2MLEC

Nmr structure of the c-domain of troponin c bound to the anchoring region of troponin i
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
72
structure length
72
Chain Sequence
MGKSEEELSDLFRMFDKNADGYIDLDELKIMLQATGETITEDDIEELMKDGDKNNDGRIDYDEFLEFMKGVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Metal binding protein
molecule keywords Troponin C, slow skeletal and cardiac muscles
publication title The dilated cardiomyopathy G159D mutation in cardiac troponin C weakens the anchoring interaction with troponin I.
pubmed doi rcsb
source organism Homo sapiens
total genus 22
structure length 72
sequence length 72
ec nomenclature
pdb deposition date 2014-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00036 EF-hand_1 EF hand
C PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2mleC00
1IG5A 1QX5B 1JFKA 1TNXA 3NSIA 1AJ4A 1CDMA 2BKIB 4TNCA 1Y0VH 3NSKA 4N1FA 1QIWA 2KSPA 1F8HA 5AERA 4PALA 1L2OB 4MLWA 1OZSA 2BL0B 2KDHA 2M1KB 2JNFA 2KI6D 4GGNA 2FCEA 1V1FA 1K90D 1UWOA 2Y1NA 3DVKA 3FWBA 3TS5C 1YVLA 1NWDA 2PRUA 4I5NB 4N5XA 5KTYA 2JNXA 1J1EA 1KSMA 1OOJA 2M0RA 3O6BA 2LVVA 2HQ8A 4DCKA 2PALA 3CLNA 5B8IB 1U5IB 1RTP1 3C1VA 3GK1A 2ZFDA 1XK4C 2LVJA 2M97A 4QJ4B 1S36A 4PHJA 4YGAA 1L7ZA 1NX1A 2SASA 2F8PA 1AUIB 1JUOA 3PATA 4GAOA 3A4UB 1S5GY 3D0YB 4Q04A 1QLSA 2KQYA 1PSBA 1SYMA 4HSZA 4I5JA 2M7NA 2VRGA 1CM1A 1PALA 3SG4A 2BE4A 1SCMC 2MHHA 2ISDA 1BG1A 2LLUA 1XFXO 2EHBA 4FQOA 2K7DA 1N2DA 3BXKA 2LCPA 1C7VA 2EGDA 2BBNA 1RJVA 1CLMA 1KSOA 2ZRSA 3I5IC 5HLOA 1QX7A 3EVRA 3ZNIA 1J7RA 2WCEA 2HETA 1BMOA 2BECA 2K0JA 1MR8A 2O60A 4ZCVA 1CNPA 1B8RA 2ZRTA 4HRGA 1Y1XA 1DVIA 1XFZO 1PSRA 1OE9B 3I5HC 3WHUB 2MLFC 1JFJA 2LM5A 3MSEB 2JZIA 3GK4X 4YI8A 1QVIZ 1A2XA 1N0YA 1YRUB 5D7FA 2LHIA 4WQ3A 2LANA 5PALA 2E6WA 1BF5A 1SKTA 3LK1A 1DJYA 3SJSA 1SR6B 1NCYA 1DGUA 2NCPA 4HREE 2I2RE 3EKJA 2JQ6A 3O78A 1A29A 1CFPA 3I5FB 1CDPA 3TDZA 3DF0B 3O2PA 1MXEA 2PSRA 1QATA 1SW8A 4OV2A 2F2OA 1J7QA 5I2LA 1QTXA 1QX2A 1KCYA 3EKHA 1DJZA 2EC6B 2KHNA 3TDIA 2LLTA 4A4BA 5AFPA 1J7PA 4YGEB 2KFHA 3GOFA 4XJKB 3ZWHA 2L4HA 5JJGA 2K7OA 5DKNA 1J55A 1GGZA 4ETOA 4JPZB 1A75A 2MRDA 3M0WA 3PLFB 3SG2A 5I8NA 1B8LA 1KK8B 1LKJA 2LP3A 2PMYA 1KWOC 2KI6C 2R2IA 1FPWA 3JVTB 1JSAA 4ORBB 2I94A 2ZNEA 1K93D 1FI5A 1G33A 2K2AA 2LVIA 1TNWA 3I5GB 3OB1B 4CLNA 1UHKA 2JPTA 1QVIY 5KU1A 1M46A 3DVMA 4MRXA 1RECA 3KHEA 1N65A 4GGFC 1JBAA 3RLZA 5CSIA 1UP5A 2PASA 1K95A 4GFTA 1TOPA 1KQVA 2KGRA 2LMTA 1FI6A 1S6JA 5I2QA 1B1GA 3CGAA 3VRRA 1QASA 3AAJA 1K9UA 2K61A 4ORCB 1TNPA 4MSPA 3DVEA 1KQMC 4R1EA 2H2KA 1DJHA 1M31A 1Y6WA 2L4IA 1B8CA 1A4PA 1E8AA 1S5GZ 2LLSA 1BU3A 2MAZA 1F54A 1U5IA 1WDCC 1BODA 1TCOB 3OHMB 4PHKA 1B47A 1NCXA 1NYAA 1S26D 1UHIA 1Y1AA 2KBMA 2KNEA 5HKWA 4BY4A 5DKQA 2WNDA 1SL7A 2L2EA 1K94A 2MJWB 3D0YA 2LAPA 3JTDB 1B9AA 2KGBC 2KYCA 4PHNA 1AJ5A 2H61A 4M2PA 4NDDA 1MQ1A 1TRFA 4U8DA 3TUYC 1IQ5A 1YTZC 2L0PA 3CS1A 4CPVA 3TS5B 1HQVA 1DMOA 1F55A 1YURA 2GGMA 1RFJA 2L98A 4YGBB 1K9KA 1V1GA 2BL0C 2WCBA 4AQJA 1EH2A 1MUXA 2FCDA 2JULA 1UUSA 1AP4A 1OSAA 1MF8B 3KEVA 1DTLA 4I5KA 3LLEA 1RROA 2K2FA 4E68A 1UHJA 2CTNA 5HKYA 1F4QA 1WRZA 2FJUB 2V53A 4MBEA 2M9GA 1GQMA 4C0JA 3D10A 1NX0A 2BKHB 1G4YR 1TNQA 1C7WA 5DKRA 5IBWA 5D69A 2CT9A 4M2OA 4PE0A 2JT8A 1QJTA 2B1UA 1RK9A 2CBLA 1WRLA 1BT6A 1KK7Z 2K8MB 1S6CA 2OS8B 2Y1MA 2KI4C 2NXQA 1IKUA 2H61C 4L9MA 1AK8A 2L50A 4ZCUA 4NDBA 5TNCA 1CMGA 3A8RA 3HCMA 1XO5A 1H4BA 4DS7A 3OX5A 1NCZA 1QIVA 3DF0A 5G08A 3EVUA 3CZTX 1JWDA 3NXAA 4C0KA 1IJ6A 2COLB 2KYFA 1NP8A 2OPOA 2QPTA 4XJKA 4WQ2A 4GNKB 3VROA 3I5HB 4GUKA 3SG3A 1CKKA 3WXAA 5HKZA 3SG6A 4PDZA 1B4CA 4DRWA 1M45A 2IS9A 2JU0A 1K8UA 2BCBA 3SIAA 4WRIA 2MBXA 3K21A 1LA3A 1K96A 3FWCA 1OZOA 1RWYA 1XVJA 2JC2A 2ZNDA 4JWQA 1CB1A 2OTGB 3WHTB 1NX2A 1IRJA 3PN7B 4MZJA 1AHRA 2WC8A 1R6PA 1OQPA 1KFUS 1Q80A 1ZUZA 4PE4A 2F33A 4C0LA 2LMVA 1NPQA 1KK7Y 1JF0A 3LK0A 2BCXA 1UURA 3BUWB 2GV5A 2MA2A 1CLBA 4CFQA 4MVFA 1KFUL 1SBJA 2LUCA 1DF0A 1DJXA 4I5LB 2G2BA 3OP0A 3FS7A 2P6BB 1MHOA 2KFGA 5K89A 3BUNB 4FTGA 1CFFA 3HX4A 1FBVA 4M2QA 1HT9A 2LHLA 2AAOA 1KWOB 1NSHA 1IGVA 1ALWA 2G9BA 2K7CA 1EL4A 3BOWB 1C07A 5BPJA 5AANA 1NX3A 1YVHA 2M3WA 4YBHB 1NUBA 1LXFC 1KK8C 2KQ6A 3H4SE 3JVTC 2CCMA 4ICBA 1BR4B 1ODBA 2ZKMX 4OVNF 3PSRA 1LINA 3I5GC 2LC5A 3NSOA 3AKAA 1YX8A 1OMDA 1EG4A 1AVSA 3CR5X 3IQQA 4AOMA 1ALVA 1YX7A 2HF5A 2M1UA 3KPXA 4N1GA 2Y5IA 3FIAA 1K9PA 2KAYA 3LCPC 4XYNA 1D1OA 1CLLA 3F45A 1H8BA 1W7IB 1TIZA 4P5OE 1CFDA 1WDCB 3GK2A 1PVBA 2WCFA 3PFVA 3VGOA 1PRWA 4OKHA 4USLA 2NCOA 2LV7A 3VRNA 1YUTA 1CM4A 1XFUO 4MZKA 4NQGA 2JT0A 2NLNA 1L2OC 1M63B 3BUXB 4UPGA 1XFWO 5GQQC 1CFCA 3JTDC 2BE6A 1QLKA 3AKBA 1SMGA 1XYDA 2JRFA 1S3PA 1S1EA 1TTXA 1BLQA 2FOTA 2JOJA 3VRQA 3AAKA 1OMRA 3BUMB 4GPLB 2LVKA 1DT7B 4PE7A 1S6IA 2E30A 2KOTA 5J3XA 3EK4A 1WLZA 2Q91A 1XA5A 3PM8A 1SNLA 3IQOA 5CPVA 5HYDA 1PK0D 4ORAB 3SG5A 1SCMB 1F71A 2RGIA 4PHMA 1CDLA 2L51A 2F2PA 1J7OA 3KO0A 2AUCA 3TDUA 1W7JB 3CTNA 3ICBA 1ZACA 2JWWA 2KFFA 2HQWA 3WNXB 1BOCA 1EXRA 3RM1A 4P2YB 2KI4B 3CR2A 1F4OA 1J1DA 1LVCD 3I5IB 4MEWA 1QV0A 2QACA 2SCPA 1A03A 5CSFA 1XFVO 2CXJA 2ZN9A 1YUUA 3KF9A 1CTRA 2K7BA 5I2OA 1IWQA 2JTTA 4AQIA 3SIBA 4DUQA 2WORA 1YR5A 2OS8C 2I18A 1FW4A 5HLVA 5AEQA 4D1EA 1IH0A 3QRXA 1BR1B 2NZ0A 5F6TA 4YGCB 3BYAA 1YUSA 4PE1A 4QJ3B 1QV1A 1VRKA 2I7AA 2WOSA 4YRUA 2MLEC 2LMUA 1M39A 4MZLA 1GGWA 1SY9A 1QXPA 3EVVA 4OR9B 2M29A 1IJ5A 1JF2A 3DVJA 2LNKA 1MWNA 3BOWA 2TN4A 5CSNA 4JQ0D 4CIDA 1BJFA 1SK6D 4DIRA 1NIWA 2L5XB 4OCIA 1CDNA 4MN0A 1WRKA 1SR6C 2BCAA 4GGFA 3CR4X 3BQ3A 4CFRA 2BBMA 1DJIA 5JOLA 2JXLA 1SPYA 1DGVA 2F3YA 2OTGC 3I5FC 2KBIA 1LA0A 3PN7C 1SCVA 5ER4X 2DOQA 1MXLC 3NSLA 2GGZA 2EC6C 1ZFSA 1JC2A 1B7TZ 4PCWA 2HPSA 4NDCA 5KSZA 3EK7A 1K2HA 2LUXA 3O4YA 4GBAA 2JXCA 1OMVA 1DJWA 1DJGA 2ZN8A 4F0ZB 1EJ3A 3CWGA 1F70A 3E3RA 5AXIA 3PALA 1PULA 3VRPA 1WLMA 2KAVA 1Y1UA 5CSJA 4YGDB 1EG3A 4QJ5B 1KFXS 3SG7A 3IF7A 2PVBA 2AMIA 2D8NA 2KAXA 2LP2A 1GJYA 1X02A 2F3ZA 1SRAA 4YI9A 4BY5A 1KFXL 1KQMB 1TN4A 3DD4A 1UHNA 1ZMZA 1QS7A 2LE9B 1R2UA 1IQ3A 2M8UA 4A4CA 2CNPA 5FYXA 1ZOTB 1PVAA 1UHHA 1A75B 1DF0B 1SL8A 2JTZA 3OX6A 4HRHA 2Y4QA 1WY9A 1XK4A 3LL8B 1SL9A 3EK8A 4IL1A 1B7TY 1G8IA 2Q4UA 2M49B 1YRTB 2O5GA 3TZ1A 4MRYA 1XFYO 5ER5A 1FF1A 2JT3A 2M7LA 3BUOB 3OB2B 2A4JA 1CMFA 1TCFA 3TUYB
