1OOIX

Crystal structure of lush from drosophila melanogaster at ph 6.5
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
124
structure length
124
Chain Sequence
MTMEQFLTSLDMIRSGCAPKFKLKTEDLDRLRVGDFNFPPSQDLMCYTKCVSLMAGTVNKKGEFNAPKALAQLPHLVPPEMMEMSRKSVEACRDTHKQFKESCERVYQTAKCFSENADGQFMWP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords odorant binding protein LUSH
publication title Structure of a specific alcohol-binding site defined by the odorant binding protein LUSH from Drosophila melanogaster
pubmed doi rcsb
source organism Drosophila melanogaster
total genus 48
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 2003-03-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.20 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 Pheromone/general odorant binding protein domain 1ooiX00
2L2CA 3S0AA 3D77A 3L4AA 3QMEA 2GTEA 1OOIX 4OZDA 4INXA 3D73A 2WC6A 4PT1A 3D78A 2QEOA 2P71A 1QWVA 1LS8A 1OOHA 3B7AA 3OGNA 3R72A 1C3YA 3CDNA 3CZ1A 3B87A 3FE8A 3Q8IA 3L4LA 3BFHA 3L47A 3R1VA 1OW4A 2P70A 2KPHA 3FE9A 3BJHA 2ERBA 2WCHA 3S0FA 1P28A 1C3ZA 4JD9A 3R1OA 3VB1A 3D76A 3D74A 3RZSA 1T14A 5DICA 3BFAA 3CZ2A 2QEHA 3FE6A 1TUJA 3DXLA 3DY9A 3DYEA 1GM0A 2WCMA 1OOFA 2QEVA 3NHTA 4INWA 3S0GA 2H8VA 3BFBA 2FJYA 3S0BA 2JPOA 3CZ0A 3D75A 2WCLA 3R1PA 5EL2A 3K1EA 1OOGA 1XFRA 3NGVA 2WCJA 3PJIA 4FQTA 2QEBA 3B86A 4F7FA 3N7HA 3S0DA 3S0EA 3B88A 3V2LA 1TWOA 3DZTA 3B6XA 3CABA 3CYZA 2PQLA 3NHIA 1ORGA 2QDIA 2WCKA 1DQEA 2WC5A
chains in the Genus database with same CATH superfamily
2L2CA 4GNKB 2Q91A 1IQ5A 1YX8A 4E68A 5G08A 1OSAA 1G4YR 3WHTB 2GTEA 2HF5A 1J7QA 2KHNA 4OZDA 1S5GZ 1KCYA 1DF0B 4INXA 3CR2A 1YRUB 4PT1A 1FPWA 1Z2CB 1SBJA 1XFZO 3PN7B 1SL8A 3CWGA 5FI2A 2F33A 2BNXA 1S36A 4YGBB 1CDMA 1DMOA 3I5HC 3LK0A 4YGCB 3LCPC 1MF8B 1NX2A 3SIBA 1TRFA 1DGVA 5HLVA 1AJ5A 1KK8C 1QV0A 2JZIA 2KQYA 5I8NA 1SSEB 4I5JA 3ZWHA 2JPTA 3PLFB 1PALA 4N1GA 2M49B 2O60A 1SNLA 4PCWA 1NCXA 5CSNA 2F3ZA 1MWNA 2COLB 2FOTA 3AKBA 4CLNA 2HETA 5HL1A 3L47A 4PHNA 2H2KA 2NXQA 3PN7C 1M63B 1TIZA 3JVTC 4FQOA 1GGWA 2BECA 1AP4A 1BLQA 1XO5A 1CKKA 1MUXA 4L9MA 1H4BA 1OW4A 2R2IA 2P70A 4MZJA 2LC5A 3SJSA 2LVKA 3BUMB 3SG3A 1CMGA 2LHLA 2NLNA 3O2PA 2B1UA 2LUCA 3HCMA 3E3RA 1FW4A 3GK2A 2DOQA 4JPZB 3VB1A 3D76A 1SPYA 2M9GA 3RZSA 1RTP1 3LK1A 1SRAA 2ZN8A 2QPTA 2LHIA 2JXLA 4IL1A 1IJ5A 2ZRSA 1F71A 3EKHA 1QX2A 2CNPA 1IG5A 1DJWA 3DYEA 2LLUA 1ODBA 4XJKA 2L51A 4Q04A 3UNWA 4MRXA 5FI7A 1R6PA 2KAXA 5J3XA 4AQJA 1RFJA 1BOCA 1L7ZA 