1BODA

The solution structures of mutant calbindin d9k's, as determined by nmr, show that the calcium binding site can adopt different folds
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
74
structure length
74
Chain Sequence
MKSPEELKGIFEKYDKEGDGQLSKEELKLLLQTEFPSLLKGMSTLDELFEELDKNGDGEVSFEEFQVLVKKISQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The solution structures of mutant calbindin D9k's, as determined by NMR, show that the calcium-binding site can adopt different folds.
pubmed doi rcsb
source organism Bos taurus
molecule tags Calcium-binding protein
molecule keywords CALBINDIN D9K
total genus 6
structure length 74
sequence length 74
ec nomenclature
pdb deposition date 1993-04-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1bodA00
1JF0A 3CR4X 2JTZA 1DJIA 4NQGA 1F54A 2BBMA 1J7PA 1C7WA 1YX7A 2LMVA 1B7TY 1NP8A 1LINA 1EL4A 1M46A 2PSRA 4MZLA 4GGNA 4HREE 4ORAB 3KF9A 5J3XA 2KOTA 3OB2B 1WDCC 2LVJA 2JT3A 4OKHA 5DKRA 1PVAA 1LXFC 1K90D 2IS9A 3H4SE 1DGUA 4I5NB 5GQQC 2LP2A 4PE4A 2PRUA 1IQ3A 1GJYA 1ZMZA 5ER5A 4C0JA 2WC8A 4MEWA 1R2UA 1G33A 2Y5IA 3IF7A 2BL0B 1N0YA 4E68A 3CR2A 2HQ8A 2LP3A 2LVKA 1G8IA 1DJHA 5JJGA 3O78A 1KK8B 1UUSA 1UWOA 1XK4C 1RROA 4M2QA 4USLA 1JWDA 1DJWA 3NSOA 2MA2A 1K2HA 3WHTB 1JFKA 1MHOA 2FJUB 1XO5A 2Q91A 1CLLA 4PE1A 3OX5A 1B7TZ 3BUWB 3EKJA 1AVSA 1Q80A 1QVIY 2ZNDA 5AEQA 1LA3A 3FWCA 4N5XA 5I2LA 2PASA 5I2OA 2LHLA 1CMFA 1RK9A 4GUKA 4OR9B 4GAOA 1IH0A 1SCMB 1SRAA 1RTP1 1WLZA 4NDBA 5CPVA 4GNKB 1OSAA 1MWNA 4MSPA 1J7QA 4YGCB 1Y6WA 2WCFA 1CFFA 1E8AA 1XVJA 2KBIA 2LC5A 1B47A 2KFHA 3CR5X 1OMDA 4C0LA 1HQVA 1FF1A 1R6PA 2JU0A 1DMOA 1MXLC 1EG3A 3TUYB 3VRQA 4MZKA 1WRLA 1S36A 1OMRA 3NSKA 2JRFA 1FI6A 3DF0A 1CDPA 2LAPA 3WNXB 3BUMB 1FPWA 5JOLA 2WNDA 3PFVA 4YI9A 4XJKB 2ZKMX 3OB1B 1QIWA 2KI4C 2NZ0A 2KYFA 1EH2A 4YBHB 5I2QA 1RJVA 4ZCUA 2I2RE 2LLSA 1C07A 1PALA 3AAJA 2D8NA 2PMYA 3PATA 2JT0A 4I5LB 3VGOA 4XJKA 2JULA 2LVVA 2H61A 2KGRA 3BUXB 1TNPA 4A4BA 2OS8C 1KFUL 1SYMA 2LVIA 4QJ3B 1F71A 4QJ5B 2KBMA 2WORA 1OMVA 4AQJA 2K2AA 2ZNEA 3KHEA 1XFXO 3K21A 2F33A 1CLMA 1NUBA 1OZSA 1S5GZ 5G08A 5AFPA 1K95A 2JXLA 2JT8A 2EC6C 4OCIA 2CXJA 1UHJA 5CSIA 1QX7A 2KHNA 1HT9A 4BY4A 1XFYO 5HKYA 2OPOA 2BCXA 3I5HC 4DUQA 1F8HA 1OQPA 1D1OA 4WQ2A 1NX2A 2I94A 4DS7A 1V1GA 1BLQA 4PDZA 2BCAA 3VROA 1BG1A 1QLSA 4MZJA 1ZUZA 3SG4A 3BOWB 2JPTA 1CMGA 2M7NA 1QXPA 5K89A 1VRKA 4JWQA 1H4BA 1J7RA 3OHMB 2F3ZA 1SR6B 1B9AA 4M2OA 2Y1NA 1SL9A 2K7BA 1TCOB 5AERA 3I5HB 4N1FA 1BOCA 1AJ4A 5DKQA 4A4CA 5BPJA 1EJ3A 5HYDA 2OTGC 5CSFA 5ER4X 2M49B 2M97A 3SG5A 1CFCA 3GK2A 2DOQA 3CGAA 1K94A 2PALA 1QVIZ 1S6CA 1S3PA 4MVFA 1KWOC 4F0ZB 2AMIA 2PVBA 2TN4A 4DRWA 1IKUA 2KI6D 2MRDA 3FIAA 2KYCA 1EXRA 1F4QA 1G4YR 2E6WA 3EKHA 5I8NA 3KPXA 2LV7A 1NYAA 2M3WA 2LLUA 1F55A 1M45A 1YVLA 3JVTC 3PLFB 1TIZA 1DJYA 1CB1A 1MQ1A 2LUXA 2GV5A 3EVUA 4C0KA 4U8DA 1LVCD 1YUSA 2K7CA 1N65A 2LCPA 1SR6C 4PE0A 1BJFA 1W7IB 2KSPA 1UHIA 1K8UA 2MLFC 4P2YB 2MLEC 3GK4X 1K96A 1TNQA 1Y1AA 1S1EA 2OTGB 2FOTA 2M1KB 3TZ1A 1KFXS 2MHHA 5AANA 1AJ5A 4YGAA 3SG2A 4ETOA 1SK6D 3AKAA 2L4IA 1KK7Y 1YVHA 2KNEA 4WRIA 1J7OA 1CLBA 2CT9A 2JWWA 1NCYA 3RLZA 2L50A 1ALWA 2F3YA 4YGEB 2M0RA 1KCYA 3TS5C 1SL8A 1YX8A 3O4YA 2I18A 2CBLA 3BOWA 3ICBA 1TNXA 3F45A 4UPGA 1CTRA 1CNPA 4TNCA 1IRJA 2FCDA 2L5XB 3D0YA 1DF0B 3VRRA 3I5FB 1PULA 1S6JA 3FWBA 2A4JA 1KWOB 3RM1A 1PVBA 2R2IA 3E3RA 4CLNA 1S6IA 5AXIA 1IG5A 2L2EA 1SKTA 4HSZA 2ZRSA 1OOJA 1OZOA 1PK0D 4CIDA 1A75B 1QLKA 1F70A 1DF0A 1XFUO 2Y1MA 1TN4A 4PHMA 1DTLA 4MBEA 1A75A 4PHKA 1CM4A 4HRGA 2BCBA 1JSAA 1A4PA 2CCMA 1J1EA 3EVRA 3SG7A 4CFQA 1WRKA 1V1FA 2H2KA 5HLOA 3GOFA 2K0JA 3I5FC 1M39A 3M0WA 2ZRTA 3LK0A 1XFZO 1YR5A 5KTYA 3I5GB 3NSLA 5KU1A 5IBWA 1NX3A 2AAOA 3FS7A 2GGZA 1SCVA 4OVNF 1IWQA 2M7LA 3DF0B 1B8CA 2BBNA 1DJXA 1SY9A 3EVVA 1QJTA 1IQ5A 1NPQA 1YRTB 3AAKA 4ZCVA 1AUIB 1NX0A 3LL8B 2KQ6A 1BR1B 3HX4A 2NLNA 1BF5A 2O5GA 2Y4QA 1QTXA 1LA0A 1L7ZA 5B8IB 4QJ4B 1QATA 4MLWA 3BQ3A 5D7FA 1TRFA 4ICBA 3PN7C 1J55A 5HKZA 1UURA 4Q04A 1XA5A 3NSIA 4L9MA 1F4OA 2AUCA 3CWGA 1SBJA 1CKKA 2BE4A 1SMGA 2M8UA 1NWDA 1ZOTB 2ZFDA 2ZN8A 1CDNA 4YGDB 3OX6A 4XYNA 1U5IB 2BL0C 4ORBB 1GGWA 3BXKA 1L2OB 1AK8A 1TOPA 1NSHA 4OV2A 1B4CA 5KSZA 2ZN9A 1M63B 3EK8A 3SG3A 1WY9A 4PCWA 4ORCB 4IL1A 1S5GY 2MAZA 3OP0A 3VRNA 1UP5A 1Y1XA 1K93D 1J1DA 2M1UA 4FQOA 4FTGA 1RFJA 2BECA 2KI4B 1IJ5A 1XYDA 2KAVA 2KFGA 2VRGA 3DVMA 3CTNA 3JVTB 5HLVA 2K7DA 1CFPA 1DVIA 2L98A 1LKJA 1UHNA 4NDDA 1MF8B 4PHJA 2NCPA 1QX2A 1NIWA 2LMUA 5D69A 1KK7Z 1PRWA 2KGBC 2ISDA 3TS5B 1TNWA 1JFJA 1AP4A 4D1EA 3C1VA 2O60A 2L0PA 4YGBB 1EG4A 3TDUA 2KAYA 3DVKA 3CLNA 1QV0A 4MRYA 3PN7B 2KAXA 1XFWO 3GK1A 2F2OA 1FI5A 2COLB 1YRUB 1YTZC 3MSEB 2JZIA 2HQWA 2MBXA 1DT7B 1JBAA 3SIBA 4GGFC 4PE7A 1RWYA 2BKIB 2LHIA 3KEVA 1JUOA 4AQIA 2EGDA 1KSMA 2KQYA 2G2BA 4MN0A 1IGVA 2RGIA 3BYAA 3I5IB 2LLTA 3TDZA 1JC2A 1A29A 2JTTA 2K7OA 1QX5B 4N1GA 2GGMA 2K2FA 1KSOA 3KO0A 2SCPA 3D0YB 3AKBA 2B1UA 1SW8A 1WLMA 1CFDA 1QS7A 2JNFA 2M9GA 2K61A 1NCZA 5TNCA 3TUYC 2E30A 2JNXA 3BUNB 4PALA 2JOJA 1XFVO 1ZACA 1KFUS 3PALA 2L51A 2LM5A 1TTXA 4I5KA 4HRHA 3A8RA 1K9KA 1QV1A 2K8MB 2CNPA 2KFFA 1WDCB 5CSNA 1BODA 2NXQA 1SCMC 2JQ6A 1BT6A 2I7AA 3CZTX 2KDHA 3SG6A 2H61C 4BY5A 3WXAA 2LE9B 1BMOA 3O6BA 1GGZA 4I5JA 5DKNA 1PSBA 2WOSA 2HF5A 1B8RA 1A03A 3IQQA 1YURA 1UHHA 2OS8B 1C7VA 3LK1A 2P6BB 1KFXL 5PALA 3CS1A 1SNLA 1WRZA 3DVJA 5FYXA 2F8PA 4GFTA 4JPZB 1B1GA 1CDMA 1CM1A 2SASA 1QASA 1Y0VH 1H8BA 1NX1A 1DJGA 2HETA 1CDLA 1DJZA 4JQ0D 3O2PA 3IQOA 4AOMA 3EK7A 1TCFA 2EHBA 1YUTA 3I5GC 2LNKA 1RECA 1QIVA 1U5IA 2G9BA 3HCMA 4WQ3A 3D10A 1L2OC 1N2DA 2NCOA 2F2PA 3A4UB 3JTDB 1MXEA 1ODBA 2M29A 3I5IC 3LLEA 4MRXA 1JF2A 1K9PA 3ZNIA 2JXCA 4DIRA 1MUXA 3TDIA 2WCEA 3ZWHA 3EK4A 2FCEA 3SIAA 3DD4A 1MR8A 1W7JB 4M2PA 1UHKA 4CPVA 1NCXA 1DGVA 2EC6B 1BU3A 1ALVA 5F6TA 1IJ6A 1AHRA 1FW4A 1XK4A 2LANA 5CSJA 3PSRA 1KQMB 3QRXA 4YRUA 3DVEA 3JTDC 5HKWA 2QPTA 3VRPA 1KK8C 4YI8A 4R1EA 3LCPC 2Q4UA 1PSRA 2QACA 1ZFSA 1YUUA 4GGFA 4DCKA 1S26D 2MJWB 1X02A 4NDCA 3PM8A 2BKHB 3SJSA 4P5OE 1K9UA 1B8LA 4CFRA 1GQMA 2KI6C 2HPSA 1FBVA 2CTNA 4GPLB 1OE9B 2LMTA 2V53A 2WCBA 1Y1UA 2JC2A 3WHUB 1SL7A 1M31A 4PHNA 1KQVA 2LUCA 1KQMC 1BR4B 3NXAA 1A2XA 2L4HA 1SPYA 2BE6A 4GBAA 3BUOB