chains in the Genus database with same CATH superfamily
1IG5A 1QX5B 1JFKA 1TNXA 3NSIA 1AJ4A 1Z4HA 1CDMA 2BKIB 4TNCA 1Y0VH 3NSKA 4N1FA 1QIWA 2KSPA 2WCJA 1F8HA 5AERA 4PALA 1L2OB 4MLWA 1OZSA 2BL0B 2KDHA 2M1KB 4JKTA 2JNFA 2KI6D 4GGNA 1T14A 2FCEA 1V1FA 1K90D 1UWOA 2Y1NA 3DVKA 3FWBA 3NHTA 3TS5C 1YVLA 1NWDA 3D78A 2PRUA 3B88A 4I5NB 4N5XA 5KTYA 2JNXA 1J1EA 1DEKA 1KSMA 1OOJA 2M0RA 3O6BA 2LVVA 2HQ8A 4DCKA 2PALA 3CLNA 5B8IB 1U5IB 1RTP1 3C1VA 3GK1A 2ZFDA 2FJYA 1XK4C 2LVJA 2M97A 3S0DA 4QJ4B 1S36A 4PHJA 4YGAA 1L7ZA 1NX1A 1C3ZA 2SASA 3L4LA 2F8PA 3CDNA 1AUIB 1JUOA 3PATA 4GAOA 3A4UB 1S5GY 3D0YB 4Q04A 1QLSA 2KQYA 2WC5A 1PSBA 4PT1A 1SYMA 4HSZA 3SS3A 4I5JA 2M7NA 2VRGA 3BFHA 1CM1A 1PALA 3SG4A 2BE4A 1SCMC 2MHHA 3EG5B 2ISDA 1BG1A 2LLUA 4FQTA 1XFXO 2EHBA 4FQOA 2K7DA 1N2DA 3BXKA 2LCPA 1C7VA 2EGDA 2BBNA 1RJVA 1CLMA 1KSOA 2ZRSA 3I5IC 5HLOA 1QX7A 3EVRA 3ZNIA 1J7RA 2WCEA 3CYZA 2HETA 1BMOA 2BECA 2K0JA 1MR8A 2O60A 4ZCVA 1CNPA 1B8RA 2ZRTA 4HRGA 3R72A 1Y1XA 1DVIA 1XFZO 1PSRA 1OE9B 3I5HC 1TUZA 2MLFC 3WHUB 1JFJA 2LM5A 2QDIA 3MSEB 2JZIA 3GK4X 4YI8A 1QVIZ 1A2XA 3S0AA 1N0YA 1YRUB 5D7FA 2LHIA 4WQ3A 2LANA 3R1PA 3Q8IA 5PALA 2E6WA 1BF5A 1SKTA 3LK1A 1DJYA 3SJSA 1SR6B 1NCYA 3SS4A 1DGUA 2NCPA 2QEBA 4HREE 2I2RE 3EKJA 2JQ6A 3O78A 1A29A 1CFPA 2P71A 3I5FB 1CDPA 3V2LA 3TDZA 3DF0B 3O2PA 1MXEA 2PSRA 1QATA 1SW8A 4OV2A 5FI2A 2F2OA 1J7QA 5I2LA 1QTXA 1QX2A 1KCYA 3EKHA 1DJZA 2EC6B 2KHNA 3TDIA 2LLTA 4A4BA 5AFPA 1J7PA 4YGEB 2KFHA 3GOFA 4XJKB 3ZWHA 3R1OA 2L4HA 5JJGA 2K7OA 5DKNA 1J55A 1GGZA 4ETOA 4JPZB 1A75A 2MRDA 3M0WA 3PLFB 3SG2A 5I8NA 1B8LA 1KK8B 1LKJA 2LP3A 2PMYA 1KWOC 2KI6C 1P28A 2R2IA 3D75A 3JVTB 1FPWA 1JSAA 4ORBB 2I94A 2ZNEA 1DQEA 1K93D 1FI5A 1G33A 2K2AA 2LVIA 3D76A 1TNWA 3I5GB 4KYNA 3OB1B 4CLNA 1UHKA 2JPTA 1QVIY 5KU1A 1M46A 3CZ0A 3DVMA 1RECA 3KHEA 1N65A 4MRXA 4GGFC 2QEHA 1JBAA 3B86A 3RLZA 5CSIA 1UP5A 2PASA 1K95A 4GFTA 1TOPA 1KQVA 2KGRA 2LMTA 1FI6A 1S6JA 5I2QA 1B1GA 3CGAA 3VRRA 1QASA 1Z2CB 3AAJA 1K9UA 2K61A 4ORCB 1TNPA 4MSPA 3DVEA 1KQMC 4R1EA 2H2KA 1DJHA 1M31A 1Y6WA 2L4IA 1B8CA 1A4PA 1E8AA 1S5GZ 2LLSA 1BU3A 4F7FA 2QEOA 2MAZA 1F54A 2WCLA 1U5IA 1WDCC 3IVTA 1BODA 3DZTA 1TCOB 3OHMB 4PHKA 1B47A 1NCXA 1NYAA 1S26D 1UHIA 1Y1AA 2KBMA 2KNEA 5HKWA 4BY4A 5DKQA 3UO9A 2WNDA 1SL7A 2L2EA 1K94A 3D74A 2MJWB 2PYQA 3D0YA 2LAPA 2QEVA 3JTDB 1B9AA 2KGBC 2KYCA 4PHNA 3B87A 1AJ5A 2H61A 3B6XA 4M2PA 1MQ1A 1TRFA 4NDDA 4U8DA 3TUYC 1IQ5A 1YTZC 2L0PA 3CS1A 3CZ2A 4CPVA 3TS5B 1HQVA 1DMOA 1F55A 3DY9A 1YURA 2GGMA 1RFJA 2L98A 4YGBB 1K9KA 1V1GA 2BL0C 2WCBA 4AQJA 1EH2A 1MUXA 2FCDA 2JULA 1UUSA 1AP4A 1OSAA 1MF8B 1XFRA 3DXLA 3KEVA 1DTLA 1OOIX 4I5KA 3LLEA 1RROA 2K2FA 4E68A 1UHJA 5I94A 2CTNA 5HKYA 1F4QA 1WRZA 3FE6A 2FJUB 2V53A 4MBEA 2M9GA 1GQMA 2H8VA 4C0JA 2P70A 3D10A 1NX0A 2BKHB 1G4YR 1TNQA 1C7WA 5DKRA 5IBWA 5D69A 2CT9A 4M2OA 4PE0A 2JT8A 1QJTA 2B1UA 1RK9A 2KLDA 2CBLA 1WRLA 2WCKA 2KLEA 1BT6A 2L2CA 1KK7Z 2K8MB 1GM0A 1S6CA 2OS8B 2Y1MA 2KI4C 2NXQA 3R1VA 1IKUA 2H61C 4L9MA 3PM2A 3OBVA 3L47A 2L50A 4ZCUA 1AK8A 4NDBA 5TNCA 2KPHA 1CMGA 3A8RA 3HCMA 1XO5A 3FE8A 1H4BA 4DS7A 3OX5A 1NCZA 1QIVA 3DF0A 5G08A 1TWOA 3EVUA 3CZTX 1JWDA 3NXAA 4C0KA 1IJ6A 2COLB 2KYFA 1NP8A 2OPOA 2QPTA 4XJKA 4WQ2A 4GNKB 3VROA 3I5HB 4GUKA 3SG3A 1CKKA 3WXAA 5HKZA 3SG6A 4PDZA 1B4CA 4DRWA 1M45A 2IS9A 3VB1A 2JU0A 1K8UA 2BCBA 3SIAA 4WRIA 2MBXA 3K21A 1LA3A 1K96A 1LS8A 3FWCA 1OZOA 1RWYA 1XVJA 2JC2A 1TUJA 2ZNDA 4JWQA 1CB1A 2OTGB 3WHTB 1NX2A 1C3YA 1IRJA 3PN7B 4MZJA 1DELA 1AHRA 2WC8A 1R6PA 1OQPA 1KFUS 1Q80A 1ZUZA 3L4AA 2F33A 4PE4A 4C0LA 2LMVA 1NPQA 1KK7Y 3SS5A 1JF0A 3LK0A 2BCXA 1UURA 3BUWB 5FI6A 2GV5A 2MA2A 1CLBA 4CFQA 4MVFA 1KFUL 2GTEA 1SBJA 2LUCA 1DF0A 1DJXA 4I5LB 2G2BA 3OP0A 3FS7A 2P6BB 1MHOA 2KFGA 5K89A 3BUNB 4FTGA 1CFFA 3HX4A 1FBVA 4M2QA 1HT9A 2LHLA 2AAOA 1KWOB 1NSHA 1IGVA 1ALWA 1OOFA 2G9BA 2K7CA 1EL4A 3BOWB 1C07A 3BJHA 5BPJA 5AANA 1NX3A 1YVHA 2M3WA 4YBHB 1W9ZA 1NUBA 1LXFC 1KK8C 2KQ6A 3H4SE 3JVTC 2CCMA 4ICBA 4OZDA 1BR4B 1ODBA 2ZKMX 4OVNF 3PSRA 3DYEA 1LINA 3I5GC 2LC5A 3N7HA 3NSOA 3AKAA 1YX8A 1OMDA 1EG4A 1AVSA 3OGNA 2L5YA 3CR5X 3IQQA 4AOMA 1ALVA 1YX7A 2HF5A 2WCMA 2M1UA 3KPXA 4N1GA 2Y5IA 3FIAA 1K9PA 2KAYA 3LCPC 4XYNA 1D1OA 1CLLA 3F45A 1H8BA 1W7IB 1TIZA 4P5OE 1CFDA 1WDCB 3GK2A 3O4XA 1PVBA 2WCFA 3PFVA 3B7AA 2WC6A 1QWVA 3VGOA 1PRWA 2ERBA 4OKHA 4USLA 2NCOA 2LV7A 3K1EA 3S0EA 3VRNA 1YUTA 1IIOA 1CM4A 2BNXA 1XFUO 4MZKA 4NQGA 2JT0A 2NLNA 1L2OC 1M63B 3BUXB 4UPGA 4IJ7A 3D73A 4INWA 1XFWO 5GQQC 1CFCA 3JTDC 2BE6A 1QLKA 3AKBA 1SMGA 1XYDA 2JRFA 1S3PA 1S1EA 1TTXA 1BLQA 2FOTA 1ORGA 2JOJA 3S0GA 3AAKA 3VRQA 1OMRA 3BUMB 2WCHA 4GPLB 2LVKA 4JD9A 1DT7B 4PE7A 1S6IA 2E30A 2KOTA 5J3XA 3EK4A 1WLZA 2Q91A 1XA5A 3PM8A 4INXA 1SNLA 3IQOA 