1OOFA 3NSKA 1DJYA 2OS8B 3NHTA 1CTRA 1DC1A 1CMFA 2KAYA 2LCPA 3IF7A 1YRTB 3VRRA 1K8UA 2H8VA 1F54A 2IS9A 1SL9A 2F2PA 1YR5A 1YURA 3EG5B 1BR4B 2FCDA 1CDNA 1KFXS 3D75A 2WCLA 5DKRA 2KGRA 2MBXA 1HQVA 1XFWO 1FBVA 2ZKMX 3TUYB 2KFHA 1K9KA 1W9ZA 1ZOTB 2JTTA 2M29A 3PJIA 1JUOA 1KK7Y 1BODA 2Y1MA 1ZFSA 3OBVA 2EC6C 1G8IA 3O6BA 5AFPA 3S0EA 1IJ6A 3C1VA 4GGNA 2OS8C 1XK4A 4PHMA 3V2LA 1JBAA 1BU3A 4DCKA 1N2DA 4ICBA 2L5XB 1TCOB 4BY4A 3CABA 3AAKA 3O78A 4U8DA 4AQIA 4P5OE 1DTLA 2SASA 2ZN9A 3BQ3A 3TUYC 2K7OA 1NSHA 1DQEA 2KQ6A 3CGAA 2WCFA 1UHIA 2EHBA 4XJKB 2KYFA 2KYCA 2NZ0A 5HYDA 1LVCD 5CSFA 2K2AA 4YBHB 3TZ1A 5KSZA 5TNCA 2V53A 4F0ZB 4GGFC 1B8LA 1KFUS 1OOIX 1S6JA 2GGZA 5FI6A 1NWDA 2NCPA 3DF0A 2K61A 2M0RA 4HRHA 5ER5A 4I5KA 3VGOA 3BUNB 1OMVA 4PALA 1BF5A 1JF2A 1OE9B 2KBIA 1XVJA 2EGDA 2QEOA 3BOWA 2LUXA 2P71A 1BR1B 3EK8A 5GQQC 1KK7Z 1QWVA 2CTNA 1IQ3A 2PMYA 3I5GB 3WXAA 3GK4X 3ICBA 3EKJA 2MHHA 3FWCA 3NXAA 4P2YB 1YUTA 4MSPA 2KGBC 1QVIY 3VRQA 5I2QA 3Q8IA 1UHKA 5I94A 3I5IC 1DJXA 3LL8B 4NQGA 4BY5A 2H61A 4YI8A 4A4CA 3SS3A 3CR4X 1RROA 5ER4X 3TS5B 4CFRA 4OR9B 1SR6C 2LV7A 3SG6A 4DRWA 1BT6A 1J7PA 1JFJA 5HKWA 4QJ3B 3SG4A 1L2OB 4N5XA 3FE9A 1DEKA 1NCZA 3I5GC 1TNQA 4OV2A 1C07A 4ZCVA 4YGEB 1K95A 1QX5B 1P28A 1X02A 4DUQA 1C3ZA 3DD4A 3M0WA 1DJIA 3DF0B 2BL0B 4JD9A 2WCBA 1XK4C 1XFUO 2BCAA 3TS5C 3DVMA 5DICA 4DIRA 3BOWB 4GFTA 2K60A 1NCYA 4MZLA 4XYNA 2LAPA 4ZCUA 1AK8A 3FE6A 1NP8A 4UPGA 2Y1NA 3OX6A 2LMVA 4ORAB 1S1EA 1Y6WA 3DY9A 1CM1A 2L2EA 4DS7A 4PE4A 2JT8A 1QIVA 2L0PA 4C0JA 3PALA 3EK4A 4FTGA 2AMIA 1MXEA 2I18A 3KO0A 1SYMA 4INWA 2KDHA 2PSRA 3HX4A 1KWOB 4C0LA 2JPOA 1A4PA 1NYAA 3CR5X 2OTGB 2JULA 4A4BA 4YGDB 3CZ0A 1OMRA 1ZUZA 1IKUA 1K2HA 5D3OA 2A4JA 3AKAA 3D0YA 3GK1A 2BAPA 1JWDA 3KF9A 1UP5A 4WQ2A 1NIWA 2LLSA 1TNXA 1YX7A 4QJ4B 1Y0VH 1B1GA 1BMOA 2E6WA 1K93D 1SK6D 4F7FA 1K9UA 2JOJA 3UO9A 3IQOA 1QS7A 1V1FA 2P6BB 3EK7A 1OMDA 2JNFA 1TNPA 2FCEA 2AAOA 2K7DA 1R2UA 3GOFA 3DVKA 3B88A 3TDUA 1A03A 3H4SE 1KSMA 1TWOA 2GV5A 4OVNF 1SW8A 2ZFDA 3JTDB 3KHEA 5DKNA 1KWOC 3SIAA 1SY9A 3B6XA 2K2FA 5PALA 1CNPA 2PQLA 5IBWA 3NHIA 3EVUA 1ZMZA 1AJ4A 2BKHB 5AERA 2ZRTA 1SMGA 1PVBA 4CIDA 1DJHA 2JT3A 2SCPA 1QLSA 4MVFA 1DVIA 3D77A 1CDLA 3L4AA 3QMEA 2M7NA 3F45A 4PE7A 1JFKA 2I94A 2KI6D 1CLBA 1QXPA 4N1FA 4OKHA 5CPVA 5KU1A 1JF0A 1CFDA 2TN4A 1RWYA 2BCXA 1J7OA 1F4OA 2YGUA 2BE6A 3D78A 3DVEA 3JTDC 1K94A 3D0YB 1IGVA 2FJUB 2M3WA 1S6CA 2VRGA 4JQ0D 5B8IB 5BPJA 2JQ6A 3A4UB 1CDPA 3A8RA 1LS8A 4IJ7A 4C0KA 1OOHA 2M1UA 3B7AA 1PRWA 1C3YA 2RGIA 