1BODA

The solution structures of mutant calbindin d9k's, as determined by nmr, show that the calcium binding site can adopt different folds
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
74
structure length
74
Chain Sequence
MKSPEELKGIFEKYDKEGDGQLSKEELKLLLQTEFPSLLKGMSTLDELFEELDKNGDGEVSFEEFQVLVKKISQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CALBINDIN D9K
publication title The solution structures of mutant calbindin D9k's, as determined by NMR, show that the calcium-binding site can adopt different folds.
pubmed doi rcsb
source organism Bos taurus
molecule tags Calcium-binding protein
total genus 6
structure length 74
sequence length 74
ec nomenclature
pdb deposition date 1993-04-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1bodA00
1KK8C 1SMGA 2RGIA 2BCXA 2ZKMX 1EJ3A 2EGDA 3FS7A 1ZMZA 1J7PA 2QACA 2G9BA 1F54A 4DRWA 1CDMA 3TUYB 1SNLA 3CR4X 2EC6B 3CS1A 3KPXA 2LP2A 4NDDA 5I2QA 2PRUA 2WORA 1L7ZA 1DJHA 1DF0A 1SL8A 1UUSA 2LAPA 2MHHA 4OR9B 1KQVA 3PALA 3CLNA 1BT6A 2MLEC 2KBMA 2M3WA 1S5GY 1KQMC 2HPSA 3I5HB 2BKIB 1KFUL 2V53A 3I5IC 3KO0A 4MLWA 1B8LA 1PSBA 1UWOA 4PHKA 3DD4A 1A4PA 1NX3A 1ODBA 1Q80A 3C1VA 1IGVA 4CPVA 1CM1A 1S6CA 2BKHB 2F2OA 1AK8A 2BL0C 3PSRA 3BOWB 1TCFA 2JT8A 3IQQA 1J7OA 1BG1A 3FIAA 3AAKA 1HT9A 2FCDA 2BBNA 3GOFA 3JTDB 1GQMA 2NXQA 2PALA 5GQQC 1WRZA 1EH2A 1SCMC 3VRPA 4YI8A 3CR2A 2L51A 2BCBA 5AEQA 2HETA 2H2KA 1Y1XA 2M97A 2KQ6A 3KHEA 3SG4A 1CMFA 3O78A 1LINA 1M31A 4C0KA 1MXEA 1YTZC 2I7AA 1C7VA 1B8RA 2I2RE 1QIVA 4L9MA 1CLLA 1S26D 2LANA 1WDCC 4Q04A 2F8PA 3PATA 4MZKA 1DVIA 2GV5A 5DKQA 1MQ1A 2LMVA 3LK1A 4MEWA 2WCFA 1K2HA 1PULA 2KFHA 1FI5A 2F33A 3DVEA 2KI4B 2WCEA 4HRHA 4BY4A 1B7TY 2LUXA 5TNCA 3DF0A 1EG4A 1K9KA 4TNCA 4IL1A 4DUQA 4WQ2A 4M2PA 3VRNA 1DJIA 1IJ6A 1BF5A 1QATA 1BMOA 4MVFA 1NSHA 2M49B 1CTRA 3SIBA 1CDNA 1U5IA 1KWOB 4YI9A 4E68A 1ZACA 5F6TA 3K21A 3VRRA 2JWWA 2JRFA 2LMUA 2K2AA 1PK0D 1XFWO 4I5KA 5AANA 2CNPA 4C0JA 1M63B 2LMTA 4ZCVA 1M45A 4HREE 1TNPA 1TOPA 1AHRA 5D7FA 2K7CA 1EL4A 1SL9A 2ZN9A 3WHUB 1OSAA 4JPZB 3JVTC 1FPWA 1SCVA 1F4OA 1NCYA 2MAZA 2R2IA 3VGOA 1H8BA 4M2QA 3OB1B 1JFKA 1QS7A 2OTGB 2F2PA 2JU0A 3PFVA 3BUOB 4GGNA 3A8RA 1UHJA 4ORAB 2CBLA 1NX2A 3NXAA 4AOMA 4WRIA 5I2LA 1NCXA 1MHOA 3I5GB 1XK4C 2WC8A 2KAXA 1OOJA 3BOWA 4ORCB 2D8NA 3SG2A 2JULA 3SG7A 2Q4UA 1B9AA 4OKHA 1CMGA 1M46A 2SCPA 3HCMA 5IBWA 3D0YB 1ZFSA 2L98A 2L0PA 4YGBB 1OQPA 2NCOA 2KDHA 2TN4A 2L50A 3EVRA 1UHHA 2FJUB 2O60A 4PE1A 1KFXS 2KYCA 4YRUA 1CLBA 1MWNA 1JFJA 2HF5A 1CNPA 5AXIA 1SBJA 1U5IB 2DOQA 2JTTA 3LK0A 4MRYA 1XFZO 1YVLA 1WLZA 1H4BA 1EG3A 4MN0A 4YGEB 2OS8B 4ORBB 1FBVA 1NCZA 2Y1MA 1OZOA 3BUMB 5CPVA 4GFTA 4NQGA 5ER4X 1KK7Z 1XA5A 4WQ3A 3SIAA 2ZRTA 1IKUA 5ER5A 5J3XA 2WNDA 4PHNA 4D1EA 2KAVA 1DTLA 4FTGA 4JWQA 1NP8A 1E8AA 2I94A 2KSPA 1YX7A 3I5HC 3GK2A 4I5JA 