5CPVA 5HYDA 1PK0D 4ORAB 3SG5A 1SCMB 1F71A 2RGIA 2K60A 4PHMA 1CDLA 2L51A 2F2PA 1J7OA 3KO0A 2AUCA 3TDUA 1W7JB 3CTNA 2BAPA 3ICBA 1ZACA 2JWWA 2KFFA 2HQWA 3WNXB 1BOCA 1EXRA 3RM1A 4P2YB 2KI4B 3CR2A 1F4OA 1J1DA 1LVCD 3I5IB 4MEWA 1QV0A 2QACA 2SCPA 5HL1A 5CSFA 1A03A 1XFVO 2CXJA 2ZN9A 1YUUA 3FE9A 1CTRA 2K7BA 3KF9A 1IWQA 2JTTA 4AQIA 3SIBA 5I2OA 4DUQA 2WORA 1YR5A 2OS8C 2I18A 1FW4A 5HLVA 5AEQA 4D1EA 1IH0A 3QRXA 1BR1B 3QMEA 2NZ0A 5F6TA 3S0BA 4YGCB 3BYAA 1YUSA 4PE1A 4QJ3B 1QV1A 1VRKA 2I7AA 2WOSA 2JPOA 4YRUA 2MLEC 2LMUA 1M39A 4MZLA 1GGWA 1SY9A 1QXPA 3EVVA 4OR9B 2M29A 1IJ5A 3NGVA 1JF2A 3DVJA 3CZ1A 5DICA 2LNKA 1MWNA 3BOWA 2TN4A 5CSNA 4JQ0D 4CIDA 1BJFA 1SK6D 4DIRA 1NIWA 2L5XB 4OCIA 1CDNA 4MN0A 1WRKA 1SR6C 2BCAA 4GGFA 3CR4X 3BQ3A 4CFRA 2BBMA 1DJIA 5JOLA 2JXLA 1SPYA 1DGVA 2F3YA 2OTGC 3I5FC 2KBIA 1OOGA 1LA0A 3PN7C 1SCVA 3BFAA 5ER4X 2PQLA 2DOQA 1MXLC 3NSLA 2GGZA 2EC6C 1ZFSA 1JC2A 3PJIA 1B7TZ 4PCWA 2HPSA 4NDCA 5KSZA 3EK7A 3RZSA 2LUXA 3O4YA 4GBAA 1K2HA 2JXCA 1OMVA 1DJWA 1DJGA 2ZN8A 4F0ZB 1EJ3A 3CWGA 1OOHA 3E3RA 1DC1A 1F70A 5AXIA 3PALA 1PULA 3VRPA 1WLMA 2KAVA 1Y1UA 5CSJA 3D77A 4YGDB 1EG3A 1OW4A 4QJ5B 1KFXS 3SG7A 3S0FA 3IF7A 2PVBA 2AMIA 2D8NA 2KAXA 2LP2A 1GJYA 1X02A 2F3ZA 1SRAA 4YI9A 4BY5A 1KFXL 1KQMB 3CABA 1TN4A 3DD4A 3UNWA 1UHNA 1ZMZA 1QS7A 2LE9B 1R2UA 1IQ3A 2M8UA 4A4CA 2CNPA 5FYXA 1ZOTB 3NHIA 1PVAA 1UHHA 1A75B 1DF0B 1SL8A 2JTZA 2YGUA 3OX6A 4HRHA 2Y4QA 1WY9A 1XK4A 3LL8B 1SL9A 5EL2A 3EK8A 4IL1A 1B7TY 1G8IA 2Q4UA 2M49B 1YRTB 2O5GA 3TZ1A 4MRYA 1XFYO 5ER5A 1FF1A 2JT3A 5FI7A 3BUOB 3OB2B 5D3OA 2M7LA 2A4JA 1CMFA 3BFBA 1TCFA 3TUYB 1SSEB
chains in the Genus database with same CATH topology
1IG5A 1QX5B 1JFKA 1TNXA 3NSIA 1AJ4A 1CDMA 2BKIB 4TNCA 1Y0VH 3NSKA 4N1FA 1QIWA 2KSPA 1F8HA 5AERA 4PALA 1L2OB 4MLWA 1OZSA 2BL0B 2KDHA 2M1KB 2JNFA 2KI6D 4GGNA 2FCEA 1V1FA 1K90D 1UWOA 2Y1NA 3DVKA 3FWBA 3TS5C 1YVLA 1NWDA 2PRUA 4I5NB 4N5XA 5KTYA 2JNXA 1J1EA 1KSMA 1OOJA 2M0RA 3O6BA 2LVVA 2HQ8A 4DCKA 2PALA 3CLNA 5B8IB 1U5IB 1RTP1 3C1VA 3GK1A 2ZFDA 1XK4C 2LVJA 2M97A 4QJ4B 1S36A 4PHJA 4YGAA 1L7ZA 1NX1A 2SASA 2F8PA 1AUIB 1JUOA 3PATA 4GAOA 3A4UB 1S5GY 3D0YB 4Q04A 1QLSA 2KQYA 1PSBA 1SYMA 4HSZA 4I5JA 2M7NA 2VRGA 1CM1A 1PALA 3SG4A 2BE4A 1SCMC 2MHHA 2ISDA 1BG1A 2LLUA 1XFXO 2EHBA 4FQOA 2K7DA 1N2DA 3BXKA 2LCPA 1C7VA 2EGDA 2BBNA 1RJVA 1CLMA 1KSOA 2ZRSA 3I5IC 5HLOA 1QX7A 3EVRA 3ZNIA 1J7RA 2WCEA 2HETA 1BMOA 2BECA 2K0JA 1MR8A 2O60A 4ZCVA 1CNPA 1B8RA 2ZRTA 4HRGA 1Y1XA 1DVIA 1XFZO 1PSRA 1OE9B 3I5HC 3WHUB 2MLFC 1JFJA 2LM5A 3MSEB 2JZIA 3GK4X 4YI8A 1QVIZ 1A2XA 1N0YA 1YRUB 5D7FA 2LHIA 4WQ3A 2LANA 5PALA 2E6WA 1BF5A 1SKTA 3LK1A 1DJYA 3SJSA 1SR6B 1NCYA 1DGUA 2NCPA 4HREE 2I2RE 3EKJA 2JQ6A 3O78A 1A29A 1CFPA 3I5FB 1CDPA 3TDZA 3DF0B 3O2PA 1MXEA 2PSRA 1QATA 1SW8A 4OV2A 2F2OA 1J7QA 5I2LA 1QTXA 1QX2A 1KCYA 3EKHA 1DJZA 2EC6B 2KHNA 3TDIA 2LLTA 4A4BA 5AFPA 1J7PA 4YGEB 2KFHA 3GOFA 4XJKB 3ZWHA 2L4HA 5JJGA 2K7OA 5DKNA 1J55A 1GGZA 4ETOA 4JPZB 1A75A 2MRDA 3M0WA 3PLFB 3SG2A 5I8NA 1B8LA 1KK8B 1LKJA 2LP3A 2PMYA 1KWOC 2KI6C 2R2IA 1FPWA 3JVTB 1JSAA 4ORBB 2I94A 2ZNEA 1K93D 1FI5A 1G33A 2K2AA 2LVIA 1TNWA 3I5GB 3OB1B 4CLNA 1UHKA 2JPTA 1QVIY 5KU1A 1M46A 3DVMA 4MRXA 1RECA 3KHEA 1N65A 4GGFC 1JBAA 3RLZA 5CSIA 1UP5A 2PASA 1K95A 4GFTA 1TOPA 1KQVA 2KGRA 2LMTA 1FI6A 1S6JA 5I2QA 1B1GA 3CGAA 3VRRA 1QASA 3AAJA 1K9UA 2K61A 4ORCB 1TNPA 4MSPA 3DVEA 1KQMC 4R1EA 2H2KA 1DJHA 1M31A 1Y6WA 2L4IA 1B8CA 1A4PA 1E8AA 1S5GZ 2LLSA 1BU3A 2MAZA 1F54A 1U5IA 1WDCC 1BODA 1TCOB 3OHMB 4PHKA 1B47A 1NCXA 1NYAA 1S26D 1UHIA 1Y1AA 2KBMA 2KNEA 5HKWA 4BY4A 5DKQA 2WNDA 1SL7A 2L2EA 1K94A 2MJWB 3D0YA 2LAPA 3JTDB 1B9AA 2KGBC 2KYCA 4PHNA 1AJ5A 2H61A 4M2PA 4NDDA 1MQ1A 1TRFA 4U8DA 3TUYC 1IQ5A 1YTZC 2L0PA 3CS1A 4CPVA 3TS5B 1HQVA 1DMOA 1F55A 1YURA 2GGMA 1RFJA 2L98A 4YGBB 1K9KA 1V1GA 2BL0C 2WCBA 4AQJA 1EH2A 1MUXA 2FCDA 2JULA 1UUSA 1AP4A 1OSAA 1MF8B 3KEVA 1DTLA 4I5KA 3LLEA 1RROA 2K2FA 4E68A 1UHJA 2CTNA 5HKYA 1F4QA 1WRZA 2FJUB 2V53A 4MBEA 2M9GA 1GQMA 4C0JA 3D10A 1NX0A 2BKHB 1G4YR 1TNQA 1C7WA 5DKRA 5IBWA 5D69A 2CT9A 4M2OA 4PE0A 2JT8A 1QJTA 2B1UA 1RK9A 2CBLA 1WRLA 1BT6A 1KK7Z 2K8MB 1S6CA 2OS8B 2Y1MA 2KI4C 2NXQA 1IKUA 2H61C 4L9MA 1AK8A 2L50A 4ZCUA 4NDBA 5TNCA 1CMGA 3A8RA 3HCMA 1XO5A 1H4BA 4DS7A 3OX5A 1NCZA 1QIVA 3DF0A 5G08A 3EVUA 3CZTX 1JWDA 3NXAA 4C0KA 1IJ6A 2COLB 2KYFA 1NP8A 2OPOA 2QPTA 4XJKA 4WQ2A 4GNKB 3VROA 3I5HB 4GUKA 3SG3A 1CKKA 3WXAA 5HKZA 3SG6A 4PDZA 1B4CA 4DRWA 1M45A 2IS9A 2JU0A 1K8UA 2BCBA 3SIAA 4WRIA 2MBXA 3K21A 1LA3A 1K96A 3FWCA 1OZOA 1RWYA 1XVJA 2JC2A 2ZNDA 4JWQA 1CB1A 2OTGB 3WHTB 1NX2A 1IRJA 3PN7B 4MZJA 1AHRA 2WC8A 1R6PA 1OQPA 1KFUS 1Q80A 1ZUZA 4PE4A 2F33A 4C0LA 2LMVA 1NPQA 1KK7Y 1JF0A 3LK0A 2BCXA 1UURA 3BUWB 2GV5A 2MA2A 1CLBA 4CFQA 4MVFA 1KFUL 1SBJA 2LUCA 1DF0A 1DJXA 4I5LB 2G2BA 3OP0A 3FS7A 2P6BB 1MHOA 2KFGA 5K89A 3BUNB 4FTGA 1CFFA 3HX4A 1FBVA 4M2QA 1HT9A 2LHLA 2AAOA 1KWOB 1NSHA 1IGVA 1ALWA 2G9BA 2K7CA 1EL4A 3BOWB 1C07A 5BPJA 5AANA 1NX3A 1YVHA 2M3WA 4YBHB 1NUBA 1LXFC 1KK8C 2KQ6A 3H4SE 3JVTC 2CCMA 4ICBA 1BR4B 1ODBA 2ZKMX 4OVNF 3PSRA 1LINA 3I5GC 2LC5A 3NSOA 3AKAA 1YX8A 1OMDA 1EG4A 1AVSA 3CR5X 3IQQA 4AOMA 1ALVA 1YX7A 2HF5A 2M1UA 3KPXA 4N1GA 2Y5IA 3FIAA 1K9PA 2KAYA 3LCPC 4XYNA 1D1OA 1CLLA 3F45A 1H8BA 1W7IB 1TIZA 4P5OE 1CFDA 1WDCB 3GK2A 1PVBA 2WCFA 3PFVA 3VGOA 1PRWA 4OKHA 4USLA 2NCOA 2LV7A 3VRNA 1YUTA 1CM4A 1XFUO 4MZKA 4NQGA 2JT0A 2NLNA 1L2OC 1M63B 3BUXB 4UPGA 1XFWO 5GQQC 1CFCA 3JTDC 2BE6A 1QLKA 3AKBA 1SMGA 1XYDA 2JRFA 1S3PA 