3EVRA 1F8HA 1EG4A 2BCBA 1IWQA 3CDNA 3CZ1A 2WC8A 3BUXB 1IRJA 1WRKA 2LANA 1Y1XA 2JNXA 1NX0A 2LVJA 3FE8A 4PE1A 2KOTA 1S3PA 4NDDA 2O5GA 3BFHA 5AANA 2GGMA 2WNDA 1WDCB 5AXIA 1UURA 3WHUB 1QASA 5JJGA 3SG2A 2KSPA 4HSZA 3CZTX 3NSIA 2G2BA 1LINA 1W7JB 2BBMA 2JWWA 2LLTA 1GQMA 1U5IA 2KPHA 1DJZA 1DGUA 1Y1UA 2KLEA 1K90D 1Y1AA 3EVVA 2BKIB 2LE9B 1S6IA 4D1EA 2F3YA 2L50A 3BJHA 4NDBA 3O4YA 2ERBA 1WY9A 2L4IA 5JOLA 4NDCA 1IH0A 4HRGA 1CLMA 2HQ8A 1AUIB 1WRZA 1YUUA 3I5FB 3WNXB 4CFQA 3R1OA 1KQMB 1M46A 1MXLC 1CFCA 1CFFA 3BFAA 1KQVA 4ORBB 1GGZA 2K7CA 5HKZA 5D69A 1TN4A 1CB1A 2MA2A 5FYXA 1A75A 1SL7A 1TUJA 2KNEA 3DXLA 1N0YA 4MEWA 1YVHA 3QRXA 2CT9A 3SS4A 2WCMA 1A29A 1MHOA 3ZNIA 4CPVA 2PVBA 3SG5A 1LKJA 4M2QA 1CFPA 1B8RA 4GAOA 2M97A 4YRUA 4YI9A 3S0GA 3I5FC 3CS1A 3S0BA 1N65A 1LA3A 1KQMC 1MQ1A 2FJYA 2L98A 2PALA 4PDZA 5D7FA 1K9PA 1WLMA 1GJYA 5EL2A 1FF1A 2E30A 1D1OA 1SCVA 1XFRA 2JU0A 1U5IB 2M8UA 3BXKA 4HREE 2WCJA 1QTXA 3PSRA 5CSIA 5HLOA 2MAZA 3IQQA 1B9AA 4FQTA 3RM1A 1YVLA 2QEBA 2K7BA 3B86A 1F55A 1L2OC 4MN0A 4AOMA 5I2OA 1QVIZ 2CXJA 3AAJA 1UWOA 3NSOA 1M45A 3JVTB 1QJTA 1YUSA 2HQWA 1BJFA 2JXCA 1LA0A 3DZTA 2LM5A 1PVAA 1SKTA 4R1EA 1VRKA 3OHMB 2NCOA 2QACA 3FS7A 4PE0A 2L5YA 1J7RA 1A2XA 1A75B 2BL0C 1NX3A 2WOSA 3FIAA 2WCKA 2KI4B 1TTXA 1H8BA 1RK9A 1B4CA 1M31A 1C7WA 1K96A 2WC5A 3RLZA 3S0AA 2KI6C 1OQPA 1DT7B 1EH2A 1FI5A 4WQ3A 4PHJA 1F70A 1J1DA 1UHHA 1NUBA 5F6TA 1OZOA 2LVIA 4MLWA 1FI6A 1B8CA 3D73A 1KSOA 2K0JA 2WC6A 1TNWA 1TOPA 3PM2A 1S26D 1W7IB 2BE4A 4JKTA 3BUOB 3IVTA 1NX1A 1CLLA 1NPQA 2H61C 2LVVA 3VROA 2MLEC 3BYAA 3OB2B 1SCMB 3LLEA 1QLKA 2JC2A 2KI4C 2M1KB 3KPXA 4GBAA 3OGNA 3R72A 4GGFA 2OTGC 5I2LA 1MR8A 2WORA 2Y4QA 4M2OA 4YGAA 1OOJA 2BBNA 2LMUA 3B87A 1ZACA 2I2RE 2CCMA 1KFXL 3TDIA 1WRLA 2MLFC 4I5LB 1ALVA 1E8AA 3L4LA 1XFXO 5KTYA 1Q80A 2LNKA 4MZKA 1EL4A 2AUCA 1XFYO 2PASA 1JC2A 2EC6B 3D10A 2F2OA 2LP2A 1SCMC 2F8PA 2OPOA 3R1VA 5CSJA 5AEQA 4PHKA 3CLNA 1RJVA 3PATA 2PYQA 1B7TY 1UHJA 2WCHA 4GPLB 1UUSA 2M7LA 1PSRA 1TCFA 1V1GA 4KYNA 3S0FA 5K89A 4USLA 1B47A 3D74A 2HPSA 1DJGA 1T14A 1TUZA 2K8MB 3CZ2A 1AVSA 3OP0A 2QEHA 1OZSA 4MRYA 2D8NA 1G33A 2Q4UA 1KFUL 1HT9A 3SS5A 1UHNA 1DELA 4ETOA 4ORCB 1YTZC 2JTZA 3SG7A 1PK0D 2MRDA 1GM0A 3VRNA 1EJ3A 3TDZA 2Y5IA 1J1EA 2ZNDA 2JT0A 2L4HA 1WLZA 2LP3A 3FWBA 3NSLA 2QEVA 1XYDA 3O4XA 4JWQA 1DF0A 4QJ5B 1JSAA 3BFBA 1C7VA 2ISDA 1S5GY 1ALWA 3KEVA 3PM8A 4OCIA 2MJWB 3R1PA 1QV1A 2G9BA 3K1EA 1OOGA 2ZNEA 1B7TZ 1WDCC 3BUWB 1J55A 2KLDA 3NGVA 3VRPA 1EG3A 3I5IB 4I5NB 1XA5A 2KAVA 2KFGA 2LMTA 1IIOA 1AHRA 2JRFA 3MSEB 3PFVA 4WRIA 1BG1A 3N7HA 1RECA 1SR6B 4M2PA 3S0DA 3OB1B 4MBEA 1M39A 4GUKA 1PULA 3DVJA 1XFVO 3K21A 3OX5A 4TNCA 5HKYA 2KBMA 1LXFC 2PRUA 1EXRA 1QX7A 2I7AA 2KFFA 3CYZA 1QATA 1ORGA 2WCEA 2QDIA 3I5HB 1F4QA 1CM4A 1Z4HA 3CTNA 5DKQA 1PSBA 1QIWA 2CBLA 1KK8B