1V1FA 4PDZA 3O4YA 3ICBA 2LHIA 2F3YA 2JXCA 2MA2A 3CR5X 4I5LB 1F71A 1NX1A 2KBIA 4BY5A 1CB1A 2LP3A 4GUKA 5CSJA 1B1GA 1J55A 4A4BA 1F8HA 1KQMB 1S6JA 4MZLA 3JTDC 2NCPA 1PSRA 3SG5A 4UPGA 1BOCA 4AQJA 3I5IB 1LKJA 1ZUZA 1WY9A 4I5NB 2K7DA 1RJVA 4AQIA 2JNXA 1QTXA 1CDLA 1DJGA 2M7NA 2LLSA 1IG5A 4XYNA 4GGFC 5DKRA 2M1KB 1NX0A 3EKHA 4P5OE 4YGCB 1V1GA 2BL0B 1JF0A 2JT3A 1C7WA 3F45A 1L2OB 4PHMA 5BPJA 5FYXA 5KSZA 2BECA 2ZRSA 1DT7B 1DJZA 4MSPA 1W7IB 1NIWA 1RTP1 1SKTA 2LLTA 2PASA 3DVJA 1KFXL 1SR6B 3TS5B 1BU3A 1DJYA 5HLOA 1PRWA 1RK9A 1SCMB 2KGBC 1QX2A 1IQ5A 1SK6D 3O2PA 1ALWA 3BXKA 4ETOA 2NLNA 5B8IB 1JUOA 1SW8A 2KOTA 2MRDA 4GBAA 3EVVA 1JWDA 1NYAA 1S6IA 3D0YA 1FF1A 1MR8A 1B4CA 2KI4C 2M8UA 4DIRA 1YX8A 2G2BA 1OMDA 2LM5A 1OE9B 4R1EA 1J7QA 3BQ3A 3TDZA 2MLFC 1NUBA 3KF9A 1QV1A 1XFUO 4PE7A 3TZ1A 2M9GA 2PMYA 1KWOC 2LNKA 1FW4A 4GAOA 3SJSA 1SPYA 1BLQA 1D1OA 1K8UA 1TRFA 2I18A 3SG3A 1Y0VH 1QX7A 3BUNB 1SYMA 1SL7A 2JNFA 2E30A 1IJ5A 4ICBA 5G08A 2CT9A 4YGDB 4N1GA 4JQ0D 4PE0A 3FWBA 1YRTB 3EVUA 2KI6D 1F70A 3WNXB 4FQOA 1YURA 1M39A 2WOSA 4USLA 1N65A 1YUTA 3CWGA 1XVJA 2KGRA 3LL8B 2K2FA 2AUCA 2LVJA 3OP0A 1JSAA 3NSKA 1KSOA 1QVIZ 2BE4A 2HQWA 2ZN8A 3OB2B 4GNKB 1AUIB 1MUXA 1IH0A 3I5FC 2QPTA 2LHLA 2LC5A 1J1DA 1XYDA 2VRGA 5CSIA 1K94A 2K7BA 1LXFC 5D69A 3HX4A 3DVKA 1K9PA 1IWQA 2EHBA 4NDCA 4U8DA 2K61A 4N1FA 1VRKA 2WCBA 1F4QA 5DKNA 1HQVA 2JZIA 5KTYA 2JPTA 1G4YR 3NSLA 1ALVA 1ZOTB 2L2EA 3E3RA 2LVIA 4MRXA 1BR4B 2M7LA 1G33A 2OS8C 3PN7B 1JBAA 4CLNA 3TUYC 4CFRA 1QXPA 2EC6C 1AJ4A 4QJ3B 1WRLA 3WXAA 2LVVA 5HKZA 1J1EA 4NDBA 1TCOB 3QRXA 1K90D 1CFPA 2L5XB 1QVIY 1R6PA 2FCEA 4YBHB 4MBEA 2JTZA 1IQ3A 3VROA 2AMIA 1KK8B 5AFPA 2M29A 2HQ8A 2PSRA 3BUXB 2F3ZA 1QV0A 1TIZA 1GGZA 3LLEA 1QIWA 2KI6C 2MBXA 5CSNA 1FI6A 3PM8A 3CZTX 1S3PA 1KCYA 1CLMA 1S1EA 2LLUA 1JF2A 1MF8B 1CM4A 3WHTB 1EXRA 1QJTA 2M1UA 1A75B 1CKKA 2K8MB 4QJ5B 1TNWA 2NZ0A 4PCWA 1K9UA 3TDIA 3ZWHA 2PVBA 3DVMA 2E6WA 1DGVA 2JQ6A 1B8CA 1KK7Y 2A4JA 3EK4A 5HKYA 1Y6WA 1TNQA 1F55A 2O5GA 4P2YB 1Y1AA 2Y1NA 2LCPA 1Y1UA 1L2OC 4OVNF 1XFXO 3LCPC 1UP5A 1CDPA 1DJWA 1QLKA 3A4UB 3KEVA 1B7TZ 1YR5A 1SR6C 4HSZA 4OV2A 1K95A 2ISDA 1A2XA 4MZJA 3TS5C 1OMVA 1YUUA 1GJYA 1RFJA 1UHIA 1MXLC 2JT0A 2L4HA 4XJKB 3TDUA 3MSEB 1DGUA 2B1UA 3BYAA 3SG6A 1RWYA 2OPOA 1RECA 1OZSA 2K7OA 2KFGA 2Q91A 5I2OA 2AAOA 1PALA 5HKWA 4GPLB 2LUCA 1R2UA 1SY9A 4ZCUA 3IQOA 4CFQA 1WDCB 3ZNIA 1S36A 1DF0B 3NSOA 5PALA 1WLMA 1OMRA 1GGWA 1G8IA 1XK4A 2LVKA 3OX6A 3AAJA 4DS7A 3EKJA 2H61A 2ZFDA 3CGAA 3GK4X 1UHNA 2KNEA 1PVBA 2KQYA 2Y5IA 4PHJA 4N5XA 3RM1A 2COLB 2K0JA 5K89A 5HLVA 4QJ4B 1QX5B 1DMOA 5I8NA 1LA3A 5AERA 2CCMA 3EK8A 1K96A 4OCIA 2CTNA 1TNXA 3H4SE 1XFYO 3O6BA 2JOJA 2Y4QA 3NSIA 1KSMA 2BBMA 2GGZA 4HRGA 2OTGC 1K93D 3PLFB 4C0LA 2ZNEA 1KFUS 1CFCA 4CIDA 3AKBA 1SRAA 1XO5A 2L4IA 1LVCD 3I5GC 1CFDA 1X02A 2KAYA 1NWDA 1DJXA 