1OOIX

Crystal structure of lush from drosophila melanogaster at ph 6.5
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
124
structure length
124
Chain Sequence
b'MTMEQFLTSLDMIRSGCAPKFKLKTEDLDRLRVGDFNFPPSQDLMCYTKCVSLMAGTVNKKGEFNAPKALAQLPHLVPPEMMEMSRKSVEACRDTHKQFKESCERVYQTAKCFSENADGQFMWP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords odorant binding protein LUSH
publication title Structure of a specific alcohol-binding site defined by the odorant binding protein LUSH from Drosophila melanogaster
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Transport protein
total genus 48
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 2003-03-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.20 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 Pheromone/general odorant binding protein domain 1ooiX00
2GTEA 3L4AA 1TUJA 3CZ1A 3DY9A 3Q8IA 3D75A 1T14A 3FE6A 3L4LA 3D74A 2FJYA 3D77A 3DYEA 3BFBA 3D78A 2KPHA 5EL2A 1TWOA 3R72A 3S0DA 1C3ZA 1XFRA 3B7AA 3D76A 3CZ2A 2WCHA 2QEHA 3BFHA 4F7FA 1OOGA 3B88A 2WC5A 1DQEA 2WCJA 2QEVA 3DXLA 2WC6A 3R1OA 5DICA 3B6XA 3NHTA 3N7HA 3B86A 2JPOA 1ORGA 3K1EA 3OGNA 3CYZA 3DZTA 4OZDA 2QEBA 3S0EA 4FQTA 1OOFA 1C3YA 3S0GA 1P28A 2QDIA 2QEOA 3BFAA 3CZ0A 3S0AA 3FE9A 1OW4A 3NGVA 3CDNA 3FE8A 3NHIA 3CABA 3R1VA 2PQLA 4PT1A 4INXA 3S0BA 3R1PA 3PJIA 2ERBA 4JD9A 2L2CA 3L47A 2P71A 2WCMA 3BJHA 1GM0A 3D73A 2WCLA 3V2LA 1OOIX 1QWVA 3B87A 1OOHA 1LS8A 3QMEA 2WCKA 4INWA 2P70A 3VB1A 2H8VA 3S0FA 3RZSA
chains in the Genus database with same CATH superfamily
2M9GA 1QIWA 1K9UA 2L4IA 3L4AA 1NWDA 2GGZA 3CZ1A 3DD4A 3DVEA 3DY9A 1IKUA 4ETOA 2Y1NA 1F4QA 1B1GA 1OMDA 3BOWB 1YUUA 1FW4A 2K7CA 1DELA 1S36A 1IH0A 2F3ZA 1SL9A 1CDPA 3SS5A 2JTTA 2KPHA 4QJ3B 1RECA 3JTDB 2JPTA 3OHMB 1DJYA 3EKHA 4C0LA 1BLQA 2ZNDA 1CMGA 1Y1XA 1XA5A 3BYAA 3D76A 1AVSA 1ZOTB 4PE7A 1HT9A 2JTZA 2WCHA 4E68A 3PM2A 1LKJA 5JJGA 2LUXA 1UP5A 4FQOA 2KI4C 4PDZA 5IBWA 3SJSA 2BBNA 4YBHB 1OSAA 2HQWA 5I2OA 1BOCA 1OOGA 1YRTB 2JT8A 2LE9B 3BUNB 2PSRA 3ICBA 3KF9A 3NSKA 2BE4A 5ER4X 3CR2A 5HKYA 2WC5A 1JC2A 1F4OA 2K0JA 2H61A 2KI4B 3DXLA 3EVRA 2F2PA 1PSRA 2K2FA 4MEWA 1CKKA 2WC6A 3R1OA 4N1GA 2KOTA 1S6JA 4CIDA 1AK8A 1XFUO 2K7DA 1B47A 1ALVA 2LV7A 3KHEA 3N7HA 1J1DA 3NHTA 4HREE 1K9PA 1EG3A 4PALA 1IQ5A 1J7OA 3DVJA 2MLEC 3K1EA 4ORCB 1M39A 4PHKA 5FYXA 2QEBA 3S0EA 1AJ5A 4PHMA 1B7TY 3PFVA 1NX1A 1QASA 2D8NA 2KQYA 2COLB 2H2KA 5AERA 5JOLA 3CS1A 2QDIA 2M7LA 4AQJA 2P6BB 1YUSA 1N0YA 2KAVA 4MLWA 