1S1EA 1TTXA 1BLQA 2FOTA 2JOJA 3VRQA 3AAKA 1OMRA 3BUMB 4GPLB 2LVKA 1DT7B 4PE7A 1S6IA 2E30A 2KOTA 5J3XA 3EK4A 1WLZA 2Q91A 1XA5A 3PM8A 1SNLA 3IQOA 5CPVA 5HYDA 1PK0D 4ORAB 3SG5A 1SCMB 1F71A 2RGIA 4PHMA 1CDLA 2L51A 2F2PA 1J7OA 3KO0A 2AUCA 3TDUA 1W7JB 3CTNA 3ICBA 1ZACA 2JWWA 2KFFA 2HQWA 3WNXB 1BOCA 1EXRA 3RM1A 4P2YB 2KI4B 3CR2A 1F4OA 1J1DA 1LVCD 3I5IB 4MEWA 1QV0A 2QACA 2SCPA 1A03A 5CSFA 1XFVO 2CXJA 2ZN9A 1YUUA 3KF9A 1CTRA 2K7BA 5I2OA 1IWQA 2JTTA 4AQIA 3SIBA 4DUQA 2WORA 1YR5A 2OS8C 2I18A 1FW4A 5HLVA 5AEQA 4D1EA 1IH0A 3QRXA 1BR1B 2NZ0A 5F6TA 4YGCB 3BYAA 1YUSA 4PE1A 4QJ3B 1QV1A 1VRKA 2I7AA 2WOSA 4YRUA 2MLEC 2LMUA 1M39A 4MZLA 1GGWA 1SY9A 1QXPA 3EVVA 4OR9B 2M29A 1IJ5A 1JF2A 3DVJA 2LNKA 1MWNA 3BOWA 2TN4A 5CSNA 4JQ0D 4CIDA 1BJFA 1SK6D 4DIRA 1NIWA 2L5XB 4OCIA 1CDNA 4MN0A 1WRKA 1SR6C 2BCAA 4GGFA 3CR4X 3BQ3A 4CFRA 2BBMA 1DJIA 5JOLA 2JXLA 1SPYA 1DGVA 2F3YA 2OTGC 3I5FC 2KBIA 1LA0A 3PN7C 1SCVA 5ER4X 2DOQA 1MXLC 3NSLA 2GGZA 2EC6C 1ZFSA 1JC2A 1B7TZ 4PCWA 2HPSA 4NDCA 5KSZA 3EK7A 1K2HA 2LUXA 3O4YA 4GBAA 2JXCA 1OMVA 1DJWA 1DJGA 2ZN8A 4F0ZB 1EJ3A 3CWGA 1F70A 3E3RA 5AXIA 3PALA 1PULA 3VRPA 1WLMA 2KAVA 1Y1UA 5CSJA 4YGDB 1EG3A 4QJ5B 1KFXS 3SG7A 3IF7A 2PVBA 2AMIA 2D8NA 2KAXA 2LP2A 1GJYA 1X02A 2F3ZA 1SRAA 4YI9A 4BY5A 1KFXL 1KQMB 1TN4A 3DD4A 1UHNA 1ZMZA 1QS7A 2LE9B 1R2UA 1IQ3A 2M8UA 4A4CA 2CNPA 5FYXA 1ZOTB 1PVAA 1UHHA 1A75B 1DF0B 1SL8A 2JTZA 3OX6A 4HRHA 2Y4QA 1WY9A 1XK4A 3LL8B 1SL9A 3EK8A 4IL1A 1B7TY 1G8IA 2Q4UA 2M49B 1YRTB 2O5GA 3TZ1A 4MRYA 1XFYO 5ER5A 1FF1A 2JT3A 2M7LA 3BUOB 3OB2B 2A4JA 1CMFA 1TCFA 3TUYB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IG5 A;  1QX5 B;  1JFK A;  1TNX A;  3NSI A;  1AJ4 A;  1CDM A;  2BKI B;  4TNC A;  1Y0V H;  3NSK A;  4N1F A;  1QIW A;  2KSP A;  1F8H A;  5AER A;  4PAL A;  1L2O B;  4MLW A;  1OZS A;  2BL0 B;  2KDH A;  2M1K B;  2JNF A;  2KI6 D;  4GGN A;  2FCE A;  1V1F A;  1K90 D;  1UWO A;  2Y1N A;  3DVK A;  3FWB A;  3TS5 C;  1YVL A;  1NWD A;  2PRU A;  4I5N B;  4N5X A;  5KTY A;  2JNX A;  1J1E A;  1KSM A;  1OOJ A;  2M0R A;  3O6B A;  2LVV A;  2HQ8 A;  4DCK A;  2PAL A;  3CLN A;  5B8I B;  1U5I B;  1RTP 1;  3C1V A;  3GK1 A;  2ZFD A;  1XK4 C;  2LVJ A;  2M97 A;  4QJ4 B;  1S36 A;  4PHJ A;  4YGA A;  1L7Z A;  1NX1 A;  2SAS A;  2F8P A;  1AUI B;  1JUO A;  3PAT A;  4GAO A;  3A4U B;  1S5G Y;  3D0Y B;  4Q04 A;  1QLS A;  2KQY A;  1PSB A;  1SYM A;  4HSZ A;  4I5J A;  2M7N A;  2VRG A;  1CM1 A;  1PAL A;  3SG4 A;  2BE4 A;  1SCM C;  2MHH A;  2ISD A;  1BG1 A;  2LLU A;  1XFX O;  2EHB A;  4FQO A;  2K7D A;  1N2D A;  3BXK A;  2LCP A;  1C7V A;  2EGD A;  2BBN A;  1RJV A;  1CLM A;  1KSO A;  2ZRS A;  3I5I C;  5HLO A;  1QX7 A;  3EVR A;  3ZNI A;  1J7R A;  2WCE A;  2HET A;  1BMO A;  2BEC A;  2K0J A;  1MR8 A;  2O60 A;  4ZCV A;  1CNP A;  1B8R A;  2ZRT A;  4HRG A;  1Y1X A;  1DVI A;  1XFZ O;  1PSR A;  1OE9 B;  3I5H C;  3WHU B;  2MLF C;  1JFJ A;  2LM5 A;  3MSE B;  2JZI A;  3GK4 X;  4YI8 A;  1QVI Z;  1A2X A;  1N0Y A;  1YRU B;  5D7F A;  2LHI A;  4WQ3 A;  2LAN A;  5PAL A;  2E6W A;  1BF5 A;  1SKT A;  3LK1 A;  1DJY A;  3SJS A;  1SR6 B;  1NCY A;  1DGU A;  2NCP A;  4HRE E;  2I2R E;  3EKJ A;  2JQ6 A;  3O78 A;  1A29 A;  1CFP A;  3I5F B;  1CDP A;  3TDZ A;  3DF0 B;  3O2P A;  1MXE A;  2PSR A;  1QAT A;  1SW8 A;  4OV2 A;  2F2O A;  1J7Q A;  5I2L A;  1QTX A;  1QX2 A;  1KCY A;  3EKH A;  1DJZ A;  2EC6 B;  2KHN A;  3TDI A;  2LLT A;  4A4B A;  5AFP A;  1J7P A;  4YGE B;  2KFH A;  3GOF A;  4XJK B;  3ZWH A;  2L4H A;  5JJG A;  2K7O A;  5DKN A;  1J55 A;  1GGZ A;  4ETO A;  4JPZ B;  1A75 A;  2MRD A;  3M0W A;  3PLF B;  3SG2 A;  5I8N A;  1B8L A;  1KK8 B;  1LKJ A;  2LP3 A;  2PMY A;  1KWO C;  2KI6 C;  2R2I A;  1FPW A;  3JVT B;  1JSA A;  4ORB B;  2I94 A;  2ZNE A;  1K93 D;  1FI5 A;  1G33 A;  2K2A A;  2LVI A;  1TNW A;  3I5G B;  3OB1 B;  4CLN A;  1UHK A;  2JPT A;  1QVI Y;  5KU1 A;  1M46 A;  3DVM A;  4MRX A;  1REC A;  3KHE A;  1N65 A;  4GGF C;  1JBA A;  3RLZ A;  5CSI A;  1UP5 A;  2PAS A;  1K95 A;  4GFT A;  1TOP A;  1KQV A;  2KGR A;  2LMT A;  1FI6 A;  1S6J A;  5I2Q A;  1B1G A;  3CGA A;  3VRR A;  1QAS A;  3AAJ A;  1K9U A;  2K61 A;  4ORC B;  1TNP A;  4MSP A;  3DVE A;  1KQM C;  4R1E A;  2H2K A;  1DJH A;  1M31 A;  1Y6W A;  2L4I A;  1B8C A;  1A4P A;  1E8A A;  1S5G Z;  2LLS A;  1BU3 A;  2MAZ A;  1F54 A;  1U5I A;  1WDC C;  1BOD A;  1TCO B;  3OHM B;  4PHK A;  1B47 A;  1NCX A;  1NYA A;  1S26 D;  1UHI A;  1Y1A A;  2KBM A;  2KNE A;  5HKW A;  4BY4 A;  5DKQ A;  2WND A;  1SL7 A;  2L2E A;  1K94 A;  2MJW B;  3D0Y A;  2LAP A;  3JTD B;  1B9A A;  2KGB C;  2KYC A;  4PHN A;  1AJ5 A;  2H61 A;  4M2P A;  4NDD A;  1MQ1 A;  1TRF A;  4U8D A;  3TUY C;  1IQ5 A;  1YTZ C;  2L0P A;  3CS1 A;  4CPV A;  3TS5 B;  1HQV A;  1DMO A;  1F55 A;  1YUR A;  2GGM A;  1RFJ A;  2L98 A;  4YGB B;  1K9K A;  1V1G A;  2BL0 C;  2WCB A;  4AQJ A;  1EH2 A;  1MUX A;  2FCD A;  2JUL A;  1UUS A;  1AP4 A;  1OSA A;  1MF8 B;  3KEV A;  1DTL A;  4I5K A;  3LLE A;  1RRO A;  2K2F A;  4E68 A;  1UHJ A;  2CTN A;  5HKY A;  1F4Q A;  1WRZ A;  2FJU B;  2V53 A;  4MBE A;  2M9G A;  1GQM A;  4C0J A;  3D10 A;  1NX0 A;  2BKH B;  1G4Y R;  1TNQ A;  1C7W A;  5DKR A;  5IBW A;  5D69 A;  2CT9 A;  4M2O A;  4PE0 A;  2JT8 A;  1QJT A;  2B1U A;  1RK9 A;  2CBL A;  1WRL A;  1BT6 A;  1KK7 Z;  2K8M B;  1S6C A;  2OS8 B;  2Y1M A;  2KI4 C;  2NXQ A;  1IKU A;  2H61 C;  4L9M A;  1AK8 A;  2L50 A;  4ZCU A;  4NDB A;  5TNC A;  1CMG A;  3A8R A;  3HCM A;  1XO5 