3EK7A 2JXLA 4DCKA 1QASA 5HYDA 2GGMA 1B47A 1TN4A 1LA0A 3JVTB 1A03A 1PVAA 1NPQA 1W7JB 2CXJA 2KHNA 5CSFA 1A29A 1N0YA 4PALA 1A75A 1BR1B 1RROA 5JJGA 3IF7A 2ZNDA 3VRQA 5KU1A 1IRJA 2KFFA 4F0ZB 2FOTA 2KYFA 2SASA 3OHMB 3CTNA 1J7RA 1AP4A 1C07A 1XFVO 4A4CA 1UHKA 4YGAA 1YVHA 2JC2A 1AVSA 1S5GZ 3AKAA 3D10A 3I5FB 4PE4A 1BODA 1CFFA 2LV7A 5JOLA 4M2OA 2H61C 3OX5A 3PN7C 2MJWB 3FWCA 1BJFA 2IS9A 1YUSA 3DF0B 1UURA 3BUWB 3GK1A 1AJ5A 2M0RA 3M0WA 1WRKA 2P6BB 1QLSA 1JC2A 1N2DA 2BE6A 1YRUB 4XJKA 1TTXA 3RLZA 2BCAA 4GGFA 2LE9B
chains in the Genus database with same CATH superfamily
1KK8C 1DELA 1SMGA 2BCXA 2RGIA 2ZKMX 1EJ3A 2EGDA 3FS7A 1ZMZA 1J7PA 2QACA 2G9BA 1F54A 4DRWA 4PHJA 3B88A 1CDMA 3D73A 1SNLA 3CR4X 3TUYB 2EC6B 2H8VA 3CS1A 3KPXA 2LP2A 4NDDA 5I2QA 2PRUA 2WORA 1L7ZA 3UNWA 1DJHA 1DC1A 2PQLA 1DF0A 1SL8A 1UUSA 2LAPA 2MHHA 4OR9B 1KQVA 2QDIA 3CLNA 3PALA 1BT6A 2MLEC 2KBMA 2M3WA 1S5GY 1KQMC 2HPSA 3I5HB 2BKIB 1KFUL 2V53A 3I5IC 3KO0A 4KYNA 4MLWA 1B8LA 1PSBA 1UWOA 4PHKA 3DD4A 1A4PA 1NX3A 1ODBA 1Q80A 3C1VA 1IGVA 4CPVA 1CM1A 1S6CA 2BKHB 2F2OA 1AK8A 2BL0C 3PSRA 3BOWB 1TCFA 2JT8A 3IQQA 1TWOA 1J7OA 1BG1A 3CABA 3FIAA 3AAKA 1HT9A 2FCDA 2BBNA 3GOFA 3JTDB 1GQMA 2NXQA 2PALA 3DZTA 1WRZA 5GQQC 1EH2A 1SCMC 3VRPA 2K60A 4YI8A 3CR2A 2L51A 3S0FA 2BCBA 5AEQA 1OOIX 2HETA 2H2KA 1Y1XA 2M97A 2KQ6A 3KHEA 3SG4A 1CMFA 3O78A 1LINA 1M31A 4C0KA 1MXEA 1YTZC 2I7AA 2P70A 1C7VA 1B8RA 2I2RE 1QIVA 4L9MA 1CLLA 1S26D 2LANA 1WDCC 4Q04A 2F8PA 3PATA 4MZKA 1DVIA 2GV5A 5DKQA 1MQ1A 3OGNA 2KLEA 2LMVA 3LK1A 4MEWA 2WCFA 1K2HA 1PULA 2KFHA 1FI5A 2F33A 3DVEA 2KI4B 2WCEA 4HRHA 4BY4A 1B7TY 2LUXA 2BAPA 5TNCA 3DF0A 1EG4A 1K9KA 4TNCA 4IJ7A 4IL1A 4DUQA 2BNXA 3O4XA 1OOGA 4WQ2A 4M2PA 3VRNA 1DJIA 1IJ6A 1BF5A 1QATA 1BMOA 4MVFA 1NSHA 2M49B 1CTRA 3SIBA 1CDNA 1U5IA 3R72A 1Z4HA 1KWOB 3BFAA 2QEVA 4YI9A 4E68A 1ZACA 5F6TA 3K21A 3VRRA 2JWWA 2JRFA 2LMUA 2K2AA 1PK0D 1XFWO 4I5KA 5AANA 2CNPA 4C0JA 1M63B 3D75A 2LMTA 4ZCVA 1M45A 4HREE 1TNPA 1TOPA 1AHRA 3PJIA 5D7FA 2K7CA 1EL4A 1SL9A 2ZN9A 3WHUB 1OSAA 4JPZB 3JVTC 1FPWA 1SCVA 3UO9A 1F4OA 1NCYA 2MAZA 2R2IA 3VGOA 1H8BA 4M2QA 3OB1B 1JFKA 1QS7A 2OTGB 2F2PA 2JU0A 3PFVA 3BUOB 4GGNA 3A8RA 1UHJA 2PYQA 2CBLA 4ORAB 1NX2A 3NXAA 4AOMA 4WRIA 5I2LA 1NCXA 1MHOA 3I5GB 1XK4C 2WC8A 2KAXA 1OOJA 3BOWA 4ORCB 2D8NA 3SG2A 2JULA 3SG7A 2Q4UA 1B9AA 4OKHA 5DICA 1M46A 2SCPA 3V2LA 3B6XA 3HCMA 5IBWA 2WCJA 3D0YB 1ZFSA 3D74A 4F7FA 2L98A 2L0PA 4YGBB 1OQPA 2NCOA 2KDHA 2TN4A 1DEKA 2L50A 3EVRA 1UHHA 2FJUB 2O60A 4PE1A 1KFXS 2KYCA 4YRUA 1CLBA 1MWNA 1JFJA 2HF5A 1CNPA 5AXIA 1SBJA 1U5IB 2QEHA 2DOQA 2JTTA 3LK0A 4MRYA 1XFZO 1YVLA 1WLZA 1H4BA 1EG3A 3CDNA 4MN0A 3BFBA 4YGEB 2OS8B 4ORBB 1FBVA 1NCZA 2Y1MA 1OZOA 3BUMB 5CPVA 4INWA 4GFTA 4NQGA 5ER4X 1KK7Z 4JKTA 1XA5A 4WQ3A 4PT1A 3SIAA 2ZRTA 1IKUA 5ER5A 5J3XA 2WNDA 4PHNA 3CZ1A 2KAVA 1DTLA 