1OOIX

Crystal structure of lush from drosophila melanogaster at ph 6.5
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
124
structure length
124
Chain Sequence
MTMEQFLTSLDMIRSGCAPKFKLKTEDLDRLRVGDFNFPPSQDLMCYTKCVSLMAGTVNKKGEFNAPKALAQLPHLVPPEMMEMSRKSVEACRDTHKQFKESCERVYQTAKCFSENADGQFMWP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords odorant binding protein LUSH
publication title Structure of a specific alcohol-binding site defined by the odorant binding protein LUSH from Drosophila melanogaster
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Transport protein
total genus 48
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 2003-03-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.20 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 Pheromone/general odorant binding protein domain 1ooiX00
3S0BA 1TUJA 4OZDA 3DXLA 2QEBA 3D74A 3R1VA 3FE9A 1OW4A 3OGNA 3S0AA 3D73A 2QEVA 3CABA 3PJIA 3CZ1A 2QEHA 3S0GA 3DY9A 3D75A 2QEOA 2WCMA 3BFHA 2H8VA 3L4LA 3FE6A 3S0EA 3K1EA 1C3ZA 4FQTA 3Q8IA 2WCKA 3NGVA 3VB1A 2KPHA 3QMEA 3V2LA 1OOHA 4F7FA 2WCHA 1T14A 1OOGA 1C3YA 3D78A 3D76A 3B88A 3NHTA 2WC6A 1XFRA 3DYEA 4PT1A 1TWOA 3B7AA 3BFAA 1P28A 1DQEA 4INWA 3R72A 3BJHA 3RZSA 3N7HA 5EL2A 3S0DA 2QDIA 1GM0A 2WCJA 2ERBA 3CYZA 3DZTA 1LS8A 4INXA 5DICA 3CDNA 3B87A 3L4AA 4JD9A 2FJYA 3B86A 1OOFA 3D77A 2L2CA 2GTEA 3L47A 3CZ0A 1QWVA 2WC5A 3CZ2A 3FE8A 2JPOA 2P71A 3BFBA 1OOIX 3NHIA 3B6XA 1ORGA 2WCLA 2PQLA 3R1OA 3S0FA 2P70A 3R1PA
chains in the Genus database with same CATH superfamily
3A8RA 3NSIA 1PSRA 3EVVA 3LL8B 1QTXA 3DXLA 2E6WA 4OZDA 4YGCB 2KYCA 2KHNA 1YURA 3R1VA 2BE6A 2KGRA 2CBLA 1BT6A 3EG5B 3FE9A 2CXJA 2MBXA 3WXAA 1SY9A 5AXIA 1F55A 1QIVA 2AAOA 3S0AA 1IRJA 5AFPA 1SR6C 2D8NA 2NCOA 2ZNEA 2HQWA 2GGZA 5HYDA 5KTYA 2PSRA 2JXLA 1LINA 1PK0D 3BUOB 1QV1A 3OX5A 5D3OA 3FIAA 1DMOA 1XYDA 2BKIB 1UUSA 1ZMZA 2HF5A 2MLEC 2K8MB 5K89A 2LVKA 3D75A 3FWCA 1A29A 1UWOA 2WCMA 3KEVA 2M1UA 5GQQC 1KFXL 4U8DA 2KAYA 2BL0C 1AVSA 1NPQA 1KQMC 1WDCB 2KBMA 3FE6A 2BBMA 3S0EA 1YUSA 3LK0A 3SG2A 4A4CA 1DELA 4F0ZB 1DJYA 2HETA 1C3ZA 5AEQA 3OB2B 1SYMA 4OCIA 3SIBA 1KK7Y 2LMUA 3SG3A 2H2KA 1CNPA 1KCYA 1KSOA 2L4HA 2PRUA 3OHMB 4YBHB 4C0JA 4XJKA 2JPTA 2M29A 4L9MA 3I5GC 4YGDB 4JPZB 3CTNA 1U5IB 1BOCA 1SRAA 3BXKA 4GFTA 1SPYA 1DJXA 1AJ4A 1K96A 1L2OC 1LVCD 2A4JA 4USLA 5ER4X 3TDZA 2BECA 2I18A 4M2OA 4UPGA 5HKYA 1F54A 3EVUA 4PHNA 1B8LA 5HKWA 1AUIB 1OOHA 2K0JA 2NZ0A 3EKJA 3I5IB 3LK1A 1SBJA 2KBIA 4F7FA 