4NDCA 3BUXB 1K96A 1PRWA 3S0AA 1KFXS 5CPVA 2JWWA 1EXRA 2KBIA 1DJWA 2MA2A 2EGDA 1F8HA 1Z4HA 3C1VA 3NHIA 2KLDA 5CSIA 3CR5X 3EK4A 5HKWA 2M97A 5GQQC 1UHJA 2L50A 4MZJA 3S0BA 2I2RE 3PN7C 4MVFA 2JXLA 1XFYO 2BKIB 3PJIA 3QRXA 4MN0A 4TNCA 4DS7A 2LAPA 5G08A 5J3XA 2WCMA 1SL8A 1DJGA 3OB1B 5KTYA 2K7OA 2V53A 1RWYA 1GM0A 3BQ3A 1PALA 1OOIX 1PVBA 2CBLA 5CSFA 3UNWA 1XYDA 4AQIA 1NSHA 2ISDA 1SNLA 1W7IB 4C0KA 4C0JA 1CNPA 1UHHA 1DJXA 2BL0C 2GV5A 2KGBC 4ZCUA 1L7ZA 1MHOA 4I5JA 4INWA 3CWGA 2JXCA 1BG1A 5I94A 2M49B 1DGVA 1ODBA 2GTEA 2ZN8A 4USLA 3TDZA 4MZKA 1X02A 1JF2A 1TUJA 2BL0B 2G2BA 2M8UA 1T14A 2L5XB 1MQ1A 2FCEA 3TS5B 3VRPA 2PALA 3SIBA 3D74A 2FJYA 3D0YA 2I94A 4P5OE 1PVAA 2MLFC 4WQ2A 2KI6D 1PK0D 2E30A 2K8MB 3GK2A 2KFGA 3PSRA 1FF1A 1QX2A 1SY9A 1F71A 3R72A 4JWQA 3RLZA 1YURA 1DF0A 1JWDA 1DMOA 1XFRA 2KNEA 3IQOA 3DVMA 1Y0VH 1KSMA 5HL1A 1CMFA 5KU1A 1YVHA 2DOQA 1CB1A 1ZACA 3JVTC 3M0WA 3OBVA 2BCBA 1LXFC 2HQ8A 4M2OA 3CZ2A 2KBMA 4I5KA 1K2HA 2QEHA 1TCOB 2SCPA 1TNQA 1UUSA 3SG7A 1UHKA 1F55A 1S6CA 3JVTB 2NCPA 2LMVA 2MRDA 4F7FA 4GFTA 4GGFA 4NQGA 1H4BA 4L9MA 4WQ3A 1DJZA 1LA3A 1KK8C 2AMIA 1SRAA 1RTP1 1YTZC 1TOPA 5DICA 5FI2A 1CDMA 1OMVA 1WLMA 1KWOC 1CFPA 3B6XA 1CDNA 1U5IA 1G4YR 3TZ1A 1QXPA 5CSJA 1KK8B 4ORBB 2LP2A 1BJFA 3O4XA 3EVVA 1YUTA 2JNXA 3RZSA 4HRHA 1ORGA 1R6PA 1WDCC 2LVJA 1JUOA 3A8RA 3CYZA 4OZDA 2Y4QA 1KWOB 2KAXA 1LVCD 2YGUA 1XK4A 1A75A 2JZIA 1GJYA 4HRGA 1OOFA 1TIZA 2CXJA 3S0GA 2JC2A 3BUMB 1P28A 1C07A 1UHIA 2E6WA 3DVKA 3NSLA 1CLMA 1XVJA 3IQQA 3SG4A 3BOWA 1WLZA 1NX0A 2EC6C 2KSPA 2LMUA 1SSEB 2OS8C 2QPTA 3HX4A 1KFUL 5HLOA 1GGWA 3LK1A 1S6IA 4GGNA 1NX2A 3O78A 1V1GA 1IRJA 2CT9A 3FE9A 1KSOA 3K21A 2BCAA 4Q04A 1S3PA 1TRFA 1S1EA 1AUIB 4OR9B 5FI7A 1DJIA 1IJ6A 2NCOA 4MSPA 1CDLA 1OMRA 1S5GZ 4XJKB 4ICBA 4DRWA 3O6BA 2KFFA 1A2XA 1YR5A 1CLLA 4U8DA 5AXIA 1YX7A 3PALA 2LC5A 1K93D 3R1PA 5PALA 1F70A 4JD9A 2L2CA 4ORAB 2L2EA 1F54A 5DKRA 3VGOA 2PRUA 3D73A 4BY4A 2L51A 1W9ZA 1MR8A 1NX3A 3AAKA 1J1EA 2LVIA 1JFKA 1MUXA 2BCXA 2F33A 2PYQA 4NDBA 1WRKA 2WCKA 2M1UA 3OP0A 3KPXA 2WC8A 3SIAA 2P70A 3VB1A 5AEQA 1R2UA 2K61A 3TDIA 5D69A 3S0FA 1OQPA 3DF0B 1Q80A 1H8BA 1M46A 2FJUB 2LHLA 2L98A 3D75A 4R1EA 3FS7A 2LANA 3FE6A 3IF7A 1TNPA 2BE6A 1QVIY 2JRFA 4YGDB 2I18A 2KYFA 1MXEA 3DYEA 3BFBA 3D78A 1IQ3A 2RGIA 4WRIA 5EL2A 3CGAA 1HQVA 2KAYA 3BUWB 1C3ZA 2KDHA 1QV0A 3I5FC 3SS4A 3ZNIA 1YRUB 2Y5IA 5AFPA 3EG5B 3B7AA 2VRGA 1B4CA 3KEVA 4HSZA 3FWCA 1TCFA 1NUBA 2L5YA 1AHRA 3CZTX 3I5HC 3VRQA 2KFHA 2KI6C 2MJWB 2ZRSA 5I2QA 2LM5A 2JT3A 