2HF5A

The structure and function of a novel two-site calcium-binding fragment of calmodulin
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
68
structure length
68
Chain Sequence
AELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords Calmodulin
publication title Calcium-induced folding of a fragment of calmodulin composed of EF-hands 2 and 3
pubmed doi rcsb
source organism Homo sapiens
total genus 15
structure length 68
sequence length 68
ec nomenclature
pdb deposition date 2006-06-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2hf5A00
2EC6C 1NWDA 1K90D 2I7AA 2GV5A 4C0KA 4AQJA 4N1GA 1C07A 2FCDA 2DOQA 1UURA 1PK0D 1QATA 1CLMA 2LHIA 3DVEA 1RROA 1SPYA 1KK7Y 1SBJA 3EVRA 4NDCA 4BY5A 2F33A 3WNXB 2HETA 2K7DA 3KHEA 1W7JB 2KI6D 5GQQC 1EXRA 4HRHA 1TN4A 2SCPA 3I5IB 4P5OE 5J3XA 3TDUA 1BODA 1CDMA 1S5GZ 2GGZA 3ICBA 2E30A 1B8CA 1U5IA 1UHHA 2EHBA 2FCEA 2Q4UA 1BR1B 3EK8A 2M97A 2JWWA 1S1EA 5AEQA 1W7IB 1MHOA 3OX6A 2JTZA 2LVJA 2LP2A 2Q91A 2K7CA 3LCPC 2JTTA 4GGFC 1NX2A 4MSPA 1G8IA 3JVTB 2M1UA 1QV1A 3DF0B 4YRUA 5HYDA 3SJSA 2PMYA 2Y5IA 3BYAA 3NSOA 3SG5A 1QVIZ 2KFHA 1KK8C 2LLUA 1CFDA 3PM8A 3SG4A 1S6JA 1Q80A 1KSMA 2JNXA 2L0PA 1UHKA 1C7VA 5CSJA 1A03A 3FS7A 1DJXA 1Y1UA 2PRUA 1WRLA 2WNDA 1NIWA 2R2IA 4YBHB 2JQ6A 1Y1XA 2JOJA 3CR5X 5BPJA 1OMDA 5G08A 1DGUA 2F2PA 2KHNA 3TS5C 1IWQA 3WHUB 1TCFA 5HLOA 2I2RE 1YUSA 1DVIA 1KSOA 1SL8A 2ZNEA 1YRTB 1YVLA 1X02A 4ORCB 4M2OA 1DJWA 4XJKB 3M0WA 4D1EA 4M2PA 4MZKA 1JC2A 4GPLB 1DTLA 3I5HB 3KO0A 2RGIA 1UHJA 2KI4C 1TOPA 1TNWA 5KTYA 2M1KB 1BF5A 1YX8A 1NP8A 1M46A 1EJ3A 1EG3A 1ZUZA 2PSRA 4C0JA 3NSKA 2K2AA 1XFYO 1K8UA 1SKTA 1KQMC 4A4BA 1AHRA 2M49B 2ZNDA 2BL0B 2H61C 1ALVA 1PSRA 1VRKA 4GFTA 1UP5A 2KGBC 2KGRA 3VGOA 4ORBB 1C7WA 1OMVA 3TDIA 4I5JA 2I18A 3OHMB 1H4BA 2LM5A 5I2OA 1SY9A 3CR2A 3SG2A 4IL1A 1WDCB 1U5IB 1KFUS 1CB1A 1B7TZ 2KSPA 1L2OB 1G33A 2JT0A 1NCXA 2KBIA 1ZOTB 3EVVA 2PASA 4YGBB 1NPQA 1CFCA 2KAXA 3KEVA 4I5NB 2KAYA 1TCOB 1FW4A 4PHNA 1UUSA 1UHNA 1UWOA 2M0RA 4Q04A 2LVIA 2NXQA 2OS8C 4XJKA 2MLFC 1A2XA 3GK4X 1SMGA 4FQOA 4GBAA 3LK0A 3NSLA 5D69A 1J7RA 3ZNIA 4AOMA 3OP0A 2KFFA 4GUKA 1S36A 1V1FA 3EKJA 4YGDB 1GGZA 2BE6A 2KBMA 4XYNA 2KYFA 5I2LA 5I8NA 1WLMA 2FJUB 1OE9B 2ZN9A 1B47A 2ISDA 1LA3A 3D10A 1XO5A 5DKQA 1JF2A 1Y1AA 3PN7C 3EK7A 3GK2A 1MR8A 3I5FB 1SR6B 5KU1A 3K21A 1JUOA 4YI9A 2CCMA 5KSZA 4OKHA 4ORAB 4USLA 2OTGC 2K2FA 2BECA 1CNPA 2LUCA 1WY9A 3I5GB 1B9AA 2CT9A 1NX0A 1ZACA 1QIVA 3TZ1A 4JPZB 1J55A 3PFVA 1B8RA 1YVHA 3RLZA 4E68A 4PCWA 2K8MB 1EH2A 1B1GA 3CTNA 3BXKA 2AMIA 5JOLA 1XA5A 1J7QA 4L9MA 1FF1A 2KI6C 2K7OA 1N2DA 2WORA 4YGCB 5IBWA 2KAVA 4PE1A 2QPTA 1ZMZA 3CZTX 1K9UA 2LLSA 1S5GY 2LAPA 2EC6B 4TNCA 1J7OA 1HQVA 2D8NA 2CXJA 3VRRA 1LA0A 4CFQA 1NUBA 1CFFA 1XFUO 3E3RA 3IF7A 2H61A 3A4UB 1AK8A 5B8IB 1CMGA 1BR4B 2CNPA 3ZWHA 5CSFA 2BCBA 4MBEA 1QIWA 3JTDC 5HKWA 2MHHA 2KNEA 1A75A 4R1EA 1TIZA 2SASA 1KWOC 1UHIA 1DMOA 3GOFA 3O6BA 1JBAA 4U8DA 1XFXO 1QVIY 4OVNF 3RM1A 4MZLA 3PSRA 2IS9A 3TUYC 2F3YA 2K0JA 3PATA 2JULA 1PALA 1RECA 2L4HA 3VRNA 2LMTA 4OV2A 2K7BA 1XFVO 1RTP1 3SG6A 4QJ5B 1J7PA 4UPGA 1CMFA 1M45A 4ZCUA 4MN0A 4MLWA 1M31A 3CR4X 3PLFB 2LNKA 1A29A 1DT7B 5ER5A 1Y6WA 2MLEC 2M9GA 1DGVA 1R2UA 5CPVA 1QTXA 1CLLA 1KK8B 1XK4C 1YTZC 1B8LA 1WLZA 2CTNA 4HRGA 1IJ5A 1K9KA 4MRYA 1TNXA 3F45A 1BT6A 1NCZA 4QJ4B 1TNPA 1F4QA 4CFRA 1QLSA 1DF0A 3TDZA 1GJYA 1PVAA 2BE4A 2AAOA 1G4YR 1KFXS 2ZRSA 3LL8B 4DS7A 1H8BA 2JZIA 1BG1A 1K93D 1KFUL 1ODBA 4MVFA 4M2QA 1F54A 1IQ5A 2E6WA 2LANA 3TS5B 2KDHA 4I5LB 2L50A 2O60A 4PALA 1SCMC 2V53A 3LLEA 4ICBA 1PULA 2KQYA 2GGMA 2O5GA 4PE4A 1CKKA 1SK6D 5DKNA 2WCBA 3QRXA 3FIAA 4OR9B 2LCPA 2MJWB 4PHMA 1RFJA 2KI4B 2G9BA 1DJYA 1E8AA 1PVBA 1QLKA 4PE7A 1YURA 2K61A 1CTRA 3SIBA 4ETOA 1CM1A 1IH0A 1F71A 1J1EA 4GGFA 1B7TY 1PSBA 1SW8A 3EVUA 4BY4A 1KQMB 1LXFC 4OCIA 1D1OA 2LC5A 4P2YB 1BLQA 5HKYA 2HQWA 2CBLA 1XFZO 1BOCA 2Y1MA 4C0LA 1K9PA 4NDDA 2LE9B 1XFWO 1J1DA 1QASA 4PDZA 2WOSA 1AUIB 1A75B 3C1VA 1DJZA 1KK7Z 3BQ3A 3D0YA 4F0ZB 4MRXA 4HSZA 2WCFA 1SYMA 2MBXA 1YRUB 4WRIA 5DKRA 1AJ4A 1QS7A 1ZFSA 1F8HA 1JSAA 1B4CA 3JVTC 2ZKMX 1MXLC 2M7NA 2L98A 2MAZA 1IGVA 2NZ0A 1AP4A 1A4PA 1LVCD 3AAKA 2L2EA 1L7ZA 3SG3A 2OS8B 2PVBA 1M63B 4AQIA 5JJGA 2BKIB 3CS1A 2F2OA 5HKZA 3HX4A 1JFJA 1EL4A 1CFPA 3DVMA 4QJ3B 1QV0A 1MWNA 4CPVA 2LVVA 4A4CA 2BCAA 3GK1A 1S6CA 4NQGA 1K94A 3WHTB 1SL7A 1Y0VH 1QXPA 1M39A 1YUTA 3BOWA 1JFKA 1CDNA 2WCEA 1K2HA 1F55A 2ZFDA 1DF0B 1XK4A 1EG4A 2Y1NA 2JT8A 2M3WA 3BUMB 1FPWA 1RWYA 4JWQA 3PN7B 2L4IA 1S3PA 2L5XB 4YGEB 5FYXA 3FWCA 4DIRA 5CSNA 1BU3A 3OB1B 3I5HC 2OTGB 1K96A 1RJVA 3VROA 1FI6A 4GAOA 4PHJA 5AERA 1IJ6A 1KCYA 3SIAA 4PE0A 3HCMA 2MRDA 1K95A 4YGAA 1LKJA 1TNQA 3MSEB 3SG7A 1MQ1A 2BKHB 2HF5A 2A4JA 4ZCVA 2LMVA 3VRPA 2KQ6A 1OQPA 3O2PA 1KQVA 4JQ0D 2BL0C 1YX7A 1CM4A 2M29A 2JU0A 3AKAA 3NSIA 3AAJA 2KYCA 1NSHA 4MEWA 1WRZA 3KF9A 1XVJA 2F8PA 4DUQA 5ER4X 2NCOA 1JWDA 1NCYA 3CGAA 1LINA 4WQ2A 4NDBA 2G2BA 1CDLA 4MZJA 1WDCC 1PRWA 1JF0A 1NYAA 1WRKA 1YR5A 2BBMA 3FWBA 1ALWA 2HQ8A 1IQ3A 2Y4QA 1MUXA 1OSAA 2OPOA 2JC2A 5AXIA 1QX5B 1L2OC 3NXAA 3DD4A 3O78A 1F4OA 1S26D 2VRGA 3OB2B 1QX7A 1IRJA 1KFXL 5CSIA 1F70A 2COLB 3D0YB 1NX1A 3WXAA 3DVJA 5F6TA 2F3ZA 2P6BB 2H2KA 3A8RA 2ZRTA 2M7LA 1MF8B 1SRAA 1TTXA 1CDPA 1YUUA 2KOTA 3CWGA 3JTDB 2LUXA 5PALA 4HREE 1MXEA 1KWOB 2LP3A 2WC8A 1GQMA 4GGNA 5HLVA 3KPXA 1HT9A 2JRFA 2LLTA 1CLBA 1N0YA 3EK4A 2JXCA 2NCPA 3BUWB 2M8UA 3TUYB 2B1UA 1OZSA 1BJFA 1N65A 3PALA 1GGWA 2TN4A 3DF0A 4PHKA 4N5XA 3CLNA 1OZOA 5K89A 5AANA 5TNCA 1RK9A 2AUCA 3OX5A 3O4YA 1XYDA 4DRWA 1OMRA 1IKUA 3BUXB 4GNKB 3BOWB 1SR6C 3I5FC 1SNLA 4DCKA 2EGDA 3BUNB 2BBNA 3AKBA 2BCXA 2ZN8A 2MA2A 3DVKA 2PALA 2JT3A 2LHLA 2LVKA 1NX3A 3I5IC 1DJHA 2L51A 3EKHA 4FTGA 3I5GC 5I2QA 1OOJA 2LV7A 1V1GA 3VRQA 1FI5A 1S6IA 1BMOA 2QACA 1QX2A 4CIDA 3IQOA 1SL9A 2HPSA 1DJIA 1R6PA 2JNFA 2KFGA 3IQQA 4I5KA 4WQ3A 1AJ5A 3BUOB 1DJGA 1FBVA 2JPTA 4CLNA 1TRFA 3H4SE 2NLNA 1IG5A 5AFPA 4YI8A 4N1FA 5D7FA 2LMUA 1SCMB 2JXLA 1AVSA 2I94A 3LK1A 1SCVA 2FOTA 1QJTA