chains in the Genus database with same CATH superfamily
1JF0A 3CR4X 2ERBA 1DJIA 2JTZA 4NQGA 5D3OA 5FI6A 1F54A 2QDIA 2BBMA 1J7PA 1C7WA 1YX7A 2LMVA 1B7TY 1NP8A 1LINA 1EL4A 1M46A 2PSRA 4MZLA 4GGNA 1Z2CB 4HREE 3KF9A 4ORAB 5J3XA 2KOTA 3OB2B 1WDCC 2LVJA 4F7FA 2JT3A 4OKHA 5DKRA 1PVAA 1LXFC 1K90D 2IS9A 3H4SE 1DGUA 4I5NB 5GQQC 2LP2A 4PE4A 2PRUA 1IQ3A 1GJYA 1ZMZA 5ER5A 4C0JA 2WC8A 4MEWA 1R2UA 1G33A 2Y5IA 3S0EA 3IF7A 2BL0B 1N0YA 4INXA 4E68A 3CR2A 2HQ8A 3QMEA 2LP3A 2LVKA 4JD9A 1G8IA 1DJHA 5JJGA 3O78A 1KK8B 1UUSA 1UWOA 1XK4C 1RROA 4M2QA 3OBVA 4USLA 1JWDA 3BFBA 1DJWA 3NSOA 2MA2A 1K2HA 3WHTB 3S0AA 1JFKA 1MHOA 3CZ2A 2WCMA 2FJUB 1XO5A 2Q91A 1CLLA 4PE1A 3OX5A 3S0FA 1B7TZ 3BUWB 3EKJA 1AVSA 1Q80A 1QVIY 2QEBA 2ZNDA 5AEQA 1LA3A 1SSEB 3FWCA 4N5XA 5I2LA 2PASA 5I2OA 2LHLA 1CMFA 1RK9A 4GUKA 4OR9B 4GAOA 1IH0A 1SCMB 1SRAA 1RTP1 1WLZA 4NDBA 5CPVA 4GNKB 1OSAA 1MWNA 3O4XA 4MSPA 1J7QA 4YGCB 1Y6WA 2WCFA 1CFFA 1E8AA 1XVJA 2KBIA 2LC5A 1B47A 2KFHA 3CR5X 1OMDA 4C0LA 1HQVA 1FF1A 5FI2A 1R6PA 3DXLA 2JU0A 1DMOA 1MXLC 1EG3A 3TUYB 3DY9A 3VRQA 4MZKA 1WRLA 1S36A 1OMRA 2QEOA 2JRFA 3NSKA 1FI6A 1QWVA 3DF0A 1CDPA 2LAPA 3WNXB 3BUMB 2GTEA 1FPWA 1P28A 2WNDA 3PFVA 3N7HA 1TUJA 4YI9A 5JOLA 4XJKB 3FE9A 2ZKMX 3OB1B 1QIWA 2KI4C 2NZ0A 2KYFA 1EH2A 4YBHB 5I2QA 1RJVA 4ZCUA 2I2RE 2LLSA 1C07A 1PALA 3AAJA 1TWOA 2D8NA 2PMYA 3PATA 2JT0A 4I5LB 4IJ7A 4XJKA 2JULA 2LVVA 3VGOA 2H61A 2KGRA 3BUXB 1TNPA 4A4BA 2OS8C 1KFUL 1SYMA 1W9ZA 1Z4HA 2LVIA 4QJ3B 1F71A 4QJ5B 2KBMA 2WORA 3BFAA 1OMVA 4AQJA 2K2AA 2ZNEA 2FJYA 3KHEA 1XFXO 2WC6A 3K21A 2F33A 2QEVA 1CLMA 1NUBA 1OZSA 1S5GZ 5G08A 5AFPA 1K95A 2JXLA 3CDNA 2JT8A 2EC6C 1ORGA 5FI7A 4OCIA 2CXJA 1UHJA 5CSIA 1QX7A 2KHNA 4FQTA 1HT9A 4BY4A 1XFYO 5HKYA 2OPOA 2BCXA 3I5HC 4DUQA 1F8HA 1OQPA 1D1OA 4WQ2A 2L5YA 3IVTA 1NX2A 2I94A 4DS7A 1V1GA 1BLQA 4PDZA 2BCAA 3VROA 1DEKA 1BG1A 1QLSA 4MZJA 1ZUZA 3BFHA 3OGNA 3SG4A 3BOWB 2JPTA 1CMGA 2M7NA 1QXPA 3R1VA 5K89A 1VRKA 4JWQA 3S0GA 1H4BA 1J7RA 3OHMB 2F3ZA 1SR6B 2KLEA 1B9AA 4M2OA 2Y1NA 1SL9A 2K7BA 1TCOB 5AERA 3I5HB 4N1FA 1BOCA 1AJ4A 5DKQA 4A4CA 5BPJA 1EJ3A 5HYDA 2OTGC 5CSFA 5ER4X 5HL1A 2M49B 3SS3A 2M97A 3SG5A 1CFCA 3GK2A 2DOQA 3CGAA 1K94A 2PALA 1QVIZ 1S6CA 3NGVA 4OZDA 1S3PA 3D78A 1KWOC 4MVFA 4F0ZB 2AMIA 2PVBA 2TN4A 3R1OA 4DRWA 2KI6D 2MRDA 1IKUA 3FIAA 2KYCA 1EXRA 1F4QA 1G4YR 2E6WA 3EKHA 5I8NA 3KPXA 2LV7A 1NYAA 2M3WA 2LLUA 1DC1A 1F55A 1M45A 1YVLA 3JVTC 3SS4A 4INWA 3PLFB 1TIZA 1DJYA 1CB1A 1MQ1A 2LUXA 2GV5A 3EVUA 4C0KA 4U8DA 1LVCD 1YUSA 2K7CA 1N65A 2KLDA 1SR6C 2LCPA 3B7AA 4JKTA 1BJFA 4PE0A 1W7IB 2WCHA 2KSPA 3VB1A 1UHIA 1K8UA 2MLFC 4P2YB 2MLEC 3GK4X 1K96A 1TNQA 1Y1AA 1S1EA 2OTGB 2FOTA 3D76A 2M1KB 2K60A 3TZ1A 1KFXS 2MHHA 5AANA 1AJ5A 4YGAA 3SG2A 4ETOA 1SK6D 3AKAA 2L4IA 3EG5B 1KK7Y 1YVHA 3DYEA 2KNEA 2BAPA 3B86A 3L4AA 4WRIA 1J7OA 3UO9A 1CLBA 2CT9A 2JWWA 1NCYA 3RLZA 2H8VA 2L50A 1ALWA 2F3YA 4YGEB 2M0RA 1KCYA 3TS5C 1SL8A 2PQLA 1YX8A 3O4YA 2I18A 2CBLA 3BOWA 3ICBA 1C3YA 1TNXA 3F45A 4UPGA 1CTRA 1CNPA 4TNCA 1IRJA 2FCDA 2L5XB 3D0YA 1DF0B 3VRRA 3I5FB 1PULA 1S6JA 3FWBA 2A4JA 1KWOB 3RM1A 1PVBA 2R2IA 3E3RA 4CLNA 1S6IA 5AXIA 1IG5A 2L2EA 1SKTA 4HSZA 2ZRSA 1OOJA 4KYNA 1OZOA 1PK0D 4CIDA 1A75B 1QLKA 1F70A 1DF0A 1XFUO 2Y1MA 1TN4A 4PHMA 1DTLA 4MBEA 1A75A 4PHKA 1CM4A 4HRGA 2BCBA 1JSAA 3SS5A 1A4PA 2CCMA 2WC5A 1J1EA 3EVRA 3SG7A 4CFQA 1WRKA 1V1FA 3R1PA 2H2KA 5HLOA 3GOFA 3CYZA 3R72A 5EL2A 2K0JA 3I5FC 1M39A 3M0WA 2ZRTA 3CABA 3LK0A 1XFZO 1YR5A 5KTYA 3I5GB 2PYQA 3NSLA 3S0BA 5KU1A 5IBWA 1NX3A 2AAOA 3FS7A 2GGZA 1SCVA 4OVNF 1IWQA 3BUOB 2M7LA 3DF0B 1B8CA 2BBNA 1DJXA 1SY9A 3EVVA 1QJTA 1IQ5A 1NPQA 1YRTB 3AAKA 3D73A 4ZCVA 1AUIB 1OOFA 1NX0A 3LL8B 2KQ6A 1BR1B 3CZ1A 3HX4A 2NLNA 3NHIA 2O5GA 3B87A 1BF5A 2Y4QA 1QTXA 1LA0A 1L7ZA 5B8IB 4QJ4B 1QATA 4MLWA 3BQ3A 5D7FA 1TRFA 4ICBA 3PN7C 1J55A 5HKZA 1UURA 4Q04A 1XA5A 3NSIA 1DQEA 4L9MA 1DELA 1F4OA 3UNWA 2AUCA 3CWGA 1SBJA 1CKKA 2BE4A 1SMGA 2M8UA 2KPHA 2BNXA 1NWDA 1ZOTB 1LS8A 2WCJA 2ZFDA 2ZN8A 4YGDB 3OX6A 4XYNA 1U5IB 1CDNA 2BL0C 4ORBB 1GGWA 3BXKA 1L2OB 1AK8A 1TOPA 1NSHA 4OV2A 1B4CA 3DZTA 5KSZA 2ZN9A 1M63B 3EK8A 3SG3A 1WY9A 4PCWA 4ORCB 4IL1A 1S5GY 2MAZA 3OP0A 3VRNA 1TUZA 1UP5A 1Y1XA 1K93D 1J1DA 2M1UA 4FQOA 1OOIX 1RFJA 2BECA 4FTGA 2KI4B 1IJ5A 1XYDA 2KAVA 2KFGA 2VRGA 1GM0A 3DVMA 3CTNA 3JVTB 3K1EA 5HLVA 2K7DA 1CFPA 1DVIA 2L98A 1LKJA 1UHNA 4NDDA 1MF8B 4PHJA 2NCPA 1QX2A 1NIWA 2LMUA 5D69A 1KK7Z 1PRWA 2KGBC 4PT1A 2ISDA 1TNWA 3TS5B 1AP4A 1JFJA 4D1EA 3C1VA 2O60A 2L0PA 4YGBB 1EG4A 3TDUA 1OOHA 2KAYA 3DVKA 3CLNA 1QV0A 4MRYA 3PN7B 2KAXA 3FE6A 1XFWO 3GK1A 2F2OA 1FI5A 2COLB 3PJIA 1YRUB 1YTZC 3MSEB 2JZIA 2HQWA 2MBXA 5I94A 1DT7B 1JBAA 3SIBA 4GGFC 4PE7A 1RWYA 2BKIB 2LHIA 3CZ0A 1JUOA 3B6XA 3KEVA 2EGDA 4AQIA 1KSMA 2KQYA 2G2BA 4MN0A 