1KSMA 1NIWA 2MRDA 2WNDA 1NWDA 1CFPA 2PMYA 3DVEA 1G4YR 3D78A 1S6IA 2JNXA 3CR4X 4AOMA 1A4PA 3B88A 3SG4A 5I2OA 1CB1A 1JSAA 1J55A 4C0LA 2LMTA 1LA3A 1MXLC 2H61C 3DYEA 3UO9A 5B8IB 5J3XA 3GK4X 2NXQA 3B7AA 3CWGA 2I7AA 1F8HA 2KGBC 4PE7A 3TZ1A 2KOTA 1XO5A 1BODA 1DQEA 2K7BA 3R1OA 5FI2A 1M63B 4PHJA 3SS5A 1L7ZA 5EL2A 1S5GY 4ZCUA 4BY5A 1SMGA 1QXPA 1SCMC 2IS9A 2KSPA 3GK1A 1GM0A 2WCJA 4C0KA 3I5HC 3CYZA 1DT7B 5DKNA 3DZTA 1MR8A 2KI4C 1C7VA 2L4IA 2OS8C 1NYAA 1Y6WA 3BOWA 1XK4A 3SG7A 1B47A 4PALA 2SASA 3CLNA 3GK2A 1QLSA 1NCYA 4MRYA 1YX7A 1DJZA 1BU3A 1Y0VH 2L5XB 2MAZA 2BL0B 1NP8A 1LKJA 1KQMB 1DF0B 4PDZA 2FJYA 1CDMA 1BLQA 1TCFA 3JVTC 4WQ2A 4YGAA 1EXRA 1QWVA 1R6PA 2JC2A 3FE8A 2JPOA 4DRWA 2M7LA 2LHLA 3BFBA 3WNXB 1C7WA 4PCWA 4N1FA 1KQVA 2AUCA 2L51A 2PQLA 4HSZA 3S0DA 3S0FA 3HX4A 2P70A 5CPVA 3R1PA 3DF0A 1MXEA 3S0BA 1ODBA 2ZFDA 4PE0A 1XFWO 1XFYO 1IJ5A 1WRKA 2RGIA 1HT9A 1GGWA 5FI7A 1K94A 2QACA 1PSBA 2LVJA 3TUYB 4QJ4B 1TNPA 2EC6B 4QJ3B 2BCAA 2R2IA 3EKHA 2L50A 2LMVA 5JJGA 2VRGA 5I2LA 2K2FA 1QVIY 1RJVA 4DCKA 5PALA 3CZ1A 1UURA 4MVFA 2K7DA 4MRXA 2JT3A 4PHMA 1VRKA 5CSFA 1CM4A 1KWOC 1CDNA 1DJWA 1F71A 1B7TY 4GGFA 2PALA 5KSZA 1CLMA 3TDIA 1G33A 1EG3A 2KFHA 4ETOA 4E68A 1AHRA 3F45A 4WRIA 1F70A 1RFJA 2KQYA 4JQ0D 3SIAA 4M2QA 1QJTA 1SCMB 1KFXS 4GAOA 1IGVA 1S1EA 3WHTB 4MZJA 1K95A 4OV2A 2E30A 2LC5A 4CIDA 1RK9A 1TNQA 1B9AA 4NQGA 2KI4B 1DEKA 2FCEA 1MF8B 2L5YA 1K8UA 1H8BA 1K93D 1NSHA 2WCBA 1OQPA 4ORBB 2LANA 3PM2A 3SG6A 3BUMB 3NGVA 1BMOA 4FTGA 3VB1A 4KYNA 1F4OA 4MN0A 3KPXA 3V2LA 3LCPC 1DJHA 4JWQA 2M3WA 1MUXA 2KNEA 1Y1AA 1BJFA 2L2EA 4MEWA 3DVMA 1JF2A 1OOGA 3PFVA 1BG1A 4WQ3A 4MBEA 1C3YA 1IH0A 1IQ3A 2WCEA 3I5FC 1CDLA 2TN4A 1ZOTB 1XFRA 1ZFSA 1CTRA 1U5IA 1RROA 1TWOA 4GGNA 3CZTX 3TS5B 3BFAA 5FYXA 2EHBA 1P28A 1TRFA 4PE1A 2FOTA 4NDBA 1S6CA 4MLWA 1OMVA 2CTNA 1SSEB 2KQ6A 2ZKMX 2JT0A 3PN7B 1RECA 1EJ3A 1CFFA 1YRTB 2JOJA 5FI6A 1SL9A 1IQ5A 4HRGA 1W7IB 1EL4A 1FF1A 3QRXA 2F8PA 1A75B 3CDNA 3O2PA 3EK7A 4I5LB 1WY9A 2BCBA 2WCFA 3E3RA 1OE9B 1J7RA 2KAVA 1IKUA 1JF0A 3RM1A 4M2PA 1D1OA 3OX6A 1J7PA 3VRRA 1QX5B 3IQOA 2MJWB 4NDDA 4I5JA 4FQOA 2KLEA 3B86A 4ZCVA 3D77A 1NCZA 2L2CA 3L47A 1V1GA 2MA2A 1OMRA 2CNPA 3VGOA 1JFKA 2P71A 1RTP1 1A03A 3NHIA 1ORGA 2JQ6A 3SJSA 2CT9A 1B8CA 2QPTA 5I2QA 1CDPA 3PSRA 1SR6B 4INWA 2F3ZA 1EH2A 5F6TA 4OVNF 2BKHB 1XFVO 4IL1A 1DF0A 2NLNA 2KAXA 3BUWB 4MZKA 4N1GA 4I5KA 2LV7A 1GGZA 1B7TZ 1V1FA 1KK8C 5DKQA 2M9GA 2JNFA 1QV0A 1JBAA 3CABA 3PJIA 2LNKA 1B1GA 1CLBA 2QEHA 1HQVA 3I5FB 3S0GA 1JC2A 