chains in the Genus database with same CATH superfamily
2EC6C 1NWDA 1K90D 2I7AA 2GV5A 4C0KA 4AQJA 4N1GA 1C07A 3L4AA 2QEHA 2FCDA 2DOQA 1UURA 1PK0D 1QATA 1CLMA 2LHIA 3B88A 3DVEA 1RROA 1SPYA 1KK7Y 1SBJA 3EVRA 4NDCA 3UO9A 5D3OA 4BY5A 2F33A 4OZDA 3WNXB 2KPHA 2HETA 2K7DA 3KHEA 1W7JB 2KI6D 5GQQC 1EXRA 4HRHA 1TN4A 2SCPA 3I5IB 4P5OE 5J3XA 3SS5A 3CZ2A 3R1OA 3TDUA 1BODA 1CDMA 1S5GZ 2GGZA 3ICBA 1GM0A 2E30A 1B8CA 1U5IA 1UHHA 2EHBA 2FCEA 2Q4UA 1BR1B 3EK8A 2M97A 2L5YA 2JWWA 1S1EA 3CZ1A 5AEQA 1W7IB 1MHOA 1OOHA 1Z2CB 3OX6A 2JTZA 2LVJA 2LP2A 2Q91A 2K7CA 3LCPC 5HL1A 2JTTA 3N7HA 4GGFC 3VB1A 1NX2A 4MSPA 1G8IA 3JVTB 3D77A 3IVTA 2M1UA 1QV1A 1TUZA 3DF0B 4YRUA 5HYDA 3SJSA 2PMYA 2Y5IA 3BYAA 3NSOA 3SG5A 1QVIZ 2KFHA 1KK8C 2LLUA 1CFDA 3PM8A 3SG4A 1S6JA 1OOGA 1Q80A 2K60A 1KSMA 2JNXA 2L0PA 1UHKA 1C7VA 3EG5B 5CSJA 1A03A 3FS7A 1DJXA 1Y1UA 2PRUA 1WRLA 2WNDA 1NIWA 2R2IA 4YBHB 2JQ6A 1Y1XA 2JOJA 3CR5X 5BPJA 1OMDA 5G08A 1DGUA 2F2PA 2KHNA 3TS5C 1IWQA 1Z4HA 1TCFA 5HLOA 2I2RE 1YUSA 3WHUB 2KLEA 1DVIA 1KSOA 1SL8A 2ZNEA 3FE6A 1YRTB 1YVLA 1X02A 4ORCB 4M2OA 1DJWA 4XJKB 3M0WA 4D1EA 4M2PA 4MZKA 1JC2A 4GPLB 1DTLA 3I5HB 3KO0A 2RGIA 1UHJA 2KI4C 2WC5A 1TOPA 1TNWA 5KTYA 2M1KB 5DICA 1BF5A 1YX8A 1NP8A 1M46A 1EJ3A 1EG3A 1ZUZA 2PSRA 4C0JA 3NSKA 2K2AA 1XFYO 1K8UA 1SKTA 1KQMC 4A4BA 1AHRA 2M49B 1QWVA 2ZNDA 2BL0B 2H61C 1ALVA 1PSRA 2QDIA 1VRKA 4GFTA 1UP5A 2KGBC 2KGRA 2JPOA 3VGOA 4ORBB 1C7WA 1OMVA 3TDIA 4I5JA 2I18A 3OHMB 1H4BA 2LM5A 5I2OA 1SY9A 3CR2A 3SG2A 4IL1A 1WDCB 1U5IB 1KFUS 1CB1A 1B7TZ 1TUJA 2KSPA 3S0BA 2PYQA 1L2OB 1G33A 2JT0A 1NCXA 2KBIA 1ZOTB 3EVVA 2PASA 4YGBB 1NPQA 1CFCA 2KAXA 3KEVA 4I5NB 2KAYA 2WCMA 2PQLA 1TCOB 1FW4A 4PHNA 1UUSA 1UHNA 1UWOA 2M0RA 3D78A 1C3ZA 2LVIA 2NXQA 4Q04A 5FI6A 2OS8C 4XJKA 2MLFC 1A2XA 3GK4X 1SMGA 4FQOA 4GBAA 3CYZA 3L47A 3LK0A 3NSLA 5D69A 1J7RA 3ZNIA 4AOMA 5I94A 3D73A 3OP0A 2KFFA 4GUKA 1S36A 1V1FA 3EKJA 4YGDB 1GGZA 2BE6A 2KBMA 4XYNA 2KYFA 5I2LA 5I8NA 1WLMA 2FJUB 1OE9B 2ZN9A 1B47A 2ISDA 1LA3A 3CDNA 3D10A 1XO5A 5DKQA 1DELA 1JF2A 1Y1AA 3PN7C 3EK7A 3GK2A 1MR8A 3I5FB 1SR6B 5FI7A 5KU1A 3K21A 1JUOA 4YI9A 2CCMA 5KSZA 4OKHA 4ORAB 2P71A 5FI2A 4USLA 2OTGC 3BJHA 2K2FA 2BECA 1CNPA 2LUCA 1WY9A 3I5GB 1B9AA 1NX0A 1ZACA 2CT9A 1QIVA 3TZ1A 4JPZB 1J55A 3PFVA 1B8RA 1OW4A 1YVHA 3RLZA 3B7AA 4E68A 4PCWA 2K8MB 3QMEA 1EH2A 1B1GA 3CTNA 3BXKA 2AMIA 5JOLA 1XA5A 1J7QA 4L9MA 3B6XA 1FF1A 2KI6C 2K7OA 1P28A 1N2DA 2WORA 4YGCB 5IBWA 2KAVA 4PE1A 3S0EA 2QPTA 3L4LA 1ZMZA 3CZTX 1K9UA 2LLSA 1S5GY 2LAPA 2EC6B 3BFAA 3FE9A 4TNCA 1J7OA 1HQVA 2D8NA 2CXJA 3VRRA 1LA0A 4CFQA 1XFRA 1NUBA 3V2LA 1CFFA 1XFUO 3E3RA 3IF7A 2H61A 3A4UB 3R72A 1AK8A 5B8IB 2FJYA 1IIOA 2BAPA 1CMGA 1BR4B 2CNPA 3ZWHA 5CSFA 1W9ZA 2QEBA 4PT1A 2BCBA 4MBEA 1QIWA 3DYEA 3JTDC 5HKWA 2MHHA 2KNEA 1A75A 4R1EA 1TIZA 2SASA 1KWOC 1UHIA 1DMOA 3GOFA 3O6BA 1JBAA 4U8DA 1XFXO 1QVIY 4OVNF 3RM1A 3NHTA 4MZLA 3PSRA 2IS9A 3TUYC 2F3YA 2K0JA 3PATA 2JULA 1PALA 1RECA 2L4HA 3VRNA 2LMTA 4OV2A 2K7BA 1XFVO 1RTP1 3SG6A 4QJ5B 1J7PA 4UPGA 1CMFA 3BFBA 1M45A 3S0DA 3PM2A 4ZCUA 4MN0A 4MLWA 1M31A 3CR4X 3K1EA 2LNKA 3PLFB 1A29A 1DT7B 5ER5A 1Y6WA 2MLEC 2M9GA 1DGVA 1R2UA 5CPVA 1QTXA 1CLLA 1KK8B 1XK4C 1YTZC 1B8LA 1WLZA 2CTNA 4HRGA 1IJ5A 1K9KA 4MRYA 1TNXA 3F45A 1BT6A 1NCZA 2QEVA 4QJ4B 1TNPA 1F4QA 4CFRA 1QLSA 1DF0A 4INWA 3TDZA 1GJYA 1PVAA 2BE4A 2WCJA 1DC1A 2AAOA 1G4YR 1KFXS 2ZRSA 3LL8B 4DS7A 1H8BA 2JZIA 1BG1A 1K93D 1KFUL 1ODBA 4MVFA 4M2QA 1F54A 1IQ5A 1ORGA 2E6WA 2GTEA 2LANA 3CZ0A 3TS5B 2KDHA 4I5LB 2L50A 2O60A 2YGUA 3CABA 4PALA 1SCMC 3OBVA 2V53A 3LLEA 3NHIA 4ICBA 1PULA 2KQYA 2GGMA 2O5GA 4PE4A 1CKKA 1SK6D 5DKNA 2WCBA 3QRXA 3FIAA 1T14A 4OR9B 2LCPA 2MJWB 4PHMA 1RFJA 2KI4B 2G9BA 1DJYA 1E8AA 1PVBA 1QLKA 4PE7A 1YURA 2K61A 1CTRA 3SIBA 4ETOA 1CM1A 1IH0A 1F71A 1J1EA 4GGFA 1B7TY 1PSBA 1SW8A 3EVUA 4BY4A 1KQMB 1LXFC 4OCIA 1D1OA 2LC5A 3SS3A 4P2YB 1BLQA 5HKYA 2HQWA 3O4XA 2ERBA 2CBLA 1XFZO 1BOCA 2Y1MA 3I5IC 4C0LA 1K9PA 4NDDA 2LE9B 1XFWO 1J1DA 1QASA 4PDZA 2WOSA 1AUIB 1A75B 3C1VA 1DJZA 1KK7Z 3BQ3A 3D0YA 4F0ZB 4MRXA 4HSZA 2WCFA 1SYMA 2H8VA 2MBXA 1YRUB 4WRIA 5DKRA 1AJ4A 1QS7A 1ZFSA 1F8HA 1JSAA 1B4CA 3JVTC 2ZKMX 1MXLC 2KLDA 3BFHA 3NGVA 2M7NA 2L98A 2MAZA 1IGVA 2NZ0A 3Q8IA 1AP4A 1A4PA 1LVCD 3AAKA 2L2EA 1L7ZA 3SG3A 2OS8B 2PVBA 1M63B 4AQIA 5JJGA 2BKIB 3CS1A 2F2OA 5HKZA 3HX4A 1JFJA 1EL4A 1CFPA 3DVMA 4QJ3B 1QV0A 1MWNA 3PJIA 4CPVA 2LVVA 4A4CA 4INXA 2BCAA 3GK1A 1S6CA 4NQGA 1K94A 3WHTB 1SL7A 1Y0VH 1QXPA 2WCLA 1M39A 1YUTA 3D75A 3BOWA 1JFKA 1CDNA 2WCEA 1K2HA 1F55A 2WCHA 2ZFDA 1DF0B 1XK4A 1EG4A 2Y1NA 2JT8A 2M3WA 3BUMB 1FPWA 1RWYA 4JWQA 3PN7B 3UNWA 2L4IA 3S0AA 1S3PA 2L5XB 4YGEB 5FYXA 3FWCA 4DIRA 5CSNA 1BU3A 2L2CA 3DXLA 3OB1B 3I5HC 2OTGB 1K96A 1RJVA 3VROA 1FI6A 4GAOA 4PHJA 5AERA 1IJ6A 1KCYA 3SIAA 4PE0A 3HCMA 2MRDA 1K95A 4YGAA 1LS8A 1LKJA 1TNQA 3MSEB 3SG7A 1MQ1A 2BKHB 2HF5A 2A4JA 3OGNA 4ZCVA 2LMVA 3VRPA 2KQ6A 1OQPA 3RZSA 3O2PA 1KQVA 