4FTGA 4JWQA 4D1EA 1NP8A 1E8AA 2I94A 2KSPA 1YX7A 3I5HC 3GK2A 4I5JA 3RZSA 1V1FA 4PDZA 5HL1A 3O4YA 3ICBA 2LHIA 2F3YA 2JXCA 2MA2A 3CR5X 4I5LB 1F71A 1NX1A 3DYEA 2KBIA 4BY5A 1CB1A 2LP3A 4GUKA 5CSJA 1B1GA 3Q8IA 1J55A 4A4BA 1F8HA 1KQMB 1S6JA 3S0AA 4MZLA 3JTDC 2NCPA 1PSRA 3SG5A 4UPGA 1BOCA 3CYZA 4AQJA 5EL2A 3I5IB 1LKJA 1ZUZA 1WY9A 4I5NB 2K7DA 1RJVA 4AQIA 2JNXA 1QTXA 1CDLA 1DJGA 2M7NA 2LLSA 3PM2A 1IG5A 4XYNA 4GGFC 5DKRA 2M1KB 1NX0A 3EKHA 2WCKA 4P5OE 4YGCB 1V1GA 1JF0A 2BL0B 2JT3A 1C7WA 3F45A 1L2OB 4PHMA 5BPJA 5FYXA 5KSZA 2BECA 2ZRSA 1DT7B 1DJZA 4MSPA 1W7IB 1NIWA 1RTP1 1SKTA 2LLTA 2PASA 2WC5A 3DVJA 1KFXL 1SR6B 3TS5B 1BU3A 3NHIA 1DJYA 1T14A 5HLOA 1PRWA 1RK9A 1SCMB 3SS3A 2KGBC 1QX2A 1IQ5A 1SK6D 3O2PA 1ALWA 3B87A 3BXKA 3FE8A 4ETOA 2NLNA 2QEOA 3FE6A 5B8IB 1JUOA 1SW8A 2KOTA 2MRDA 4GBAA 3EVVA 1JWDA 1QWVA 1NYAA 1S6IA 4JD9A 3D0YA 1FF1A 1MR8A 1B4CA 2KI4C 2M8UA 2WC6A 4DIRA 3OBVA 1YX8A 2G2BA 1OMDA 2L5YA 2LM5A 3FE9A 1OE9B 4R1EA 1J7QA 3BQ3A 3TDZA 2MLFC 1NUBA 1XFRA 3KF9A 1QV1A 1XFUO 4PE7A 3SS4A 3TZ1A 2M9GA 2PMYA 1KWOC 2LNKA 1FW4A 4GAOA 3SJSA 1SPYA 1BLQA 1D1OA 3S0BA 1K8UA 3L47A 1TRFA 2I18A 3SG3A 1Y0VH 1QX7A 3BUNB 4OZDA 1SYMA 1C3YA 1SL7A 2JNFA 2E30A 3B86A 1IJ5A 4ICBA 5G08A 2CT9A 3K1EA 4YGDB 4N1GA 4JQ0D 4PE0A 3FWBA 1YRTB 3EVUA 2QEBA 2KI6D 1F70A 3WNXB 4FQOA 1YURA 1M39A 5FI6A 2WOSA 4USLA 3DY9A 1N65A 1YUTA 3D78A 3CWGA 1XVJA 2KGRA 3LL8B 2K2FA 2AUCA 2LVJA 3OP0A 1JSAA 3NSKA 1KSOA 1W9ZA 1QVIZ 2BE4A 2HQWA 2ZN8A 3OB2B 1OW4A 1AUIB 4GNKB 1MUXA 1IH0A 3DXLA 3I5FC 2QPTA 3CZ0A 2LHLA 2LC5A 1J1DA 1GM0A 1XYDA 3S0DA 2VRGA 5CSIA 1K94A 2K7BA 1LXFC 5D69A 3HX4A 3DVKA 1K9PA 1CMGA 1IWQA 2EHBA 4NDCA 4U8DA 2K61A 1DQEA 4N1FA 1VRKA 2WCBA 1F4QA 5DKNA 1HQVA 2JZIA 5KTYA 2JPTA 1G4YR 3NSLA 1ALVA 1ZOTB 2L2EA 3E3RA 2LVIA 4MRXA 1BR4B 2M7LA 1G33A 2OS8C 3PN7B 2WCMA 1JBAA 4CLNA 3TUYC 4CFRA 1QXPA 2EC6C 2ERBA 1AJ4A 4QJ3B 1WRLA 3WXAA 2LVVA 5HKZA 1J1EA 4NDBA 1TCOB 3QRXA 1K90D 2L2CA 1CFPA 2L5XB 1QVIY 1R6PA 2FCEA 4YBHB 4MBEA 2JTZA 1IQ3A 3VROA 2AMIA 1KK8B 5AFPA 2M29A 2HQ8A 2PSRA 3BUXB 2F3ZA 1QV0A 1TIZA 1GGZA 3EG5B 3LLEA 1QIWA 3R1PA 1IIOA 2KI6C 1ORGA 3IVTA 5CSNA 2MBXA 1FI6A 3R1VA 3PM8A 3CZTX 5D3OA 1S3PA 1KCYA 1CLMA 1OOHA 1S1EA 1P28A 1JF2A 2LLUA 1MF8B 1CM4A 2YGUA 1EXRA 4FQTA 3WHTB 1QJTA 2M1UA 1A75B 1CKKA 2K8MB 4QJ5B 1TNWA 2NZ0A 4PCWA 1K9UA 3TDIA 2KPHA 3N7HA 3ZWHA 2PVBA 3DVMA 2E6WA 1DGVA 2JQ6A 1B8CA 1KK7Y 2A4JA 3EK4A 3S0EA 5HKYA 1Y6WA 1TNQA 1F55A 2O5GA 4P2YB 1OOFA 1Y1AA 3SS5A 2Y1NA 2LCPA 1Y1UA 1L2OC 4OVNF 1XFXO 3LCPC 2KLDA 1UP5A 1CDPA 1DJWA 1QLKA 3A4UB 3KEVA 1B7TZ 1YR5A 1SR6C 4HSZA 4OV2A 1K95A 2FJYA 1A2XA 3D76A 4MZJA 2ISDA 3TS5C 1OMVA 1YUUA 1GJYA 3QMEA 1RFJA 1UHIA 1MXLC 2JT0A 2L4HA 4XJKB 3TDUA 3MSEB 1DGUA 2B1UA 3BYAA 3VB1A 3L4LA 3SG6A 1RWYA 2OPOA 1RECA 1OZSA 2K7OA 2KFGA 2Q91A 5I2OA 2AAOA 1PALA 5HKWA 4GPLB 