1IGVA 2RGIA 3BYAA 3D74A 2LLTA 3I5IB 3S0DA 1A29A 2JTTA 2K7OA 3TDZA 1QX5B 1JC2A 4N1GA 2GGMA 2K2FA 1KSOA 5DICA 3KO0A 2SCPA 3D0YB 3AKBA 2B1UA 1SW8A 1WLMA 2JPOA 1CFDA 1QS7A 2JNFA 2M9GA 2K61A 1NCZA 5TNCA 3TUYC 2E30A 2JNXA 3BUNB 4PALA 2JOJA 1XFVO 1ZACA 3D75A 1KFUS 3PALA 2L51A 2LM5A 1TTXA 4I5KA 4HRHA 3A8RA 1K9KA 1QV1A 2K8MB 2CNPA 2KFFA 1WDCB 2WCKA 5CSNA 2YGUA 1BODA 2NXQA 1SCMC 2JQ6A 1BT6A 2I7AA 3CZTX 2KDHA 3SG6A 2H61C 1OOGA 4BY5A 3WXAA 2LE9B 1BMOA 3O6BA 1GGZA 1XFRA 4I5JA 5DKNA 1PSBA 2WOSA 2HF5A 1B8RA 1A03A 3IQQA 1YURA 1UHHA 2OS8B 1C7VA 3LK1A 2P6BB 1KFXL 5PALA 3CS1A 1IIOA 1SNLA 1WRZA 3DVJA 5FYXA 3V2LA 2F8PA 4GFTA 4JPZB 1B1GA 1CDMA 1CM1A 2WCLA 2SASA 1QASA 1Y0VH 1H8BA 1NX1A 1DJGA 2HETA 1CDLA 2P70A 1DJZA 3L4LA 3NHTA 4JQ0D 3BJHA 3O2PA 3IQOA 4AOMA 3EK7A 1TCFA 2EHBA 2P71A 1YUTA 3I5GC 2LNKA 1RECA 1QIVA 1U5IA 2G9BA 3HCMA 3L47A 4WQ3A 3D10A 1L2OC 1N2DA 2NCOA 2F2PA 3A4UB 3JTDB 1MXEA 1ODBA 2M29A 3I5IC 3LLEA 4MRXA 1JF2A 1K9PA 3ZNIA 2JXCA 4DIRA 1MUXA 3TDIA 2WCEA 3ZWHA 3EK4A 3PM2A 2FCEA 3SIAA 3DD4A 1MR8A 1W7JB 4M2PA 1UHKA 2QEHA 4CPVA 1NCXA 1DGVA 2EC6B 3Q8IA 1BU3A 1ALVA 5F6TA 1IJ6A 1AHRA 1FW4A 1XK4A 2LANA 5CSJA 3RZSA 3PSRA 1KQMB 3QRXA 3FE8A 4YRUA 3B88A 3DVEA 3JTDC 5HKWA 2QPTA 3VRPA 1KK8C 4YI8A 4R1EA 3LCPC 2Q4UA 1PSRA 2QACA 1ZFSA 1YUUA 4GGFA 4DCKA 1C3ZA 1S26D 1T14A 2MJWB 1X02A 4NDCA 3PM8A 2BKHB 3SJSA 4P5OE 1K9UA 1B8LA 4CFRA 1GQMA 2KI6C 3D77A 1FBVA 2HPSA 2CTNA 4GPLB 1OE9B 2LMTA 2V53A 2WCBA 1Y1UA 2JC2A 3WHUB 1SL7A 1M31A 4PHNA 1KQVA 2LUCA 1KQMC 1BR4B 3NXAA 1A2XA 2L4HA 2L2CA 1SPYA 2BE6A 4GBAA 1OW4A
chains in the Genus database with same CATH topology
1JF0A 3CR4X 2JTZA 1DJIA 4NQGA 1F54A 2BBMA 1J7PA 1C7WA 1YX7A 2LMVA 1B7TY 1NP8A 1LINA 1EL4A 1M46A 2PSRA 4MZLA 4GGNA 4HREE 4ORAB 3KF9A 5J3XA 2KOTA 3OB2B 1WDCC 2LVJA 2JT3A 4OKHA 5DKRA 1PVAA 1LXFC 1K90D 2IS9A 3H4SE 1DGUA 4I5NB 5GQQC 2LP2A 4PE4A 2PRUA 1IQ3A 1GJYA 1ZMZA 5ER5A 4C0JA 2WC8A 4MEWA 1R2UA 1G33A 2Y5IA 3IF7A 2BL0B 1N0YA 4E68A 3CR2A 2HQ8A 2LP3A 2LVKA 1G8IA 1DJHA 5JJGA 3O78A 1KK8B 1UUSA 1UWOA 1XK4C 1RROA 4M2QA 4USLA 1JWDA 1DJWA 3NSOA 2MA2A 1K2HA 3WHTB 1JFKA 1MHOA 2FJUB 1XO5A 2Q91A 1CLLA 4PE1A 3OX5A 1B7TZ 3BUWB 3EKJA 1AVSA 1Q80A 1QVIY 2ZNDA 5AEQA 1LA3A 3FWCA 4N5XA 5I2LA 2PASA 5I2OA 2LHLA 1CMFA 1RK9A 4GUKA 4OR9B 4GAOA 1IH0A 1SCMB 1SRAA 1RTP1 1WLZA 4NDBA 5CPVA 4GNKB 1OSAA 1MWNA 4MSPA 1J7QA 4YGCB 1Y6WA 2WCFA 1CFFA 1E8AA 1XVJA 2KBIA 2LC5A 1B47A 2KFHA 3CR5X 1OMDA 4C0LA 1HQVA 1FF1A 1R6PA 2JU0A 1DMOA 1MXLC 1EG3A 3TUYB 3VRQA 4MZKA 1WRLA 1S36A 1OMRA 3NSKA 2JRFA 1FI6A 3DF0A 1CDPA 2LAPA 3WNXB 3BUMB 1FPWA 5JOLA 2WNDA 3PFVA 4YI9A 4XJKB 2ZKMX 3OB1B 1QIWA 2KI4C 2NZ0A 2KYFA 1EH2A 4YBHB 5I2QA 1RJVA 4ZCUA 2I2RE 2LLSA 1C07A 1PALA 3AAJA 2D8NA 2PMYA 3PATA 2JT0A 4I5LB 3VGOA 4XJKA 2JULA 2LVVA 2H61A 2KGRA 3BUXB 1TNPA 4A4BA 2OS8C 1KFUL 1SYMA 2LVIA 4QJ3B 1F71A 4QJ5B 2KBMA 2WORA 1OMVA 4AQJA 2K2AA 2ZNEA 3KHEA 1XFXO 3K21A 2F33A 1CLMA 1NUBA 1OZSA 1S5GZ 5G08A 5AFPA 1K95A 2JXLA 2JT8A 2EC6C 4OCIA 2CXJA 1UHJA 5CSIA 1QX7A 2KHNA 1HT9A 4BY4A 1XFYO 5HKYA 2OPOA 2BCXA 3I5HC 4DUQA 1F8HA 1OQPA 1D1OA 4WQ2A 1NX2A 2I94A 4DS7A 1V1GA 1BLQA 4PDZA 2BCAA 3VROA 1BG1A 1QLSA 4MZJA 1ZUZA 3SG4A 3BOWB 2JPTA 1CMGA 2M7NA 1QXPA 5K89A 1VRKA 4JWQA 1H4BA 1J7RA 3OHMB 2F3ZA 1SR6B 1B9AA 4M2OA 2Y1NA 1SL9A 2K7BA 1TCOB 5AERA 3I5HB 4N1FA 1BOCA 1AJ4A 5DKQA 4A4CA 5BPJA 1EJ3A 5HYDA 2OTGC 5CSFA 5ER4X 2M49B 2M97A 3SG5A 1CFCA 3GK2A 2DOQA 3CGAA 1K94A 2PALA 1QVIZ 1S6CA 1S3PA 4MVFA 1KWOC 4F0ZB 2AMIA 2PVBA 2TN4A 4DRWA 1IKUA 2KI6D 2MRDA 3FIAA 2KYCA 1EXRA 1F4QA 1G4YR 2E6WA 3EKHA 5I8NA 3KPXA 2LV7A 1NYAA 2M3WA 2LLUA 1F55A 1M45A 1YVLA 3JVTC 3PLFB 1TIZA 1DJYA 1CB1A 1MQ1A 2LUXA 2GV5A 3EVUA 4C0KA 4U8DA 1LVCD 1YUSA 2K7CA 1N65A 2LCPA 1SR6C 4PE0A 1BJFA 1W7IB 2KSPA 1UHIA 1K8UA 2MLFC 4P2YB 2MLEC 3GK4X 1K96A 1TNQA 1Y1AA 1S1EA 2OTGB 2FOTA 2M1KB 3TZ1A 1KFXS 2MHHA 5AANA 1AJ5A 4YGAA 3SG2A 4ETOA 1SK6D 3AKAA 2L4IA 1KK7Y 1YVHA 2KNEA 4WRIA 1J7OA 1CLBA 2CT9A 2JWWA 1NCYA 3RLZA 2L50A 1ALWA 2F3YA 4YGEB 2M0RA 1KCYA 3TS5C 1SL8A 1YX8A 3O4YA 2I18A 2CBLA 3BOWA 3ICBA 1TNXA 3F45A 4UPGA 1CTRA 1CNPA 4TNCA 1IRJA 2FCDA 2L5XB 3D0YA 1DF0B 3VRRA 3I5FB 1PULA 1S6JA 3FWBA 2A4JA 1KWOB 3RM1A 1PVBA 2R2IA 3E3RA 4CLNA 1S6IA 5AXIA 1IG5A 2L2EA 1SKTA 4HSZA 2ZRSA 1OOJA 1OZOA 1PK0D 4CIDA 1A75B 1QLKA 1F70A 1DF0A 1XFUO 2Y1MA 1TN4A 4PHMA 1DTLA 4MBEA 1A75A 4PHKA 1CM4A 4HRGA 2BCBA 1JSAA 1A4PA 2CCMA 1J1EA 3EVRA 3SG7A 4CFQA 1WRKA 1V1FA 2H2KA 5HLOA 3GOFA 2K0JA 3I5FC 1M39A 3M0WA 2ZRTA 3LK0A 1XFZO 1YR5A 5KTYA 3I5GB 3NSLA 5KU1A 5IBWA 1NX3A 2AAOA 3FS7A 2GGZA 1SCVA 4OVNF 1IWQA 2M7LA 3DF0B 1B8CA 2BBNA 1DJXA 1SY9A 3EVVA 1QJTA 1IQ5A 1NPQA 1YRTB 3AAKA 4ZCVA 1AUIB 1NX0A 3LL8B 2KQ6A 1BR1B 3HX4A 2NLNA 1BF5A 2O5GA 2Y4QA 1QTXA 1LA0A 1L7ZA 5B8IB 4QJ4B 1QATA 4MLWA 3BQ3A 5D7FA 1TRFA 4ICBA 3PN7C 1J55A 5HKZA 1UURA 4Q04A 1XA5A 3NSIA 4L9MA 1F4OA 2AUCA 3CWGA 1SBJA 1CKKA 2BE4A 1SMGA 2M8UA 1NWDA 1ZOTB 2ZFDA 2ZN8A 1CDNA 4YGDB 3OX6A 4XYNA 1U5IB 2BL0C 4ORBB 1GGWA 3BXKA 1L2OB 1AK8A 1TOPA 1NSHA 4OV2A 1B4CA 5KSZA 2ZN9A 1M63B 3EK8A 3SG3A 1WY9A 4PCWA 4ORCB 4IL1A 1S5GY 2MAZA 3OP0A 3VRNA 1UP5A 1Y1XA 1K93D 1J1DA 2M1UA 4FQOA 4FTGA 1RFJA 2BECA 2KI4B 1IJ5A 1XYDA 2KAVA 2KFGA 2VRGA 3DVMA 3CTNA 3JVTB 5HLVA 2K7DA 1CFPA 1DVIA 2L98A 1LKJA 1UHNA 4NDDA 1MF8B 4PHJA 2NCPA 1QX2A 1NIWA 2LMUA 5D69A 1KK7Z 1PRWA 2KGBC 2ISDA 3TS5B 1TNWA 1JFJA 1AP4A 4D1EA 3C1VA 2O60A 2L0PA 4YGBB 1EG4A 3TDUA 2KAYA 3DVKA 3CLNA 1QV0A 4MRYA 3PN7B 2KAXA 1XFWO 3GK1A 