1CM1A 1TCOB 2JWWA 2LUXA 2KFFA 1WLMA 4ORCB 1ALWA 1DGVA 4ORAB 5CSJA 2L0PA 3BFHA 2SCPA 1MHOA 3DVKA 3SS4A 1TUZA 2KFGA 1UHHA 4CLNA 5D7FA 3I5GB 1DTLA 4PHKA 3L4LA 3CR5X 5ER5A 1EG4A 1F4QA 3K1EA 1L2OB 3NXAA 2M1KB 5BPJA 1J1EA 1K9UA 1M31A 3PALA 1K9KA 2JRFA 4FQTA 1IG5A 3NSOA 3BUNB 3KHEA 5G08A 3NSKA 2H61A 2MLFC 3Q8IA 4BY4A 2LLSA 1NX3A 1S3PA 1NUBA 2Q91A 1LXFC 2WCKA 1K90D 1K9PA 2K2AA 2KPHA 3QMEA 4DUQA 2OTGC 3SS3A 3BQ3A 1OMDA 1TNWA 4DIRA 1KK7Z 5KU1A 4MZLA 1QASA 1BF5A 1T14A 4YI9A 1SK6D 1QS7A 1MQ1A 2ISDA 3D10A 1XFZO 3NHTA 1M45A 3D0YB 1YUUA 3H4SE 1QATA 3I5HB 3LLEA 4R1EA 2LHIA 2FJUB 2JTZA 2G2BA 2Y4QA 2LAPA 2OS8B 5CSNA 3I5IC 2F2PA 1B8RA 5HKZA 5I94A 1XA5A 3VRQA 5I8NA 3K21A 1XFUO 3R72A 1PRWA 3RZSA 1N2DA 1TIZA 3N7HA 3UNWA 4CFRA 1CKKA 1CMFA 2LP3A 3NSLA 3IVTA 4I5NB 2ERBA 4OKHA 2KI6D 4OR9B 1PVAA 2WORA 4YGBB 3RLZA 3JVTB 1LS8A 3CS1A 3OP0A 2ZN9A 1YRUB 1J7OA 1DGUA 3CGAA 3L4AA 1FBVA 1UHKA 4JD9A 1UP5A 1S5GZ 2F3YA 3PM8A 2M8UA 1OOJA 1SL7A 2WC8A 5JOLA 3ZWHA 3HCMA 1Y1XA 2GTEA 1UHNA 1JFJA 5D69A 1N65A 1CLLA 1YVLA 3AKAA 3MSEB 2NCPA 3TDUA 1CMGA 1OOIX 2I94A 1H4BA 1S6JA 2ZRSA 1A2XA 4P5OE 1MWNA 1YR5A 1NX0A 1A75A 1Q80A 1XK4C 2K7CA 1RWYA 2JULA 2BBNA 2KLDA 1TUJA 1GQMA 3BUXB 1IIOA 2DOQA 3O78A 2O60A 2FCDA 2LP2A 1TN4A 1YVHA 1PULA 1YUTA 2M0RA 2QEBA 2KDHA 3D74A 3IF7A 1R2UA 1AK8A 2BNXA 1IJ6A 3FWBA 1DC1A 1KWOB 1OSAA 2OTGB 1KFUS 3ICBA 2OPOA 3AAJA 1C07A 3EK8A 1UHIA 1OW4A 2JTTA 3OGNA 1CFCA 4MSPA 4CPVA 1UHJA 3VRPA 2M7NA 4Q04A 3D73A 1YX8A 4HRHA 2KI6C 2LM5A 2QEVA 1QIWA 2F33A 1JWDA 3BYAA 1WLZA 2ZNDA 1YTZC 5CSIA 1W9ZA 1ALVA 3SG5A 1TOPA 3O4YA 3DY9A 3VRNA 4XJKB 2QEOA 3TUYC 1J1DA 1QX7A 3EVRA 3JTDC 2EC6C 2K7OA 3IQQA 2GV5A 1TNXA 4YGEB 2H8VA 1OZSA 3PLFB 1SL8A 2HQ8A 1ZACA 2V53A 1KFUL 1QVIZ 2KYFA 3DD4A 2P6BB 2Q4UA 2LVVA 2EGDA 1BR4B 5DKRA 1B4CA 2G9BA 1NX2A 3GOFA 4GUKA 2AMIA 2Y5IA 3C1VA 3KF9A 2COLB 1QLKA 2LUCA 4PE4A 1Y1UA 2PASA 4YI8A 3M0WA 1Z4HA 1G8IA 1NCXA 1S36A 4IJ7A 4AQJA 1J7QA 2JU0A 4GGFC 3O4XA 1W7JB 1GJYA 1WRZA 1DJIA 2GGMA 3A4UB 2I2RE 1LA0A 2L98A 1N0YA 1OZOA 2YGUA 3OB1B 1SKTA 2WCHA 1JUOA 1NX1A 5IBWA 1FI5A 4CFQA 3D76A 4ICBA 4JKTA 2K60A 3BOWB 2Y1NA 3AKBA 4P2YB 1ZUZA 2WC6A 2ZN8A 3VROA 4QJ5B 1DJGA 1IWQA 2LCPA 4N5XA 4PT1A 1FI6A 2ZRTA 1XFXO 2CCMA 2O5GA 2LLUA 3FS7A 2JT8A 2LVIA 1S26D 1SCVA 3WHUB 2BAPA 1FPWA 1AJ5A 1WDCC 2BCXA 3BJHA 4XYNA 5TNCA 5HLOA 4A4BA 4DS7A 4YRUA 4HREE 2LE9B 2QDIA 4D1EA 1FW4A 3OBVA 2M49B 3EK4A 3KO0A 1K2HA 1WRLA 2MHHA 1TTXA 4NDCA 3TS5C 5HL1A 4INXA 5DICA 4GNKB 3D0YA 3CR2A 3DF0B 2JZIA 1E8AA 3B87A 4GBAA 2PVBA 1AP4A 2B1UA 1BR1B 2BE4A 1M39A 3JTDB 3ZNIA 5AANA 4AQIA 1SNLA 1QX2A 4GPLB 3AAKA 1M46A 3PN7C 3O6BA 5HLVA 5AERA 2F2OA 2WOSA 3PATA 1OOFA 1PALA 2Y1MA 3CZ0A 3DVJA 2WC5A 3CZ2A 2PYQA 2LLTA 1PVBA 1DVIA 2M97A 1X02A 2JXCA 3B6XA 2HPSA 2K61A 1CFDA 1KK8B 1XVJA 2WCLA 1Z2CB 4TNCA 1SW8A