A;  1H4B A;  4DS7 A;  3OX5 A;  1NCZ A;  1QIV A;  3DF0 A;  5G08 A;  3EVU A;  3CZT X;  1JWD A;  3NXA A;  4C0K A;  1IJ6 A;  2COL B;  2KYF A;  1NP8 A;  2OPO A;  2QPT A;  4XJK A;  4WQ2 A;  4GNK B;  3VRO A;  3I5H B;  4GUK A;  3SG3 A;  1CKK A;  3WXA A;  5HKZ A;  3SG6 A;  4PDZ A;  1B4C A;  4DRW A;  1M45 A;  2IS9 A;  2JU0 A;  1K8U A;  2BCB A;  3SIA A;  4WRI A;  2MBX A;  3K21 A;  1LA3 A;  1K96 A;  3FWC A;  1OZO A;  1RWY A;  1XVJ A;  2JC2 A;  2ZND A;  4JWQ A;  1CB1 A;  2OTG B;  3WHT B;  1NX2 A;  1IRJ A;  3PN7 B;  4MZJ A;  1AHR A;  2WC8 A;  1R6P A;  1OQP A;  1KFU S;  1Q80 A;  1ZUZ A;  4PE4 A;  2F33 A;  4C0L A;  2LMV A;  1NPQ A;  1KK7 Y;  1JF0 A;  3LK0 A;  2BCX A;  1UUR A;  3BUW B;  2GV5 A;  2MA2 A;  1CLB A;  4CFQ A;  4MVF A;  1KFU L;  1SBJ A;  2LUC A;  1DF0 A;  1DJX A;  4I5L B;  2G2B A;  3OP0 A;  3FS7 A;  2P6B B;  1MHO A;  2KFG A;  5K89 A;  3BUN B;  4FTG A;  1CFF A;  3HX4 A;  1FBV A;  4M2Q A;  1HT9 A;  2LHL A;  2AAO A;  1KWO B;  1NSH A;  1IGV A;  1ALW A;  2G9B A;  2K7C A;  1EL4 A;  3BOW B;  1C07 A;  5BPJ A;  5AAN A;  1NX3 A;  1YVH A;  2M3W A;  4YBH B;  1NUB A;  1LXF C;  1KK8 C;  2KQ6 A;  3H4S E;  3JVT C;  2CCM A;  4ICB A;  1BR4 B;  1ODB A;  2ZKM X;  4OVN F;  3PSR A;  1LIN A;  3I5G C;  2LC5 A;  3NSO A;  3AKA A;  1YX8 A;  1OMD A;  1EG4 A;  1AVS A;  3CR5 X;  3IQQ A;  4AOM A;  1ALV A;  1YX7 A;  2HF5 A;  2M1U A;  3KPX A;  4N1G A;  2Y5I A;  3FIA A;  1K9P A;  2KAY A;  3LCP C;  4XYN A;  1D1O A;  1CLL A;  3F45 A;  1H8B A;  1W7I B;  1TIZ A;  4P5O E;  1CFD A;  1WDC B;  3GK2 A;  1PVB A;  2WCF A;  3PFV A;  3VGO A;  1PRW A;  4OKH A;  4USL A;  2NCO A;  2LV7 A;  3VRN A;  1YUT A;  1CM4 A;  1XFU O;  4MZK A;  4NQG A;  2JT0 A;  2NLN A;  1L2O C;  1M63 B;  3BUX B;  4UPG A;  1XFW O;  5GQQ C;  1CFC A;  3JTD C;  2BE6 A;  1QLK A;  3AKB A;  1SMG A;  1XYD A;  2JRF A;  1S3P A;  1S1E A;  1TTX A;  1BLQ A;  2FOT A;  2JOJ A;  3VRQ A;  3AAK A;  1OMR A;  3BUM B;  4GPL B;  2LVK A;  1DT7 B;  4PE7 A;  1S6I A;  2E30 A;  2KOT A;  5J3X A;  3EK4 A;  1WLZ A;  2Q91 A;  1XA5 A;  3PM8 A;  1SNL A;  3IQO A;  5CPV A;  5HYD A;  1PK0 D;  4ORA B;  3SG5 A;  1SCM B;  1F71 A;  2RGI A;  4PHM A;  1CDL A;  2L51 A;  2F2P A;  1J7O A;  3KO0 A;  2AUC A;  3TDU A;  1W7J B;  3CTN A;  3ICB A;  1ZAC A;  2JWW A;  2KFF A;  2HQW A;  3WNX B;  1BOC A;  1EXR A;  3RM1 A;  4P2Y B;  2KI4 B;  3CR2 A;  1F4O A;  1J1D A;  1LVC D;  3I5I B;  4MEW A;  1QV0 A;  2QAC A;  2SCP A;  1A03 A;  5CSF A;  1XFV O;  2CXJ A;  2ZN9 A;  1YUU A;  3KF9 A;  1CTR A;  2K7B A;  5I2O A;  1IWQ A;  2JTT A;  4AQI A;  3SIB A;  4DUQ A;  2WOR A;  1YR5 A;  2OS8 C;  2I18 A;  1FW4 A;  5HLV A;  5AEQ A;  4D1E A;  1IH0 A;  3QRX A;  1BR1 B;  2NZ0 A;  5F6T A;  4YGC B;  3BYA A;  1YUS A;  4PE1 A;  4QJ3 B;  1QV1 A;  1VRK A;  2I7A A;  2WOS A;  4YRU A;  2MLE C;  2LMU A;  1M39 A;  4MZL A;  1GGW A;  1SY9 A;  1QXP A;  3EVV A;  4OR9 B;  2M29 A;  1IJ5 A;  1JF2 A;  3DVJ A;  2LNK A;  1MWN A;  3BOW A;  2TN4 A;  5CSN A;  4JQ0 D;  4CID A;  1BJF A;  1SK6 D;  4DIR A;  1NIW A;  2L5X B;  4OCI A;  1CDN A;  4MN0 A;  1WRK A;  1SR6 C;  2BCA A;  4GGF A;  3CR4 X;  3BQ3 A;  4CFR A;  2BBM A;  1DJI A;  5JOL A;  2JXL A;  1SPY A;  1DGV A;  2F3Y A;  2OTG C;  3I5F C;  2KBI A;  1LA0 A;  3PN7 C;  1SCV A;  5ER4 X;  2DOQ A;  1MXL C;  3NSL A;  2GGZ A;  2EC6 C;  1ZFS A;  1JC2 A;  1B7T Z;  4PCW A;  2HPS A;  4NDC A;  5KSZ A;  3EK7 A;  1K2H A;  2LUX A;  3O4Y A;  4GBA A;  2JXC A;  1OMV A;  1DJW A;  1DJG A;  2ZN8 A;  4F0Z B;  1EJ3 A;  3CWG A;  1F70 A;  3E3R A;  5AXI A;  3PAL A;  1PUL A;  3VRP A;  1WLM A;  2KAV A;  1Y1U A;  5CSJ A;  4YGD B;  1EG3 A;  4QJ5 B;  1KFX S;  3SG7 A;  3IF7 A;  2PVB A;  2AMI A;  2D8N A;  2KAX A;  2LP2 A;  1GJY A;  1X02 A;  2F3Z A;  1SRA A;  4YI9 A;  4BY5 A;  1KFX L;  1KQM B;  1TN4 A;  3DD4 A;  1UHN A;  1ZMZ A;  1QS7 A;  2LE9 B;  1R2U A;  1IQ3 A;  2M8U A;  4A4C A;  2CNP A;  5FYX A;  1ZOT B;  1PVA A;  1UHH A;  1A75 B;  1DF0 B;  1SL8 A;  2JTZ A;  3OX6 A;  4HRH A;  2Y4Q A;  1WY9 A;  1XK4 A;  3LL8 B;  1SL9 A;  3EK8 A;  4IL1 A;  1B7T Y;  1G8I A;  2Q4U A;  2M49 B;  1YRT B;  2O5G A;  3TZ1 A;  4MRY A;  1XFY O;  5ER5 A;  1FF1 A;  2JT3 A;  2M7L A;  3BUO B;  3OB2 B;  2A4J A;  1CMF A;  1TCF A;  3TUY B; 
#chains in the Genus database with same CATH topology
 1IG5 A;  1QX5 B;  1JFK A;  1TNX A;  3NSI A;  1AJ4 A;  1Z4H A;  1CDM A;  2BKI B;  4TNC A;  1Y0V H;  3NSK A;  4N1F A;  1QIW A;  2KSP A;  2WCJ A;  1F8H A;  5AER A;  4PAL A;  1L2O B;  4MLW A;  1OZS A;  2BL0 B;  2KDH A;  2M1K B;  4JKT A;  2JNF A;  2KI6 D;  4GGN A;  1T14 A;  2FCE A;  1V1F A;  1K90 D;  1UWO A;  2Y1N A;  3DVK A;  3FWB A;  3NHT A;  3TS5 C;  1YVL A;  1NWD A;  3D78 A;  2PRU A;  3B88 A;  4I5N B;  4N5X A;  5KTY A;  2JNX A;  1J1E A;  1DEK A;  1KSM A;  1OOJ A;  2M0R A;  3O6B A;  2LVV A;  2HQ8 A;  4DCK A;  2PAL A;  3CLN A;  5B8I B;  1U5I B;  1RTP 1;  3C1V A;  3GK1 A;  2ZFD A;  2FJY A;  1XK4 C;  2LVJ A;  2M97 A;  3S0D A;  4QJ4 B;  1S36 A;  4PHJ A;  4YGA A;  1L7Z A;  1NX1 A;  1C3Z A;  2SAS A;  3L4L A;  2F8P A;  3CDN A;  1AUI B;  1JUO A;  3PAT A;  4GAO A;  3A4U B;  1S5G Y;  3D0Y B;  4Q04 A;  1QLS A;  2KQY A;  2WC5 A;  1PSB A;  4PT1 A;  1SYM A;  4HSZ A;  3SS3 A;  4I5J A;  2M7N A;  2VRG A;  3BFH A;  1CM1 A;  1PAL A;  3SG4 A;  2BE4 A;  1SCM C;  2MHH A;  3EG5 B;  2ISD A;  1BG1 A;  2LLU A;  4FQT A;  1XFX O;  2EHB A;  4FQO A;  2K7D A;  1N2D A;  3BXK A;  2LCP A;  1C7V A;  2EGD A;  2BBN A;  