2F2OA 1FI5A 2COLB 1YRUB 1YTZC 3MSEB 2JZIA 2HQWA 2MBXA 1DT7B 1JBAA 3SIBA 4GGFC 4PE7A 1RWYA 2BKIB 2LHIA 3KEVA 1JUOA 4AQIA 2EGDA 1KSMA 2KQYA 2G2BA 4MN0A 1IGVA 2RGIA 3BYAA 3I5IB 2LLTA 3TDZA 1JC2A 1A29A 2JTTA 2K7OA 1QX5B 4N1GA 2GGMA 2K2FA 1KSOA 3KO0A 2SCPA 3D0YB 3AKBA 2B1UA 1SW8A 1WLMA 1CFDA 1QS7A 2JNFA 2M9GA 2K61A 1NCZA 5TNCA 3TUYC 2E30A 2JNXA 3BUNB 4PALA 2JOJA 1XFVO 1ZACA 1KFUS 3PALA 2L51A 2LM5A 1TTXA 4I5KA 4HRHA 3A8RA 1K9KA 1QV1A 2K8MB 2CNPA 2KFFA 1WDCB 5CSNA 1BODA 2NXQA 1SCMC 2JQ6A 1BT6A 2I7AA 3CZTX 2KDHA 3SG6A 2H61C 4BY5A 3WXAA 2LE9B 1BMOA 3O6BA 1GGZA 4I5JA 5DKNA 1PSBA 2WOSA 2HF5A 1B8RA 1A03A 3IQQA 1YURA 1UHHA 2OS8B 1C7VA 3LK1A 2P6BB 1KFXL 5PALA 3CS1A 1SNLA 1WRZA 3DVJA 5FYXA 2F8PA 4GFTA 4JPZB 1B1GA 1CDMA 1CM1A 2SASA 1QASA 1Y0VH 1H8BA 1NX1A 1DJGA 2HETA 1CDLA 1DJZA 4JQ0D 3O2PA 3IQOA 4AOMA 3EK7A 1TCFA 2EHBA 1YUTA 3I5GC 2LNKA 1RECA 1QIVA 1U5IA 2G9BA 3HCMA 4WQ3A 3D10A 1L2OC 1N2DA 2NCOA 2F2PA 3A4UB 3JTDB 1MXEA 1ODBA 2M29A 3I5IC 3LLEA 4MRXA 1JF2A 1K9PA 3ZNIA 2JXCA 4DIRA 1MUXA 3TDIA 2WCEA 3ZWHA 3EK4A 2FCEA 3SIAA 3DD4A 1MR8A 1W7JB 4M2PA 1UHKA 4CPVA 1NCXA 1DGVA 2EC6B 1BU3A 1ALVA 5F6TA 1IJ6A 1AHRA 1FW4A 1XK4A 2LANA 5CSJA 3PSRA 1KQMB 3QRXA 4YRUA 3DVEA 3JTDC 5HKWA 2QPTA 3VRPA 1KK8C 4YI8A 4R1EA 3LCPC 2Q4UA 1PSRA 2QACA 1ZFSA 1YUUA 4GGFA 4DCKA 1S26D 2MJWB 1X02A 4NDCA 3PM8A 2BKHB 3SJSA 4P5OE 1K9UA 1B8LA 4CFRA 1GQMA 2KI6C 2HPSA 1FBVA 2CTNA 4GPLB 1OE9B 2LMTA 2V53A 2WCBA 1Y1UA 2JC2A 3WHUB 1SL7A 1M31A 4PHNA 1KQVA 2LUCA 1KQMC 1BR4B 3NXAA 1A2XA 2L4HA 1SPYA 2BE6A 4GBAA 3BUOB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JF0 A;  3CR4 X;  2JTZ A;  1DJI A;  4NQG A;  1F54 A;  2BBM A;  1J7P A;  1C7W A;  1YX7 A;  2LMV A;  1B7T Y;  1NP8 A;  1LIN A;  1EL4 A;  1M46 A;  2PSR A;  4MZL A;  4GGN A;  4HRE E;  4ORA B;  3KF9 A;  5J3X A;  2KOT A;  3OB2 B;  1WDC C;  2LVJ A;  2JT3 A;  4OKH A;  5DKR A;  1PVA A;  1LXF C;  1K90 D;  2IS9 A;  3H4S E;  1DGU A;  4I5N B;  5GQQ C;  2LP2 A;  4PE4 A;  2PRU A;  1IQ3 A;  1GJY A;  1ZMZ A;  5ER5 A;  4C0J A;  2WC8 A;  4MEW A;  1R2U A;  1G33 A;  2Y5I A;  3IF7 A;  2BL0 B;  1N0Y A;  4E68 A;  3CR2 A;  2HQ8 A;  2LP3 A;  2LVK A;  1G8I A;  1DJH A;  5JJG A;  3O78 A;  1KK8 B;  1UUS A;  1UWO A;  1XK4 C;  1RRO A;  4M2Q A;  4USL A;  1JWD A;  1DJW A;  3NSO A;  2MA2 A;  1K2H A;  3WHT B;  1JFK A;  1MHO A;  2FJU B;  1XO5 A;  2Q91 A;  1CLL A;  4PE1 A;  3OX5 A;  1B7T Z;  3BUW B;  3EKJ A;  1AVS A;  1Q80 A;  1QVI Y;  2ZND A;  5AEQ A;  1LA3 A;  3FWC A;  4N5X A;  5I2L A;  2PAS A;  5I2O A;  2LHL A;  1CMF A;  1RK9 A;  4GUK A;  4OR9 B;  4GAO A;  1IH0 A;  1SCM B;  1SRA A;  1RTP 1;  1WLZ A;  4NDB A;  5CPV A;  4GNK B;  1OSA A;  1MWN A;  4MSP A;  1J7Q A;  4YGC B;  1Y6W A;  2WCF A;  1CFF A;  1E8A A;  1XVJ A;  2KBI A;  2LC5 A;  1B47 A;  2KFH A;  3CR5 X;  1OMD A;  4C0L A;  1HQV A;  1FF1 A;  1R6P A;  2JU0 A;  1DMO A;  1MXL C;  1EG3 A;  3TUY B;  3VRQ A;  4MZK A;  1WRL A;  1S36 A;  1OMR A;  3NSK A;  2JRF A;  1FI6 A;  3DF0 A;  1CDP A;  2LAP A;  3WNX B;  3BUM B;  1FPW A;  5JOL A;  2WND A;  3PFV A;  4YI9 A;  4XJK B;  2ZKM X;  3OB1 B;  1QIW A;  2KI4 C;  2NZ0 A;  2KYF A;  1EH2 A;  4YBH B;  5I2Q A;  1RJV A;  4ZCU A;  2I2R E;  2LLS A;  1C07 A;  1PAL A;  3AAJ A;  2D8N A;  2PMY A;  3PAT A;  2JT0 A;  4I5L B;  3VGO A;  4XJK A;  2JUL A;  2LVV A;  2H61 A;  2KGR A;  3BUX B;  1TNP A;  4A4B A;  2OS8 C;  1KFU L;  1SYM A;  2LVI A;  4QJ3 B;  1F71 A;  4QJ5 B;  2KBM A;  2WOR A;  1OMV A;  4AQJ A;  2K2A A;  2ZNE A;  3KHE A;  1XFX O;  3K21 A;  2F33 A;  1CLM A;  1NUB A;  1OZS A;  1S5G Z;  5G08 A;  5AFP A;  1K95 A;  2JXL A;  2JT8 A;  2EC6 C;  4OCI A;  2CXJ A;  1UHJ A;  5CSI A;  1QX7 A;  2KHN A;  1HT9 A;  4BY4 A;  1XFY O;  5HKY A;  2OPO A;  2BCX A;  3I5H C;  4DUQ A;  1F8H A;  1OQP A;  1D1O A;  4WQ2 A;  1NX2 A;  2I94 A;  4DS7 A;  1V1G A;  1BLQ A;  4PDZ A;  2BCA A;  3VRO A;  1BG1 A;  1QLS A;  4MZJ A;  1ZUZ A;  3SG4 A;  3BOW B;  2JPT A;  1CMG A;  2M7N A;  1QXP A;  5K89 A;  1VRK A;  4JWQ A;  1H4B A;  1J7R A;  3OHM B;  2F3Z A;  1SR6 B;  1B9A A;  4M2O A;  2Y1N A;  1SL9 A;  2K7B A;  1TCO B;  5AER A;  3I5H B;  4N1F A;  1BOC A;  1AJ4 A;  5DKQ A;  4A4C A;  5BPJ A;  1EJ3 A;  5HYD A;  2OTG C;  5CSF A;  5ER4 X;  2M49 B;  2M97 A;  3SG5 A;  1CFC A;  3GK2 A;  2DOQ A;  3CGA A;  1K94 A;  2PAL A;  1QVI Z;  1S6C A;  1S3P A;  4MVF A;  1KWO C;  4F0Z B;  2AMI A;  2PVB A;  2TN4 A;  4DRW A;  1IKU A;  2KI6 D;  2MRD A;  3FIA A;  2KYC A;  1EXR A;  1F4Q A;  1G4Y R;  2E6W A;  3EKH A;  5I8N A;  3KPX A;  2LV7 A;  1NYA A;  2M3W A;  2LLU A;  1F55 A;  1M45 A;  1YVL A;  3JVT C;  3PLF B;  1TIZ A;  1DJY A;  1CB1 A;  1MQ1 A;  2LUX A;  2GV5 A;  3EVU A;  4C0K A;  4U8D A;  1LVC D;  1YUS A;  2K7C A;  1N65 A;  2LCP A;  1SR6 C;  4PE0 A;  1BJF A;  1W7I B;  2KSP A;  1UHI A;  1K8U A;  2MLF C;  4P2Y B;  2MLE C;  3GK4 X;  1K96 A;  1TNQ A;  1Y1A A;  1S1E A;  2OTG B;  2FOT A;  2M1K B;  3TZ1 A;  1KFX S;  2MHH A;  5AAN A;  1AJ5 A;  4YGA A;  3SG2 A;  4ETO A;  1SK6 D;  3AKA A;  2L4I A;  1KK7 Y;  1YVH A;  2KNE A;  4WRI A;  1J7O A;  1CLB A;  2CT9 A;  2JWW A;  1NCY A;  3RLZ A;  2L50 A;  1ALW A;  2F3Y A;  4YGE B;  2M0R A;  1KCY A;  3TS5 C;  1SL8 A;  1YX8 A;  3O4Y A;  2I18 A;  2CBL A;  3BOW A;  3ICB A;  1TNX A;  3F45 A;  4UPG A;  1CTR A;  1CNP A;  4TNC A;  1IRJ A;  2FCD A;  2L5X B;  3D0Y A;  1DF0 B;  3VRR A;  3I5F B;  1PUL A;  1S6J A;  3FWB A;  2A4J A;  1KWO B;  3RM1 A;  1PVB A;  2R2I A;  3E3R A;  