chains in the Genus database with same CATH topology
3S0BA 1TUJA 4OZDA 3DXLA 2QEBA 3D74A 3R1VA 3FE9A 1OW4A 3OGNA 3S0AA 3D73A 2QEVA 3CABA 3PJIA 3CZ1A 2QEHA 3S0GA 3DY9A 3D75A 2QEOA 2WCMA 3BFHA 2H8VA 3L4LA 3FE6A 3S0EA 3K1EA 1C3ZA 4FQTA 3Q8IA 2WCKA 3NGVA 3VB1A 2KPHA 3QMEA 3V2LA 1OOHA 4F7FA 2WCHA 1T14A 1OOGA 1C3YA 3D78A 3D76A 3B88A 3NHTA 2WC6A 1XFRA 3DYEA 4PT1A 1TWOA 3B7AA 3BFAA 1P28A 1DQEA 4INWA 3R72A 3BJHA 3RZSA 3N7HA 5EL2A 3S0DA 2QDIA 1GM0A 2WCJA 2ERBA 3CYZA 3DZTA 1LS8A 4INXA 5DICA 3CDNA 3B87A 3L4AA 4JD9A 2FJYA 3B86A 1OOFA 3D77A 2L2CA 2GTEA 3L47A 3CZ0A 1QWVA 2WC5A 3CZ2A 3FE8A 2JPOA 2P71A 3BFBA 1OOIX 3NHIA 3B6XA 1ORGA 2WCLA 2PQLA 3R1OA 3S0FA 2P70A 3R1PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3S0B A;  1TUJ A;  4OZD A;  3DXL A;  2QEB A;  3D74 A;  3R1V A;  3FE9 A;  1OW4 A;  3OGN A;  3S0A A;  3D73 A;  2QEV A;  3CAB A;  3PJI A;  3CZ1 A;  2QEH A;  3S0G A;  3DY9 A;  3D75 A;  2QEO A;  2WCM A;  3BFH A;  2H8V A;  3L4L A;  3FE6 A;  3S0E A;  3K1E A;  1C3Z A;  4FQT A;  3Q8I A;  2WCK A;  3NGV A;  3VB1 A;  2KPH A;  3QME A;  3V2L A;  1OOH A;  4F7F A;  2WCH A;  1T14 A;  1OOG A;  1C3Y A;  3D78 A;  3D76 A;  3B88 A;  3NHT A;  2WC6 A;  1XFR A;  3DYE A;  4PT1 A;  1TWO A;  3B7A A;  3BFA A;  1P28 A;  1DQE A;  4INW A;  3R72 A;  3BJH A;  3RZS A;  3N7H A;  5EL2 A;  3S0D A;  2QDI A;  1GM0 A;  2WCJ A;  2ERB A;  3CYZ A;  3DZT A;  1LS8 A;  4INX A;  5DIC A;  3CDN A;  3B87 A;  3L4A A;  4JD9 A;  2FJY A;  3B86 A;  1OOF A;  3D77 A;  2L2C A;  2GTE A;  3L47 A;  3CZ0 A;  1QWV A;  2WC5 A;  3CZ2 A;  3FE8 A;  2JPO A;  2P71 A;  3BFB A;  1OOI X;  3NHI A;  3B6X A;  1ORG A;  2WCL A;  2PQL A;  3R1O A;  3S0F A;  2P70 A;  3R1P A; 
#chains in the Genus database with same CATH topology
 3A8R A;  3NSI A;  1PSR A;  3EVV A;  3LL8 B;  1QTX A;  3DXL A;  2E6W A;  4OZD A;  4YGC B;  2KYC A;  2KHN A;  1YUR A;  3R1V A;  2BE6 A;  2KGR A;  2CBL A;  1BT6 A;  3EG5 B;  3FE9 A;  2CXJ A;  2MBX A;  3WXA A;  1SY9 A;  5AXI A;  1F55 A;  1QIV A;  2AAO A;  3S0A A;  1IRJ A;  5AFP A;  1SR6 C;  2D8N A;  2NCO A;  2ZNE A;  2HQW A;  2GGZ A;  5HYD A;  5KTY A;  2PSR A;  2JXL A;  1LIN A;  1PK0 D;  3BUO B;  1QV1 A;  