1RJV A;  1CLM A;  1KSO A;  2ZRS A;  3I5I C;  5HLO A;  1QX7 A;  3EVR A;  3ZNI A;  1J7R A;  2WCE A;  3CYZ A;  2HET A;  1BMO A;  2BEC A;  2K0J A;  1MR8 A;  2O60 A;  4ZCV A;  1CNP A;  1B8R A;  2ZRT A;  4HRG A;  3R72 A;  1Y1X A;  1DVI A;  1XFZ O;  1PSR A;  1OE9 B;  3I5H C;  1TUZ A;  2MLF C;  3WHU B;  1JFJ A;  2LM5 A;  2QDI A;  3MSE B;  2JZI A;  3GK4 X;  4YI8 A;  1QVI Z;  1A2X A;  3S0A A;  1N0Y A;  1YRU B;  5D7F A;  2LHI A;  4WQ3 A;  2LAN A;  3R1P A;  3Q8I A;  5PAL A;  2E6W A;  1BF5 A;  1SKT A;  3LK1 A;  1DJY A;  3SJS A;  1SR6 B;  1NCY A;  3SS4 A;  1DGU A;  2NCP A;  2QEB A;  4HRE E;  2I2R E;  3EKJ A;  2JQ6 A;  3O78 A;  1A29 A;  1CFP A;  2P71 A;  3I5F B;  1CDP A;  3V2L A;  3TDZ A;  3DF0 B;  3O2P A;  1MXE A;  2PSR A;  1QAT A;  1SW8 A;  4OV2 A;  5FI2 A;  2F2O A;  1J7Q A;  5I2L A;  1QTX A;  1QX2 A;  1KCY A;  3EKH A;  1DJZ A;  2EC6 B;  2KHN A;  3TDI A;  2LLT A;  4A4B A;  5AFP A;  1J7P A;  4YGE B;  2KFH A;  3GOF A;  4XJK B;  3ZWH A;  3R1O A;  2L4H A;  5JJG A;  2K7O A;  5DKN A;  1J55 A;  1GGZ A;  4ETO A;  4JPZ B;  1A75 A;  2MRD A;  3M0W A;  3PLF B;  3SG2 A;  5I8N A;  1B8L A;  1KK8 B;  1LKJ A;  2LP3 A;  2PMY A;  1KWO C;  2KI6 C;  1P28 A;  2R2I A;  3D75 A;  3JVT B;  1FPW A;  1JSA A;  4ORB B;  2I94 A;  2ZNE A;  1DQE A;  1K93 D;  1FI5 A;  1G33 A;  2K2A A;  2LVI A;  3D76 A;  1TNW A;  3I5G B;  4KYN A;  3OB1 B;  4CLN A;  1UHK A;  2JPT A;  1QVI Y;  5KU1 A;  1M46 A;  3CZ0 A;  3DVM A;  1REC A;  3KHE A;  1N65 A;  4MRX A;  4GGF C;  2QEH A;  1JBA A;  3B86 A;  3RLZ A;  5CSI A;  1UP5 A;  2PAS A;  1K95 A;  4GFT A;  1TOP A;  1KQV A;  2KGR A;  2LMT A;  1FI6 A;  1S6J A;  5I2Q A;  1B1G A;  3CGA A;  3VRR A;  1QAS A;  1Z2C B;  3AAJ A;  1K9U A;  2K61 A;  4ORC B;  1TNP A;  4MSP A;  3DVE A;  1KQM C;  4R1E A;  2H2K A;  1DJH A;  1M31 A;  1Y6W A;  2L4I A;  1B8C A;  1A4P A;  1E8A A;  1S5G Z;  2LLS A;  1BU3 A;  4F7F A;  2QEO A;  2MAZ A;  1F54 A;  2WCL A;  1U5I A;  1WDC C;  3IVT A;  1BOD A;  3DZT A;  1TCO B;  3OHM B;  4PHK A;  1B47 A;  1NCX A;  1NYA A;  1S26 D;  1UHI A;  1Y1A A;  2KBM A;  2KNE A;  5HKW A;  4BY4 A;  5DKQ A;  3UO9 A;  2WND A;  1SL7 A;  2L2E A;  1K94 A;  3D74 A;  2MJW B;  2PYQ A;  3D0Y A;  2LAP A;  2QEV A;  3JTD B;  1B9A A;  2KGB C;  2KYC A;  4PHN A;  3B87 A;  1AJ5 A;  2H61 A;  3B6X A;  4M2P A;  1MQ1 A;  1TRF A;  4NDD A;  4U8D A;  3TUY C;  1IQ5 A;  1YTZ C;  2L0P A;  3CS1 A;  3CZ2 A;  4CPV A;  3TS5 B;  1HQV A;  1DMO A;  1F55 A;  3DY9 A;  1YUR A;  2GGM A;  1RFJ A;  2L98 A;  4YGB B;  1K9K A;  1V1G A;  2BL0 C;  2WCB A;  4AQJ A;  1EH2 A;  1MUX A;  2FCD A;  2JUL A;  1UUS A;  1AP4 A;  1OSA A;  1MF8 B;  1XFR A;  3DXL A;  3KEV A;  1DTL A;  1OOI X;  4I5K A;  3LLE A;  1RRO A;  2K2F A;  4E68 A;  1UHJ A;  5I94 A;  2CTN A;  5HKY A;  1F4Q A;  1WRZ A;  3FE6 A;  2FJU B;  2V53 A;  4MBE A;  2M9G A;  1GQM A;  2H8V A;  4C0J A;  2P70 A;  3D10 A;  1NX0 A;  2BKH B;  1G4Y R;  1TNQ A;  1C7W A;  5DKR A;  5IBW A;  5D69 A;  2CT9 A;  4M2O A;  4PE0 A;  2JT8 A;  1QJT A;  2B1U A;  1RK9 A;  2KLD A;  2CBL A;  1WRL A;  2WCK A;  2KLE A;  1BT6 A;  2L2C A;  1KK7 Z;  2K8M B;  1GM0 A;  1S6C A;  2OS8 B;  2Y1M A;  2KI4 C;  2NXQ A;  3R1V A;  1IKU A;  2H61 C;  4L9M A;  3PM2 A;  3OBV A;  3L47 A;  2L50 A;  4ZCU A;  1AK8 A;  4NDB A;  5TNC A;  2KPH A;  1CMG A;  3A8R A;  3HCM A;  1XO5 A;  3FE8 A;  1H4B A;  4DS7 A;  3OX5 A;  1NCZ A;  1QIV A;  3DF0 A;  5G08 A;  1TWO A;  3EVU A;  3CZT X;  1JWD A;  3NXA A;  4C0K A;  1IJ6 A;  2COL B;  2KYF A;  1NP8 A;  2OPO A;  2QPT A;  4XJK A;  4WQ2 A;  4GNK B;  3VRO A;  3I5H B;  4GUK A;  3SG3 A;  1CKK A;  3WXA A;  5HKZ A;  3SG6 A;  4PDZ A;  1B4C A;  4DRW A;  1M45 A;  2IS9 A;  3VB1 A;  2JU0 A;  1K8U A;  2BCB A;  3SIA A;  4WRI A;  2MBX A;  3K21 A;  1LA3 A;  1K96 A;  1LS8 A;  3FWC A;  1OZO A;  1RWY A;  1XVJ A;  2JC2 A;  1TUJ A;  2ZND A;  4JWQ A;  1CB1 A;  2OTG B;  3WHT B;  1NX2 A;  1C3Y A;  1IRJ A;  3PN7 B;  4MZJ A;  1DEL A;  1AHR A;  2WC8 A;  1R6P A;  1OQP A;  1KFU S;  1Q80 A;  1ZUZ A;  3L4A A;  2F33 A;  4PE4 A;  4C0L A;  2LMV A;  1NPQ A;  1KK7 Y;  3SS5 A;  1JF0 A;  3LK0 A;  2BCX A;  1UUR A;  3BUW B;  5FI6 A;  2GV5 A;  2MA2 A;  1CLB A;  4CFQ A;  4MVF A;  1KFU L;  2GTE A;  1SBJ A;  2LUC A;  1DF0 A;  1DJX A;  4I5L B;  2G2B A;  3OP0 A;  3FS7 A;  2P6B B;  1MHO A;  2KFG A;  5K89 A;  3BUN B;  4FTG A;  1CFF A;  3HX4 A;  1FBV A;  4M2Q A;  1HT9 A;  2LHL A;  2AAO A;  1KWO B;  1NSH A;  1IGV A;  1ALW A;  1OOF A;  2G9B A;  2K7C A;  1EL4 A;  3BOW B;  1C07 A;  3BJH A;  5BPJ A;  5AAN A;  1NX3 A;  1YVH A;  2M3W A;  4YBH B;  1W9Z A;  1NUB A;  1LXF C;  1KK8 C;  2KQ6 A;  3H4S E;  3JVT C;  2CCM A;  4ICB A;  4OZD A;  1BR4 B;  1ODB A;  2ZKM X;  4OVN F;  3PSR A;  3DYE A;  1LIN A;  3I5G C;  2LC5 A;  3N7H A;  3NSO A;  3AKA A;  1YX8 A;  1OMD A;  1EG4 A;  1AVS A;  3OGN A;  2L5Y A;  3CR5 X;  3IQQ A;  4AOM A;  1ALV A;  1YX7 A;  2HF5 A;  2WCM A;  2M1U A;  3KPX A;  4N1G A;  2Y5I A;  3FIA A;  1K9P A;  2KAY A;  3LCP C;  4XYN A;  1D1O A;  1CLL A;  3F45 A;  1H8B A;  1W7I B;  1TIZ A;  4P5O E;  1CFD A;  1WDC B;  3GK2 A;  3O4X A;  1PVB A;  2WCF A;  3PFV A;  3B7A A;  2WC6 A;  1QWV A;  3VGO A;  1PRW A;  2ERB A;  4OKH A;  4USL A;  2NCO A;  2LV7 A;  3K1E A;  3S0E A;  3VRN A;  1YUT A;  1IIO A;  1CM4 A;  2BNX A;  1XFU O;  4MZK A;  4NQG A;  2JT0 A;  2NLN A;  1L2O C;  1M63 B;  3BUX B;  4UPG A;  4IJ7 A;  3D73 A;  4INW A;  1XFW O;  5GQQ C;  1CFC A;  3JTD C;  2BE6 A;  1QLK A;  