4JQ0D 2BL0C 1YX7A 1CM4A 2M29A 2JU0A 3AKAA 3NSIA 3AAJA 4FQTA 2KYCA 3S0GA 1NSHA 4MEWA 1WRZA 3S0FA 3KF9A 1XVJA 2F8PA 4DUQA 3D74A 5ER4X 2NCOA 1JWDA 1NCYA 3CGAA 3R1PA 1LINA 1SSEB 4WQ2A 4NDBA 2G2BA 1CDLA 4MZJA 1WDCC 1PRWA 1JF0A 1NYAA 1WRKA 1YR5A 2BBMA 3FE8A 1ALWA 2HQ8A 1IQ3A 2Y4QA 1MUXA 3B87A 1OSAA 2OPOA 1OOFA 2JC2A 5AXIA 1QX5B 1L2OC 3NXAA 3DD4A 3O78A 1F4OA 1S26D 2VRGA 3OB2B 1QX7A 1IRJA 1KFXL 5CSIA 1F70A 2COLB 3D0YB 1NX1A 3WXAA 3DVJA 5F6TA 2F3ZA 1OOIX 2P6BB 2H2KA 3A8RA 2ZRTA 4JD9A 2M7LA 1MF8B 1SRAA 1TTXA 1YUUA 1CDPA 2KOTA 3CWGA 3JTDB 2LUXA 5PALA 4HREE 1MXEA 1KWOB 2LP3A 2WC8A 1GQMA 4GGNA 5HLVA 3KPXA 1HT9A 2JRFA 2LLTA 4JKTA 1CLBA 1N0YA 3EK4A 2JXCA 2NCPA 3BUWB 1TWOA 2M8UA 3TUYB 2B1UA 1OZSA 1BJFA 1N65A 3PALA 2WC6A 1GGWA 2TN4A 3DF0A 4PHKA 4N5XA 3CLNA 4IJ7A 1OZOA 5K89A 3B86A 2WCKA 5AANA 5TNCA 2P70A 1RK9A 2AUCA 3OX5A 3O4YA 1XYDA 4DRWA 1OMRA 5EL2A 3BUXB 1IKUA 4GNKB 3BOWB 1SR6C 3I5FC 1SNLA 1DEKA 4DCKA 3R1VA 1DQEA 2EGDA 4KYNA 3BUNB 2BBNA 3AKBA 2BCXA 2ZN8A 2MA2A 3DVKA 2PALA 2JT3A 2LHLA 2LVKA 1NX3A 3D76A 3DZTA 1DJHA 2L51A 3EKHA 4FTGA 3I5GC 2BNXA 5I2QA 1OOJA 2LV7A 1V1GA 2QEOA 3VRQA 1FI5A 1S6IA 1BMOA 2QACA 1QX2A 4CIDA 3IQOA 1SL9A 2HPSA 1DJIA 1R6PA 2JNFA 2KFGA 3IQQA 4I5KA 4WQ3A 1AJ5A 3BUOB 1DJGA 1FBVA 2JPTA 4CLNA 1TRFA 3H4SE 2NLNA 1IG5A 5AFPA 4YI8A 1C3YA 4N1FA 5D7FA 2LMUA 1SCMB 2JXLA 1AVSA 3FWBA 2I94A 3DY9A 1SCVA 3LK1A 4F7FA 3SS4A 2FOTA 1QJTA
chains in the Genus database with same CATH topology
2EC6C 1NWDA 1K90D 2I7AA 2GV5A 4C0KA 4AQJA 4N1GA 1C07A 2FCDA 2DOQA 1UURA 1PK0D 1QATA 1CLMA 2LHIA 3DVEA 1RROA 1SPYA 1KK7Y 1SBJA 3EVRA 4NDCA 4BY5A 2F33A 3WNXB 2HETA 2K7DA 3KHEA 1W7JB 2KI6D 5GQQC 1EXRA 4HRHA 1TN4A 2SCPA 3I5IB 4P5OE 5J3XA 3TDUA 1BODA 1CDMA 1S5GZ 2GGZA 3ICBA 2E30A 1B8CA 1U5IA 1UHHA 2EHBA 2FCEA 2Q4UA 1BR1B 3EK8A 2M97A 2JWWA 1S1EA 5AEQA 1W7IB 1MHOA 3OX6A 2JTZA 2LVJA 2LP2A 2Q91A 2K7CA 3LCPC 2JTTA 4GGFC 1NX2A 4MSPA 1G8IA 3JVTB 2M1UA 1QV1A 3DF0B 4YRUA 5HYDA 3SJSA 2PMYA 2Y5IA 3BYAA 3NSOA 3SG5A 1QVIZ 2KFHA 1KK8C 2LLUA 1CFDA 3PM8A 3SG4A 1S6JA 1Q80A 1KSMA 2JNXA 2L0PA 1UHKA 1C7VA 5CSJA 1A03A 3FS7A 1DJXA 1Y1UA 2PRUA 1WRLA 2WNDA 1NIWA 2R2IA 4YBHB 2JQ6A 1Y1XA 2JOJA 3CR5X 5BPJA 1OMDA 5G08A 1DGUA 2F2PA 2KHNA 3TS5C 1IWQA 3WHUB 1TCFA 5HLOA 2I2RE 1YUSA 1DVIA 1KSOA 1SL8A 2ZNEA 1YRTB 1YVLA 1X02A 4ORCB 4M2OA 1DJWA 4XJKB 3M0WA 4D1EA 4M2PA 4MZKA 1JC2A 4GPLB 1DTLA 3I5HB 3KO0A 2RGIA 1UHJA 2KI4C 1TOPA 1TNWA 5KTYA 2M1KB 1BF5A 1YX8A 1NP8A 1M46A 1EJ3A 1EG3A 1ZUZA 2PSRA 4C0JA 3NSKA 2K2AA 1XFYO 1K8UA 1SKTA 1KQMC 4A4BA 1AHRA 2M49B 2ZNDA 2BL0B 2H61C 1ALVA 1PSRA 1VRKA 4GFTA 1UP5A 2KGBC 2KGRA 3VGOA 4ORBB 1C7WA 1OMVA 3TDIA 4I5JA 2I18A 3OHMB 1H4BA 2LM5A 5I2OA 1SY9A 3CR2A 3SG2A 4IL1A 1WDCB 1U5IB 1KFUS 1CB1A 1B7TZ 2KSPA 1L2OB 1G33A 2JT0A 1NCXA 2KBIA 1ZOTB 3EVVA 2PASA 4YGBB 1NPQA 1CFCA 2KAXA 3KEVA 4I5NB 2KAYA 1TCOB 1FW4A 4PHNA 1UUSA 1UHNA 1UWOA 2M0RA 4Q04A 2LVIA 2NXQA 2OS8C 4XJKA 2MLFC 1A2XA 3GK4X 1SMGA 4FQOA 4GBAA 3LK0A 3NSLA 5D69A 1J7RA 3ZNIA 4AOMA 3OP0A 2KFFA 4GUKA 1S36A 1V1FA 3EKJA 4YGDB 1GGZA 2BE6A 2KBMA 4XYNA 2KYFA 5I2LA 5I8NA 1WLMA 2FJUB 1OE9B 2ZN9A 1B47A 2ISDA 1LA3A 3D10A 1XO5A 5DKQA 1JF2A 1Y1AA 3PN7C 3EK7A 3GK2A 1MR8A 3I5FB 1SR6B 5KU1A 3K21A 1JUOA 4YI9A 2CCMA 5KSZA 4OKHA 4ORAB 4USLA 2OTGC 2K2FA 2BECA 1CNPA 2LUCA 1WY9A 3I5GB 1B9AA 2CT9A 1NX0A 1ZACA 1QIVA 3TZ1A 4JPZB 1J55A 3PFVA 1B8RA 1YVHA 3RLZA 4E68A 4PCWA 2K8MB 1EH2A 1B1GA 3CTNA 3BXKA 2AMIA 5JOLA 1XA5A 1J7QA 4L9MA 1FF1A 2KI6C 2K7OA 1N2DA 2WORA 4YGCB 5IBWA 2KAVA 4PE1A 2QPTA 1ZMZA 3CZTX 1K9UA 2LLSA 1S5GY 2LAPA 2EC6B 4TNCA 1J7OA 1HQVA 2D8NA 2CXJA 3VRRA 1LA0A 4CFQA 1NUBA 1CFFA 1XFUO 3E3RA 3IF7A 2H61A 3A4UB 1AK8A 5B8IB 1CMGA 1BR4B 2CNPA 3ZWHA 5CSFA 2BCBA 4MBEA 1QIWA 3JTDC 5HKWA 2MHHA 2KNEA 1A75A 4R1EA 1TIZA 2SASA 1KWOC 1UHIA 1DMOA 3GOFA 3O6BA 1JBAA 4U8DA 1XFXO 1QVIY 4OVNF 3RM1A 4MZLA 3PSRA 2IS9A 3TUYC 2F3YA 2K0JA 3PATA 2JULA 1PALA 1RECA 2L4HA 3VRNA 2LMTA 4OV2A 2K7BA 1XFVO 1RTP1 3SG6A 4QJ5B 1J7PA 4UPGA 1CMFA 1M45A 4ZCUA 4MN0A 4MLWA 1M31A 3CR4X 3PLFB 2LNKA 1A29A 1DT7B 5ER5A 1Y6WA 2MLEC 2M9GA 1DGVA 1R2UA 5CPVA 1QTXA 1CLLA 1KK8B 1XK4C 1YTZC 1B8LA 1WLZA 2CTNA 4HRGA 1IJ5A 1K9KA 4MRYA 1TNXA 3F45A 1BT6A 1NCZA 4QJ4B 1TNPA 1F4QA 4CFRA 1QLSA 1DF0A 3TDZA 1GJYA 1PVAA 2BE4A 2AAOA 1G4YR 1KFXS 2ZRSA 3LL8B 4DS7A 1H8BA 2JZIA 1BG1A 1K93D 1KFUL 1ODBA 4MVFA 4M2QA 1F54A 1IQ5A 2E6WA 2LANA 3TS5B 2KDHA 4I5LB 2L50A 2O60A 4PALA 1SCMC 2V53A 3LLEA 4ICBA 1PULA 2KQYA 2GGMA 2O5GA 4PE4A 1CKKA 1SK6D 5DKNA 2WCBA 3QRXA 3FIAA 4OR9B 2LCPA 2MJWB 4PHMA 1RFJA 2KI4B 2G9BA 1DJYA 1E8AA 1PVBA 1QLKA 4PE7A 1YURA 2K61A 1CTRA 3SIBA 4ETOA 1CM1A 1IH0A 1F71A 1J1EA 4GGFA 1B7TY 1PSBA 1SW8A 3EVUA 4BY4A 1KQMB 1LXFC 4OCIA 1D1OA 2LC5A 4P2YB 1BLQA 5HKYA 2HQWA 2CBLA 1XFZO 1BOCA 2Y1MA 4C0LA 1K9PA 4NDDA 2LE9B 1XFWO 1J1DA 1QASA 4PDZA 2WOSA 1AUIB 1A75B 3C1VA 1DJZA 1KK7Z 3BQ3A 3D0YA 4F0ZB 4MRXA 4HSZA 2WCFA 1SYMA 2MBXA 1YRUB 4WRIA 5DKRA 1AJ4A 1QS7A 1ZFSA 1F8HA 1JSAA 1B4CA 3JVTC 2ZKMX 1MXLC 2M7NA 2L98A 2MAZA 1IGVA 2NZ0A 1AP4A 1A4PA 1LVCD 3AAKA 2L2EA 1L7ZA 3SG3A 2OS8B 2PVBA 1M63B 4AQIA 5JJGA 2BKIB 3CS1A 2F2OA 5HKZA 3HX4A 1JFJA 1EL4A 1CFPA 3DVMA 4QJ3B 1QV0A 1MWNA 4CPVA 2LVVA 4A4CA 2BCAA 3GK1A 1S6CA 4NQGA 1K94A 3WHTB 1SL7A 1Y0VH 1QXPA 1M39A 1YUTA 3BOWA 1JFKA 1CDNA 2WCEA 1K2HA 1F55A 2ZFDA 1DF0B 1XK4A 1EG4A 2Y1NA 2JT8A 2M3WA 3BUMB 1FPWA 1RWYA 4JWQA 3PN7B 2L4IA 1S3PA 2L5XB 4YGEB 5FYXA 3FWCA 4DIRA 5CSNA 1BU3A 3OB1B 3I5HC 2OTGB 