3OX5 A;  5D3O A;  3FIA A;  1DMO A;  1XYD A;  2BKI B;  1UUS A;  1ZMZ A;  2HF5 A;  2MLE C;  2K8M B;  5K89 A;  2LVK A;  3D75 A;  3FWC A;  1A29 A;  1UWO A;  2WCM A;  3KEV A;  2M1U A;  5GQQ C;  1KFX L;  4U8D A;  2KAY A;  2BL0 C;  1AVS A;  1NPQ A;  1KQM C;  1WDC B;  2KBM A;  3FE6 A;  2BBM A;  3S0E A;  1YUS A;  3LK0 A;  3SG2 A;  4A4C A;  1DEL A;  4F0Z B;  1DJY A;  2HET A;  1C3Z A;  5AEQ A;  3OB2 B;  1SYM A;  4OCI A;  3SIB A;  1KK7 Y;  2LMU A;  3SG3 A;  2H2K A;  1CNP A;  1KCY A;  1KSO A;  2L4H A;  2PRU A;  3OHM B;  4YBH B;  4C0J A;  4XJK A;  2JPT A;  2M29 A;  4L9M A;  3I5G C;  4YGD B;  4JPZ B;  3CTN A;  1U5I B;  1BOC A;  1SRA A;  3BXK A;  4GFT A;  1SPY A;  1DJX A;  1AJ4 A;  1K96 A;  1L2O C;  1LVC D;  2A4J A;  4USL A;  5ER4 X;  3TDZ A;  2BEC A;  2I18 A;  4M2O A;  4UPG A;  5HKY A;  1F54 A;  3EVU A;  4PHN A;  1B8L A;  5HKW A;  1AUI B;  1OOH A;  2K0J A;  2NZ0 A;  3EKJ A;  3I5I B;  3LK1 A;  1SBJ A;  2KBI A;  4F7F A;  1KSM A;  1NIW A;  2MRD A;  2WND A;  1NWD A;  1CFP A;  2PMY A;  3DVE A;  1G4Y R;  3D78 A;  1S6I A;  2JNX A;  3CR4 X;  4AOM A;  1A4P A;  3B88 A;  3SG4 A;  5I2O A;  1CB1 A;  1JSA A;  1J55 A;  4C0L A;  2LMT A;  1LA3 A;  1MXL C;  2H61 C;  3DYE A;  3UO9 A;  5B8I B;  5J3X A;  3GK4 X;  2NXQ A;  3B7A A;  3CWG A;  2I7A A;  1F8H A;  2KGB C;  4PE7 A;  3TZ1 A;  2KOT A;  1XO5 A;  1BOD A;  1DQE A;  2K7B A;  3R1O A;  5FI2 A;  1M63 B;  4PHJ A;  3SS5 A;  1L7Z A;  5EL2 A;  1S5G Y;  4ZCU A;  4BY5 A;  1SMG A;  1QXP A;  1SCM C;  2IS9 A;  2KSP A;  3GK1 A;  1GM0 A;  2WCJ A;  4C0K A;  3I5H C;  3CYZ A;  1DT7 B;  5DKN A;  3DZT A;  1MR8 A;  2KI4 C;  1C7V A;  2L4I A;  2OS8 C;  1NYA A;  1Y6W A;  3BOW A;  1XK4 A;  3SG7 A;  1B47 A;  4PAL A;  2SAS A;  3CLN A;  3GK2 A;  1QLS A;  1NCY A;  4MRY A;  1YX7 A;  1DJZ A;  1BU3 A;  1Y0V H;  2L5X B;  2MAZ A;  2BL0 B;  1NP8 A;  1LKJ A;  1KQM B;  1DF0 B;  4PDZ A;  2FJY A;  1CDM A;  1BLQ A;  1TCF A;  3JVT C;  4WQ2 A;  4YGA A;  1EXR A;  1QWV A;  1R6P A;  2JC2 A;  3FE8 A;  2JPO A;  4DRW A;  2M7L A;  2LHL A;  3BFB A;  3WNX B;  1C7W A;  4PCW A;  4N1F A;  1KQV A;  2AUC A;  2L51 A;  2PQL A;  4HSZ A;  3S0D A;  3S0F A;  3HX4 A;  2P70 A;  5CPV A;  3R1P A;  3DF0 A;  1MXE A;  3S0B A;  1ODB A;  2ZFD A;  4PE0 A;  1XFW O;  1XFY O;  1IJ5 A;  1WRK A;  2RGI A;  1HT9 A;  1GGW A;  5FI7 A;  1K94 A;  2QAC A;  1PSB A;  2LVJ A;  3TUY B;  4QJ4 B;  1TNP A;  2EC6 B;  4QJ3 B;  2BCA A;  2R2I A;  3EKH A;  2L50 A;  2LMV A;  5JJG A;  2VRG A;  5I2L A;  2K2F