2LUCA 1R2UA 1SY9A 4ZCUA 3IQOA 4CFQA 3CZ2A 1WDCB 3ZNIA 1S36A 1DF0B 2WCHA 3NSOA 5PALA 1WLMA 1OMRA 3BFHA 2P71A 1GGWA 1G8IA 1XK4A 2LVKA 3OX6A 2GTEA 3AAJA 4DS7A 3EKJA 1Z2CB 2H61A 2ZFDA 3CGAA 1UHNA 2KNEA 1PVBA 2KQYA 2Y5IA 3GK4X 3NGVA 4N5XA 1TUZA 3RM1A 2COLB 2K0JA 5K89A 5HLVA 4QJ4B 1QX5B 1DMOA 3L4AA 1LA3A 5I8NA 5AERA 2CCMA 3EK8A 1K96A 2WCLA 4OCIA 2CTNA 1TNXA 3H4SE 5I94A 1XFYO 3O6BA 2JOJA 2Y4QA 3NSIA 5FI2A 1KSMA 2BBMA 2GGZA 4HRGA 1LS8A 2OTGC 1K93D 3PLFB 4C0LA 2ZNEA 1KFUS 1CFCA 4CIDA 3B7AA 3AKBA 1SRAA 1XO5A 2L4IA 1LVCD 3I5GC 1CFDA 1X02A 2KAYA 1NWDA 1DJXA 3EK7A 2JPOA 2JXLA 4DCKA 1QASA 5HYDA 2GGMA 1B47A 1TN4A 1LA0A 1C3ZA 3JVTB 1A03A 1PVAA 1NPQA 1W7JB 2CXJA 2KHNA 5CSFA 1A29A 1N0YA 4PALA 1A75A 1BR1B 1RROA 5JJGA 3IF7A 2ZNDA 3VRQA 5FI7A 3BJHA 3R1OA 5KU1A 1IRJA 2KFFA 4F0ZB 2FOTA 2KYFA 2SASA 3OHMB 3CTNA 1J7RA 1AP4A 1C07A 1XFVO 4A4CA 1UHKA 4YGAA 1YVHA 2JC2A 1AVSA 1S5GZ 3AKAA 3D10A 3I5FB 4PE4A 1BODA 1CFFA 2LV7A 1SSEB 5JOLA 4M2OA 2H61C 3OX5A 3PN7C 4INXA 2MJWB 3D77A 1TUJA 3FWCA 1BJFA 2IS9A 1YUSA 3DF0B 1UURA 3BUWB 3GK1A 1AJ5A 2M0RA 3M0WA 1WRKA 2P6BB 1QLSA 1JC2A 1N2DA 2BE6A 1YRUB 4XJKA 1TTXA 3RLZA 2BCAA 3S0GA 4GGFA 3NHTA 2LE9B
chains in the Genus database with same CATH topology
1KK8C 1SMGA 2RGIA 2BCXA 2ZKMX 1EJ3A 2EGDA 3FS7A 1ZMZA 1J7PA 2QACA 2G9BA 1F54A 4DRWA 1CDMA 3TUYB 1SNLA 3CR4X 2EC6B 3CS1A 3KPXA 2LP2A 4NDDA 5I2QA 2PRUA 2WORA 1L7ZA 1DJHA 1DF0A 1SL8A 1UUSA 2LAPA 2MHHA 4OR9B 1KQVA 3PALA 3CLNA 1BT6A 2MLEC 2KBMA 2M3WA 1S5GY 1KQMC 2HPSA 3I5HB 2BKIB 1KFUL 2V53A 3I5IC 3KO0A 4MLWA 1B8LA 1PSBA 1UWOA 4PHKA 3DD4A 1A4PA 1NX3A 1ODBA 1Q80A 3C1VA 1IGVA 4CPVA 1CM1A 1S6CA 2BKHB 2F2OA 1AK8A 2BL0C 3PSRA 3BOWB 1TCFA 2JT8A 3IQQA 1J7OA 1BG1A 3FIAA 3AAKA 1HT9A 2FCDA 2BBNA 3GOFA 3JTDB 1GQMA 2NXQA 2PALA 5GQQC 1WRZA 1EH2A 1SCMC 3VRPA 4YI8A 3CR2A 2L51A 2BCBA 5AEQA 2HETA 2H2KA 1Y1XA 2M97A 2KQ6A 3KHEA 3SG4A 1CMFA 3O78A 1LINA 1M31A 4C0KA 1MXEA 1YTZC 2I7AA 1C7VA 1B8RA 2I2RE 1QIVA 4L9MA 1CLLA 1S26D 2LANA 1WDCC 4Q04A 2F8PA 3PATA 4MZKA 1DVIA 2GV5A 5DKQA 1MQ1A 2LMVA 3LK1A 4MEWA 2WCFA 1K2HA 1PULA 2KFHA 1FI5A 2F33A 3DVEA 2KI4B 2WCEA 4HRHA 4BY4A 1B7TY 2LUXA 5TNCA 3DF0A 1EG4A 1K9KA 4TNCA 4IL1A 4DUQA 4WQ2A 4M2PA 3VRNA 1DJIA 1IJ6A 1BF5A 1QATA 1BMOA 4MVFA 1NSHA 2M49B 1CTRA 3SIBA 1CDNA 1U5IA 1KWOB 4YI9A 4E68A 1ZACA 5F6TA 3K21A 3VRRA 2JWWA 2JRFA 2LMUA 2K2AA 1PK0D 1XFWO 4I5KA 5AANA 2CNPA 4C0JA 1M63B 2LMTA 4ZCVA 1M45A 4HREE 1TNPA 1TOPA 1AHRA 5D7FA 2K7CA 1EL4A 1SL9A 2ZN9A 3WHUB 1OSAA 4JPZB 3JVTC 1FPWA 1SCVA 1F4OA 1NCYA 2MAZA 2R2IA 3VGOA 1H8BA 4M2QA 3OB1B 1JFKA 1QS7A 2OTGB 2F2PA 2JU0A 3PFVA 3BUOB 4GGNA 3A8RA 1UHJA 4ORAB 2CBLA 1NX2A 3NXAA 4AOMA 4WRIA 5I2LA 1NCXA 1MHOA 3I5GB 1XK4C 2WC8A 2KAXA 1OOJA 3BOWA 4ORCB 2D8NA 3SG2A 2JULA 3SG7A 2Q4UA 1B9AA 4OKHA 1CMGA 1M46A 2SCPA 3HCMA 5IBWA 3D0YB 1ZFSA 2L98A 