1K96A 1RJVA 3VROA 1FI6A 4GAOA 4PHJA 5AERA 1IJ6A 1KCYA 3SIAA 4PE0A 3HCMA 2MRDA 1K95A 4YGAA 1LKJA 1TNQA 3MSEB 3SG7A 1MQ1A 2BKHB 2HF5A 2A4JA 4ZCVA 2LMVA 3VRPA 2KQ6A 1OQPA 3O2PA 1KQVA 4JQ0D 2BL0C 1YX7A 1CM4A 2M29A 2JU0A 3AKAA 3NSIA 3AAJA 2KYCA 1NSHA 4MEWA 1WRZA 3KF9A 1XVJA 2F8PA 4DUQA 5ER4X 2NCOA 1JWDA 1NCYA 3CGAA 1LINA 4WQ2A 4NDBA 2G2BA 1CDLA 4MZJA 1WDCC 1PRWA 1JF0A 1NYAA 1WRKA 1YR5A 2BBMA 3FWBA 1ALWA 2HQ8A 1IQ3A 2Y4QA 1MUXA 1OSAA 2OPOA 2JC2A 5AXIA 1QX5B 1L2OC 3NXAA 3DD4A 3O78A 1F4OA 1S26D 2VRGA 3OB2B 1QX7A 1IRJA 1KFXL 5CSIA 1F70A 2COLB 3D0YB 1NX1A 3WXAA 3DVJA 5F6TA 2F3ZA 2P6BB 2H2KA 3A8RA 2ZRTA 2M7LA 1MF8B 1SRAA 1TTXA 1CDPA 1YUUA 2KOTA 3CWGA 3JTDB 2LUXA 5PALA 4HREE 1MXEA 1KWOB 2LP3A 2WC8A 1GQMA 4GGNA 5HLVA 3KPXA 1HT9A 2JRFA 2LLTA 1CLBA 1N0YA 3EK4A 2JXCA 2NCPA 3BUWB 2M8UA 3TUYB 2B1UA 1OZSA 1BJFA 1N65A 3PALA 1GGWA 2TN4A 3DF0A 4PHKA 4N5XA 3CLNA 1OZOA 5K89A 5AANA 5TNCA 1RK9A 2AUCA 3OX5A 3O4YA 1XYDA 4DRWA 1OMRA 1IKUA 3BUXB 4GNKB 3BOWB 1SR6C 3I5FC 1SNLA 4DCKA 2EGDA 3BUNB 2BBNA 3AKBA 2BCXA 2ZN8A 2MA2A 3DVKA 2PALA 2JT3A 2LHLA 2LVKA 1NX3A 3I5IC 1DJHA 2L51A 3EKHA 4FTGA 3I5GC 5I2QA 1OOJA 2LV7A 1V1GA 3VRQA 1FI5A 1S6IA 1BMOA 2QACA 1QX2A 4CIDA 3IQOA 1SL9A 2HPSA 1DJIA 1R6PA 2JNFA 2KFGA 3IQQA 4I5KA 4WQ3A 1AJ5A 3BUOB 1DJGA 1FBVA 2JPTA 4CLNA 1TRFA 3H4SE 2NLNA 1IG5A 5AFPA 4YI8A 4N1FA 5D7FA 2LMUA 1SCMB 2JXLA 1AVSA 2I94A 3LK1A 1SCVA 2FOTA 1QJTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EC6 C;  1NWD A;  1K90 D;  2I7A A;  2GV5 A;  4C0K A;  4AQJ A;  4N1G A;  1C07 A;  2FCD A;  2DOQ A;  1UUR A;  1PK0 D;  1QAT A;  1CLM A;  2LHI A;  3DVE A;  1RRO A;  1SPY A;  1KK7 Y;  1SBJ A;  3EVR A;  4NDC A;  4BY5 A;  2F33 A;  3WNX B;  2HET A;  2K7D A;  3KHE A;  1W7J B;  2KI6 D;  5GQQ C;  1EXR A;  4HRH A;  1TN4 A;  2SCP A;  3I5I B;  4P5O E;  5J3X A;  3TDU A;  1BOD A;  1CDM A;  1S5G Z;  2GGZ A;  3ICB A;  2E30 A;  1B8C A;  1U5I A;  1UHH A;  2EHB A;  2FCE A;  2Q4U A;  1BR1 B;  3EK8 A;  2M97 A;  2JWW A;  1S1E A;  5AEQ A;  1W7I B;  1MHO A;  3OX6 A;  2JTZ A;  2LVJ A;  2LP2 A;  2Q91 A;  2K7C A;  3LCP C;  2JTT A;  4GGF C;  1NX2 A;  4MSP A;  1G8I A;  3JVT B;  2M1U A;  1QV1 A;  3DF0 B;  4YRU A;  5HYD A;  3SJS A;  2PMY A;  2Y5I A;  3BYA A;  3NSO A;  3SG5 A;  1QVI Z;  2KFH A;  1KK8 C;  2LLU A;  1CFD A;  3PM8 A;  3SG4 A;  1S6J A;  1Q80 A;  1KSM A;  2JNX A;  2L0P A;  1UHK A;  1C7V A;  5CSJ A;  1A03 A;  3FS7 A;  1DJX A;  1Y1U A;  2PRU A;  1WRL A;  2WND A;  1NIW A;  2R2I A;  4YBH B;  2JQ6 A;  1Y1X A;  2JOJ A;  3CR5 X;  5BPJ A;  1OMD A;  5G08 A;  1DGU A;  2F2P A;  2KHN A;  3TS5 C;  1IWQ A;  3WHU B;  1TCF A;  5HLO A;  2I2R E;  1YUS A;  1DVI A;  1KSO A;  1SL8 A;  2ZNE A;  1YRT B;  1YVL A;  1X02 A;  4ORC B;  4M2O A;  1DJW A;  4XJK B;  3M0W A;  4D1E A;  4M2P A;  4MZK A;  1JC2 A;  4GPL B;  1DTL A;  3I5H B;  3KO0 A;  2RGI A;  1UHJ A;  2KI4 C;  1TOP A;  1TNW A;  5KTY A;  2M1K B;  1BF5 A;  1YX8 A;  1NP8 A;  1M46 A;  1EJ3 A;  1EG3 A;  1ZUZ A;  2PSR A;  4C0J A;  3NSK A;  2K2A A;  1XFY O;  1K8U A;  1SKT A;  1KQM C;  4A4B A;  1AHR A;  2M49 B;  2ZND A;  2BL0 B;  2H61 C;  1ALV A;  1PSR A;  1VRK A;  4GFT A;  1UP5 A;  2KGB C;  2KGR A;  3VGO A;  4ORB B;  1C7W A;  1OMV A;  3TDI A;  4I5J A;  2I18 A;  3OHM B;  1H4B A;  2LM5 A;  5I2O A;  1SY9 A;  3CR2 A;  3SG2 A;  4IL1 A;  1WDC B;  1U5I B;  1KFU S;  1CB1 A;  1B7T Z;  2KSP A;  1L2O B;  1G33 A;  2JT0 A;  1NCX A;  2KBI A;  1ZOT B;  3EVV A;  2PAS A;  4YGB B;  1NPQ A;  1CFC A;  2KAX A;  3KEV A;  4I5N B;  2KAY A;  1TCO B;  1FW4 A;  4PHN A;  1UUS A;  1UHN A;  1UWO A;  2M0R A;  4Q04 A;  2LVI A;  2NXQ A;  2OS8 C;  4XJK A;  2MLF C;  1A2X A;  3GK4 X;  1SMG A;  4FQO A;  4GBA A;  3LK0 A;  3NSL A;  5D69 A;  1J7R A;  3ZNI A;  4AOM A;  3OP0 A;  2KFF A;  4GUK A;  1S36 A;  1V1F A;  3EKJ A;  4YGD B;  1GGZ A;  2BE6 A;  2KBM A;  4XYN A;  2KYF A;  5I2L A;  5I8N A;  1WLM A;  2FJU B;  1OE9 B;  2ZN9 A;  1B47 A;  2ISD A;  1LA3 A;  3D10 A;  1XO5 A;  5DKQ A;  1JF2 A;  1Y1A A;  3PN7 C;  3EK7 A;  3GK2 A;  1MR8 A;  3I5F B;  1SR6 B;  5KU1 A;  3K21 A;  1JUO A;  4YI9 A;  2CCM A;  5KSZ A;  4OKH A;  4ORA B;  4USL A;  2OTG C;  2K2F A;  2BEC A;  1CNP A;  2LUC A;  1WY9 A;  3I5G B;  1B9A A;  2CT9 A;  1NX0 A;  1ZAC A;  1QIV A;  3TZ1 A;  4JPZ B;  1J55 A;  3PFV A;  1B8R A;  1YVH A;  3RLZ A;  4E68 A;  4PCW A;  2K8M B;  1EH2 A;  1B1G A;  3CTN A;  3BXK A;  2AMI A;  5JOL A;  1XA5 A;  1J7Q A;  4L9M A;  1FF1 A;  2KI6 C;  2K7O A;  1N2D A;  2WOR A;  4YGC B;  5IBW A;  2KAV A;  4PE1 A;  2QPT A;  1ZMZ A;  3CZT X;  1K9U A;  2LLS A;  1S5G Y;  2LAP A;  2EC6 B;  4TNC A;  1J7O A;  1HQV A;  2D8N A;  2CXJ A;  3VRR A;  1LA0 A;  4CFQ A;  1NUB A;  1CFF A;  1XFU O;  3E3R A;  3IF7 A;  2H61 A;  3A4U B;  1AK8 A;  5B8I B;  1CMG A;  1BR4 B;  2CNP A;  3ZWH A;  5CSF A;  2BCB A;  4MBE A;  1QIW A;  3JTD C;  5HKW A;  2MHH A;  2KNE A;  1A75 A;  4R1E A;  1TIZ A;  2SAS A;  1KWO C;  1UHI A;  1DMO A;  3GOF A;  3O6B A;  1JBA A;  4U8D A;  1XFX O;  1QVI Y;  4OVN F;  3RM1 A;  4MZL A;  3PSR A;  2IS9 A;  3TUY C;  2F3Y A;  2K0J A;  3PAT A;  2JUL A;  1PAL A;  1REC A;  2L4H A;  3VRN A;  2LMT A;  4OV2 A;  2K7B A;  1XFV O;  1RTP 1;  3SG6 A;  4QJ5 B;  1J7P A;  4UPG A;  1CMF A;  1M45 A;  4ZCU A;  4MN0 A;  4MLW A;  1M31 A;  3CR4 X;  3PLF B;  2LNK A;  1A29 A;  1DT7 B;  5ER5 A;  1Y6W A;  2MLE C;  2M9G A;  1DGV A;  1R2U A;  5CPV A;  1QTX A;  1CLL A;  1KK8 B;  1XK4 