3AKB A;  1SMG A;  1XYD A;  2JRF A;  1S3P A;  1S1E A;  1TTX A;  1BLQ A;  2FOT A;  1ORG A;  2JOJ A;  3S0G A;  3AAK A;  3VRQ A;  1OMR A;  3BUM B;  2WCH A;  4GPL B;  2LVK A;  4JD9 A;  1DT7 B;  4PE7 A;  1S6I A;  2E30 A;  2KOT A;  5J3X A;  3EK4 A;  1WLZ A;  2Q91 A;  1XA5 A;  3PM8 A;  4INX A;  1SNL A;  3IQO A;  5CPV A;  5HYD A;  1PK0 D;  4ORA B;  3SG5 A;  1SCM B;  1F71 A;  2RGI A;  2K60 A;  4PHM A;  1CDL A;  2L51 A;  2F2P A;  1J7O A;  3KO0 A;  2AUC A;  3TDU A;  1W7J B;  3CTN A;  2BAP A;  3ICB A;  1ZAC A;  2JWW A;  2KFF A;  2HQW A;  3WNX B;  1BOC A;  1EXR A;  3RM1 A;  4P2Y B;  2KI4 B;  3CR2 A;  1F4O A;  1J1D A;  1LVC D;  3I5I B;  4MEW A;  1QV0 A;  2QAC A;  2SCP A;  5HL1 A;  5CSF A;  1A03 A;  1XFV O;  2CXJ A;  2ZN9 A;  1YUU A;  3FE9 A;  1CTR A;  2K7B A;  3KF9 A;  1IWQ A;  2JTT A;  4AQI A;  3SIB A;  5I2O A;  4DUQ A;  2WOR A;  1YR5 A;  2OS8 C;  2I18 A;  1FW4 A;  5HLV A;  5AEQ A;  4D1E A;  1IH0 A;  3QRX A;  1BR1 B;  3QME A;  2NZ0 A;  5F6T A;  3S0B A;  4YGC B;  3BYA A;  1YUS A;  4PE1 A;  4QJ3 B;  1QV1 A;  1VRK A;  2I7A A;  2WOS A;  2JPO A;  4YRU A;  2MLE C;  2LMU A;  1M39 A;  4MZL A;  1GGW A;  1SY9 A;  1QXP A;  3EVV A;  4OR9 B;  2M29 A;  1IJ5 A;  3NGV A;  1JF2 A;  3DVJ A;  3CZ1 A;  5DIC A;  2LNK A;  1MWN A;  3BOW A;  2TN4 A;  5CSN A;  4JQ0 D;  4CID A;  1BJF A;  1SK6 D;  4DIR A;  1NIW A;  2L5X B;  4OCI A;  1CDN A;  4MN0 A;  1WRK A;  1SR6 C;  2BCA A;  4GGF A;  3CR4 X;  3BQ3 A;  4CFR A;  2BBM A;  1DJI A;  5JOL A;  2JXL A;  1SPY A;  1DGV A;  2F3Y A;  2OTG C;  3I5F C;  2KBI A;  1OOG A;  1LA0 A;  3PN7 C;  1SCV A;  3BFA A;  5ER4 X;  2PQL A;  2DOQ A;  1MXL C;  3NSL A;  2GGZ A;  2EC6 C;  1ZFS A;  1JC2 A;  3PJI A;  1B7T Z;  4PCW A;  2HPS A;  4NDC A;  5KSZ A;  3EK7 A;  3RZS A;  2LUX A;  3O4Y A;  4GBA A;  1K2H A;  2JXC A;  1OMV A;  1DJW A;  1DJG A;  2ZN8 A;  4F0Z B;  1EJ3 A;  3CWG A;  1OOH A;  3E3R A;  1DC1 A;  1F70 A;  5AXI A;  3PAL A;  1PUL A;  3VRP A;  1WLM A;  2KAV A;  1Y1U A;  5CSJ A;  3D77 A;  4YGD B;  1EG3 A;  1OW4 A;  4QJ5 B;  1KFX S;  3SG7 A;  3S0F A;  3IF7 A;  2PVB A;  2AMI A;  2D8N A;  2KAX A;  2LP2 A;  1GJY A;  1X02 A;  2F3Z A;  1SRA A;  4YI9 A;  4BY5 A;  1KFX L;  1KQM B;  3CAB A;  1TN4 A;  3DD4 A;  3UNW A;  1UHN A;  1ZMZ A;  1QS7 A;  2LE9 B;  1R2U A;  1IQ3 A;  2M8U A;  4A4C A;  2CNP A;  5FYX A;  1ZOT B;  3NHI A;  1PVA A;  1UHH A;  1A75 B;  1DF0 B;  1SL8 A;  2JTZ A;  2YGU A;  3OX6 A;  4HRH A;  2Y4Q A;  1WY9 A;  1XK4 A;  3LL8 B;  1SL9 A;  5EL2 A;  3EK8 A;  4IL1 A;  1B7T Y;  1G8I A;  2Q4U A;  2M49 B;  1YRT B;  2O5G A;  3TZ1 A;  4MRY A;  1XFY O;  5ER5 A;  1FF1 A;  2JT3 A;  5FI7 A;  3BUO B;  3OB2 B;  5D3O A;  2M7L A;  2A4J A;  1CMF A;  3BFB A;  1TCF A;  3TUY B;  1SSE B; 
#chains in the Genus database with same CATH homology
 1IG5 A;  1QX5 B;  1JFK A;  1TNX A;  3NSI A;  1AJ4 A;  1CDM A;  2BKI B;  4TNC A;  1Y0V H;  3NSK A;  4N1F A;  1QIW A;  2KSP A;  1F8H A;  5AER A;  4PAL A;  1L2O B;  4MLW A;  1OZS A;  2BL0 B;  2KDH A;  2M1K B;  2JNF A;  2KI6 D;  4GGN A;  2FCE A;  1V1F A;  1K90 D;  1UWO A;  2Y1N A;  3DVK A;  3FWB A;  3TS5 C;  1YVL A;  1NWD A;  2PRU A;  4I5N B;  4N5X A;  5KTY A;  2JNX A;  1J1E A;  1KSM A;  1OOJ A;  2M0R A;  3O6B A;  2LVV A;  2HQ8 A;  4DCK A;  2PAL A;  3CLN A;  5B8I B;  1U5I B;  1RTP 1;  3C1V A;  3GK1 A;  2ZFD A;  1XK4 C;  2LVJ A;  2M97 A;  4QJ4 B;  1S36 A;  4PHJ A;  4YGA A;  1L7Z A;  1NX1 A;  2SAS A;  2F8P A;  1AUI B;  1JUO A;  3PAT A;  4GAO A;  3A4U B;  1S5G Y;  3D0Y B;  4Q04 A;  1QLS A;  2KQY A;  1PSB A;  1SYM A;  4HSZ A;  4I5J A;  2M7N A;  2VRG A;  1CM1 A;  1PAL A;  3SG4 A;  2BE4 A;  1SCM C;  2MHH A;  2ISD A;  1BG1 A;  2LLU A;  1XFX O;  2EHB A;  4FQO A;  2K7D A;  1N2D A;  3BXK A;  2LCP A;  1C7V A;  2EGD A;  2BBN A;  1RJV A;  1CLM A;  1KSO A;  2ZRS A;  3I5I C;  5HLO A;  1QX7 A;  3EVR A;  3ZNI A;  1J7R A;  2WCE A;  2HET A;  1BMO A;  2BEC A;  2K0J A;  1MR8 A;  2O60 A;  4ZCV A;  1CNP A;  1B8R A;  2ZRT A;  4HRG A;  1Y1X A;  1DVI A;  1XFZ O;  1PSR A;  1OE9 B;  3I5H C;  3WHU B;  2MLF C;  1JFJ A;  2LM5 A;  3MSE B;  2JZI A;  3GK4 X;  4YI8 A;  1QVI Z;  1A2X A;  1N0Y A;  1YRU B;  5D7F A;  2LHI A;  4WQ3 A;  2LAN A;  5PAL A;  2E6W A;  1BF5 A;  1SKT A;  3LK1 A;  1DJY A;  3SJS A;  1SR6 B;  1NCY A;  1DGU A;  2NCP A;  4HRE E;  2I2R E;  3EKJ A;  2JQ6 A;  3O78 A;  1A29 A;  1CFP A;  3I5F B;  1CDP A;  3TDZ A;  3DF0 B;  3O2P A;  1MXE A;  2PSR A;  1QAT A;  1SW8 A;  4OV2 A;  2F2O A;  1J7Q A;  5I2L A;  1QTX A;  1QX2 A;  1KCY A;  3EKH A;  1DJZ A;  2EC6 B;  2KHN A;  3TDI A;  2LLT A;  4A4B A;  5AFP A;  1J7P A;  4YGE B;  2KFH A;  3GOF A;  4XJK B;  3ZWH A;  2L4H A;  5JJG A;  2K7O A;  5DKN A;  1J55 A;  1GGZ A;  4ETO A;  4JPZ B;  1A75 A;  2MRD A;  3M0W A;  3PLF B;  3SG2 A;  5I8N A;  1B8L A;  1KK8 B;  1LKJ A;  2LP3 A;  2PMY A;  1KWO C;  2KI6 C;  2R2I A;  1FPW A;  3JVT B;  1JSA A;  4ORB B;  2I94 A;  2ZNE A;  1K93 D;  1FI5 A;  1G33 A;  2K2A A;  2LVI A;  1TNW A;  3I5G B;  3OB1 B;  4CLN A;  1UHK A;  2JPT A;  1QVI Y;  5KU1 A;  1M46 A;  3DVM A;  4MRX A;  1REC A;  3KHE A;  1N65 A;  4GGF C;  1JBA A;  3RLZ A;  5CSI A;  1UP5 A;  2PAS A;  1K95 A;  4GFT A;  1TOP A;  1KQV A;  2KGR A;  2LMT A;  1FI6 A;  1S6J A;  5I2Q A;  1B1G A;  3CGA A;  3VRR A;  1QAS A;  3AAJ A;  1K9U A;  2K61 A;  4ORC B;  1TNP A;  4MSP A;  3DVE A;  1KQM C;  4R1E A;  2H2K A;  1DJH A;  1M31 A;  1Y6W A;  2L4I A;  1B8C A;  1A4P A;  1E8A A;  1S5G Z;  2LLS A;  