chains in the Genus database with same CATH topology
2L2CA 3S0AA 3D77A 3L4AA 3QMEA 2GTEA 1OOIX 4OZDA 4INXA 3D73A 2WC6A 4PT1A 3D78A 2QEOA 2P71A 1QWVA 1LS8A 1OOHA 3B7AA 3OGNA 3R72A 1C3YA 3CDNA 3CZ1A 3B87A 3FE8A 3Q8IA 3L4LA 3BFHA 3L47A 3R1VA 1OW4A 2P70A 2KPHA 3FE9A 3BJHA 2ERBA 2WCHA 3S0FA 1P28A 1C3ZA 4JD9A 3R1OA 3VB1A 3D76A 3D74A 3RZSA 1T14A 5DICA 3BFAA 3CZ2A 2QEHA 3FE6A 1TUJA 3DXLA 3DY9A 3DYEA 1GM0A 2WCMA 1OOFA 2QEVA 3NHTA 4INWA 3S0GA 2H8VA 3BFBA 2FJYA 3S0BA 2JPOA 3CZ0A 3D75A 2WCLA 3R1PA 5EL2A 3K1EA 1OOGA 1XFRA 3NGVA 2WCJA 3PJIA 4FQTA 2QEBA 3B86A 4F7FA 3N7HA 3S0DA 3S0EA 3B88A 3V2LA 1TWOA 3DZTA 3B6XA 3CABA 3CYZA 2PQLA 3NHIA 1ORGA 2QDIA 2WCKA 1DQEA 2WC5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2L2C A;  3S0A A;  3D77 A;  3L4A A;  3QME A;  2GTE A;  1OOI X;  4OZD A;  4INX A;  3D73 A;  2WC6 A;  4PT1 A;  3D78 A;  2QEO A;  2P71 A;  1QWV A;  1LS8 A;  1OOH A;  3B7A A;  3OGN A;  3R72 A;  1C3Y A;  3CDN A;  3CZ1 A;  3B87 A;  3FE8 A;  3Q8I A;  3L4L A;  3BFH A;  3L47 A;  3R1V A;  1OW4 A;  2P70 A;  2KPH A;  3FE9 A;  3BJH A;  2ERB A;  2WCH A;  3S0F A;  1P28 A;  1C3Z A;  4JD9 A;  3R1O A;  3VB1 A;  3D76 A;  3D74 A;  3RZS A;  1T14 A;  5DIC A;  3BFA A;  3CZ2 A;  2QEH A;  3FE6 A;  1TUJ A;  3DXL A;  3DY9 A;  3DYE A;  1GM0 A;  2WCM A;  1OOF A;  2QEV A;  3NHT A;  4INW A;  3S0G A;  2H8V A;  3BFB A;  2FJY A;  3S0B A;  2JPO A;  3CZ0 A;  3D75 A;  2WCL A;  3R1P A;  5EL2 A;  3K1E A;  1OOG A;  1XFR A;  3NGV A;  2WCJ A;  3PJI A;  4FQT A;  2QEB A;  3B86 A;  4F7F A;  3N7H A;  3S0D A;  3S0E A;  3B88 A;  3V2L A;  1TWO A;  3DZT A;  3B6X A;  3CAB A;  3CYZ A;  2PQL A;  3NHI A;  1ORG A;  2QDI A;  2WCK A;  1DQE A;  2WC5 A; 
#chains in the Genus database with same CATH topology
 2L2C A;  4GNK B;  2Q91 A;  1IQ5 A;  1YX8 A;  4E68 A;  5G08 A;  1OSA A;  1G4Y R;  3WHT B;  2GTE A;  2HF5 A;  1J7Q A;  2KHN A;  4OZD A;  1S5G Z;  1KCY A;  1DF0 B;  4INX A;  3CR2 A;  1YRU B;  4PT1 A;  1FPW A;  1Z2C B;  1SBJ A;  1XFZ O;  3PN7 B;  1SL8 A;  3CWG A;  5FI2 A;  2F33 A;  2BNX A;  1S36 A;  4YGB B;  1CDM A;  1DMO A;  3I5H C;  3LK0 A;  4YGC B;  3LCP C;  1MF8 B;  1NX2 A;  3SIB A;  1TRF A;  1DGV A;  5HLV