C;  1YTZ C;  1B8L A;  1WLZ A;  2CTN A;  4HRG A;  1IJ5 A;  1K9K A;  4MRY A;  1TNX A;  3F45 A;  1BT6 A;  1NCZ A;  4QJ4 B;  1TNP A;  1F4Q A;  4CFR A;  1QLS A;  1DF0 A;  3TDZ A;  1GJY A;  1PVA A;  2BE4 A;  2AAO A;  1G4Y R;  1KFX S;  2ZRS A;  3LL8 B;  4DS7 A;  1H8B A;  2JZI A;  1BG1 A;  1K93 D;  1KFU L;  1ODB A;  4MVF A;  4M2Q A;  1F54 A;  1IQ5 A;  2E6W A;  2LAN A;  3TS5 B;  2KDH A;  4I5L B;  2L50 A;  2O60 A;  4PAL A;  1SCM C;  2V53 A;  3LLE A;  4ICB A;  1PUL A;  2KQY A;  2GGM A;  2O5G A;  4PE4 A;  1CKK A;  1SK6 D;  5DKN A;  2WCB A;  3QRX A;  3FIA A;  4OR9 B;  2LCP A;  2MJW B;  4PHM A;  1RFJ A;  2KI4 B;  2G9B A;  1DJY A;  1E8A A;  1PVB A;  1QLK A;  4PE7 A;  1YUR A;  2K61 A;  1CTR A;  3SIB A;  4ETO A;  1CM1 A;  1IH0 A;  1F71 A;  1J1E A;  4GGF A;  1B7T Y;  1PSB A;  1SW8 A;  3EVU A;  4BY4 A;  1KQM B;  1LXF C;  4OCI A;  1D1O A;  2LC5 A;  4P2Y B;  1BLQ A;  5HKY A;  2HQW A;  2CBL A;  1XFZ O;  1BOC A;  2Y1M A;  4C0L A;  1K9P A;  4NDD A;  2LE9 B;  1XFW O;  1J1D A;  1QAS A;  4PDZ A;  2WOS A;  1AUI B;  1A75 B;  3C1V A;  1DJZ A;  1KK7 Z;  3BQ3 A;  3D0Y A;  4F0Z B;  4MRX A;  4HSZ A;  2WCF A;  1SYM A;  2MBX A;  1YRU B;  4WRI A;  5DKR A;  1AJ4 A;  1QS7 A;  1ZFS A;  1F8H A;  1JSA A;  1B4C A;  3JVT C;  2ZKM X;  1MXL C;  2M7N A;  2L98 A;  2MAZ A;  1IGV A;  2NZ0 A;  1AP4 A;  1A4P A;  1LVC D;  3AAK A;  2L2E A;  1L7Z A;  3SG3 A;  2OS8 B;  2PVB A;  1M63 B;  4AQI A;  5JJG A;  2BKI B;  3CS1 A;  2F2O A;  5HKZ A;  3HX4 A;  1JFJ A;  1EL4 A;  1CFP A;  3DVM A;  4QJ3 B;  1QV0 A;  1MWN A;  4CPV A;  2LVV A;  4A4C A;  2BCA A;  3GK1 A;  1S6C A;  4NQG A;  1K94 A;  3WHT B;  1SL7 A;  1Y0V H;  1QXP A;  1M39 A;  1YUT A;  3BOW A;  1JFK A;  1CDN A;  2WCE A;  1K2H A;  1F55 A;  2ZFD A;  1DF0 B;  1XK4 A;  1EG4 A;  2Y1N A;  2JT8 A;  2M3W A;  3BUM B;  1FPW A;  1RWY A;  4JWQ A;  3PN7 B;  2L4I A;  1S3P A;  2L5X B;  4YGE B;  5FYX A;  3FWC A;  4DIR A;  5CSN A;  1BU3 A;  3OB1 B;  3I5H C;  2OTG B;  1K96 A;  1RJV A;  3VRO A;  1FI6 A;  4GAO A;  4PHJ A;  5AER A;  1IJ6 A;  1KCY A;  3SIA A;  4PE0 A;  3HCM A;  2MRD A;  1K95 A;  4YGA A;  1LKJ A;  1TNQ A;  3MSE B;  3SG7 A;  1MQ1 A;  2BKH B;  2HF5 A;  2A4J A;  4ZCV A;  2LMV A;  3VRP A;  2KQ6 A;  1OQP A;  3O2P A;  1KQV A;  4JQ0 D;  2BL0 C;  1YX7 A;  1CM4 A;  2M29 A;  2JU0 A;  3AKA A;  3NSI A;  3AAJ A;  2KYC A;  1NSH A;  4MEW A;  1WRZ A;  3KF9 A;  1XVJ A;  2F8P A;  4DUQ A;  5ER4 X;  2NCO A;  1JWD A;  1NCY A;  3CGA A;  1LIN A;  4WQ2 A;  4NDB A;  2G2B A;  1CDL A;  4MZJ A;  1WDC C;  1PRW A;  1JF0 A;  1NYA A;  1WRK A;  1YR5 A;  2BBM A;  3FWB A;  1ALW A;  2HQ8 A;  1IQ3 A;  2Y4Q A;  1MUX A;  1OSA A;  2OPO A;  2JC2 A;  5AXI A;  1QX5 B;  1L2O C;  3NXA A;  3DD4 A;  3O78 A;  1F4O A;  1S26 D;  2VRG A;  3OB2 B;  1QX7 A;  1IRJ A;  1KFX L;  5CSI A;  1F70 A;  2COL B;  3D0Y B;  1NX1 A;  3WXA A;  3DVJ A;  5F6T A;  2F3Z A;  2P6B B;  2H2K A;  3A8R A;  2ZRT A;  2M7L A;  1MF8 B;  1SRA A;  1TTX A;  1CDP A;  1YUU A;  2KOT A;  3CWG A;  3JTD B;  2LUX A;  5PAL A;  4HRE E;  1MXE A;  1KWO B;  2LP3 A;  2WC8 A;  1GQM A;  4GGN A;  5HLV A;  3KPX A;  1HT9 A;  2JRF A;  2LLT A;  1CLB A;  1N0Y A;  3EK4 A;  2JXC A;  2NCP A;  3BUW B;  2M8U A;  3TUY B;  2B1U A;  1OZS A;  1BJF A;  1N65 A;  3PAL A;  1GGW A;  2TN4 A;  3DF0 A;  4PHK A;  4N5X A;  3CLN A;  1OZO A;  5K89 A;  5AAN A;  5TNC A;  1RK9 A;  2AUC A;  3OX5 A;  3O4Y A;  1XYD A;  4DRW A;  1OMR A;  1IKU A;  3BUX B;  4GNK B;  3BOW B;  1SR6 C;  3I5F C;  1SNL A;  4DCK A;  2EGD A;  3BUN B;  2BBN A;  3AKB A;  2BCX A;  2ZN8 A;  2MA2 A;  3DVK A;  2PAL A;  2JT3 A;  2LHL A;  2LVK A;  1NX3 A;  3I5I C;  1DJH A;  2L51 A;  3EKH A;  4FTG A;  3I5G C;  5I2Q A;  1OOJ A;  2LV7 A;  1V1G A;  3VRQ A;  1FI5 A;  1S6I A;  1BMO A;  2QAC A;  1QX2 A;  4CID A;  3IQO A;  1SL9 A;  2HPS A;  1DJI A;  1R6P A;  2JNF A;  2KFG A;  3IQQ A;  4I5K A;  4WQ3 A;  1AJ5 A;  3BUO B;  1DJG A;  1FBV A;  2JPT A;  4CLN A;  1TRF A;  3H4S E;  2NLN A;  1IG5 A;  5AFP A;  4YI8 A;  4N1F A;  5D7F A;  2LMU A;  1SCM B;  2JXL A;  1AVS A;  2I94 A;  3LK1 A;  1SCV A;  2FOT A;  1QJT A; 
#chains in the Genus database with same CATH topology
 2EC6 C;  1NWD A;  1K90 D;  2I7A A;  2GV5 A;  4C0K A;  4AQJ A;  4N1G A;  1C07 A;  3L4A A;  2QEH A;  2FCD A;  2DOQ A;  1UUR A;  1PK0 D;  1QAT A;  1CLM A;  2LHI A;  3B88 A;  3DVE A;  1RRO A;  1SPY A;  1KK7 Y;  1SBJ A;  3EVR A;  4NDC A;  3UO9 A;  5D3O A;  4BY5 A;  2F33 A;  4OZD A;  3WNX B;  2KPH A;  2HET A;  2K7D A;  3KHE A;  1W7J B;  2KI6 D;  5GQQ C;  1EXR A;  4HRH A;  1TN4 A;  2SCP A;  3I5I B;  4P5O E;  5J3X A;  3SS5 A;  3CZ2 A;  3R1O A;  3TDU A;  1BOD A;  1CDM A;  1S5G Z;  2GGZ A;  3ICB A;  1GM0 A;  2E30 A;  1B8C A;  1U5I A;  1UHH A;  2EHB A;  2FCE A;  2Q4U A;  1BR1 B;  3EK8 A;  2M97 A;  2L5Y A;  2JWW A;  1S1E A;  3CZ1 A;  5AEQ A;  1W7I B;  1MHO A;  1OOH A;  1Z2C B;  3OX6 A;  2JTZ A;  2LVJ A;  2LP2 A;  2Q91 A;  2K7C A;  3LCP C;  5HL1 A;  2JTT A;  3N7H A;  4GGF C;  3VB1 A;  1NX2 A;  4MSP A;  1G8I A;  3JVT B;  3D77 A;  3IVT A;  2M1U A;  1QV1 A;  1TUZ A;  3DF0 B;  4YRU A;  5HYD A;  3SJS A;  2PMY A;  2Y5I A;  3BYA A;  3NSO A;  3SG5 A;  1QVI Z;  2KFH A;  1KK8 C;  2LLU A;  1CFD A;  3PM8 A;  3SG4 A;  1S6J A;  1OOG A;  1Q80 A;  2K60 A;  1KSM A;  2JNX A;  2L0P A;  1UHK A;  1C7V A;  3EG5 B;  5CSJ A;  1A03 A;  3FS7 A;  1DJX A;  1Y1U A;  2PRU A;  1WRL A;  2WND A;  1NIW A;  2R2I A;  4YBH