  1OSA A;  2GGZ A;  1BOD A;  2KFF A;  4MSP A;  1YX8 A;  5I2O A;  2HF5 A;  5DKQ A;  4P2Y B;  2KGR A;  3LCP C;  2BBM A;  3RLZ A;  3CS1 A;  1OOJ A;  1YVL A;  3NSL A;  1A75 A;  1W7I B;  1Q80 A;  1BR1 B;  1QTX A;  1LXF C;  1B7T Z;  2NCO A;  4QJ4 B;  1MQ1 A;  1X02 A;  2F2O A;  1G4Y R;  2KAX A;  1MXL C;  2M8U A;  2OTG B;  2PVB A;  2QPT A;  4I5J A;  1QV0 A;  1D1O A;  2JXC A;  1SYM A;  3EK8 A;  3I5H C;  3O2P A;  1CDM A;  2L98 A;  1XVJ A;  3CR5 X;  4C0J A;  2LNK A;  5B8I B;  2JTZ A;  2Q4U A;  2ZN9 A;  1B9A A;  1A2X A;  2LP2 A;  1H4B A;  2LVK A;  1TNX A;  2Y1M A;  2LAP A;  2A4J A;  4YGC B;  2NLN A;  5D69 A;  2BE6 A;  1IWQ A;  3JVT C;  2E6W A;  2KYC A;  4MEW A;  1UHI A;  3SG6 A;  3VGO A;  1U5I B;  1Y0V H;  1CTR A;  1CLL A;  1F8H A;  1B4C A;  1ZUZ A;  2KAY A;  1EJ3 A;  1K2H A;  1A4P A;  2ZRT A;  2JZI A;  1AUI B;  2KAV A;  3OP0 A;  3EVV A;  3TS5 C;  1QV1 A;  4WQ3 A;  1CKK A;  2OPO A;  4MBE A;  1JF0 A;  4YBH B;  3OB1 B;  1AK8 A;  4GFT A;  1DJZ A;  4ORC B;  2H61 A;  1K94 A;  5AER A;  1XFX O;  3I5G B;  4FQO A;  1KFU S;  1K90 D;  1MR8 A;  3LK1 A;  4YI8 A;  2MA2 A;  4OCI A;  1TTX A;  1DJG A;  1B47 A;  1ALV A;  3FWC A;  1IGV A;  1WRK A;  2BL0 B;  2JT8 A;  3PN7 C;  4GAO A;  4YRU A;  1PVB A;  1F55 A;  1J7R A;  2M9G A;  3OX6 A;  3TS5 B;  1BMO A;  1DJI A;  1ODB A;  2NCP A;  3F45 A;  4PE7 A;  2K7C A;  3I5I C;  4MZJ A;  2L5X B;  2K7O A;  2ZFD A;  2MJW B;  2LAN A;  1OMD A;  2LVI A;  4U8D A;  5D7F A;  4BY4 A;  1F70 A;  3D10 A;  1DF0 A;  5CSJ A;  1DGV A;  2F2P A;  2GV5 A;  1ZMZ A;  2PMY A;  2JOJ A;  2MRD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...