4IJ7A 4ZCVA 3SG6A 1NIWA 2Q91A 3I5FB 4YGEB 3SG5A 5HKZA 3D10A 1CLBA 1MF8B 2M1KB 4YI9A 2AAOA 1W7JB 2M3WA 3BFHA 3UO9A 2LVKA 1QIVA 3BUOB 3MSEB 1D1OA 2BECA 3I5HB 2GGMA 1UWOA 2CCMA 2LMTA 2KYCA 1J55A 1WRLA 1M31A 1RK9A 2L4HA 2WCJA 2WNDA 1GQMA 2EHBA 2M29A 2QEVA 3A4UB 1B7TZ 4PE1A 1JFJA 2PVBA 4PE4A 2WOSA 1V1FA 1UHNA 1K90D 1OZSA 1K9KA 5HYDA 3TUYC 4CLNA 1FI5A 1SMGA 5KSZA 1YX8A 1UURA 3FWBA 4MZLA 4PHJA 1K8UA 4GNKB 2K2AA 3WXAA 3OGNA 2M7NA 4MBEA 3DZTA 3I5GC 4I5LB 3NSOA 5TNCA 1ZUZA 3TUYB 3O4YA 4P2YB 3EKJA 2AUCA 1CFDA 4FQTA 1CTRA 5I8NA 1C3YA 5I2LA 4NDDA 1XFXO 3EK8A 2B1UA 1IIOA 1SCVA 1L2OC 1XK4C 3I5GB 3KO0A 5HLVA 3CZ0A 1SK6D 1IGVA 2L0PA 3EVUA 3LL8B 1B8CA 4M2PA 3CTNA 3OX5A 1JBAA 1OW4A 3NGVA 2MBXA 5BPJA 1LINA 3FE8A 4JKTA 1B8RA 1QLSA 2H61C 2HPSA 3CABA 1L2OB 3R1VA 4YGAA 4OCIA 4PCWA 4PT1A 1CM1A 3AKBA 4UPGA 4A4CA 3EK7A 1N2DA 2I7AA 2LLSA 3NXAA 1DT7B 1SCMC 2JT0A 1RROA 1BMOA 3JTDC 2ERBA 4DUQA 1EH2A 1KQVA 1TTXA 2FOTA 1FPWA 4JQ0D 1SR6C 3OX6A 3L47A 1SBJA 2P71A 1FBVA 2WCBA 3BJHA 1DEKA 1KQMC 3AKAA 3I5IC 1XFZO 2ZKMX 1WDCB 2WCLA 1SCMB 1K95A 2O60A 4MRXA 1XO5A 5F6TA 2JNFA 3SG2A 3PM8A 3OB2B 4GPLB 3LLEA 1SR6B 3QMEA 5DKNA 1RFJA 1DJHA 1SYMA 2F2OA 1NPQA 1DTLA 2OTGC 3AAJA 3E3RA 1KQMB 2R2IA 3I5IB 3SG3A 4DCKA 2ZN9A 1DC1A 1PULA 1C7VA 1ZFSA 4YGCB 2EC6B 1NYAA 2M0RA 2OS8B 3GOFA 1QJTA 1QX5B 3Q8IA 1IG5A 1S26D 3PN7B 4MRYA 1MXLC 2OTGB 3L4LA 3WHTB 2O5GA 1KK7Y 1WY9A 3BXKA 1N65A 3D77A 5DKQA 3SS3A 2JOJA 1A29A 2NZ0A 1EJ3A 4F0ZB 2Y1MA 2MHHA 3GK1A 1BR4B 3CR4X 4YGBB 1FI6A 1TWOA 2SASA 3NSIA 3S0DA 2G9BA 2ZNEA 4N5XA 1PSBA 1CM4A 2KLEA 1Y1AA 2BAPA 1TNWA 1JF0A 1WRZA 4BY5A 1MWNA 1GGZA 4I5NB 2TN4A 1OOJA 1Z2CB 3WNXB 4DIRA 4XJKA 1G8IA 1B9AA 1QX7A 4D1EA 2KHNA 1LA0A 2JULA 3PLFB 4FTGA 1NP8A 1J7PA 2JQ6A 3B88A 4GBAA 2LHIA 1IJ5A 3LCPC 4CFQA 1B8LA 1XFWO 4CFRA 1SW8A 1DQEA 1RJVA 1SL7A 1OE9B 1BR1B 1NCXA 4AOMA 1IWQA 1DGUA 2K7BA 1KCYA 2LLTA 2LLUA 2WCEA 2HF5A 3GK4X 1QATA 3VRNA 2LUCA 2BKHB 1QTXA 3B86A 1ZMZA 4XYNA 1CFCA 1E8AA 2JPOA 2KQ6A 1VRKA 2LNKA 1QV1A 1K94A 3D0YB 1JSAA 5CSNA 1BODA 4OVNF 4M2QA 3VRRA 2CNPA 5B8IB 3DF0A 4YRUA 3H4SE 3O2PA 4N1FA 1NCYA 1DF0B 2QEOA 1AJ4A 5AANA 3ZWHA 3CLNA 2K60A 3BFAA 1EG4A 1KK7Z 1Y1UA 1A03A 2BBMA 1TN4A 4GAOA 1DVIA 5FI6A 2WCFA 2WORA 3IVTA 4GGFC 2LP3A 1YVLA 2PMYA 2IS9A 4QJ5B 3F45A 3RM1A 3TS5C 1AP4A 3CDNA 1EL4A 1J7QA 1SPYA 2JU0A 2LCPA 3PATA 3TDUA 2F3YA 4OV2A 2PQLA 1C7WA 3VROA 4INXA 4PE0A 1QS7A 4KYNA 4PHNA 4A4BA 1SKTA 2CTNA 2F8PA 1ALWA 1KFXL 2NXQA 4GUKA 2Q4UA 4JPZB 1KFUS 2QACA 4OKHA 4CPVA 1BT6A 1M45A 1QLKA 1Y6WA 1J7RA 2NLNA 5D3OA 1CFFA 2ZFDA 1M63B 1A4PA 1TUZA 1OZOA 3WHUB 1XFVO 1BF5A 2KGRA 2MAZA 3LK0A 3V2LA 1U5IB 2BNXA 1QWVA 3B87A 1S5GY 1NCZA 5D7FA 2FCDA 1OOHA 2OPOA 2ZRTA 5K89A 1QVIZ 3FIAA 1G33A 1BU3A 1LS8A 2LVVA 4YI8A 3HCMA 2H8VA 2A4JA 2PASA 4QJ4B 4IL1A 1TNXA 5ER5A 2HETA 1A75B