1BU3 A;  2MAZ A;  1F54 A;  1U5I A;  1WDC C;  1BOD A;  1TCO B;  3OHM B;  4PHK A;  1B47 A;  1NCX A;  1NYA A;  1S26 D;  1UHI A;  1Y1A A;  2KBM A;  2KNE A;  5HKW A;  4BY4 A;  5DKQ A;  2WND A;  1SL7 A;  2L2E A;  1K94 A;  2MJW B;  3D0Y A;  2LAP A;  3JTD B;  1B9A A;  2KGB C;  2KYC A;  4PHN A;  1AJ5 A;  2H61 A;  4M2P A;  4NDD A;  1MQ1 A;  1TRF A;  4U8D A;  3TUY C;  1IQ5 A;  1YTZ C;  2L0P A;  3CS1 A;  4CPV A;  3TS5 B;  1HQV A;  1DMO A;  1F55 A;  1YUR A;  2GGM A;  1RFJ A;  2L98 A;  4YGB B;  1K9K A;  1V1G A;  2BL0 C;  2WCB A;  4AQJ A;  1EH2 A;  1MUX A;  2FCD A;  2JUL A;  1UUS A;  1AP4 A;  1OSA A;  1MF8 B;  3KEV A;  1DTL A;  4I5K A;  3LLE A;  1RRO A;  2K2F A;  4E68 A;  1UHJ A;  2CTN A;  5HKY A;  1F4Q A;  1WRZ A;  2FJU B;  2V53 A;  4MBE A;  2M9G A;  1GQM A;  4C0J A;  3D10 A;  1NX0 A;  2BKH B;  1G4Y R;  1TNQ A;  1C7W A;  5DKR A;  5IBW A;  5D69 A;  2CT9 A;  4M2O A;  4PE0 A;  2JT8 A;  1QJT A;  2B1U A;  1RK9 A;  2CBL A;  1WRL A;  1BT6 A;  1KK7 Z;  2K8M B;  1S6C A;  2OS8 B;  2Y1M A;  2KI4 C;  2NXQ A;  1IKU A;  2H61 C;  4L9M A;  1AK8 A;  2L50 A;  4ZCU A;  4NDB A;  5TNC A;  1CMG A;  3A8R A;  3HCM A;  1XO5 A;  1H4B A;  4DS7 A;  3OX5 A;  1NCZ A;  1QIV A;  3DF0 A;  5G08 A;  3EVU A;  3CZT X;  1JWD A;  3NXA A;  4C0K A;  1IJ6 A;  2COL B;  2KYF A;  1NP8 A;  2OPO A;  2QPT A;  4XJK A;  4WQ2 A;  4GNK B;  3VRO A;  3I5H B;  4GUK A;  3SG3 A;  1CKK A;  3WXA A;  5HKZ A;  3SG6 A;  4PDZ A;  1B4C A;  4DRW A;  1M45 A;  2IS9 A;  2JU0 A;  1K8U A;  2BCB A;  3SIA A;  4WRI A;  2MBX A;  3K21 A;  1LA3 A;  1K96 A;  3FWC A;  1OZO A;  1RWY A;  1XVJ A;  2JC2 A;  2ZND A;  4JWQ A;  1CB1 A;  2OTG B;  3WHT B;  1NX2 A;  1IRJ A;  3PN7 B;  4MZJ A;  1AHR A;  2WC8 A;  1R6P A;  1OQP A;  1KFU S;  1Q80 A;  1ZUZ A;  4PE4 A;  2F33 A;  4C0L A;  2LMV A;  1NPQ A;  1KK7 Y;  1JF0 A;  3LK0 A;  2BCX A;  1UUR A;  3BUW B;  2GV5 A;  2MA2 A;  1CLB A;  4CFQ A;  4MVF A;  1KFU L;  1SBJ A;  2LUC A;  1DF0 A;  1DJX A;  4I5L B;  2G2B A;  3OP0 A;  3FS7 A;  2P6B B;  1MHO A;  2KFG A;  5K89 A;  3BUN B;  4FTG A;  1CFF A;  3HX4 A;  1FBV A;  4M2Q A;  1HT9 A;  2LHL A;  2AAO A;  1KWO B;  1NSH A;  1IGV A;  1ALW A;  2G9B A;  2K7C A;  1EL4 A;  3BOW B;  1C07 A;  5BPJ A;  5AAN A;  1NX3 A;  1YVH A;  2M3W A;  4YBH B;  1NUB A;  1LXF C;  1KK8 C;  2KQ6 A;  3H4S E;  3JVT C;  2CCM A;  4ICB A;  1BR4 B;  1ODB A;  2ZKM X;  4OVN F;  3PSR A;  1LIN A;  3I5G C;  2LC5 A;  3NSO A;  3AKA A;  1YX8 A;  1OMD A;  1EG4 A;  1AVS A;  3CR5 X;  3IQQ A;  4AOM A;  1ALV A;  1YX7 A;  2HF5 A;  2M1U A;  3KPX A;  4N1G A;  2Y5I A;  3FIA A;  1K9P A;  2KAY A;  3LCP C;  4XYN A;  1D1O A;  1CLL A;  3F45 A;  1H8B A;  1W7I B;  1TIZ A;  4P5O E;  1CFD A;  1WDC B;  3GK2 A;  1PVB A;  2WCF A;  3PFV A;  3VGO A;  1PRW A;  4OKH A;  4USL A;  2NCO A;  2LV7 A;  3VRN A;  1YUT A;  1CM4 A;  1XFU O;  4MZK A;  4NQG A;  2JT0 A;  2NLN A;  1L2O C;  1M63 B;  3BUX B;  4UPG A;  1XFW O;  5GQQ C;  1CFC A;  3JTD C;  2BE6 A;  1QLK A;  3AKB A;  1SMG A;  1XYD A;  2JRF A;  1S3P A;  1S1E A;  1TTX A;  1BLQ A;  2FOT A;  2JOJ A;  3VRQ A;  3AAK A;  1OMR A;  3BUM B;  4GPL B;  2LVK A;  1DT7 B;  4PE7 A;  1S6I A;  2E30 A;  2KOT A;  5J3X A;  3EK4 A;  1WLZ A;  2Q91 A;  1XA5 A;  3PM8 A;  1SNL A;  3IQO A;  5CPV A;  5HYD A;  1PK0 D;  4ORA B;  3SG5 A;  1SCM B;  1F71 A;  2RGI A;  4PHM A;  1CDL A;  2L51 A;  2F2P A;  1J7O A;  3KO0 A;  2AUC A;  3TDU A;  1W7J B;  3CTN A;  3ICB A;  1ZAC A;  2JWW A;  2KFF A;  2HQW A;  3WNX B;  1BOC A;  1EXR A;  3RM1 A;  4P2Y B;  2KI4 B;  3CR2 A;  1F4O A;  1J1D A;  1LVC D;  3I5I B;  4MEW A;  1QV0 A;  2QAC A;  2SCP A;  1A03 A;  5CSF A;  1XFV O;  2CXJ A;  2ZN9 A;  1YUU A;  3KF9 A;  1CTR A;  2K7B A;  5I2O A;  1IWQ A;  2JTT A;  4AQI A;  3SIB A;  4DUQ A;  2WOR A;  1YR5 A;  2OS8 C;  2I18 A;  1FW4 A;  5HLV A;  5AEQ A;  4D1E A;  1IH0 A;  3QRX A;  1BR1 B;  2NZ0 A;  5F6T A;  4YGC B;  3BYA A;  1YUS A;  4PE1 A;  4QJ3 B;  1QV1 A;  1VRK A;  2I7A A;  2WOS A;  4YRU A;  2MLE C;  2LMU A;  1M39 A;  4MZL A;  1GGW A;  1SY9 A;  1QXP A;  3EVV A;  4OR9 B;  2M29 A;  1IJ5 A;  1JF2 A;  3DVJ A;  2LNK A;  1MWN A;  3BOW A;  2TN4 A;  5CSN A;  4JQ0 D;  4CID A;  1BJF A;  1SK6 D;  4DIR A;  1NIW A;  2L5X B;  4OCI A;  1CDN A;  4MN0 A;  1WRK A;  1SR6 C;  2BCA A;  4GGF A;  3CR4 X;  3BQ3 A;  4CFR A;  2BBM A;  1DJI A;  5JOL A;  2JXL A;  1SPY A;  1DGV A;  2F3Y A;  2OTG C;  3I5F C;  2KBI A;  1LA0 A;  3PN7 C;  1SCV A;  5ER4 X;  2DOQ A;  1MXL C;  3NSL A;  2GGZ A;  2EC6 C;  1ZFS A;  1JC2 A;  1B7T Z;  4PCW A;  2HPS A;  4NDC A;  5KSZ A;  3EK7 A;  1K2H A;  2LUX A;  3O4Y A;  4GBA A;  2JXC A;  1OMV A;  1DJW A;  1DJG A;  2ZN8 A;  4F0Z B;  1EJ3 A;  3CWG A;  1F70 A;  3E3R A;  5AXI A;  3PAL A;  1PUL A;  3VRP A;  1WLM A;  2KAV A;  1Y1U A;  5CSJ A;  4YGD B;  1EG3 A;  4QJ5 B;  1KFX S;  3SG7 A;  3IF7 A;  2PVB A;  2AMI A;  2D8N A;  2KAX A;  2LP2 A;  1GJY A;  1X02 A;  2F3Z A;  1SRA A;  4YI9 A;  4BY5 A;  1KFX L;  1KQM B;  1TN4 A;  3DD4 A;  1UHN A;  1ZMZ A;  1QS7 A;  2LE9 B;  1R2U A;  1IQ3 A;  2M8U A;  4A4C A;  2CNP A;  5FYX A;  1ZOT B;  1PVA A;  1UHH A;  1A75 B;  1DF0 B;  1SL8 A;  2JTZ A;  3OX6 A;  4HRH A;  2Y4Q A;  1WY9 A;  1XK4 A;  3LL8 B;  1SL9 A;  3EK8 A;  4IL1 A;  1B7T Y;  1G8I A;  2Q4U A;  2M49 B;  1YRT B;  2O5G A;  3TZ1 A;  4MRY A;  1XFY O;  5ER5 A;  1FF1 A;  2JT3 A;  2M7L A;  3BUO B;  3OB2 B;  2A4J A;  1CMF A;  1TCF A;  3TUY B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...