2L0PA 4YGBB 1OQPA 2NCOA 2KDHA 2TN4A 2L50A 3EVRA 1UHHA 2FJUB 2O60A 4PE1A 1KFXS 2KYCA 4YRUA 1CLBA 1MWNA 1JFJA 2HF5A 1CNPA 5AXIA 1SBJA 1U5IB 2DOQA 2JTTA 3LK0A 4MRYA 1XFZO 1YVLA 1WLZA 1H4BA 1EG3A 4MN0A 4YGEB 2OS8B 4ORBB 1FBVA 1NCZA 2Y1MA 1OZOA 3BUMB 5CPVA 4GFTA 4NQGA 5ER4X 1KK7Z 1XA5A 4WQ3A 3SIAA 2ZRTA 1IKUA 5ER5A 5J3XA 2WNDA 4PHNA 4D1EA 2KAVA 1DTLA 4FTGA 4JWQA 1NP8A 1E8AA 2I94A 2KSPA 1YX7A 3I5HC 3GK2A 4I5JA 1V1FA 4PDZA 3O4YA 3ICBA 2LHIA 2F3YA 2JXCA 2MA2A 3CR5X 4I5LB 1F71A 1NX1A 2KBIA 4BY5A 1CB1A 2LP3A 4GUKA 5CSJA 1B1GA 1J55A 4A4BA 1F8HA 1KQMB 1S6JA 4MZLA 3JTDC 2NCPA 1PSRA 3SG5A 4UPGA 1BOCA 4AQJA 3I5IB 1LKJA 1ZUZA 1WY9A 4I5NB 2K7DA 1RJVA 4AQIA 2JNXA 1QTXA 1CDLA 1DJGA 2M7NA 2LLSA 1IG5A 4XYNA 4GGFC 5DKRA 2M1KB 1NX0A 3EKHA 4P5OE 4YGCB 1V1GA 2BL0B 1JF0A 2JT3A 1C7WA 3F45A 1L2OB 4PHMA 5BPJA 5FYXA 5KSZA 2BECA 2ZRSA 1DT7B 1DJZA 4MSPA 1W7IB 1NIWA 1RTP1 1SKTA 2LLTA 2PASA 3DVJA 1KFXL 1SR6B 3TS5B 1BU3A 1DJYA 5HLOA 1PRWA 1RK9A 1SCMB 2KGBC 1QX2A 1IQ5A 1SK6D 3O2PA 1ALWA 3BXKA 4ETOA 2NLNA 5B8IB 1JUOA 1SW8A 2KOTA 2MRDA 4GBAA 3EVVA 1JWDA 1NYAA 1S6IA 3D0YA 1FF1A 1MR8A 1B4CA 2KI4C 2M8UA 4DIRA 1YX8A 2G2BA 1OMDA 2LM5A 1OE9B 4R1EA 1J7QA 3BQ3A 3TDZA 2MLFC 1NUBA 3KF9A 1QV1A 1XFUO 4PE7A 3TZ1A 2M9GA 2PMYA 1KWOC 2LNKA 1FW4A 4GAOA 3SJSA 1SPYA 1BLQA 1D1OA 1K8UA 1TRFA 2I18A 3SG3A 1Y0VH 1QX7A 3BUNB 1SYMA 1SL7A 2JNFA 2E30A 1IJ5A 4ICBA 5G08A 2CT9A 4YGDB 4N1GA 4JQ0D 4PE0A 3FWBA 1YRTB 3EVUA 2KI6D 1F70A 3WNXB 4FQOA 1YURA 1M39A 2WOSA 4USLA 1N65A 1YUTA 3CWGA 1XVJA 2KGRA 3LL8B 2K2FA 2AUCA 2LVJA 3OP0A 1JSAA 3NSKA 1KSOA 1QVIZ 2BE4A 2HQWA 2ZN8A 3OB2B 4GNKB 1AUIB 1MUXA 1IH0A 3I5FC 2QPTA 2LHLA 2LC5A 1J1DA 1XYDA 2VRGA 5CSIA 1K94A 2K7BA 1LXFC 5D69A 3HX4A 3DVKA 1K9PA 1IWQA 2EHBA 4NDCA 4U8DA 2K61A 4N1FA 1VRKA 2WCBA 1F4QA 5DKNA 1HQVA 2JZIA 5KTYA 2JPTA 1G4YR 3NSLA 1ALVA 1ZOTB 2L2EA 3E3RA 2LVIA 4MRXA 1BR4B 2M7LA 1G33A 2OS8C 3PN7B 1JBAA 4CLNA 3TUYC 4CFRA 1QXPA 2EC6C 1AJ4A 4QJ3B 1WRLA 3WXAA 2LVVA 5HKZA 1J1EA 4NDBA 1TCOB 3QRXA 1K90D 1CFPA 2L5XB 1QVIY 1R6PA 2FCEA 4YBHB 4MBEA 2JTZA 1IQ3A 3VROA 2AMIA 1KK8B 5AFPA 2M29A 2HQ8A 2PSRA 3BUXB 2F3ZA 1QV0A 1TIZA 1GGZA 3LLEA 1QIWA 2KI6C 2MBXA 5CSNA 1FI6A 3PM8A 3CZTX 1S3PA 1KCYA 1CLMA 1S1EA 2LLUA 1JF2A 1MF8B 1CM4A 3WHTB 1EXRA 1QJTA 2M1UA 1A75B 1CKKA 2K8MB 4QJ5B 1TNWA 2NZ0A 4PCWA 1K9UA 3TDIA 3ZWHA 2PVBA 3DVMA 2E6WA 1DGVA 2JQ6A 1B8CA 1KK7Y 2A4JA 3EK4A 5HKYA 1Y6WA 1TNQA 1F55A 2O5GA 4P2YB 1Y1AA 2Y1NA 2LCPA 1Y1UA 1L2OC 4OVNF 1XFXO 3LCPC 1UP5A 1CDPA 1DJWA 1QLKA 3A4UB 3KEVA 1B7TZ 1YR5A 1SR6C 4HSZA 4OV2A 1K95A 2ISDA 1A2XA 4MZJA 3TS5C 1OMVA 1YUUA 1GJYA 1RFJA 1UHIA 1MXLC 2JT0A 2L4HA 4XJKB 3TDUA 3MSEB 1DGUA 2B1UA 3BYAA 3SG6A 1RWYA 2OPOA 1RECA 1OZSA 2K7OA 2KFGA 2Q91A 5I2OA 2AAOA 1PALA 5HKWA 4GPLB 2LUCA 1R2UA 1SY9A 4ZCUA 3IQOA 4CFQA 1WDCB 3ZNIA 1S36A 1DF0B 3NSOA 