chains in the Genus database with same CATH topology
2GTEA 3L4AA 1TUJA 3CZ1A 3DY9A 3Q8IA 3D75A 1T14A 3FE6A 3L4LA 3D74A 2FJYA 3D77A 3DYEA 3BFBA 3D78A 2KPHA 5EL2A 1TWOA 3R72A 3S0DA 1C3ZA 1XFRA 3B7AA 3D76A 3CZ2A 2WCHA 2QEHA 3BFHA 4F7FA 1OOGA 3B88A 2WC5A 1DQEA 2WCJA 2QEVA 3DXLA 2WC6A 3R1OA 5DICA 3B6XA 3NHTA 3N7HA 3B86A 2JPOA 1ORGA 3K1EA 3OGNA 3CYZA 3DZTA 4OZDA 2QEBA 3S0EA 4FQTA 1OOFA 1C3YA 3S0GA 1P28A 2QDIA 2QEOA 3BFAA 3CZ0A 3S0AA 3FE9A 1OW4A 3NGVA 3CDNA 3FE8A 3NHIA 3CABA 3R1VA 2PQLA 4PT1A 4INXA 3S0BA 3R1PA 3PJIA 2ERBA 4JD9A 2L2CA 3L47A 2P71A 2WCMA 3BJHA 1GM0A 3D73A 2WCLA 3V2LA 1OOIX 1QWVA 3B87A 1OOHA 1LS8A 3QMEA 2WCKA 4INWA 2P70A 3VB1A 2H8VA 3S0FA 3RZSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GTE A;  3L4A A;  1TUJ A;  3CZ1 A;  3DY9 A;  3Q8I A;  3D75 A;  1T14 A;  3FE6 A;  3L4L A;  3D74 A;  2FJY A;  3D77 A;  3DYE A;  3BFB A;  3D78 A;  2KPH A;  5EL2 A;  1TWO A;  3R72 A;  3S0D A;  1C3Z A;  1XFR A;  3B7A A;  3D76 A;  3CZ2 A;  2WCH A;  2QEH A;  3BFH A;  4F7F A;  1OOG A;  3B88 A;  2WC5 A;  1DQE A;  2WCJ A;  2QEV A;  3DXL A;  2WC6 A;  3R1O A;  5DIC A;  3B6X A;  3NHT A;  3N7H A;  3B86 A;  2JPO A;  1ORG A;  3K1E A;  3OGN A;  3CYZ A;  3DZT A;  4OZD A;  2QEB A;  3S0E A;  4FQT A;  1OOF A;  1C3Y A;  3S0G A;  1P28 A;  2QDI A;  2QEO A;  3BFA A;  3CZ0 A;  3S0A A;  3FE9 A;  1OW4 A;  3NGV A;  3CDN A;  3FE8 A;  3NHI A;  3CAB A;  3R1V A;  2PQL A;  4PT1 A;  4INX A;  3S0B A;  3R1P A;  3PJI A;  2ERB A;  4JD9 A;  2L2C A;  3L47 A;  2P71 A;  2WCM A;  3BJH A;  1GM0 A;  3D73 A;  2WCL A;  3V2L A;  1OOI X;  1QWV A;  3B87 A;  1OOH A;  1LS8 A;  3QME A;  2WCK A;  4INW A;  2P70 A;  3VB1 A;  2H8V A;  3S0F A;  3RZS A; 
#chains in the Genus database with same CATH topology
 2M9G A;  1QIW A;  1K9U A;  2L4I A;  3L4A A;  1NWD A;  2GGZ A;  3CZ1 A;  3DD4 A;  3DVE A;  3DY9 A;  1IKU A;  4ETO A;  2Y1N A;  1F4Q A;  1B1G A;  1OMD A;  3BOW B;  1YUU A;  1FW4 A;  2K7C A;  1DEL A;  1S36 A;  1IH0 A;  2F3Z A;  1SL9 A;  1CDP A;  3SS5 A;  2JTT A;  2KPH A;  4QJ3 B;  1REC A;  3JTD B;  2JPT A;  3OHM B;  1DJY A;  3EKH A;  4C0L A;  1BLQ A;  2ZND A;  1CMG A;  1Y1X A;  1XA5 A;  3BYA A;  3D76 A;  