B;  2JQ6 A;  1Y1X A;  2JOJ A;  3CR5 X;  5BPJ A;  1OMD A;  5G08 A;  1DGU A;  2F2P A;  2KHN A;  3TS5 C;  1IWQ A;  1Z4H A;  1TCF A;  5HLO A;  2I2R E;  1YUS A;  3WHU B;  2KLE A;  1DVI A;  1KSO A;  1SL8 A;  2ZNE A;  3FE6 A;  1YRT B;  1YVL A;  1X02 A;  4ORC B;  4M2O A;  1DJW A;  4XJK B;  3M0W A;  4D1E A;  4M2P A;  4MZK A;  1JC2 A;  4GPL B;  1DTL A;  3I5H B;  3KO0 A;  2RGI A;  1UHJ A;  2KI4 C;  2WC5 A;  1TOP A;  1TNW A;  5KTY A;  2M1K B;  5DIC A;  1BF5 A;  1YX8 A;  1NP8 A;  1M46 A;  1EJ3 A;  1EG3 A;  1ZUZ A;  2PSR A;  4C0J A;  3NSK A;  2K2A A;  1XFY O;  1K8U A;  1SKT A;  1KQM C;  4A4B A;  1AHR A;  2M49 B;  1QWV A;  2ZND A;  2BL0 B;  2H61 C;  1ALV A;  1PSR A;  2QDI A;  1VRK A;  4GFT A;  1UP5 A;  2KGB C;  2KGR A;  2JPO A;  3VGO A;  4ORB B;  1C7W A;  1OMV A;  3TDI A;  4I5J A;  2I18 A;  3OHM B;  1H4B A;  2LM5 A;  5I2O A;  1SY9 A;  3CR2 A;  3SG2 A;  4IL1 A;  1WDC B;  1U5I B;  1KFU S;  1CB1 A;  1B7T Z;  1TUJ A;  2KSP A;  3S0B A;  2PYQ A;  1L2O B;  1G33 A;  2JT0 A;  1NCX A;  2KBI A;  1ZOT B;  3EVV A;  2PAS A;  4YGB B;  1NPQ A;  1CFC A;  2KAX A;  3KEV A;  4I5N B;  2KAY A;  2WCM A;  2PQL A;  1TCO B;  1FW4 A;  4PHN A;  1UUS A;  1UHN A;  1UWO A;  2M0R A;  3D78 A;  1C3Z A;  2LVI A;  2NXQ A;  4Q04 A;  5FI6 A;  2OS8 C;  4XJK A;  2MLF C;  1A2X A;  3GK4 X;  1SMG A;  4FQO A;  4GBA A;  3CYZ A;  3L47 A;  3LK0 A;  3NSL A;  5D69 A;  1J7R A;  3ZNI A;  4AOM A;  5I94 A;  3D73 A;  3OP0 A;  2KFF A;  4GUK A;  1S36 A;  1V1F A;  3EKJ A;  4YGD B;  1GGZ A;  2BE6 A;  2KBM A;  4XYN A;  2KYF A;  5I2L A;  5I8N A;  1WLM A;  2FJU B;  1OE9 B;  2ZN9 A;  1B47 A;  2ISD A;  1LA3 A;  3CDN A;  3D10 A;  1XO5 A;  5DKQ A;  1DEL A;  1JF2 A;  1Y1A A;  3PN7 C;  3EK7 A;  3GK2 A;  1MR8 A;  3I5F B;  1SR6 B;  5FI7 A;  5KU1 A;  3K21 A;  1JUO A;  4YI9 A;  2CCM A;  5KSZ A;  4OKH A;  4ORA B;  2P71 A;  5FI2 A;  4USL A;  2OTG C;  3BJH A;  2K2F A;  2BEC A;  1CNP A;  2LUC A;  1WY9 A;  3I5G B;  1B9A A;  1NX0 A;  1ZAC A;  2CT9 A;  1QIV A;  3TZ1 A;  4JPZ B;  1J55 A;  3PFV A;  1B8R A;  1OW4 A;  1YVH A;  3RLZ A;  3B7A A;  4E68 A;  4PCW A;  2K8M B;  3QME A;  1EH2 A;  1B1G A;  3CTN A;  3BXK A;  2AMI A;  5JOL A;  1XA5 A;  1J7Q A;  4L9M A;  3B6X A;  1FF1 A;  2KI6 C;  2K7O A;  1P28 A;  1N2D A;  2WOR A;  4YGC B;  5IBW A;  2KAV A;  4PE1 A;  3S0E A;  2QPT A;  3L4L A;  1ZMZ A;  3CZT X;  1K9U A;  2LLS A;  1S5G Y;  2LAP A;  2EC6 B;  3BFA A;  3FE9 A;  4TNC A;  1J7O A;  1HQV A;  2D8N A;  2CXJ A;  3VRR A;  1LA0 A;  4CFQ A;  1XFR A;  1NUB A;  3V2L A;  1CFF A;  1XFU O;  3E3R A;  3IF7 A;  2H61 A;  3A4U B;  3R72 A;  1AK8 A;  5B8I B;  2FJY A;  1IIO A;  2BAP A;  1CMG A;  1BR4 B;  2CNP A;  3ZWH A;  5CSF A;  1W9Z A;  2QEB A;  4PT1 A;  2BCB A;  4MBE A;  1QIW A;  3DYE A;  3JTD C;  5HKW A;  2MHH A;  2KNE A;  1A75 A;  4R1E A;  1TIZ A;  2SAS A;  1KWO C;  1UHI A;  1DMO A;  3GOF A;  3O6B A;  1JBA A;  4U8D A;  1XFX O;  1QVI Y;  4OVN F;  3RM1 A;  3NHT A;  4MZL A;  3PSR A;  2IS9 A;  3TUY C;  2F3Y A;  2K0J A;  3PAT A;  2JUL A;  1PAL A;  1REC A;  2L4H A;  3VRN A;  2LMT A;  4OV2 A;  2K7B A;  1XFV O;  1RTP 1;  3SG6 A;  4QJ5 B;  1J7P A;  4UPG A;  1CMF A;  3BFB A;  1M45 A;  3S0D A;  3PM2 A;  4ZCU A;  4MN0 A;  4MLW A;  1M31 A;  3CR4 X;  3K1E A;  2LNK A;  3PLF B;  1A29 A;  1DT7 B;  5ER5 A;  1Y6W A;  2MLE C;  2M9G A;  1DGV A;  1R2U A;  5CPV A;  1QTX A;  1CLL A;  1KK8 B;  1XK4 C;  1YTZ C;  1B8L A;  1WLZ A;  2CTN A;  4HRG A;  1IJ5 A;  1K9K A;  4MRY A;  1TNX A;  3F45 A;  1BT6 A;  1NCZ A;  2QEV A;  4QJ4 B;  1TNP A;  1F4Q A;  4CFR A;  1QLS A;  1DF0 A;  4INW A;  3TDZ A;  1GJY A;  1PVA A;  2BE4 A;  2WCJ A;  1DC1 A;  2AAO A;  1G4Y R;  1KFX S;  2ZRS A;  3LL8 B;  4DS7 A;  1H8B A;  2JZI A;  1BG1 A;  1K93 D;  1KFU L;  1ODB A;  4MVF A;  4M2Q A;  1F54 A;  1IQ5 A;  1ORG A;  2E6W A;  2GTE A;  2LAN A;  3CZ0 A;  3TS5 B;  2KDH A;  4I5L B;  2L50 A;  2O60 A;  2YGU A;  3CAB A;  4PAL A;  1SCM C;  3OBV A;  2V53 A;  3LLE A;  3NHI A;  4ICB A;  1PUL A;  2KQY A;  2GGM A;  2O5G A;  4PE4 A;  1CKK A;  1SK6 D;  5DKN A;  2WCB A;  3QRX A;  3FIA A;  1T14 A;  4OR9 B;  2LCP A;  2MJW B;  4PHM A;  1RFJ A;  2KI4 B;  2G9B A;  1DJY A;  1E8A A;  1PVB A;  1QLK A;  4PE7 A;  1YUR A;  2K61 A;  1CTR A;  3SIB A;  4ETO A;  1CM1 A;  1IH0 A;  1F71 A;  1J1E A;  4GGF A;  1B7T Y;  1PSB A;  1SW8 A;  3EVU A;  4BY4 A;  1KQM B;  1LXF C;  4OCI A;  1D1O A;  2LC5 A;  3SS3 A;  4P2Y B;  1BLQ A;  5HKY A;  2HQW A;  3O4X A;  2ERB A;  2CBL A;  1XFZ O;  1BOC A;  2Y1M A;  3I5I C;  4C0L A;  1K9P A;  4NDD A;  2LE9 B;  1XFW O;  1J1D A;  1QAS A;  4PDZ A;  2WOS A;  1AUI B;  1A75 B;  3C1V A;  1DJZ A;  1KK7 Z;  3BQ3 A;  3D0Y A;  4F0Z B;  4MRX A;  4HSZ A;  2WCF A;  1SYM A;  2H8V A;  2MBX A;  1YRU B;  4WRI A;  5DKR A;  1AJ4 A;  1QS7 A;  1ZFS A;  1F8H A;  1JSA A;  1B4C A;  3JVT C;  2ZKM X;  1MXL C;  2KLD A;  3BFH A;  3NGV A;  2M7N A;  2L98 A;  2MAZ A;  1IGV A;  2NZ0 A;  3Q8I A;  1AP4 A;  1A4P A;  1LVC D;  3AAK A;  2L2E A;  1L7Z A;  3SG3 A;  2OS8 B;  2PVB A;  1M63 B;  4AQI A;  5JJG A;  2BKI B;  3CS1 A;  2F2O A;  5HKZ A;  3HX4 A;  1JFJ A;  1EL4 A;  1CFP A;  3DVM A;  4QJ3 B;  1QV0 A;  1MWN A;  3PJI A;  4CPV A;  2LVV A;  4A4C A;  4INX A;  2BCA A;  3GK1 A;  1S6C A;  4NQG A;  1K94 A;  3WHT B;  1SL7 A;  1Y0V H;  1QXP A;  2WCL A;  1M39 A;  1YUT A;  3D75 A;  3BOW A;  1JFK A;  1CDN A;  2WCE A;  1K2H A;  1F55 A;  2WCH A;  2ZFD A;  1DF0 B;  1XK4 A;  