A;  1AJ5 A;  1KK8 C;  1QV0 A;  2JZI A;  2KQY A;  5I8N A;  1SSE B;  4I5J A;  3ZWH A;  2JPT A;  3PLF B;  1PAL A;  4N1G A;  2M49 B;  2O60 A;  1SNL A;  4PCW A;  1NCX A;  5CSN A;  2F3Z A;  1MWN A;  2COL B;  2FOT A;  3AKB A;  4CLN A;  2HET A;  5HL1 A;  3L47 A;  4PHN A;  2H2K A;  2NXQ A;  3PN7 C;  1M63 B;  1TIZ A;  3JVT C;  4FQO A;  1GGW A;  2BEC A;  1AP4 A;  1BLQ A;  1XO5 A;  1CKK A;  1MUX A;  4L9M A;  1H4B A;  1OW4 A;  2R2I A;  2P70 A;  4MZJ A;  2LC5 A;  3SJS A;  2LVK A;  3BUM B;  3SG3 A;  1CMG A;  2LHL A;  2NLN A;  3O2P A;  2B1U A;  2LUC A;  3HCM A;  3E3R A;  1FW4 A;  3GK2 A;  2DOQ A;  4JPZ B;  3VB1 A;  3D76 A;  1SPY A;  2M9G A;  3RZS A;  1RTP 1;  3LK1 A;  1SRA A;  2ZN8 A;  2QPT A;  2LHI A;  2JXL A;  4IL1 A;  1IJ5 A;  2ZRS A;  1F71 A;  3EKH A;  1QX2 A;  2CNP A;  1IG5 A;  1DJW A;  3DYE A;  2LLU A;  1ODB A;  4XJK A;  2L51 A;  4Q04 A;  3UNW A;  4MRX A;  5FI7 A;  1R6P A;  2KAX A;  5J3X A;  4AQJ A;  1RFJ A;  1BOC A;  1L7Z A;  1OOF A;  3NSK A;  1DJY A;  2OS8 B;  3NHT A;  1CTR A;  1DC1 A;  1CMF A;  2KAY A;  2LCP A;  3IF7 A;  1YRT B;  3VRR A;  1K8U A;  2H8V A;  1F54 A;  2IS9 A;  1SL9 A;  2F2P A;  1YR5 A;  1YUR A;  3EG5 B;  1BR4 B;  2FCD A;  1CDN A;  1KFX S;  3D75 A;  2WCL A;  5DKR A;  2KGR A;  2MBX A;  1HQV A;  1XFW O;  1FBV A;  2ZKM X;  3TUY B;  2KFH A;  1K9K A;  1W9Z A;  1ZOT B;  2JTT A;  2M29 A;  3PJI A;  1JUO A;  1KK7 Y;  1BOD A;  2Y1M A;  1ZFS A;  3OBV A;  2EC6 C;  1G8I A;  3O6B A;  5AFP A;  3S0E A;  1IJ6 A;  3C1V A;  4GGN A;  2OS8 C;  1XK4 A;  4PHM A;  3V2L A;  1JBA A;  1BU3 A;  4DCK A;  1N2D A;  4ICB A;  2L5X B;  1TCO B;  4BY4 A;  3CAB A;  3AAK A;  3O78 A;  4U8D A;  4AQI A;  4P5O E;  1DTL A;  2SAS A;  2ZN9 A;  3BQ3 A;  3TUY C;  2K7O A;  1NSH A;  1DQE A;  2KQ6 A;  3CGA A;  2WCF A;  1UHI A;  2EHB A;  4XJK B;  2KYF A;  2KYC A;  2NZ0 A;  5HYD A;  1LVC D;  5CSF A;  2K2A A;  4YBH B;  3TZ1 A;  5KSZ A;  5TNC A;  2V53 A;  4F0Z B;  4GGF C;  1B8L A;  1KFU S;  1OOI X;  1S6J A;  2GGZ A;  5FI6 A;  1NWD A;  2NCP A;  3DF0 A;  2K61 A;  2M0R A;  4HRH A;  5ER5 A;  4I5K A;  3VGO A;  3BUN B;  1OMV A;  4PAL A;  1BF5 A;  1JF2 A;  1OE9 B;  2KBI A;  1XVJ A;  2EGD A;  2QEO A;  3BOW A;  2LUX A;  2P71 A;  1BR1 B;  3EK8 A;  5GQQ C;  1KK7 Z;  1QWV A;  2CTN A;  1IQ3 A;  2PMY A;  3I5G B;  3WXA A;  3GK4 X;  3ICB A;  3EKJ A;  2MHH A;  3FWC A;  3NXA A;  4P2Y B;  1YUT A;  4MSP A;  2KGB C;  1QVI Y;  3VRQ A;  5I2Q A;  3Q8I A;  1UHK A;  5I94 A;  3I5I C;  1DJX A;  3LL8 B;  