4CLN A;  1S6I A;  5AXI A;  1IG5 A;  2L2E A;  1SKT A;  4HSZ A;  2ZRS A;  1OOJ A;  1OZO A;  1PK0 D;  4CID A;  1A75 B;  1QLK A;  1F70 A;  1DF0 A;  1XFU O;  2Y1M A;  1TN4 A;  4PHM A;  1DTL A;  4MBE A;  1A75 A;  4PHK A;  1CM4 A;  4HRG A;  2BCB A;  1JSA A;  1A4P A;  2CCM A;  1J1E A;  3EVR A;  3SG7 A;  4CFQ A;  1WRK A;  1V1F A;  2H2K A;  5HLO A;  3GOF A;  2K0J A;  3I5F C;  1M39 A;  3M0W A;  2ZRT A;  3LK0 A;  1XFZ O;  1YR5 A;  5KTY A;  3I5G B;  3NSL A;  5KU1 A;  5IBW A;  1NX3 A;  2AAO A;  3FS7 A;  2GGZ A;  1SCV A;  4OVN F;  1IWQ A;  2M7L A;  3DF0 B;  1B8C A;  2BBN A;  1DJX A;  1SY9 A;  3EVV A;  1QJT A;  1IQ5 A;  1NPQ A;  1YRT B;  3AAK A;  4ZCV A;  1AUI B;  1NX0 A;  3LL8 B;  2KQ6 A;  1BR1 B;  3HX4 A;  2NLN A;  1BF5 A;  2O5G A;  2Y4Q A;  1QTX A;  1LA0 A;  1L7Z A;  5B8I B;  4QJ4 B;  1QAT A;  4MLW A;  3BQ3 A;  5D7F A;  1TRF A;  4ICB A;  3PN7 C;  1J55 A;  5HKZ A;  1UUR A;  4Q04 A;  1XA5 A;  3NSI A;  4L9M A;  1F4O A;  2AUC A;  3CWG A;  1SBJ A;  1CKK A;  2BE4 A;  1SMG A;  2M8U A;  1NWD A;  1ZOT B;  2ZFD A;  2ZN8 A;  1CDN A;  4YGD B;  3OX6 A;  4XYN A;  1U5I B;  2BL0 C;  4ORB B;  1GGW A;  3BXK A;  1L2O B;  1AK8 A;  1TOP A;  1NSH A;  4OV2 A;  1B4C A;  5KSZ A;  2ZN9 A;  1M63 B;  3EK8 A;  3SG3 A;  1WY9 A;  4PCW A;  4ORC B;  4IL1 A;  1S5G Y;  2MAZ A;  3OP0 A;  3VRN A;  1UP5 A;  1Y1X A;  1K93 D;  1J1D A;  2M1U A;  4FQO A;  4FTG A;  1RFJ A;  2BEC A;  2KI4 B;  1IJ5 A;  1XYD A;  2KAV A;  2KFG A;  2VRG A;  3DVM A;  3CTN A;  3JVT B;  5HLV A;  2K7D A;  1CFP A;  1DVI A;  2L98 A;  1LKJ A;  1UHN A;  4NDD A;  1MF8 B;  4PHJ A;  2NCP A;  1QX2 A;  1NIW A;  2LMU A;  5D69 A;  1KK7 Z;  1PRW A;  2KGB C;  2ISD A;  3TS5 B;  1TNW A;  1JFJ A;  1AP4 A;  4D1E A;  3C1V A;  2O60 A;  2L0P A;  4YGB B;  1EG4 A;  3TDU A;  2KAY A;  3DVK A;  3CLN A;  1QV0 A;  4MRY A;  3PN7 B;  2KAX A;  1XFW O;  3GK1 A;  2F2O A;  1FI5 A;  2COL B;  1YRU B;  1YTZ C;  3MSE B;  2JZI A;  2HQW A;  2MBX A;  1DT7 B;  1JBA A;  3SIB A;  4GGF C;  4PE7 A;  1RWY A;  2BKI B;  2LHI A;  3KEV A;  1JUO A;  4AQI A;  2EGD A;  1KSM A;  2KQY A;  2G2B A;  4MN0 A;  1IGV A;  2RGI A;  3BYA A;  3I5I B;  2LLT A;  3TDZ A;  1JC2 A;  1A29 A;  2JTT A;  2K7O A;  1QX5 B;  4N1G A;  2GGM A;  2K2F A;  1KSO A;  3KO0 A;  2SCP A;  3D0Y B;  3AKB A;  2B1U A;  1SW8 A;  1WLM A;  1CFD A;  1QS7 A;  2JNF A;  2M9G A;  2K61 A;  1NCZ A;  5TNC A;  3TUY C;  2E30 A;  2JNX A;  3BUN B;  4PAL A;  2JOJ A;  1XFV O;  1ZAC A;  1KFU S;  3PAL A;  2L51 A;  2LM5 A;  1TTX A;  4I5K A;  4HRH A;  3A8R A;  1K9K A;  1QV1 A;  2K8M B;  2CNP A;  2KFF A;  1WDC B;  5CSN A;  1BOD A;  2NXQ A;  1SCM C;  2JQ6 A;  1BT6 A;  2I7A A;  3CZT X;  2KDH A;  3SG6 A;  2H61 C;  4BY5 A;  3WXA A;  2LE9 B;  1BMO A;  3O6B A;  1GGZ A;  4I5J A;  5DKN A;  1PSB A;  2WOS A;  2HF5 A;  1B8R A;  1A03 A;  3IQQ A;  1YUR A;  1UHH A;  2OS8 B;  1C7V A;  3LK1 A;  2P6B B;  1KFX L;  5PAL A;  3CS1 A;  1SNL A;  1WRZ A;  3DVJ A;  5FYX A;  2F8P A;  4GFT A;  4JPZ B;  1B1G A;  1CDM A;  1CM1 A;  2SAS A;  1QAS A;  1Y0V H;  1H8B A;  1NX1 A;  1DJG A;  2HET A;  1CDL A;  1DJZ A;  4JQ0 D;  3O2P A;  3IQO A;  4AOM A;  3EK7 A;  1TCF A;  2EHB A;  1YUT A;  3I5G C;  2LNK A;  1REC A;  1QIV A;  1U5I A;  2G9B A;  3HCM A;  4WQ3 A;  3D10 A;  1L2O C;  1N2D A;  2NCO A;  2F2P A;  3A4U B;  3JTD B;  1MXE A;  1ODB A;  2M29 A;  3I5I C;  3LLE A;  4MRX A;  1JF2 A;  1K9P A;  3ZNI A;  2JXC A;  4DIR A;  1MUX A;  3TDI A;  2WCE A;  3ZWH A;  3EK4 A;  2FCE A;  3SIA A;  3DD4 A;  1MR8 A;  1W7J B;  4M2P A;  1UHK A;  4CPV A;  1NCX A;  1DGV A;  2EC6 B;  1BU3 A;  1ALV A;  5F6T A;  1IJ6 A;  1AHR A;  1FW4 A;  1XK4 A;  2LAN A;  5CSJ A;  3PSR A;  1KQM B;  3QRX A;  4YRU A;  3DVE A;  3JTD C;  5HKW A;  2QPT A;  3VRP A;  1KK8 C;  4YI8 A;  4R1E A;  3LCP C;  2Q4U A;  1PSR A;  2QAC A;  1ZFS A;  1YUU A;  4GGF A;  4DCK A;  1S26 D;  2MJW B;  1X02 A;  4NDC A;  3PM8 A;  2BKH B;  3SJS A;  4P5O E;  1K9U A;  1B8L A;  4CFR A;  1GQM A;  2KI6 C;  2HPS A;  1FBV A;  2CTN A;  4GPL B;  1OE9 B;  2LMT A;  2V53 A;  2WCB A;  1Y1U A;  2JC2 A;  3WHU B;  1SL7 A;  1M31 A;  4PHN A;  1KQV A;  2LUC A;  1KQM C;  1BR4 B;  3NXA A;  1A2X A;  2L4H A;  1SPY A;  2BE6 A;  4GBA A;  3BUO B; 
#chains in the Genus database with same CATH topology
 1JF0 A;  3CR4 X;  2ERB A;  1DJI A;  2JTZ A;  4NQG A;  5D3O A;  5FI6 A;  1F54 A;  2QDI A;  2BBM A;  1J7P A;  1C7W A;  1YX7 A;  2LMV A;  1B7T Y;  1NP8 A;  1LIN A;  1EL4 A;  1M46 A;  2PSR A;  4MZL A;  4GGN A;  1Z2C B;  4HRE E;  3KF9 A;  4ORA B;  5J3X A;  2KOT A;  3OB2 B;  1WDC C;  2LVJ A;  4F7F A;  2JT3 A;  4OKH A;  5DKR A;  1PVA A;  1LXF C;  1K90 D;  2IS9 A;  3H4S E;  1DGU A;  4I5N B;  5GQQ C;  2LP2 A;  4PE4 A;  2PRU A;  1IQ3 A;  1GJY A;  1ZMZ A;  5ER5 A;  4C0J A;  2WC8 A;  4MEW A;  1R2U A;  1G33 A;  2Y5I A;  3S0E A;  3IF7 A;  2BL0 B;  1N0Y A;  4INX A;  4E68 A;  3CR2 A;  2HQ8 A;  3QME A;  2LP3 A;  2LVK A;  4JD9 A;  1G8I A;  1DJH A;  5JJG A;  3O78 A;  1KK8 B;  1UUS A;  1UWO A;  1XK4 C;  1RRO A;  4M2Q A;  3OBV A;  4USL A;  1JWD A;  3BFB A;  1DJW A;  3NSO A;  2MA2 A;  1K2H A;  3WHT B;  3S0A A;  1JFK A;  1MHO A;  3CZ2 A;  2WCM A;  2FJU B;  1XO5 A;  2Q91 A;  1CLL A;  4PE1 A;  3OX5 A;  3S0F A;  1B7T Z;  3BUW B;  3EKJ A;  1AVS A;  1Q80 A;  1QVI Y;  2QEB A;  2ZND A;  5AEQ A;  1LA3 A;  1SSE B;  3FWC A;  4N5X A;  5I2L A;  2PAS A;  5I2O A;  2LHL A;  1CMF A;  1RK9 A;  4GUK A;  4OR9 B;  4GAO A;  1IH0 A;  1SCM B;  