1EG4 A;  2Y1N A;  2JT8 A;  2M3W A;  3BUM B;  1FPW A;  1RWY A;  4JWQ A;  3PN7 B;  3UNW A;  2L4I A;  3S0A A;  1S3P A;  2L5X B;  4YGE B;  5FYX A;  3FWC A;  4DIR A;  5CSN A;  1BU3 A;  2L2C A;  3DXL A;  3OB1 B;  3I5H C;  2OTG B;  1K96 A;  1RJV A;  3VRO A;  1FI6 A;  4GAO A;  4PHJ A;  5AER A;  1IJ6 A;  1KCY A;  3SIA A;  4PE0 A;  3HCM A;  2MRD A;  1K95 A;  4YGA A;  1LS8 A;  1LKJ A;  1TNQ A;  3MSE B;  3SG7 A;  1MQ1 A;  2BKH B;  2HF5 A;  2A4J A;  3OGN A;  4ZCV A;  2LMV A;  3VRP A;  2KQ6 A;  1OQP A;  3RZS A;  3O2P A;  1KQV A;  4JQ0 D;  2BL0 C;  1YX7 A;  1CM4 A;  2M29 A;  2JU0 A;  3AKA A;  3NSI A;  3AAJ A;  4FQT A;  2KYC A;  3S0G A;  1NSH A;  4MEW A;  1WRZ A;  3S0F A;  3KF9 A;  1XVJ A;  2F8P A;  4DUQ A;  3D74 A;  5ER4 X;  2NCO A;  1JWD A;  1NCY A;  3CGA A;  3R1P A;  1LIN A;  1SSE B;  4WQ2 A;  4NDB A;  2G2B A;  1CDL A;  4MZJ A;  1WDC C;  1PRW A;  1JF0 A;  1NYA A;  1WRK A;  1YR5 A;  2BBM A;  3FE8 A;  1ALW A;  2HQ8 A;  1IQ3 A;  2Y4Q A;  1MUX A;  3B87 A;  1OSA A;  2OPO A;  1OOF A;  2JC2 A;  5AXI A;  1QX5 B;  1L2O C;  3NXA A;  3DD4 A;  3O78 A;  1F4O A;  1S26 D;  2VRG A;  3OB2 B;  1QX7 A;  1IRJ A;  1KFX L;  5CSI A;  1F70 A;  2COL B;  3D0Y B;  1NX1 A;  3WXA A;  3DVJ A;  5F6T A;  2F3Z A;  1OOI X;  2P6B B;  2H2K A;  3A8R A;  2ZRT A;  4JD9 A;  2M7L A;  1MF8 B;  1SRA A;  1TTX A;  1YUU A;  1CDP A;  2KOT A;  3CWG A;  3JTD B;  2LUX A;  5PAL A;  4HRE E;  1MXE A;  1KWO B;  2LP3 A;  2WC8 A;  1GQM A;  4GGN A;  5HLV A;  3KPX A;  1HT9 A;  2JRF A;  2LLT A;  4JKT A;  1CLB A;  1N0Y A;  3EK4 A;  2JXC A;  2NCP A;  3BUW B;  1TWO A;  2M8U A;  3TUY B;  2B1U A;  1OZS A;  1BJF A;  1N65 A;  3PAL A;  2WC6 A;  1GGW A;  2TN4 A;  3DF0 A;  4PHK A;  4N5X A;  3CLN A;  4IJ7 A;  1OZO A;  5K89 A;  3B86 A;  2WCK A;  5AAN A;  5TNC A;  2P70 A;  1RK9 A;  2AUC A;  3OX5 A;  3O4Y A;  1XYD A;  4DRW A;  1OMR A;  5EL2 A;  3BUX B;  1IKU A;  4GNK B;  3BOW B;  1SR6 C;  3I5F C;  1SNL A;  1DEK A;  4DCK A;  3R1V A;  1DQE A;  2EGD A;  4KYN A;  3BUN B;  2BBN A;  3AKB A;  2BCX A;  2ZN8 A;  2MA2 A;  3DVK A;  2PAL A;  2JT3 A;  2LHL A;  2LVK A;  1NX3 A;  3D76 A;  3DZT A;  1DJH A;  2L51 A;  3EKH A;  4FTG A;  3I5G C;  2BNX A;  5I2Q A;  1OOJ A;  2LV7 A;  1V1G A;  2QEO A;  3VRQ A;  1FI5 A;  1S6I A;  1BMO A;  2QAC A;  1QX2 A;  4CID A;  3IQO A;  1SL9 A;  2HPS A;  1DJI A;  1R6P A;  2JNF A;  2KFG A;  3IQQ A;  4I5K A;  4WQ3 A;  1AJ5 A;  3BUO B;  1DJG A;  1FBV A;  2JPT A;  4CLN A;  1TRF A;  3H4S E;  2NLN A;  1IG5 A;  5AFP A;  4YI8 A;  1C3Y A;  4N1F A;  5D7F A;  2LMU A;  1SCM B;  2JXL A;  1AVS A;  3FWB A;  2I94 A;  3DY9 A;  1SCV A;  3LK1 A;  4F7F A;  3SS4 A;  2FOT A;  1QJT A; 
#chains in the Genus database with same CATH homology
 2EC6 C;  1NWD A;  1K90 D;  2I7A A;  2GV5 A;  4C0K A;  4AQJ A;  4N1G A;  1C07 A;  2FCD A;  2DOQ A;  1UUR A;  1PK0 D;  1QAT A;  1CLM A;  2LHI A;  3DVE A;  1RRO A;  1SPY A;  1KK7 Y;  1SBJ A;  3EVR A;  4NDC A;  4BY5 A;  2F33 A;  3WNX B;  2HET A;  2K7D A;  3KHE A;  1W7J B;  2KI6 D;  5GQQ C;  1EXR A;  4HRH A;  1TN4 A;  2SCP A;  3I5I B;  4P5O E;  5J3X A;  3TDU A;  1BOD A;  1CDM A;  1S5G Z;  2GGZ A;  3ICB A;  2E30 A;  1B8C A;  1U5I A;  1UHH A;  2EHB A;  2FCE A;  2Q4U A;  1BR1 B;  3EK8 A;  2M97 A;  2JWW A;  1S1E A;  5AEQ A;  1W7I B;  1MHO A;  3OX6 A;  2JTZ A;  2LVJ A;  2LP2 A;  2Q91 A;  2K7C A;  3LCP C;  2JTT A;  4GGF C;  1NX2 A;  4MSP A;  1G8I A;  3JVT B;  2M1U A;  1QV1 A;  3DF0 B;  4YRU A;  5HYD A;  3SJS A;  2PMY A;  2Y5I A;  3BYA A;  3NSO A;  3SG5 A;  1QVI Z;  2KFH A;  1KK8 C;  2LLU A;  1CFD A;  3PM8 A;  3SG4 A;  1S6J A;  1Q80 A;  1KSM A;  2JNX A;  2L0P A;  1UHK A;  1C7V A;  5CSJ A;  1A03 A;  3FS7 A;  1DJX A;  1Y1U A;  2PRU A;  1WRL A;  2WND A;  1NIW A;  2R2I A;  4YBH B;  2JQ6 A;  1Y1X A;  2JOJ A;  3CR5 X;  5BPJ A;  1OMD A;  5G08 A;  1DGU A;  2F2P A;  2KHN A;  3TS5 C;  1IWQ A;  3WHU B;  1TCF A;  5HLO A;  2I2R E;  1YUS A;  1DVI A;  1KSO A;  1SL8 A;  2ZNE A;  1YRT B;  1YVL A;  1X02 A;  4ORC B;  4M2O A;  1DJW A;  4XJK B;  3M0W A;  4D1E A;  4M2P A;  4MZK A;  1JC2 A;  4GPL B;  1DTL A;  3I5H B;  3KO0 A;  2RGI A;  1UHJ A;  2KI4 C;  1TOP A;  1TNW A;  5KTY A;  2M1K B;  1BF5 A;  1YX8 A;  1NP8 A;  1M46 A;  1EJ3 A;  1EG3 A;  1ZUZ A;  2PSR A;  4C0J A;  3NSK A;  2K2A A;  1XFY O;  1K8U A;  1SKT A;  1KQM C;  4A4B A;  1AHR A;  2M49 B;  2ZND A;  2BL0 B;  2H61 C;  1ALV A;  1PSR A;  1VRK A;  4GFT A;  1UP5 A;  2KGB C;  2KGR A;  3VGO A;  4ORB B;  1C7W A;  1OMV A;  3TDI A;  4I5J A;  2I18 A;  3OHM B;  1H4B A;  2LM5 A;  5I2O A;  1SY9 A;  3CR2 A;  3SG2 A;  4IL1 A;  1WDC B;  1U5I B;  1KFU S;  1CB1 A;  1B7T Z;  2KSP A;  1L2O B;  1G33 A;  2JT0 A;  1NCX A;  2KBI A;  1ZOT B;  3EVV A;  2PAS A;  4YGB B;  1NPQ A;  1CFC A;  2KAX A;  3KEV A;  4I5N B;  2KAY A;  1TCO B;  1FW4 A;  4PHN A;  1UUS A;  1UHN A;  1UWO A;  2M0R A;  4Q04 A;  2LVI A;  2NXQ A;  2OS8 C;  4XJK A;  2MLF C;  1A2X A;  3GK4 X;  1SMG A;  4FQO A;  4GBA A;  3LK0 A;  3NSL A;  5D69 A;  1J7R A;  3ZNI A;  4AOM A;  3OP0 A;  2KFF A;  4GUK A;  1S36 A;  1V1F A;  3EKJ A;  4YGD B;  1GGZ A;  2BE6 A;  2KBM A;  4XYN A;  2KYF A;  5I2L A;  5I8N A;  1WLM A;  2FJU B;  1OE9 B;  2ZN9 A;  1B47 A;  2ISD A;  1LA3 A;  3D10 A;  1XO5 A;  5DKQ A;  1JF2 A;  1Y1A A;  3PN7 C;  3EK7 A;  3GK2 A;  1MR8 A;  3I5F B;  1SR6 B;  5KU1 A;  3K21 A;  1JUO A;  4YI9 A;  2CCM A;  5KSZ A;  4OKH A;  4ORA B;  4USL A;  2OTG C;  