1AVS A;  1ZOT B;  4PE7 A;  1HT9 A;  2JTZ A;  2WCH A;  4E68 A;  3PM2 A;  1LKJ A;  5JJG A;  2LUX A;  1UP5 A;  4FQO A;  2KI4 C;  4PDZ A;  5IBW A;  3SJS A;  2BBN A;  4YBH B;  1OSA A;  2HQW A;  5I2O A;  1BOC A;  1OOG A;  1YRT B;  2JT8 A;  2LE9 B;  3BUN B;  2PSR A;  3ICB A;  3KF9 A;  3NSK A;  2BE4 A;  5ER4 X;  3CR2 A;  5HKY A;  2WC5 A;  1JC2 A;  1F4O A;  2K0J A;  2H61 A;  2KI4 B;  3DXL A;  3EVR A;  2F2P A;  1PSR A;  2K2F A;  4MEW A;  1CKK A;  2WC6 A;  3R1O A;  4N1G A;  2KOT A;  1S6J A;  4CID A;  1AK8 A;  1XFU O;  2K7D A;  1B47 A;  1ALV A;  2LV7 A;  3KHE A;  3N7H A;  1J1D A;  3NHT A;  4HRE E;  1K9P A;  1EG3 A;  4PAL A;  1IQ5 A;  1J7O A;  3DVJ A;  2MLE C;  3K1E A;  4ORC B;  1M39 A;  4PHK A;  5FYX A;  2QEB A;  3S0E A;  1AJ5 A;  4PHM A;  1B7T Y;  3PFV A;  1NX1 A;  1QAS A;  2D8N A;  2KQY A;  2COL B;  2H2K A;  5AER A;  5JOL A;  3CS1 A;  2QDI A;  2M7L A;  4AQJ A;  2P6B B;  1YUS A;  1N0Y A;  2KAV A;  4MLW A;  4NDC A;  3BUX B;  1K96 A;  1PRW A;  3S0A A;  1KFX S;  5CPV A;  2JWW A;  1EXR A;  2KBI A;  1DJW A;  2MA2 A;  2EGD A;  1F8H A;  1Z4H A;  3C1V A;  3NHI A;  2KLD A;  5CSI A;  3CR5 X;  3EK4 A;  5HKW A;  2M97 A;  5GQQ C;  1UHJ A;  2L50 A;  4MZJ A;  3S0B A;  2I2R E;  3PN7 C;  4MVF A;  2JXL A;  1XFY O;  2BKI B;  3PJI A;  3QRX A;  4MN0 A;  4TNC A;  4DS7 A;  2LAP A;  5G08 A;  5J3X A;  2WCM A;  1SL8 A;  1DJG A;  3OB1 B;  5KTY A;  2K7O A;  2V53 A;  1RWY A;  1GM0 A;  3BQ3 A;  1PAL A;  1OOI X;  1PVB A;  2CBL A;  5CSF A;  3UNW A;  1XYD A;  4AQI A;  1NSH A;  2ISD A;  1SNL A;  1W7I B;  4C0K A;  4C0J A;  1CNP A;  1UHH A;  1DJX A;  2BL0 C;  2GV5 A;  2KGB C;  4ZCU A;  1L7Z A;  1MHO A;  4I5J A;  4INW A;  3CWG A;  2JXC A;  1BG1 A;  5I94 A;  2M49 B;  1DGV A;  1ODB A;  2GTE A;  2ZN8 A;  4USL A;  3TDZ A;  4MZK A;  1X02 A;  1JF2 A;  1TUJ A;  2BL0 B;  2G2B A;  2M8U A;  1T14 A;  2L5X B;  1MQ1 A;  2FCE A;  3TS5 B;  3VRP A;  2PAL A;  3SIB A;  3D74 A;  2FJY A;  3D0Y A;  2I94 A;  4P5O E;  1PVA A;  2MLF C;  4WQ2 A;  2KI6 D;  1PK0 D;  2E30 A;  2K8M B;  3GK2 A;  2KFG A;  3PSR A;  1FF1 A;  1QX2 A;  1SY9 A;  1F71 A;  3R72 A;  4JWQ A;  3RLZ A;  1YUR A;  1DF0 A;  1JWD A;  1DMO A;  1XFR A;  2KNE A;  3IQO A;  3DVM A;  1Y0V H;  1KSM A;  5HL1 A;  1CMF A;  5KU1 A;  1YVH A;  2DOQ A;  1CB1 A;  1ZAC A;  3JVT C;  3M0W A;  3OBV A;  2BCB A;  1LXF C;  2HQ8 A;  4M2O A;  3CZ2 A;  2KBM A;  4I5K A;  1K2H A;  2QEH A;  1TCO B;  2SCP A;  1TNQ A;  1UUS A;  3SG7 A;  1UHK A;  1F55 A;  1S6C A;  3JVT