1SRA A;  1RTP 1;  1WLZ A;  4NDB A;  5CPV A;  4GNK B;  1OSA A;  1MWN A;  3O4X A;  4MSP A;  1J7Q A;  4YGC B;  1Y6W A;  2WCF A;  1CFF A;  1E8A A;  1XVJ A;  2KBI A;  2LC5 A;  1B47 A;  2KFH A;  3CR5 X;  1OMD A;  4C0L A;  1HQV A;  1FF1 A;  5FI2 A;  1R6P A;  3DXL A;  2JU0 A;  1DMO A;  1MXL C;  1EG3 A;  3TUY B;  3DY9 A;  3VRQ A;  4MZK A;  1WRL A;  1S36 A;  1OMR A;  2QEO A;  2JRF A;  3NSK A;  1FI6 A;  1QWV A;  3DF0 A;  1CDP A;  2LAP A;  3WNX B;  3BUM B;  2GTE A;  1FPW A;  1P28 A;  2WND A;  3PFV A;  3N7H A;  1TUJ A;  4YI9 A;  5JOL A;  4XJK B;  3FE9 A;  2ZKM X;  3OB1 B;  1QIW A;  2KI4 C;  2NZ0 A;  2KYF A;  1EH2 A;  4YBH B;  5I2Q A;  1RJV A;  4ZCU A;  2I2R E;  2LLS A;  1C07 A;  1PAL A;  3AAJ A;  1TWO A;  2D8N A;  2PMY A;  3PAT A;  2JT0 A;  4I5L B;  4IJ7 A;  4XJK A;  2JUL A;  2LVV A;  3VGO A;  2H61 A;  2KGR A;  3BUX B;  1TNP A;  4A4B A;  2OS8 C;  1KFU L;  1SYM A;  1W9Z A;  1Z4H A;  2LVI A;  4QJ3 B;  1F71 A;  4QJ5 B;  2KBM A;  2WOR A;  3BFA A;  1OMV A;  4AQJ A;  2K2A A;  2ZNE A;  2FJY A;  3KHE A;  1XFX O;  2WC6 A;  3K21 A;  2F33 A;  2QEV A;  1CLM A;  1NUB A;  1OZS A;  1S5G Z;  5G08 A;  5AFP A;  1K95 A;  2JXL A;  3CDN A;  2JT8 A;  2EC6 C;  1ORG A;  5FI7 A;  4OCI A;  2CXJ A;  1UHJ A;  5CSI A;  1QX7 A;  2KHN A;  4FQT A;  1HT9 A;  4BY4 A;  1XFY O;  5HKY A;  2OPO A;  2BCX A;  3I5H C;  4DUQ A;  1F8H A;  1OQP A;  1D1O A;  4WQ2 A;  2L5Y A;  3IVT A;  1NX2 A;  2I94 A;  4DS7 A;  1V1G A;  1BLQ A;  4PDZ A;  2BCA A;  3VRO A;  1DEK A;  1BG1 A;  1QLS A;  4MZJ A;  1ZUZ A;  3BFH A;  3OGN A;  3SG4 A;  3BOW B;  2JPT A;  1CMG A;  2M7N A;  1QXP A;  3R1V A;  5K89 A;  1VRK A;  4JWQ A;  3S0G A;  1H4B A;  1J7R A;  3OHM B;  2F3Z A;  1SR6 B;  2KLE A;  1B9A A;  4M2O A;  2Y1N A;  1SL9 A;  2K7B A;  1TCO B;  5AER A;  3I5H B;  4N1F A;  1BOC A;  1AJ4 A;  5DKQ A;  4A4C A;  5BPJ A;  1EJ3 A;  5HYD A;  2OTG C;  5CSF A;  5ER4 X;  5HL1 A;  2M49 B;  3SS3 A;  2M97 A;  3SG5 A;  1CFC A;  3GK2 A;  2DOQ A;  3CGA A;  1K94 A;  2PAL A;  1QVI Z;  1S6C A;  3NGV A;  4OZD A;  1S3P A;  3D78 A;  1KWO C;  4MVF A;  4F0Z B;  2AMI A;  2PVB A;  2TN4 A;  3R1O A;  4DRW A;  2KI6 D;  2MRD A;  1IKU A;  3FIA A;  2KYC A;  1EXR A;  1F4Q A;  1G4Y R;  2E6W A;  3EKH A;  5I8N A;  3KPX A;  2LV7 A;  1NYA A;  2M3W A;  2LLU A;  1DC1 A;  1F55 A;  1M45 A;  1YVL A;  3JVT C;  3SS4 A;  4INW A;  3PLF B;  1TIZ A;  1DJY A;  1CB1 A;  1MQ1 A;  2LUX A;  2GV5 A;  3EVU A;  4C0K A;  4U8D A;  1LVC D;  1YUS A;  2K7C A;  1N65 A;  2KLD A;  1SR6 C;  2LCP A;  3B7A A;  4JKT A;  1BJF A;  4PE0 A;  1W7I B;  2WCH A;  2KSP A;  3VB1 A;  1UHI A;  1K8U A;  2MLF C;  4P2Y B;  2MLE C;  3GK4 X;  1K96 A;  1TNQ A;  1Y1A A;  1S1E A;  2OTG B;  2FOT A;  3D76 A;  2M1K B;  2K60 A;  3TZ1 A;  1KFX S;  2MHH A;  5AAN A;  1AJ5 A;  4YGA A;  3SG2 A;  4ETO A;  1SK6 D;  3AKA A;  2L4I A;  3EG5 B;  1KK7 Y;  1YVH A;  3DYE A;  2KNE A;  2BAP A;  3B86 A;  3L4A A;  4WRI A;  1J7O A;  3UO9 A;  1CLB A;  2CT9 A;  2JWW A;  1NCY A;  3RLZ A;  2H8V A;  2L50 A;  1ALW A;  2F3Y A;  4YGE B;  2M0R A;  1KCY A;  3TS5 C;  1SL8 A;  2PQL A;  1YX8 A;  3O4Y A;  2I18 A;  2CBL A;  3BOW A;  3ICB A;  1C3Y A;  1TNX A;  3F45 A;  4UPG A;  1CTR A;  1CNP A;  4TNC A;  1IRJ A;  2FCD A;  2L5X B;  3D0Y A;  1DF0 B;  3VRR A;  3I5F B;  1PUL A;  1S6J A;  3FWB A;  2A4J A;  1KWO B;  3RM1 A;  1PVB A;  2R2I A;  3E3R A;  4CLN A;  1S6I A;  5AXI A;  1IG5 A;  2L2E A;  1SKT A;  4HSZ A;  2ZRS A;  1OOJ A;  4KYN A;  1OZO A;  1PK0 D;  4CID A;  1A75 B;  1QLK A;  1F70 A;  1DF0 A;  1XFU O;  2Y1M A;  1TN4 A;  4PHM A;  1DTL A;  4MBE A;  1A75 A;  4PHK A;  1CM4 A;  4HRG A;  2BCB A;  1JSA A;  3SS5 A;  1A4P A;  2CCM A;  2WC5 A;  1J1E A;  3EVR A;  3SG7 A;  4CFQ A;  1WRK A;  1V1F A;  3R1P A;  2H2K A;  5HLO A;  3GOF A;  3CYZ A;  3R72 A;  5EL2 A;  2K0J A;  3I5F C;  1M39 A;  3M0W A;  2ZRT A;  3CAB A;  3LK0 A;  1XFZ O;  1YR5 A;  5KTY A;  3I5G B;  2PYQ A;  3NSL A;  3S0B A;  5KU1 A;  5IBW A;  1NX3 A;  2AAO A;  3FS7 A;  2GGZ A;  1SCV A;  4OVN F;  1IWQ A;  3BUO B;  2M7L A;  3DF0 B;  1B8C A;  2BBN A;  1DJX A;  1SY9 A;  3EVV A;  1QJT A;  1IQ5 A;  1NPQ A;  1YRT B;  3AAK A;  3D73 A;  4ZCV A;  1AUI B;  1OOF A;  1NX0 A;  3LL8 B;  2KQ6 A;  1BR1 B;  3CZ1 A;  3HX4 A;  2NLN A;  3NHI A;  2O5G A;  3B87 A;  1BF5 A;  2Y4Q A;  1QTX A;  1LA0 A;  1L7Z A;  5B8I B;  4QJ4 B;  1QAT A;  4MLW A;  3BQ3 A;  5D7F A;  1TRF A;  4ICB A;  3PN7 C;  1J55 A;  5HKZ A;  1UUR A;  4Q04 A;  1XA5 A;  3NSI A;  1DQE A;  4L9M A;  1DEL A;  1F4O A;  3UNW A;  2AUC A;  3CWG A;  1SBJ A;  1CKK A;  2BE4 A;  1SMG A;  2M8U A;  2KPH A;  2BNX A;  1NWD A;  1ZOT B;  1LS8 A;  2WCJ A;  2ZFD A;  2ZN8 A;  4YGD B;  3OX6 A;  4XYN A;  1U5I B;  1CDN A;  2BL0 C;  4ORB B;  1GGW A;  3BXK A;  1L2O B;  1AK8 A;  1TOP A;  1NSH A;  4OV2 A;  1B4C A;  3DZT A;  5KSZ A;  2ZN9 A;  1M63 B;  3EK8 A;  3SG3 A;  1WY9 A;  4PCW A;  4ORC B;  4IL1 A;  1S5G Y;  2MAZ A;  3OP0 A;  3VRN A;  1TUZ A;  1UP5 A;  1Y1X A;  1K93 D;  1J1D A;  2M1U A;  4FQO A;  1OOI X;  1RFJ A;  2BEC A;  4FTG A;  2KI4 B;  1IJ5 A;  1XYD A;  2KAV A;  2KFG A;  2VRG A;  1GM0 A;  3DVM A;  3CTN A;  3JVT B;  3K1E A;  5HLV A;  2K7D A;  1CFP A;  1DVI A;  2L98 A;  1LKJ A;  1UHN A;  4NDD A;  1MF8 B;  4PHJ A;  2NCP A;  1QX2 A;  1NIW A;  2LMU A;  5D69 A;  1KK7 Z;  1PRW A;  2KGB C;  4PT1 A;  2ISD A;  1TNW A;  3TS5 B;  1AP4 A;  1JFJ A;  4D1E A;  3C1V A;  2O60 A;  2L0P A;  4YGB B;  1EG4 A;  3TDU A;  1OOH A;  2KAY