5PALA 1WLMA 1OMRA 1GGWA 1G8IA 1XK4A 2LVKA 3OX6A 3AAJA 4DS7A 3EKJA 2H61A 2ZFDA 3CGAA 3GK4X 1UHNA 2KNEA 1PVBA 2KQYA 2Y5IA 4PHJA 4N5XA 3RM1A 2COLB 2K0JA 5K89A 5HLVA 4QJ4B 1QX5B 1DMOA 5I8NA 1LA3A 5AERA 2CCMA 3EK8A 1K96A 4OCIA 2CTNA 1TNXA 3H4SE 1XFYO 3O6BA 2JOJA 2Y4QA 3NSIA 1KSMA 2BBMA 2GGZA 4HRGA 2OTGC 1K93D 3PLFB 4C0LA 2ZNEA 1KFUS 1CFCA 4CIDA 3AKBA 1SRAA 1XO5A 2L4IA 1LVCD 3I5GC 1CFDA 1X02A 2KAYA 1NWDA 1DJXA 3EK7A 2JXLA 4DCKA 1QASA 5HYDA 2GGMA 1B47A 1TN4A 1LA0A 3JVTB 1A03A 1PVAA 1NPQA 1W7JB 2CXJA 2KHNA 5CSFA 1A29A 1N0YA 4PALA 1A75A 1BR1B 1RROA 5JJGA 3IF7A 2ZNDA 3VRQA 5KU1A 1IRJA 2KFFA 4F0ZB 2FOTA 2KYFA 2SASA 3OHMB 3CTNA 1J7RA 1AP4A 1C07A 1XFVO 4A4CA 1UHKA 4YGAA 1YVHA 2JC2A 1AVSA 1S5GZ 3AKAA 3D10A 3I5FB 4PE4A 1BODA 1CFFA 2LV7A 5JOLA 4M2OA 2H61C 3OX5A 3PN7C 2MJWB 3FWCA 1BJFA 2IS9A 1YUSA 3DF0B 1UURA 3BUWB 3GK1A 1AJ5A 2M0RA 3M0WA 1WRKA 2P6BB 1QLSA 1JC2A 1N2DA 2BE6A 1YRUB 4XJKA 1TTXA 3RLZA 2BCAA 4GGFA 2LE9B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KK8 C;  1SMG A;  2RGI A;  2BCX A;  2ZKM X;  1EJ3 A;  2EGD A;  3FS7 A;  1ZMZ A;  1J7P A;  2QAC A;  2G9B A;  1F54 A;  4DRW A;  1CDM A;  3TUY B;  1SNL A;  3CR4 X;  2EC6 B;  3CS1 A;  3KPX A;  2LP2 A;  4NDD A;  5I2Q A;  2PRU A;  2WOR A;  1L7Z A;  1DJH A;  1DF0 A;  1SL8 A;  1UUS A;  2LAP A;  2MHH A;  4OR9 B;  1KQV A;  3PAL A;  3CLN A;  1BT6 A;  2MLE C;  2KBM A;  2M3W A;  1S5G Y;  1KQM C;  2HPS A;  3I5H B;  2BKI B;  1KFU L;  2V53 A;  3I5I C;  3KO0 A;  4MLW A;  1B8L A;  1PSB A;  1UWO A;  4PHK A;  3DD4 A;  1A4P A;  1NX3 A;  1ODB A;  1Q80 A;  3C1V A;  1IGV A;  4CPV A;  1CM1 A;  1S6C A;  2BKH B;  2F2O A;  1AK8 A;  2BL0 C;  3PSR A;  3BOW B;  1TCF A;  2JT8 A;  3IQQ A;  1J7O A;  1BG1 A;  3FIA A;  3AAK A;  1HT9 A;  2FCD A;  2BBN A;  3GOF A;  3JTD B;  1GQM A;  2NXQ A;  2PAL A;  5GQQ C;  1WRZ A;  1EH2 A;  1SCM C;  3VRP A;  4YI8 A;  3CR2 A;  2L51 A;  2BCB A;  5AEQ A;  2HET A;  2H2K A;  1Y1X A;  2M97 A;  2KQ6 A;  3KHE A;  3SG4 A;  1CMF A;  3O78 A;  1LIN A;  1M31 A;  4C0K A;  1MXE A;  1YTZ C;  2I7A A;  1C7V A;  1B8R A;  2I2R E;  1QIV A;  4L9M A;  1CLL A;  1S26 D;  2LAN A;  1WDC C;  4Q04 A;  2F8P A;  3PAT A;  4MZK A;  1DVI A;  2GV5 A;  5DKQ A;  1MQ1 A;  2LMV A;  3LK1 A;  4MEW A;  2WCF A;  1K2H A;  1PUL A;  2KFH A;  1FI5 A;  2F33 A;  3DVE A;  2KI4 B;  2WCE A;  4HRH A;  4BY4 A;  1B7T Y;  2LUX A;  5TNC A;  3DF0 A;  1EG4 A;  1K9K A;  4TNC A;  4IL1 A;  4DUQ A;  4WQ2 A;  4M2P A;  3VRN A;  1DJI A;  1IJ6 A;  1BF5 A;  1QAT A;  1BMO A;  4MVF A;  1NSH A;  2M49 B;  1CTR A;  3SIB A;  1CDN A;  1U5I A;  1KWO B;  4YI9 A;  4E68 A;  1ZAC A;  5F6T A;  3K21 A;  3VRR A;  2JWW A;  2JRF A;  2LMU A;  2K2A A;  1PK0 D;  1XFW O;  4I5K A;  5AAN A;  2CNP A;  4C0J A;  1M63 B;  2LMT A;  4ZCV A;  1M45 A;  4HRE E;  1TNP A;  1TOP A;  1AHR