4NQG A;  4BY5 A;  2H61 A;  4YI8 A;  4A4C A;  3SS3 A;  3CR4 X;  1RRO A;  5ER4 X;  3TS5 B;  4CFR A;  4OR9 B;  1SR6 C;  2LV7 A;  3SG6 A;  4DRW A;  1BT6 A;  1J7P A;  1JFJ A;  5HKW A;  4QJ3 B;  3SG4 A;  1L2O B;  4N5X A;  3FE9 A;  1DEK A;  1NCZ A;  3I5G C;  1TNQ A;  4OV2 A;  1C07 A;  4ZCV A;  4YGE B;  1K95 A;  1QX5 B;  1P28 A;  1X02 A;  4DUQ A;  1C3Z A;  3DD4 A;  3M0W A;  1DJI A;  3DF0 B;  2BL0 B;  4JD9 A;  2WCB A;  1XK4 C;  1XFU O;  2BCA A;  3TS5 C;  3DVM A;  5DIC A;  4DIR A;  3BOW B;  4GFT A;  2K60 A;  1NCY A;  4MZL A;  4XYN A;  2LAP A;  4ZCU A;  1AK8 A;  3FE6 A;  1NP8 A;  4UPG A;  2Y1N A;  3OX6 A;  2LMV A;  4ORA B;  1S1E A;  1Y6W A;  3DY9 A;  1CM1 A;  2L2E A;  4DS7 A;  4PE4 A;  2JT8 A;  1QIV A;  2L0P A;  4C0J A;  3PAL A;  3EK4 A;  4FTG A;  2AMI A;  1MXE A;  2I18 A;  3KO0 A;  1SYM A;  4INW A;  2KDH A;  2PSR A;  3HX4 A;  1KWO B;  4C0L A;  2JPO A;  1A4P A;  1NYA A;  3CR5 X;  2OTG B;  2JUL A;  4A4B A;  4YGD B;  3CZ0 A;  1OMR A;  1ZUZ A;  1IKU A;  1K2H A;  5D3O A;  2A4J A;  3AKA A;  3D0Y A;  3GK1 A;  2BAP A;  1JWD A;  3KF9 A;  1UP5 A;  4WQ2 A;  1NIW A;  2LLS A;  1TNX A;  1YX7 A;  4QJ4 B;  1Y0V H;  1B1G A;  1BMO A;  2E6W A;  1K93 D;  1SK6 D;  4F7F A;  1K9U A;  2JOJ A;  3UO9 A;  3IQO A;  1QS7 A;  1V1F A;  2P6B B;  3EK7 A;  1OMD A;  2JNF A;  1TNP A;  2FCE A;  2AAO A;  2K7D A;  1R2U A;  3GOF A;  3DVK A;  3B88 A;  3TDU A;  1A03 A;  3H4S E;  1KSM A;  1TWO A;  2GV5 A;  4OVN F;  1SW8 A;  2ZFD A;  3JTD B;  3KHE A;  5DKN A;  1KWO C;  3SIA A;  1SY9 A;  3B6X A;  2K2F A;  5PAL A;  1CNP A;  2PQL A;  5IBW A;  3NHI A;  3EVU A;  1ZMZ A;  1AJ4 A;  2BKH B;  5AER A;  2ZRT A;  1SMG A;  1PVB A;  4CID A;  1DJH A;  2JT3 A;  2SCP A;  1QLS A;  4MVF A;  1DVI A;  3D77 A;  1CDL A;  3L4A A;  3QME A;  2M7N A;  3F45 A;  4PE7 A;  1JFK A;  2I94 A;  2KI6 D;  1CLB A;  1QXP A;  4N1F A;  4OKH A;  5CPV A;  5KU1 A;  1JF0 A;  1CFD A;  2TN4 A;  1RWY A;  2BCX A;  1J7O A;  1F4O A;  2YGU A;  2BE6 A;  3D78 A;  3DVE A;  3JTD C;  1K94 A;  3D0Y B;  1IGV A;  2FJU B;  2M3W A;  1S6C A;  2VRG A;  4JQ0 D;  5B8I B;  5BPJ A;  2JQ6 A;  3A4U B;  1CDP A;  3A8R A;  1LS8 A;  4IJ7 A;  4C0K A;  1OOH A;  2M1U A;  3B7A A;  1PRW A;  1C3Y A;  2RGI A;  3EVR A;  1F8H A;  1EG4 A;  2BCB A;  1IWQ A;  3CDN A;  3CZ1 A;  2WC8 A;  3BUX B;  1IRJ A;  1WRK A;  2LAN A;  1Y1X A;  2JNX A;  1NX0 A;  2LVJ A;  3FE8 A;  4PE1 A;  2KOT A;  1S3P A;  4NDD A;  2O5G A;  3BFH A;  5AAN A;  2GGM A;  2WND A;  1WDC B;  5AXI A;  