A;  3DVK A;  3CLN A;  1QV0 A;  4MRY A;  3PN7 B;  2KAX A;  3FE6 A;  1XFW O;  3GK1 A;  2F2O A;  1FI5 A;  2COL B;  3PJI A;  1YRU B;  1YTZ C;  3MSE B;  2JZI A;  2HQW A;  2MBX A;  5I94 A;  1DT7 B;  1JBA A;  3SIB A;  4GGF C;  4PE7 A;  1RWY A;  2BKI B;  2LHI A;  3CZ0 A;  1JUO A;  3B6X A;  3KEV A;  2EGD A;  4AQI A;  1KSM A;  2KQY A;  2G2B A;  4MN0 A;  1IGV A;  2RGI A;  3BYA A;  3D74 A;  2LLT A;  3I5I B;  3S0D A;  1A29 A;  2JTT A;  2K7O A;  3TDZ A;  1QX5 B;  1JC2 A;  4N1G A;  2GGM A;  2K2F A;  1KSO A;  5DIC A;  3KO0 A;  2SCP A;  3D0Y B;  3AKB A;  2B1U A;  1SW8 A;  1WLM A;  2JPO A;  1CFD A;  1QS7 A;  2JNF A;  2M9G A;  2K61 A;  1NCZ A;  5TNC A;  3TUY C;  2E30 A;  2JNX A;  3BUN B;  4PAL A;  2JOJ A;  1XFV O;  1ZAC A;  3D75 A;  1KFU S;  3PAL A;  2L51 A;  2LM5 A;  1TTX A;  4I5K A;  4HRH A;  3A8R A;  1K9K A;  1QV1 A;  2K8M B;  2CNP A;  2KFF A;  1WDC B;  2WCK A;  5CSN A;  2YGU A;  1BOD A;  2NXQ A;  1SCM C;  2JQ6 A;  1BT6 A;  2I7A A;  3CZT X;  2KDH A;  3SG6 A;  2H61 C;  1OOG A;  4BY5 A;  3WXA A;  2LE9 B;  1BMO A;  3O6B A;  1GGZ A;  1XFR A;  4I5J A;  5DKN A;  1PSB A;  2WOS A;  2HF5 A;  1B8R A;  1A03 A;  3IQQ A;  1YUR A;  1UHH A;  2OS8 B;  1C7V A;  3LK1 A;  2P6B B;  1KFX L;  5PAL A;  3CS1 A;  1IIO A;  1SNL A;  1WRZ A;  3DVJ A;  5FYX A;  3V2L A;  2F8P A;  4GFT A;  4JPZ B;  1B1G A;  1CDM A;  1CM1 A;  2WCL A;  2SAS A;  1QAS A;  1Y0V H;  1H8B A;  1NX1 A;  1DJG A;  2HET A;  1CDL A;  2P70 A;  1DJZ A;  3L4L A;  3NHT A;  4JQ0 D;  3BJH A;  3O2P A;  3IQO A;  4AOM A;  3EK7 A;  1TCF A;  2EHB A;  2P71 A;  1YUT A;  3I5G C;  2LNK A;  1REC A;  1QIV A;  1U5I A;  2G9B A;  3HCM A;  3L47 A;  4WQ3 A;  3D10 A;  1L2O C;  1N2D A;  2NCO A;  2F2P A;  3A4U B;  3JTD B;  1MXE A;  1ODB A;  2M29 A;  3I5I C;  3LLE A;  4MRX A;  1JF2 A;  1K9P A;  3ZNI A;  2JXC A;  4DIR A;  1MUX A;  3TDI A;  2WCE A;  3ZWH A;  3EK4 A;  3PM2 A;  2FCE A;  3SIA A;  3DD4 A;  1MR8 A;  1W7J B;  4M2P A;  1UHK A;  2QEH A;  4CPV A;  1NCX A;  1DGV A;  2EC6 B;  3Q8I A;  1BU3 A;  1ALV A;  5F6T A;  1IJ6 A;  1AHR A;  1FW4 A;  1XK4 A;  2LAN A;  5CSJ A;  3RZS A;  3PSR A;  1KQM B;  3QRX A;  3FE8 A;  4YRU A;  3B88 A;  3DVE A;  3JTD C;  5HKW A;  2QPT A;  3VRP A;  1KK8 C;  4YI8 A;  4R1E A;  3LCP C;  2Q4U A;  1PSR A;  2QAC A;  1ZFS A;  1YUU A;  4GGF A;  4DCK A;  1C3Z A;  1S26 D;  1T14 A;  2MJW B;  1X02 A;  4NDC A;  3PM8 A;  2BKH B;  3SJS A;  4P5O E;  1K9U A;  1B8L A;  4CFR A;  1GQM A;  2KI6 C;  3D77 A;  1FBV A;  2HPS A;  2CTN A;  4GPL B;  1OE9 B;  2LMT A;  2V53 A;  2WCB A;  1Y1U A;  2JC2 A;  3WHU B;  1SL7 A;  1M31 A;  4PHN A;  1KQV A;  2LUC A;  1KQM C;  1BR4 B;  3NXA A;  1A2X A;  2L4H A;  2L2C A;  1SPY A;  2BE6 A;  4GBA A;  1OW4 A; 
#chains in the Genus database with same CATH homology
 1JF0 A;  3CR4 X;  2JTZ A;  1DJI A;  4NQG A;  1F54 A;  2BBM A;  1J7P A;  1C7W A;  1YX7 A;  2LMV A;  1B7T Y;  1NP8 A;  1LIN A;  1EL4 A;  1M46 A;  2PSR A;  4MZL A;  4GGN A;  4HRE E;  4ORA B;  3KF9 A;  5J3X A;  2KOT A;  3OB2 B;  1WDC C;  2LVJ A;  2JT3 A;  4OKH A;  5DKR A;  1PVA A;  1LXF C;  1K90 D;  2IS9 A;  3H4S E;  1DGU A;  4I5N B;  5GQQ C;  2LP2 A;  4PE4 A;  2PRU A;  1IQ3 A;  1GJY A;  1ZMZ A;  5ER5 A;  4C0J A;  2WC8 A;  4MEW A;  1R2U A;  1G33 A;  2Y5I A;  3IF7 A;  2BL0 B;  1N0Y A;  4E68 A;  3CR2 A;  2HQ8 A;  2LP3 A;  2LVK A;  1G8I A;  1DJH A;  5JJG A;  3O78 A;  1KK8 B;  1UUS A;  1UWO A;  1XK4 C;  1RRO A;  4M2Q A;  4USL A;  1JWD A;  1DJW A;  3NSO A;  2MA2 A;  1K2H A;  3WHT B;  1JFK A;  1MHO A;  2FJU B;  1XO5 A;  2Q91 A;  1CLL A;  4PE1 A;  3OX5 A;  1B7T Z;  3BUW B;  3EKJ A;  1AVS A;  1Q80 A;  1QVI Y;  2ZND A;  5AEQ A;  1LA3 A;  3FWC A;  4N5X A;  5I2L A;  2PAS A;  5I2O A;  2LHL A;  1CMF A;  1RK9 A;  4GUK A;  4OR9 B;  4GAO A;  1IH0 A;  1SCM B;  1SRA A;  1RTP 1;  1WLZ A;  4NDB A;  5CPV A;  4GNK B;  1OSA A;  1MWN A;  4MSP A;  1J7Q A;  4YGC B;  1Y6W A;  2WCF A;  1CFF A;  1E8A A;  1XVJ A;  2KBI A;  2LC5 A;  1B47 A;  2KFH A;  3CR5 X;  1OMD A;  4C0L A;  1HQV A;  1FF1 A;  1R6P A;  2JU0 A;  1DMO A;  1MXL C;  1EG3 A;  3TUY B;  3VRQ A;  4MZK A;  1WRL A;  1S36 A;  1OMR A;  3NSK A;  2JRF A;  1FI6 A;  3DF0 A;  1CDP A;  2LAP A;  3WNX B;  3BUM B;  1FPW A;  5JOL A;  2WND A;  3PFV A;  4YI9 A;  4XJK B;  2ZKM X;  3OB1 B;  1QIW A;  2KI4 C;  2NZ0 A;  2KYF A;  1EH2 A;  4YBH B;  5I2Q A;  1RJV A;  4ZCU A;  2I2R E;  2LLS A;  1C07 A;  1PAL A;  3AAJ A;  2D8N A;  2PMY A;  3PAT A;  2JT0 A;  4I5L B;  3VGO A;  4XJK A;  2JUL A;  2LVV A;  2H61 A;  2KGR A;  3BUX B;  1TNP A;  4A4B A;  2OS8 C;  1KFU L;  1SYM A;  2LVI A;  4QJ3 B;  1F71 A;  4QJ5 B;  2KBM A;  2WOR A;  1OMV A;  4AQJ A;  2K2A A;  2ZNE A;  3KHE A;  1XFX O;  3K21 A;  2F33 A;  1CLM A;  1NUB A;  1OZS A;  1S5G Z;  5G08 A;  5AFP A;  1K95 A;  2JXL A;  2JT8 A;  2EC6 C;  4OCI A;  2CXJ A;  1UHJ A;  5CSI A;  1QX7 A;  2KHN A;  1HT9 A;  4BY4 A;  1XFY O;  5HKY A;  2OPO A;  2BCX A;  3I5H C;  4DUQ A;  1F8H A;  1OQP A;  1D1O A;  4WQ2 A;  1NX2 A;  2I94 A;  4DS7 A;  1V1G A;  1BLQ A;  4PDZ A;  2BCA A;  3VRO A;  1BG1 A;  1QLS A;  4MZJ A;  1ZUZ A;  3SG4 A;  3BOW B;  2JPT A;  1CMG A;  2M7N A;  1QXP A;  5K89 A;  1VRK A;  4JWQ A;  1H4B A;  1J7R A;  3OHM B;  2F3Z A;  1SR6 B;  1B9A A;  4M2O A;  2Y1N A;  1SL9 A;  2K7B A;  1TCO B;  5AER A;  3I5H B;  4N1F A;  1BOC A;  1AJ4 A;  5DKQ A;  4A4C A;  5BPJ A;  1EJ3 A;  5HYD A;  2OTG C;  5CSF A;  5ER4 X;  2M49 B;  2M97 A;  3SG5 A;  1CFC A;  3GK2 