A;  1QVI Y;  1RJV A;  4DCK A;  5PAL A;  3CZ1 A;  1UUR A;  4MVF A;  2K7D A;  4MRX A;  2JT3 A;  4PHM A;  1VRK A;  5CSF A;  1CM4 A;  1KWO C;  1CDN A;  1DJW A;  1F71 A;  1B7T Y;  4GGF A;  2PAL A;  5KSZ A;  1CLM A;  3TDI A;  1G33 A;  1EG3 A;  2KFH A;  4ETO A;  4E68 A;  1AHR A;  3F45 A;  4WRI A;  1F70 A;  1RFJ A;  2KQY A;  4JQ0 D;  3SIA A;  4M2Q A;  1QJT A;  1SCM B;  1KFX S;  4GAO A;  1IGV A;  1S1E A;  3WHT B;  4MZJ A;  1K95 A;  4OV2 A;  2E30 A;  2LC5 A;  4CID A;  1RK9 A;  1TNQ A;  1B9A A;  4NQG A;  2KI4 B;  1DEK A;  2FCE A;  1MF8 B;  2L5Y A;  1K8U A;  1H8B A;  1K93 D;  1NSH A;  2WCB A;  1OQP A;  4ORB B;  2LAN A;  3PM2 A;  3SG6 A;  3BUM B;  3NGV A;  1BMO A;  4FTG A;  3VB1 A;  4KYN A;  1F4O A;  4MN0 A;  3KPX A;  3V2L A;  3LCP C;  1DJH A;  4JWQ A;  2M3W A;  1MUX A;  2KNE A;  1Y1A A;  1BJF A;  2L2E A;  4MEW A;  3DVM A;  1JF2 A;  1OOG A;  3PFV A;  1BG1 A;  4WQ3 A;  4MBE A;  1C3Y A;  1IH0 A;  1IQ3 A;  2WCE A;  3I5F C;  1CDL A;  2TN4 A;  1ZOT B;  1XFR A;  1ZFS A;  1CTR A;  1U5I A;  1RRO A;  1TWO A;  4GGN A;  3CZT X;  3TS5 B;  3BFA A;  5FYX A;  2EHB A;  1P28 A;  1TRF A;  4PE1 A;  2FOT A;  4NDB A;  1S6C A;  4MLW A;  1OMV A;  2CTN A;  1SSE B;  2KQ6 A;  2ZKM X;  2JT0 A;  3PN7 B;  1REC A;  1EJ3 A;  1CFF A;  1YRT B;  2JOJ A;  5FI6 A;  1SL9 A;  1IQ5 A;  4HRG A;  1W7I B;  1EL4 A;  1FF1 A;  3QRX A;  2F8P A;  1A75 B;  3CDN A;  3O2P A;  3EK7 A;  4I5L B;  1WY9 A;  2BCB A;  2WCF A;  3E3R A;  1OE9 B;  1J7R A;  2KAV A;  1IKU A;  1JF0 A;  3RM1 A;  4M2P A;  1D1O A;  3OX6 A;  1J7P A;  3VRR A;  1QX5 B;  3IQO A;  2MJW B;  4NDD A;  4I5J A;  4FQO A;  2KLE A;  3B86 A;  4ZCV A;  3D77 A;  1NCZ A;  2L2C A;  3L47 A;  1V1G A;  2MA2 A;  1OMR A;  2CNP A;  3VGO A;  1JFK A;  2P71 A;  1RTP 1;  1A03 A;  3NHI A;  1ORG A;  2JQ6 A;  3SJS A;  2CT9 A;  1B8C A;  2QPT A;  5I2Q A;  1CDP A;  3PSR A;  1SR6 B;  4INW A;  2F3Z A;  1EH2 A;  5F6T A;  4OVN F;  2BKH B;  1XFV O;  4IL1 A;  1DF0 A;  2NLN A;  2KAX A;  3BUW B;  4MZK A;  4N1G A;  4I5K A;  2LV7 A;  1GGZ A;  1B7T Z;  1V1F A;  1KK8 C;  5DKQ A;  2M9G A;  2JNF A;  1QV0 A;  1JBA A;  3CAB A;  3PJI A;  2LNK A;  1B1G A;  1CLB A;  2QEH A;  1HQV A;  3I5F B;  3S0G A;  1JC2 A;  1CM1 A;  1TCO B;  2JWW A;  2LUX A;  2KFF A;  1WLM A;  4ORC B;  1ALW A;  1DGV A;  4ORA B;  5CSJ A;  2L0P A;  3BFH A;  2SCP A;  1MHO A;  3DVK A;  3SS4 A;  1TUZ A;  2KFG A;  1UHH A;  4CLN A;  5D7F A;  3I5G B;  1DTL A;  4PHK A;  3L4L A;  3CR5 X;  5ER5 A;  1EG4 A;  1F4Q A;  