1UUR A;  3WHU B;  1QAS A;  5JJG A;  3SG2 A;  2KSP A;  4HSZ A;  3CZT X;  3NSI A;  2G2B A;  1LIN A;  1W7J B;  2BBM A;  2JWW A;  2LLT A;  1GQM A;  1U5I A;  2KPH A;  1DJZ A;  1DGU A;  1Y1U A;  2KLE A;  1K90 D;  1Y1A A;  3EVV A;  2BKI B;  2LE9 B;  1S6I A;  4D1E A;  2F3Y A;  2L50 A;  3BJH A;  4NDB A;  3O4Y A;  2ERB A;  1WY9 A;  2L4I A;  5JOL A;  4NDC A;  1IH0 A;  4HRG A;  1CLM A;  2HQ8 A;  1AUI B;  1WRZ A;  1YUU A;  3I5F B;  3WNX B;  4CFQ A;  3R1O A;  1KQM B;  1M46 A;  1MXL C;  1CFC A;  1CFF A;  3BFA A;  1KQV A;  4ORB B;  1GGZ A;  2K7C A;  5HKZ A;  5D69 A;  1TN4 A;  1CB1 A;  2MA2 A;  5FYX A;  1A75 A;  1SL7 A;  1TUJ A;  2KNE A;  3DXL A;  1N0Y A;  4MEW A;  1YVH A;  3QRX A;  2CT9 A;  3SS4 A;  2WCM A;  1A29 A;  1MHO A;  3ZNI A;  4CPV A;  2PVB A;  3SG5 A;  1LKJ A;  4M2Q A;  1CFP A;  1B8R A;  4GAO A;  2M97 A;  4YRU A;  4YI9 A;  3S0G A;  3I5F C;  3CS1 A;  3S0B A;  1N65 A;  1LA3 A;  1KQM C;  1MQ1 A;  2FJY A;  2L98 A;  2PAL A;  4PDZ A;  5D7F A;  1K9P A;  1WLM A;  1GJY A;  5EL2 A;  1FF1 A;  2E30 A;  1D1O A;  1SCV A;  1XFR A;  2JU0 A;  1U5I B;  2M8U A;  3BXK A;  4HRE E;  2WCJ A;  1QTX A;  3PSR A;  5CSI A;  5HLO A;  2MAZ A;  3IQQ A;  1B9A A;  4FQT A;  3RM1 A;  1YVL A;  2QEB A;  2K7B A;  3B86 A;  1F55 A;  1L2O C;  4MN0 A;  4AOM A;  5I2O A;  1QVI Z;  2CXJ A;  3AAJ A;  1UWO A;  3NSO A;  1M45 A;  3JVT B;  1QJT A;  1YUS A;  2HQW A;  1BJF A;  2JXC A;  1LA0 A;  3DZT A;  2LM5 A;  1PVA A;  1SKT A;  4R1E A;  1VRK A;  3OHM B;  2NCO A;  2QAC A;  3FS7 A;  4PE0 A;  2L5Y A;  1J7R A;  1A2X A;  1A75 B;  2BL0 C;  1NX3 A;  2WOS A;  3FIA A;  2WCK A;  2KI4 B;  1TTX A;  1H8B A;  1RK9 A;  1B4C A;  1M31 A;  1C7W A;  1K96 A;  2WC5 A;  3RLZ A;  3S0A A;  2KI6 C;  1OQP A;  1DT7 B;  1EH2 A;  1FI5 A;  4WQ3 A;  4PHJ A;  1F70 A;  1J1D A;  1UHH A;  1NUB A;  5F6T A;  1OZO A;  2LVI A;  4MLW A;  1FI6 A;  1B8C A;  3D73 A;  1KSO A;  2K0J A;  2WC6 A;  1TNW A;  1TOP A;  3PM2 A;  1S26 D;  1W7I B;  2BE4 A;  4JKT A;  3BUO B;  3IVT A;  1NX1 A;  1CLL A;  1NPQ A;  2H61 C;  2LVV A;  3VRO A;  2MLE C;  3BYA A;  3OB2 B;  1SCM B;  3LLE A;  1QLK A;  2JC2 A;  2KI4 C;  2M1K B;  3KPX A;  4GBA A;  3OGN A;  3R72 A;  4GGF A;  2OTG C;  5I2L A;  1MR8 A;  2WOR A;  2Y4Q A;  4M2O A;  4YGA A;  1OOJ A;  2BBN A;  2LMU A;  3B87 A;  1ZAC A;  2I2R E;  2CCM A;  1KFX L;  3TDI A;  1WRL A;  2MLF C;  4I5L B;  1ALV A;  1E8A A;  3L4L A;  1XFX O;  5KTY A;  1Q80 A;  2LNK A;  4MZK A;  1EL4 A;  2AUC A;  1XFY O;  2PAS A;  1JC2 