2K2F A;  2BEC A;  1CNP A;  2LUC A;  1WY9 A;  3I5G B;  1B9A A;  2CT9 A;  1NX0 A;  1ZAC A;  1QIV A;  3TZ1 A;  4JPZ B;  1J55 A;  3PFV A;  1B8R A;  1YVH A;  3RLZ A;  4E68 A;  4PCW A;  2K8M B;  1EH2 A;  1B1G A;  3CTN A;  3BXK A;  2AMI A;  5JOL A;  1XA5 A;  1J7Q A;  4L9M A;  1FF1 A;  2KI6 C;  2K7O A;  1N2D A;  2WOR A;  4YGC B;  5IBW A;  2KAV A;  4PE1 A;  2QPT A;  1ZMZ A;  3CZT X;  1K9U A;  2LLS A;  1S5G Y;  2LAP A;  2EC6 B;  4TNC A;  1J7O A;  1HQV A;  2D8N A;  2CXJ A;  3VRR A;  1LA0 A;  4CFQ A;  1NUB A;  1CFF A;  1XFU O;  3E3R A;  3IF7 A;  2H61 A;  3A4U B;  1AK8 A;  5B8I B;  1CMG A;  1BR4 B;  2CNP A;  3ZWH A;  5CSF A;  2BCB A;  4MBE A;  1QIW A;  3JTD C;  5HKW A;  2MHH A;  2KNE A;  1A75 A;  4R1E A;  1TIZ A;  2SAS A;  1KWO C;  1UHI A;  1DMO A;  3GOF A;  3O6B A;  1JBA A;  4U8D A;  1XFX O;  1QVI Y;  4OVN F;  3RM1 A;  4MZL A;  3PSR A;  2IS9 A;  3TUY C;  2F3Y A;  2K0J A;  3PAT A;  2JUL A;  1PAL A;  1REC A;  2L4H A;  3VRN A;  2LMT A;  4OV2 A;  2K7B A;  1XFV O;  1RTP 1;  3SG6 A;  4QJ5 B;  1J7P A;  4UPG A;  1CMF A;  1M45 A;  4ZCU A;  4MN0 A;  4MLW A;  1M31 A;  3CR4 X;  3PLF B;  2LNK A;  1A29 A;  1DT7 B;  5ER5 A;  1Y6W A;  2MLE C;  2M9G A;  1DGV A;  1R2U A;  5CPV A;  1QTX A;  1CLL A;  1KK8 B;  1XK4 C;  1YTZ C;  1B8L A;  1WLZ A;  2CTN A;  4HRG A;  1IJ5 A;  1K9K A;  4MRY A;  1TNX A;  3F45 A;  1BT6 A;  1NCZ A;  4QJ4 B;  1TNP A;  1F4Q A;  4CFR A;  1QLS A;  1DF0 A;  3TDZ A;  1GJY A;  1PVA A;  2BE4 A;  2AAO A;  1G4Y R;  1KFX S;  2ZRS A;  3LL8 B;  4DS7 A;  1H8B A;  2JZI A;  1BG1 A;  1K93 D;  1KFU L;  1ODB A;  4MVF A;  4M2Q A;  1F54 A;  1IQ5 A;  2E6W A;  2LAN A;  3TS5 B;  2KDH A;  4I5L B;  2L50 A;  2O60 A;  4PAL A;  1SCM C;  2V53 A;  3LLE A;  4ICB A;  1PUL A;  2KQY A;  2GGM A;  2O5G A;  4PE4 A;  1CKK A;  1SK6 D;  5DKN A;  2WCB A;  3QRX A;  3FIA A;  4OR9 B;  2LCP A;  2MJW B;  4PHM A;  1RFJ A;  2KI4 B;  2G9B A;  1DJY A;  1E8A A;  1PVB A;  1QLK A;  4PE7 A;  1YUR A;  2K61 A;  1CTR A;  3SIB A;  4ETO A;  1CM1 A;  1IH0 A;  1F71 A;  1J1E A;  4GGF A;  1B7T Y;  1PSB A;  1SW8 A;  3EVU A;  4BY4 A;  1KQM B;  1LXF C;  4OCI A;  1D1O A;  2LC5 A;  4P2Y B;  1BLQ A;  5HKY A;  2HQW A;  2CBL A;  1XFZ O;  1BOC A;  2Y1M A;  4C0L A;  1K9P A;  4NDD A;  2LE9 B;  1XFW O;  1J1D A;  1QAS A;  4PDZ A;  2WOS A;  1AUI B;  1A75 B;  3C1V A;  1DJZ A;  1KK7 Z;  3BQ3 A;  3D0Y A;  4F0Z B;  4MRX A;  4HSZ A;  2WCF A;  1SYM A;  2MBX A;  1YRU B;  4WRI A;  5DKR A;  1AJ4 A;  1QS7 A;  1ZFS A;  1F8H A;  1JSA A;  1B4C A;  3JVT C;  2ZKM X;  1MXL C;  2M7N A;  2L98 A;  2MAZ A;  1IGV A;  2NZ0 A;  1AP4 A;  1A4P A;  1LVC D;  3AAK A;  2L2E A;  1L7Z A;  3SG3 A;  2OS8 B;  2PVB A;  1M63 B;  4AQI A;  5JJG A;  2BKI B;  3CS1 A;  2F2O A;  5HKZ A;  3HX4 A;  1JFJ A;  1EL4 A;  1CFP A;  3DVM A;  4QJ3 B;  1QV0 A;  1MWN A;  4CPV A;  2LVV A;  4A4C A;  2BCA A;  3GK1 A;  1S6C A;  4NQG A;  1K94 A;  3WHT B;  1SL7 A;  1Y0V H;  1QXP A;  1M39 A;  1YUT A;  3BOW A;  1JFK A;  1CDN A;  2WCE A;  1K2H A;  1F55 A;  2ZFD A;  1DF0 B;  1XK4 A;  1EG4 A;  2Y1N A;  2JT8 A;  2M3W A;  3BUM B;  1FPW A;  1RWY A;  4JWQ A;  3PN7 B;  2L4I A;  1S3P A;  2L5X B;  4YGE B;  5FYX A;  3FWC A;  4DIR A;  5CSN A;  1BU3 A;  3OB1 B;  3I5H C;  2OTG B;  1K96 A;  1RJV A;  3VRO A;  1FI6 A;  4GAO A;  4PHJ A;  5AER A;  1IJ6 A;  1KCY A;  3SIA A;  4PE0 A;  3HCM A;  2MRD A;  1K95 A;  4YGA A;  1LKJ A;  1TNQ A;  3MSE B;  3SG7 A;  1MQ1 A;  2BKH B;  2HF5 A;  2A4J A;  4ZCV A;  2LMV A;  3VRP A;  2KQ6 A;  1OQP A;  3O2P A;  1KQV A;  4JQ0 D;  2BL0 C;  1YX7 A;  1CM4 A;  2M29 A;  2JU0 A;  3AKA A;  3NSI A;  3AAJ A;  2KYC A;  1NSH A;  4MEW A;  1WRZ A;  3KF9 A;  1XVJ A;  2F8P A;  4DUQ A;  5ER4 X;  2NCO A;  1JWD A;  1NCY A;  3CGA A;  1LIN A;  4WQ2 A;  4NDB A;  2G2B A;  1CDL A;  4MZJ A;  1WDC C;  1PRW A;  1JF0 A;  1NYA A;  1WRK A;  1YR5 A;  2BBM A;  3FWB A;  1ALW A;  2HQ8 A;  1IQ3 A;  2Y4Q A;  1MUX A;  1OSA A;  2OPO A;  2JC2 A;  5AXI A;  1QX5 B;  1L2O C;  3NXA A;  3DD4 A;  3O78 A;  1F4O A;  1S26 D;  2VRG A;  3OB2 B;  1QX7 A;  1IRJ A;  1KFX L;  5CSI A;  1F70 A;  2COL B;  3D0Y B;  1NX1 A;  3WXA A;  3DVJ A;  5F6T A;  2F3Z A;  2P6B B;  2H2K A;  3A8R A;  2ZRT A;  2M7L A;  1MF8 B;  1SRA A;  1TTX A;  1CDP A;  1YUU A;  2KOT A;  3CWG A;  3JTD B;  2LUX A;  5PAL A;  4HRE E;  1MXE A;  1KWO B;  2LP3 A;  2WC8 A;  1GQM A;  4GGN A;  5HLV A;  3KPX A;  1HT9 A;  2JRF A;  2LLT A;  1CLB A;  1N0Y A;  3EK4 A;  2JXC A;  2NCP A;  3BUW B;  2M8U A;  3TUY B;  2B1U A;  1OZS A;  1BJF A;  1N65 A;  3PAL A;  1GGW A;  2TN4 A;  3DF0 A;  4PHK A;  4N5X A;  3CLN A;  1OZO A;  5K89 A;  5AAN A;  5TNC A;  1RK9 A;  2AUC A;  3OX5 A;  3O4Y A;  1XYD A;  4DRW A;  1OMR A;  1IKU A;  3BUX B;  4GNK B;  3BOW B;  1SR6 C;  3I5F C;  1SNL A;  4DCK A;  2EGD A;  3BUN B;  2BBN A;  3AKB A;  2BCX A;  2ZN8 A;  2MA2 A;  3DVK A;  2PAL A;  2JT3 A;  2LHL A;  2LVK A;  1NX3 A;  3I5I C;  1DJH A;  2L51 A;  3EKH A;  4FTG A;  3I5G C;  5I2Q A;  1OOJ A;  2LV7 A;  1V1G A;  3VRQ A;  1FI5 A;  1S6I A;  1BMO A;  2QAC A;  1QX2 A;  4CID A;  3IQO A;  1SL9 A;  2HPS A;  1DJI A;  1R6P A;  2JNF A;  2KFG A;  3IQQ A;  4I5K A;  4WQ3 A;  1AJ5 A;  3BUO B;  1DJG A;  1FBV A;  2JPT A;  4CLN A;  1TRF A;  3H4S E;  2NLN A;  1IG5 A;  5AFP A;  4YI8 A;  4N1F A;  5D7F A;  2LMU A;  1SCM B;  2JXL A;  1AVS A;  2I94 A;  3LK1 A;  1SCV A;  2FOT A;  1QJT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...