3K1E A;  1L2O B;  3NXA A;  2M1K B;  5BPJ A;  1J1E A;  1K9U A;  1M31 A;  3PAL A;  1K9K A;  2JRF A;  4FQT A;  1IG5 A;  3NSO A;  3BUN B;  3KHE A;  5G08 A;  3NSK A;  2H61 A;  2MLF C;  3Q8I A;  4BY4 A;  2LLS A;  1NX3 A;  1S3P A;  1NUB A;  2Q91 A;  1LXF C;  2WCK A;  1K90 D;  1K9P A;  2K2A A;  2KPH A;  3QME A;  4DUQ A;  2OTG C;  3SS3 A;  3BQ3 A;  1OMD A;  1TNW A;  4DIR A;  1KK7 Z;  5KU1 A;  4MZL A;  1QAS A;  1BF5 A;  1T14 A;  4YI9 A;  1SK6 D;  1QS7 A;  1MQ1 A;  2ISD A;  3D10 A;  1XFZ O;  3NHT A;  1M45 A;  3D0Y B;  1YUU A;  3H4S E;  1QAT A;  3I5H B;  3LLE A;  4R1E A;  2LHI A;  2FJU B;  2JTZ A;  2G2B A;  2Y4Q A;  2LAP A;  2OS8 B;  5CSN A;  3I5I C;  2F2P A;  1B8R A;  5HKZ A;  5I94 A;  1XA5 A;  3VRQ A;  5I8N A;  3K21 A;  1XFU O;  3R72 A;  1PRW A;  3RZS A;  1N2D A;  1TIZ A;  3N7H A;  3UNW A;  4CFR A;  1CKK A;  1CMF A;  2LP3 A;  3NSL A;  3IVT A;  4I5N B;  2ERB A;  4OKH A;  2KI6 D;  4OR9 B;  1PVA A;  2WOR A;  4YGB B;  3RLZ A;  3JVT B;  1LS8 A;  3CS1 A;  3OP0 A;  2ZN9 A;  1YRU B;  1J7O A;  1DGU A;  3CGA A;  3L4A A;  1FBV A;  1UHK A;  4JD9 A;  1UP5 A;  1S5G Z;  2F3Y A;  3PM8 A;  2M8U A;  1OOJ A;  1SL7 A;  2WC8 A;  5JOL A;  3ZWH A;  3HCM A;  1Y1X A;  2GTE A;  1UHN A;  1JFJ A;  5D69 A;  1N65 A;  1CLL A;  1YVL A;  3AKA A;  3MSE B;  2NCP A;  3TDU A;  1CMG A;  1OOI X;  2I94 A;  1H4B A;  1S6J A;  2ZRS A;  1A2X A;  4P5O E;  1MWN A;  1YR5 A;  1NX0 A;  1A75 A;  1Q80 A;  1XK4 C;  2K7C A;  1RWY A;  2JUL A;  2BBN A;  2KLD A;  1TUJ A;  1GQM A;  3BUX B;  1IIO A;  2DOQ A;  3O78 A;  2O60 A;  2FCD A;  2LP2 A;  1TN4 A;  1YVH A;  1PUL A;  1YUT A;  2M0R A;  2QEB A;  2KDH A;  3D74 A;  3IF7 A;  1R2U A;  1AK8 A;  2BNX A;  1IJ6 A;  3FWB A;  1DC1 A;  1KWO B;  1OSA A;  2OTG B;  1KFU S;  3ICB A;  2OPO A;  3AAJ A;  1C07 A;  3EK8 A;  1UHI A;  1OW4 A;  2JTT A;  3OGN A;  1CFC A;  4MSP A;  4CPV A;  1UHJ A;  3VRP A;  2M7N A;  4Q04 A;  3D73 A;  1YX8 A;  4HRH A;  2KI6 C;  2LM5 A;  2QEV A;  1QIW A;  2F33 A;  1JWD A;  3BYA A;  1WLZ A;  2ZND A;  1YTZ C;  5CSI A;  1W9Z A;  1ALV A;  3SG5 A;  1TOP A;  3O4Y A;  3DY9 A;  3VRN A;  4XJK B;  2QEO A;  3TUY C;  1J1D A;  1QX7 A;  3EVR A;  3JTD C;  2EC6 C;  2K7O A;  3IQQ A;  2GV5 A;  1TNX A;  4YGE B;  2H8V A;  1OZS A;  3PLF B;  1SL8 A;  2HQ8 A;  1ZAC A;  2V53 A;  1KFU L;  1QVI Z;  2KYF A;  3DD4 A;  2P6B B;  2Q4U A;  2LVV A;  2EGD A;  1BR4 B;  5DKR A;  1B4C A;  2G9B A;  1NX2 A;  3GOF A;  4GUK A;  2AMI A;  2Y5I A;  3C1V A;  3KF9 A;  2COL B;  1QLK A;  2LUC A;  4PE4 A;  1Y1U A;  2PAS A;  4YI8 A;  3M0W A;  1Z4H A;  1G8I A;  1NCX A;  1S36 A;  4IJ7 A;  4AQJ A;  1J7Q A;  2JU0 A;  4GGF C;  3O4X A;  1W7J B;  1GJY A;  1WRZ A;  1DJI A;  2GGM A;  3A4U B;  2I2R E;  1LA0 A;  2L98 A;  1N0Y A;  1OZO A;  2YGU A;  3OB1 B;  1SKT A;  2WCH A;  1JUO A;  1NX1 A;  5IBW A;  1FI5 A;  4CFQ A;  3D76 A;  4ICB A;  4JKT A;  2K60 A;  3BOW B;  2Y1N A;  3AKB A;  4P2Y B;  1ZUZ A;  2WC6 A;  2ZN8 A;  3VRO A;  4QJ5 B;  1DJG A;  1IWQ A;  2LCP A;  4N5X A;  4PT1 A;  1FI6 A;  2ZRT A;  1XFX O;  2CCM A;  2O5G A;  2LLU A;  3FS7 A;  2JT8 A;  2LVI A;  1S26 D;  1SCV A;  3WHU B;  2BAP A;  1FPW A;  1AJ5 A;  1WDC C;  2BCX A;  3BJH A;  4XYN A;  5TNC A;  5HLO A;  4A4B A;  4DS7 A;  4YRU A;  4HRE E;  2LE9 B;  2QDI A;  4D1E A;  1FW4 A;  3OBV A;  2M49 B;  3EK4 A;  3KO0 A;  1K2H A;  1WRL A;  2MHH A;  1TTX A;  4NDC A;  3TS5 C;  5HL1 A;  4INX A;  5DIC A;  4GNK B;  3D0Y A;  3CR2 A;  3DF0 B;  2JZI A;  1E8A A;  3B87 A;  4GBA A;  2PVB A;  1AP4 A;  2B1U A;  1BR1 B;  2BE4 A;  1M39 A;  3JTD B;  3ZNI A;  5AAN A;  4AQI A;  1SNL A;  1QX2 A;  4GPL B;  3AAK A;  1M46 A;  3PN7 C;  3O6B A;  5HLV A;  5AER A;  2F2O A;  2WOS A;  3PAT A;  1OOF A;  1PAL A;  2Y1M A;  3CZ0 A;  3DVJ A;  2WC5 A;  3CZ2 A;  2PYQ A;  2LLT A;  1PVB A;  1DVI A;  2M97 A;  1X02 A;  2JXC A;  3B6X A;  2HPS A;  2K61 A;  1CFD A;  1KK8 B;  1XVJ A;  2WCL A;  1Z2C B;  4TNC A;  1SW8 A; 
#chains in the Genus database with same CATH homology
 3S0B A;  1TUJ A;  4OZD A;  3DXL A;  2QEB A;  3D74 A;  3R1V A;  3FE9 A;  1OW4 A;  3OGN A;  3S0A A;  3D73 A;  2QEV A;  3CAB A;  3PJI A;  3CZ1 A;  2QEH A;  3S0G A;  3DY9 A;  3D75 A;  2QEO A;  2WCM A;  3BFH A;  2H8V A;  3L4L A;  3FE6 A;  3S0E A;  3K1E A;  1C3Z A;  4FQT A;  3Q8I A;  2WCK A;  3NGV A;  3VB1 A;  2KPH A;  3QME A;  3V2L A;  1OOH A;  4F7F A;  2WCH A;  1T14 A;  1OOG A;  1C3Y A;  3D78 A;  3D76 A;  3B88 A;  3NHT A;  2WC6 A;  1XFR A;  3DYE A;  4PT1 A;  1TWO A;  3B7A A;  3BFA A;  1P28 A;  1DQE A;  4INW A;  3R72 A;  3BJH A;  3RZS A;  3N7H A;  5EL2 A;  3S0D A;  2QDI A;  1GM0 A;  2WCJ A;  2ERB A;  3CYZ A;  3DZT A;  1LS8 A;  4INX A;  5DIC A;  3CDN A;  3B87 A;  3L4A A;  4JD9 A;  2FJY A;  3B86 A;  1OOF A;  3D77 A;  2L2C A;  2GTE A;  3L47 A;  3CZ0 A;  1QWV A;  2WC5 A;  3CZ2 A;  3FE8 A;  2JPO A;  2P71 A;  3BFB A;  1OOI X;  3NHI A;  3B6X A;  1ORG A;  2WCL A;  2PQL A;  3R1O A;  3S0F A;  2P70 A;  3R1P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...