A;  2DOQ A;  3CGA A;  1K94 A;  2PAL A;  1QVI Z;  1S6C A;  1S3P A;  4MVF A;  1KWO C;  4F0Z B;  2AMI A;  2PVB A;  2TN4 A;  4DRW A;  1IKU A;  2KI6 D;  2MRD A;  3FIA A;  2KYC A;  1EXR A;  1F4Q A;  1G4Y R;  2E6W A;  3EKH A;  5I8N A;  3KPX A;  2LV7 A;  1NYA A;  2M3W A;  2LLU A;  1F55 A;  1M45 A;  1YVL A;  3JVT C;  3PLF B;  1TIZ A;  1DJY A;  1CB1 A;  1MQ1 A;  2LUX A;  2GV5 A;  3EVU A;  4C0K A;  4U8D A;  1LVC D;  1YUS A;  2K7C A;  1N65 A;  2LCP A;  1SR6 C;  4PE0 A;  1BJF A;  1W7I B;  2KSP A;  1UHI A;  1K8U A;  2MLF C;  4P2Y B;  2MLE C;  3GK4 X;  1K96 A;  1TNQ A;  1Y1A A;  1S1E A;  2OTG B;  2FOT A;  2M1K B;  3TZ1 A;  1KFX S;  2MHH A;  5AAN A;  1AJ5 A;  4YGA A;  3SG2 A;  4ETO A;  1SK6 D;  3AKA A;  2L4I A;  1KK7 Y;  1YVH A;  2KNE A;  4WRI A;  1J7O A;  1CLB A;  2CT9 A;  2JWW A;  1NCY A;  3RLZ A;  2L50 A;  1ALW A;  2F3Y A;  4YGE B;  2M0R A;  1KCY A;  3TS5 C;  1SL8 A;  1YX8 A;  3O4Y A;  2I18 A;  2CBL A;  3BOW A;  3ICB A;  1TNX A;  3F45 A;  4UPG A;  1CTR A;  1CNP A;  4TNC A;  1IRJ A;  2FCD A;  2L5X B;  3D0Y A;  1DF0 B;  3VRR A;  3I5F B;  1PUL A;  1S6J A;  3FWB A;  2A4J A;  1KWO B;  3RM1 A;  1PVB A;  2R2I A;  3E3R A;  4CLN A;  1S6I A;  5AXI A;  1IG5 A;  2L2E A;  1SKT A;  4HSZ A;  2ZRS A;  1OOJ A;  1OZO A;  1PK0 D;  4CID A;  1A75 B;  1QLK A;  1F70 A;  1DF0 A;  1XFU O;  2Y1M A;  1TN4 A;  4PHM A;  1DTL A;  4MBE A;  1A75 A;  4PHK A;  1CM4 A;  4HRG A;  2BCB A;  1JSA A;  1A4P A;  2CCM A;  1J1E A;  3EVR A;  3SG7 A;  4CFQ A;  1WRK A;  1V1F A;  2H2K A;  5HLO A;  3GOF A;  2K0J A;  3I5F C;  1M39 A;  3M0W A;  2ZRT A;  3LK0 A;  1XFZ O;  1YR5 A;  5KTY A;  3I5G B;  3NSL A;  5KU1 A;  5IBW A;  1NX3 A;  2AAO A;  3FS7 A;  2GGZ A;  1SCV A;  4OVN F;  1IWQ A;  2M7L A;  3DF0 B;  1B8C A;  2BBN A;  1DJX A;  1SY9 A;  3EVV A;  1QJT A;  1IQ5 A;  1NPQ A;  1YRT B;  3AAK A;  4ZCV A;  1AUI B;  1NX0 A;  3LL8 B;  2KQ6 A;  1BR1 B;  3HX4 A;  2NLN A;  1BF5 A;  2O5G A;  2Y4Q A;  1QTX A;  1LA0 A;  1L7Z A;  5B8I B;  4QJ4 B;  1QAT A;  4MLW A;  3BQ3 A;  5D7F A;  1TRF A;  4ICB A;  3PN7 C;  1J55 A;  5HKZ A;  1UUR A;  4Q04 A;  1XA5 A;  3NSI A;  4L9M A;  1F4O A;  2AUC A;  3CWG A;  1SBJ A;  1CKK A;  2BE4 A;  1SMG A;  2M8U A;  1NWD A;  1ZOT B;  2ZFD A;  2ZN8 A;  1CDN A;  4YGD B;  3OX6 A;  4XYN A;  1U5I B;  2BL0 C;  4ORB B;  1GGW A;  3BXK A;  1L2O B;  1AK8 A;  1TOP A;  1NSH A;  4OV2 A;  1B4C A;  5KSZ A;  2ZN9 A;  1M63 B;  3EK8 A;  3SG3 A;  1WY9 A;  4PCW A;  4ORC B;  4IL1 A;  1S5G Y;  2MAZ A;  3OP0 A;  3VRN A;  1UP5 A;  1Y1X A;  1K93 D;  1J1D A;  2M1U A;  4FQO A;  4FTG A;  1RFJ A;  2BEC A;  2KI4 B;  1IJ5 A;  1XYD A;  2KAV A;  2KFG A;  2VRG A;  3DVM A;  3CTN A;  3JVT B;  5HLV A;  2K7D A;  1CFP A;  1DVI A;  2L98 A;  1LKJ A;  1UHN A;  4NDD A;  1MF8 B;  4PHJ A;  2NCP A;  1QX2 A;  1NIW A;  2LMU A;  5D69 A;  1KK7 Z;  1PRW A;  2KGB C;  2ISD A;  3TS5 B;  1TNW A;  1JFJ A;  1AP4 A;  4D1E A;  3C1V A;  2O60 A;  2L0P A;  4YGB B;  1EG4 A;  3TDU A;  2KAY A;  3DVK A;  3CLN A;  1QV0 A;  4MRY A;  3PN7 B;  2KAX A;  1XFW O;  3GK1 A;  2F2O A;  1FI5 A;  2COL B;  1YRU B;  1YTZ C;  3MSE B;  2JZI A;  2HQW A;  2MBX A;  1DT7 B;  1JBA A;  3SIB A;  4GGF C;  4PE7 A;  1RWY A;  2BKI B;  2LHI A;  3KEV A;  1JUO A;  4AQI A;  2EGD A;  1KSM A;  2KQY A;  2G2B A;  4MN0 A;  1IGV A;  2RGI A;  3BYA A;  3I5I B;  2LLT A;  3TDZ A;  1JC2 A;  1A29 A;  2JTT A;  2K7O A;  1QX5 B;  4N1G A;  2GGM A;  2K2F A;  1KSO A;  3KO0 A;  2SCP A;  3D0Y B;  3AKB A;  2B1U A;  1SW8 A;  1WLM A;  1CFD A;  1QS7 A;  2JNF A;  2M9G A;  2K61 A;  1NCZ A;  5TNC A;  3TUY C;  2E30 A;  2JNX A;  3BUN B;  4PAL A;  2JOJ A;  1XFV O;  1ZAC A;  1KFU S;  3PAL A;  2L51 A;  2LM5 A;  1TTX A;  4I5K A;  4HRH A;  3A8R A;  1K9K A;  1QV1 A;  2K8M B;  2CNP A;  2KFF A;  1WDC B;  5CSN A;  1BOD A;  2NXQ A;  1SCM C;  2JQ6 A;  1BT6 A;  2I7A A;  3CZT X;  2KDH A;  3SG6 A;  2H61 C;  4BY5 A;  3WXA A;  2LE9 B;  1BMO A;  3O6B A;  1GGZ A;  4I5J A;  5DKN A;  1PSB A;  2WOS A;  2HF5 A;  1B8R A;  1A03 A;  3IQQ A;  1YUR A;  1UHH A;  2OS8 B;  1C7V A;  3LK1 A;  2P6B B;  1KFX L;  5PAL A;  3CS1 A;  1SNL A;  1WRZ A;  3DVJ A;  5FYX A;  2F8P A;  4GFT A;  4JPZ B;  1B1G A;  1CDM A;  1CM1 A;  2SAS A;  1QAS A;  1Y0V H;  1H8B A;  1NX1 A;  1DJG A;  2HET A;  1CDL A;  1DJZ A;  4JQ0 D;  3O2P A;  3IQO A;  4AOM A;  3EK7 A;  1TCF A;  2EHB A;  1YUT A;  3I5G C;  2LNK A;  1REC A;  1QIV A;  1U5I A;  2G9B A;  3HCM A;  4WQ3 A;  3D10 A;  1L2O C;  1N2D A;  2NCO A;  2F2P A;  3A4U B;  3JTD B;  1MXE A;  1ODB A;  2M29 A;  3I5I C;  3LLE A;  4MRX A;  1JF2 A;  1K9P A;  3ZNI A;  2JXC A;  4DIR A;  1MUX A;  3TDI A;  2WCE A;  3ZWH A;  3EK4 A;  2FCE A;  3SIA A;  3DD4 A;  1MR8 A;  1W7J B;  4M2P A;  1UHK A;  4CPV A;  1NCX A;  1DGV A;  2EC6 B;  1BU3 A;  1ALV A;  5F6T A;  1IJ6 A;  1AHR A;  1FW4 A;  1XK4 A;  2LAN A;  5CSJ A;  3PSR A;  1KQM B;  3QRX A;  4YRU A;  3DVE A;  3JTD C;  5HKW A;  2QPT A;  3VRP A;  1KK8 C;  4YI8 A;  4R1E A;  3LCP C;  2Q4U A;  1PSR A;  2QAC A;  1ZFS A;  1YUU A;  4GGF A;  4DCK A;  1S26 D;  2MJW B;  1X02 A;  4NDC A;  3PM8 A;  2BKH B;  3SJS A;  4P5O E;  1K9U A;  1B8L A;  4CFR A;  1GQM A;  2KI6 C;  2HPS A;  1FBV A;  2CTN A;  4GPL B;  1OE9 B;  2LMT A;  2V53 A;  2WCB A;  1Y1U A;  2JC2 A;  3WHU B;  1SL7 A;  1M31 A;  4PHN A;  1KQV A;  2LUC A;  1KQM C;  1BR4 B;  3NXA A;  1A2X A;  2L4H A;  1SPY A;  2BE6 A;  4GBA A;  3BUO B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...