B;  2NCP A;  2LMV A;  2MRD A;  4F7F A;  4GFT A;  4GGF A;  4NQG A;  1H4B A;  4L9M A;  4WQ3 A;  1DJZ A;  1LA3 A;  1KK8 C;  2AMI A;  1SRA A;  1RTP 1;  1YTZ C;  1TOP A;  5DIC A;  5FI2 A;  1CDM A;  1OMV A;  1WLM A;  1KWO C;  1CFP A;  3B6X A;  1CDN A;  1U5I A;  1G4Y R;  3TZ1 A;  1QXP A;  5CSJ A;  1KK8 B;  4ORB B;  2LP2 A;  1BJF A;  3O4X A;  3EVV A;  1YUT A;  2JNX A;  3RZS A;  4HRH A;  1ORG A;  1R6P A;  1WDC C;  2LVJ A;  1JUO A;  3A8R A;  3CYZ A;  4OZD A;  2Y4Q A;  1KWO B;  2KAX A;  1LVC D;  2YGU A;  1XK4 A;  1A75 A;  2JZI A;  1GJY A;  4HRG A;  1OOF A;  1TIZ A;  2CXJ A;  3S0G A;  2JC2 A;  3BUM B;  1P28 A;  1C07 A;  1UHI A;  2E6W A;  3DVK A;  3NSL A;  1CLM A;  1XVJ A;  3IQQ A;  3SG4 A;  3BOW A;  1WLZ A;  1NX0 A;  2EC6 C;  2KSP A;  2LMU A;  1SSE B;  2OS8 C;  2QPT A;  3HX4 A;  1KFU L;  5HLO A;  1GGW A;  3LK1 A;  1S6I A;  4GGN A;  1NX2 A;  3O78 A;  1V1G A;  1IRJ A;  2CT9 A;  3FE9 A;  1KSO A;  3K21 A;  2BCA A;  4Q04 A;  1S3P A;  1TRF A;  1S1E A;  1AUI B;  4OR9 B;  5FI7 A;  1DJI A;  1IJ6 A;  2NCO A;  4MSP A;  1CDL A;  1OMR A;  1S5G Z;  4XJK B;  4ICB A;  4DRW A;  3O6B A;  2KFF A;  1A2X A;  1YR5 A;  1CLL A;  4U8D A;  5AXI A;  1YX7 A;  3PAL A;  2LC5 A;  1K93 D;  3R1P A;  5PAL A;  1F70 A;  4JD9 A;  2L2C A;  4ORA B;  2L2E A;  1F54 A;  5DKR A;  3VGO A;  2PRU A;  3D73 A;  4BY4 A;  2L51 A;  1W9Z A;  1MR8 A;  1NX3 A;  3AAK A;  1J1E A;  2LVI A;  1JFK A;  1MUX A;  2BCX A;  2F33 A;  2PYQ A;  4NDB A;  1WRK A;  2WCK A;  2M1U A;  3OP0 A;  3KPX A;  2WC8 A;  3SIA A;  2P70 A;  3VB1 A;  5AEQ A;  1R2U A;  2K61 A;  3TDI A;  5D69 A;  3S0F A;  1OQP A;  3DF0 B;  1Q80 A;  1H8B A;  1M46 A;  2FJU B;  2LHL A;  2L98 A;  3D75 A;  4R1E A;  3FS7 A;  2LAN A;  3FE6 A;  3IF7 A;  1TNP A;  2BE6 A;  1QVI Y;  2JRF A;  4YGD B;  2I18 A;  2KYF A;  1MXE A;  3DYE A;  3BFB A;  3D78 A;  1IQ3 A;  2RGI A;  4WRI A;  5EL2 A;  3CGA A;  1HQV A;  2KAY A;  3BUW B;  1C3Z A;  2KDH A;  1QV0 A;  3I5F C;  3SS4 A;  3ZNI A;  1YRU B;  2Y5I A;  5AFP A;  3EG5 B;  3B7A A;  2VRG A;  1B4C A;  3KEV A;  4HSZ A;  3FWC A;  1TCF A;  1NUB A;  2L5Y A;  1AHR A;  3CZT X;  3I5H C;  3VRQ A;  2KFH A;  2KI6 C;  2MJW B;  2ZRS A;  5I2Q A;  2LM5 A;  2JT3 A;  4IJ7 A;  4ZCV A;  3SG6 A;  1NIW A;  2Q91 A;  3I5F B;  4YGE B;  3SG5 A;  5HKZ A;  3D10 A;  1CLB A;  1MF8 B;  2M1K B;  4YI9 A;  2AAO A;  1W7J B;  2M3W A;  3BFH A;  3UO9 A;  2LVK A;  1QIV A;  3BUO B;  3MSE B;  1D1O A;  2BEC A;  3I5H B;  2GGM A;  1UWO A;  2CCM A;  2LMT A;  