A;  2EC6 B;  3D10 A;  2F2O A;  2LP2 A;  1SCM C;  2F8P A;  2OPO A;  3R1V A;  5CSJ A;  5AEQ A;  4PHK A;  3CLN A;  1RJV A;  3PAT A;  2PYQ A;  1B7T Y;  1UHJ A;  2WCH A;  4GPL B;  1UUS A;  2M7L A;  1PSR A;  1TCF A;  1V1G A;  4KYN A;  3S0F A;  5K89 A;  4USL A;  1B47 A;  3D74 A;  2HPS A;  1DJG A;  1T14 A;  1TUZ A;  2K8M B;  3CZ2 A;  1AVS A;  3OP0 A;  2QEH A;  1OZS A;  4MRY A;  2D8N A;  1G33 A;  2Q4U A;  1KFU L;  1HT9 A;  3SS5 A;  1UHN A;  1DEL A;  4ETO A;  4ORC B;  1YTZ C;  2JTZ A;  3SG7 A;  1PK0 D;  2MRD A;  1GM0 A;  3VRN A;  1EJ3 A;  3TDZ A;  2Y5I A;  1J1E A;  2ZND A;  2JT0 A;  2L4H A;  1WLZ A;  2LP3 A;  3FWB A;  3NSL A;  2QEV A;  1XYD A;  3O4X A;  4JWQ A;  1DF0 A;  4QJ5 B;  1JSA A;  3BFB A;  1C7V A;  2ISD A;  1S5G Y;  1ALW A;  3KEV A;  3PM8 A;  4OCI A;  2MJW B;  3R1P A;  1QV1 A;  2G9B A;  3K1E A;  1OOG A;  2ZNE A;  1B7T Z;  1WDC C;  3BUW B;  1J55 A;  2KLD A;  3NGV A;  3VRP A;  1EG3 A;  3I5I B;  4I5N B;  1XA5 A;  2KAV A;  2KFG A;  2LMT A;  1IIO A;  1AHR A;  2JRF A;  3MSE B;  3PFV A;  4WRI A;  1BG1 A;  3N7H A;  1REC A;  1SR6 B;  4M2P A;  3S0D A;  3OB1 B;  4MBE A;  1M39 A;  4GUK A;  1PUL A;  3DVJ A;  1XFV O;  3K21 A;  3OX5 A;  4TNC A;  5HKY A;  2KBM A;  1LXF C;  2PRU A;  1EXR A;  1QX7 A;  2I7A A;  2KFF A;  3CYZ A;  1QAT A;  1ORG A;  2WCE A;  2QDI A;  3I5H B;  1F4Q A;  1CM4 A;  1Z4H A;  3CTN A;  5DKQ A;  1PSB A;  1QIW A;  2CBL A;  1KK8 B; 
#chains in the Genus database with same CATH homology
 2L2C A;  3S0A A;  3D77 A;  3L4A A;  3QME A;  2GTE A;  1OOI X;  4OZD A;  4INX A;  3D73 A;  2WC6 A;  4PT1 A;  3D78 A;  2QEO A;  2P71 A;  1QWV A;  1LS8 A;  1OOH A;  3B7A A;  3OGN A;  3R72 A;  1C3Y A;  3CDN A;  3CZ1 A;  3B87 A;  3FE8 A;  3Q8I A;  3L4L A;  3BFH A;  3L47 A;  3R1V A;  1OW4 A;  2P70 A;  2KPH A;  3FE9 A;  3BJH A;  2ERB A;  2WCH A;  3S0F A;  1P28 A;  1C3Z A;  4JD9 A;  3R1O A;  3VB1 A;  3D76 A;  3D74 A;  3RZS A;  1T14 A;  5DIC A;  3BFA A;  3CZ2 A;  2QEH A;  3FE6 A;  1TUJ A;  3DXL A;  3DY9 A;  3DYE A;  1GM0 A;  2WCM A;  1OOF A;  2QEV A;  3NHT A;  4INW A;  3S0G A;  2H8V A;  3BFB A;  2FJY A;  3S0B A;  2JPO A;  3CZ0 A;  3D75 A;  2WCL A;  3R1P A;  5EL2 A;  3K1E A;  1OOG A;  1XFR A;  3NGV A;  2WCJ A;  3PJI A;  4FQT A;  2QEB A;  3B86 A;  4F7F A;  3N7H A;  3S0D A;  3S0E A;  3B88 A;  3V2L A;  1TWO A;  3DZT A;  3B6X A;  3CAB A;  3CYZ A;  2PQL A;  3NHI A;  1ORG A;  2QDI A;  2WCK A;  1DQE A;  2WC5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...