2KYC A;  1J55 A;  1WRL A;  1M31 A;  1RK9 A;  2L4H A;  2WCJ A;  2WND A;  1GQM A;  2EHB A;  2M29 A;  2QEV A;  3A4U B;  1B7T Z;  4PE1 A;  1JFJ A;  2PVB A;  4PE4 A;  2WOS A;  1V1F A;  1UHN A;  1K90 D;  1OZS A;  1K9K A;  5HYD A;  3TUY C;  4CLN A;  1FI5 A;  1SMG A;  5KSZ A;  1YX8 A;  1UUR A;  3FWB A;  4MZL A;  4PHJ A;  1K8U A;  4GNK B;  2K2A A;  3WXA A;  3OGN A;  2M7N A;  4MBE A;  3DZT A;  3I5G C;  4I5L B;  3NSO A;  5TNC A;  1ZUZ A;  3TUY B;  3O4Y A;  4P2Y B;  3EKJ A;  2AUC A;  1CFD A;  4FQT A;  1CTR A;  5I8N A;  1C3Y A;  5I2L A;  4NDD A;  1XFX O;  3EK8 A;  2B1U A;  1IIO A;  1SCV A;  1L2O C;  1XK4 C;  3I5G B;  3KO0 A;  5HLV A;  3CZ0 A;  1SK6 D;  1IGV A;  2L0P A;  3EVU A;  3LL8 B;  1B8C A;  4M2P A;  3CTN A;  3OX5 A;  1JBA A;  1OW4 A;  3NGV A;  2MBX A;  5BPJ A;  1LIN A;  3FE8 A;  4JKT A;  1B8R A;  1QLS A;  2H61 C;  2HPS A;  3CAB A;  1L2O B;  3R1V A;  4YGA A;  4OCI A;  4PCW A;  4PT1 A;  1CM1 A;  3AKB A;  4UPG A;  4A4C A;  3EK7 A;  1N2D A;  2I7A A;  2LLS A;  3NXA A;  1DT7 B;  1SCM C;  2JT0 A;  1RRO A;  1BMO A;  3JTD C;  2ERB A;  4DUQ A;  1EH2 A;  1KQV A;  1TTX A;  2FOT A;  1FPW A;  4JQ0 D;  1SR6 C;  3OX6 A;  3L47 A;  1SBJ A;  2P71 A;  1FBV A;  2WCB A;  3BJH A;  1DEK A;  1KQM C;  3AKA A;  3I5I C;  1XFZ O;  2ZKM X;  1WDC B;  2WCL A;  1SCM B;  1K95 A;  2O60 A;  4MRX A;  1XO5 A;  5F6T A;  2JNF A;  3SG2 A;  3PM8 A;  3OB2 B;  4GPL B;  3LLE A;  1SR6 B;  3QME A;  5DKN A;  1RFJ A;  1DJH A;  1SYM A;  2F2O A;  1NPQ A;  1DTL A;  2OTG C;  3AAJ A;  3E3R A;  1KQM B;  2R2I A;  3I5I B;  3SG3 A;  4DCK A;  2ZN9 A;  1DC1 A;  1PUL A;  1C7V A;  1ZFS A;  4YGC B;  2EC6 B;  1NYA A;  2M0R A;  2OS8 B;  3GOF A;  1QJT A;  1QX5 B;  3Q8I A;  1IG5 A;  1S26 D;  3PN7 B;  4MRY A;  1MXL C;  2OTG B;  3L4L A;  3WHT B;  2O5G A;  1KK7 Y;  1WY9 A;  3BXK A;  1N65 A;  3D77 A;  5DKQ A;  3SS3 A;  2JOJ A;  1A29 A;  2NZ0 A;  1EJ3 A;  4F0Z B;  2Y1M A;  2MHH A;  3GK1 A;  1BR4 B;  3CR4 X;  4YGB B;  1FI6 A;  1TWO A;  2SAS A;  3NSI A;  3S0D A;  2G9B A;  2ZNE A;  4N5X A;  1PSB A;  1CM4 A;  2KLE A;  1Y1A A;  2BAP A;  1TNW A;  1JF0 A;  1WRZ A;  4BY5 A;  1MWN A;  1GGZ A;  4I5N B;  2TN4 A;  1OOJ A;  1Z2C B;  3WNX B;  4DIR A;  4XJK A;  1G8I A;  1B9A A;  1QX7 A;  4D1E A;  2KHN A;  1LA0 A;  2JUL A;  3PLF B;  4FTG A;  1NP8 A;  1J7P A;  2JQ6 A;  3B88 A;  4GBA A;  2LHI A;  1IJ5 A;  3LCP C;  4CFQ A;  1B8L A;  1XFW O;  4CFR A;  1SW8 A;  1DQE A;  1RJV A;  1SL7 A;  1OE9 B;  1BR1 B;  1NCX A;  4AOM A;  1IWQ A;  1DGU A;  2K7B A;  1KCY A;  2LLT A;  2LLU A;  2WCE A;  2HF5 A;  3GK4 X;  1QAT A;  3VRN A;  2LUC A;  2BKH B;  1QTX A;  3B86 A;  1ZMZ A;  4XYN A;  1CFC A;  1E8A A;  2JPO A;  2KQ6 A;  1VRK A;  2LNK A;  1QV1 A;  1K94 A;  3D0Y B;  1JSA A;  5CSN A;  1BOD A;  4OVN F;  4M2Q A;  3VRR A;  2CNP A;  5B8I B;  3DF0 A;  4YRU A;  3H4S E;  3O2P A;  4N1F A;  1NCY A;  1DF0 B;  2QEO A;  1AJ4 A;  5AAN A;  3ZWH A;  3CLN A;  2K60 A;  3BFA A;  1EG4 A;  1KK7 Z;  1Y1U A;  1A03 A;  2BBM A;  1TN4 A;  4GAO A;  1DVI A;  5FI6 A;  2WCF A;  2WOR A;  3IVT A;  4GGF C;  2LP3 A;  1YVL A;  2PMY A;  2IS9 A;  4QJ5 B;  3F45 A;  3RM1 A;  3TS5 C;  1AP4 A;  3CDN A;  1EL4 A;  1J7Q A;  1SPY A;  2JU0 A;  2LCP A;  3PAT A;  3TDU A;  2F3Y A;  4OV2 A;  2PQL A;  1C7W A;  3VRO A;  4INX A;  4PE0 A;  1QS7 A;  4KYN A;  4PHN A;  4A4B A;  1SKT A;  2CTN A;  2F8P A;  1ALW A;  1KFX L;  2NXQ A;  4GUK A;  2Q4U A;  4JPZ B;  1KFU S;  2QAC A;  4OKH A;  4CPV A;  1BT6 A;  1M45 A;  1QLK A;  1Y6W A;  1J7R A;  2NLN A;  5D3O A;  1CFF A;  2ZFD A;  1M63 B;  1A4P A;  1TUZ A;  1OZO A;  3WHU B;  1XFV O;  1BF5 A;  2KGR A;  2MAZ A;  3LK0 A;  3V2L A;  1U5I B;  2BNX A;  1QWV A;  3B87 A;  1S5G Y;  1NCZ A;  5D7F A;  2FCD A;  1OOH A;  2OPO A;  2ZRT A;  5K89 A;  1QVI Z;  3FIA A;  1G33 A;  1BU3 A;  1LS8 A;  2LVV A;  4YI8 A;  3HCM A;  2H8V A;  2A4J A;  2PAS A;  4QJ4 B;  4IL1 A;  1TNX A;  5ER5 A;  2HET A;  1A75 B; 
#chains in the Genus database with same CATH homology
 2GTE A;  3L4A A;  1TUJ A;  3CZ1 A;  3DY9 A;  3Q8I A;  3D75 A;  1T14 A;  3FE6 A;  3L4L A;  3D74 A;  2FJY A;  3D77 A;  3DYE A;  3BFB A;  3D78 A;  2KPH A;  5EL2 A;  1TWO A;  3R72 A;  3S0D A;  1C3Z A;  1XFR A;  3B7A A;  3D76 A;  3CZ2 A;  2WCH A;  2QEH A;  3BFH A;  4F7F A;  1OOG A;  3B88 A;  2WC5 A;  1DQE A;  2WCJ A;  2QEV A;  3DXL A;  2WC6 A;  3R1O A;  5DIC A;  3B6X A;  3NHT A;  3N7H A;  3B86 A;  2JPO A;  1ORG A;  3K1E A;  3OGN A;  3CYZ A;  3DZT A;  4OZD A;  2QEB A;  3S0E A;  4FQT A;  1OOF A;  1C3Y A;  3S0G A;  1P28 A;  2QDI A;  2QEO A;  3BFA A;  3CZ0 A;  3S0A A;  3FE9 A;  1OW4 A;  3NGV A;  3CDN A;  3FE8 A;  3NHI A;  3CAB A;  3R1V A;  2PQL A;  4PT1 A;  4INX A;  3S0B A;  3R1P A;  3PJI A;  2ERB A;  4JD9 A;  2L2C A;  3L47 A;  2P71 A;  2WCM A;  3BJH A;  1GM0 A;  3D73 A;  2WCL A;  3V2L A;  1OOI X;  1QWV A;  3B87 A;  1OOH A;  1LS8 A;  3QME A;  2WCK A;  4INW A;  2P70 A;  3VB1 A;  2H8V A;  3S0F A;  3RZS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...