A;  5D7F A;  2K7C A;  1EL4 A;  1SL9 A;  2ZN9 A;  3WHU B;  1OSA A;  4JPZ B;  3JVT C;  1FPW A;  1SCV A;  1F4O A;  1NCY A;  2MAZ A;  2R2I A;  3VGO A;  1H8B A;  4M2Q A;  3OB1 B;  1JFK A;  1QS7 A;  2OTG B;  2F2P A;  2JU0 A;  3PFV A;  3BUO B;  4GGN A;  3A8R A;  1UHJ A;  4ORA B;  2CBL A;  1NX2 A;  3NXA A;  4AOM A;  4WRI A;  5I2L A;  1NCX A;  1MHO A;  3I5G B;  1XK4 C;  2WC8 A;  2KAX A;  1OOJ A;  3BOW A;  4ORC B;  2D8N A;  3SG2 A;  2JUL A;  3SG7 A;  2Q4U A;  1B9A A;  4OKH A;  1CMG A;  1M46 A;  2SCP A;  3HCM A;  5IBW A;  3D0Y B;  1ZFS A;  2L98 A;  2L0P A;  4YGB B;  1OQP A;  2NCO A;  2KDH A;  2TN4 A;  2L50 A;  3EVR A;  1UHH A;  2FJU B;  2O60 A;  4PE1 A;  1KFX S;  2KYC A;  4YRU A;  1CLB A;  1MWN A;  1JFJ A;  2HF5 A;  1CNP A;  5AXI A;  1SBJ A;  1U5I B;  2DOQ A;  2JTT A;  3LK0 A;  4MRY A;  1XFZ O;  1YVL A;  1WLZ A;  1H4B A;  1EG3 A;  4MN0 A;  4YGE B;  2OS8 B;  4ORB B;  1FBV A;  1NCZ A;  2Y1M A;  1OZO A;  3BUM B;  5CPV A;  4GFT A;  4NQG A;  5ER4 X;  1KK7 Z;  1XA5 A;  4WQ3 A;  3SIA A;  2ZRT A;  1IKU A;  5ER5 A;  5J3X A;  2WND A;  4PHN A;  4D1E A;  2KAV A;  1DTL A;  4FTG A;  4JWQ A;  1NP8 A;  1E8A A;  2I94 A;  2KSP A;  1YX7 A;  3I5H C;  3GK2 A;  4I5J A;  1V1F A;  4PDZ A;  3O4Y A;  3ICB A;  2LHI A;  2F3Y A;  2JXC A;  2MA2 A;  3CR5 X;  4I5L B;  1F71 A;  1NX1 A;  2KBI A;  4BY5 A;  1CB1 A;  2LP3 A;  4GUK A;  5CSJ A;  1B1G A;  1J55 A;  4A4B A;  1F8H A;  1KQM B;  1S6J A;  4MZL A;  3JTD C;  2NCP A;  1PSR A;  3SG5 A;  4UPG A;  1BOC A;  4AQJ A;  3I5I B;  1LKJ A;  1ZUZ A;  1WY9 A;  4I5N B;  2K7D A;  1RJV A;  4AQI A;  2JNX A;  1QTX A;  1CDL A;  1DJG A;  2M7N A;  2LLS A;  1IG5 A;  4XYN A;  4GGF C;  5DKR A;  2M1K B;  1NX0 A;  3EKH A;  4P5O E;  4YGC B;  1V1G A;  2BL0 B;  1JF0 A;  2JT3 A;  1C7W A;  3F45 A;  1L2O B;  4PHM A;  5BPJ A;  5FYX A;  5KSZ A;  2BEC A;  2ZRS A;  1DT7 B;  1DJZ A;  4MSP A;  1W7I B;  1NIW A;  1RTP 1;  1SKT A;  2LLT A;  2PAS A;  3DVJ A;  1KFX L;  1SR6 B;  3TS5 B;  1BU3 A;  1DJY A;  5HLO A;  1PRW A;  1RK9 A;  1SCM B;  2KGB C;  1QX2 A;  1IQ5 A;  1SK6 D;  3O2P A;  1ALW A;  3BXK A;  4ETO A;  2NLN A;  5B8I B;  1JUO A;  1SW8 A;  2KOT A;  2MRD A;  4GBA A;  3EVV A;  1JWD A;  1NYA A;  1S6I A;  3D0Y A;  1FF1 A;  1MR8 A;  1B4C A;  2KI4 C;  2M8U A;  4DIR A;  1YX8 A;  2G2B A;  1OMD A;  2LM5 A;  1OE9 B;  4R1E A;  1J7Q A;  3BQ3 A;  3TDZ A;  2MLF C;  1NUB A;  3KF9 A;  1QV1 A;  1XFU O;  4PE7 A;  3TZ1 A;  2M9G A;  2PMY A;  1KWO C;  2LNK A;  1FW4 A;  4GAO A;  3SJS A;  1SPY A;  1BLQ A;  1D1O A;  1K8U A;  1TRF A;  2I18 A;  3SG3 A;  1Y0V H;  1QX7 A;  3BUN B;  1SYM A;  1SL7 A;  2JNF A;  2E30 A;  1IJ5 A;  4ICB A;  5G08 A;  2CT9 A;  4YGD B;  4N1G A;  4JQ0 D;  4PE0 A;  3FWB A;  1YRT B;  3EVU A;  2KI6 D;  1F70 A;  3WNX B;  4FQO A;  1YUR A;  1M39 A;  2WOS A;  4USL A;  1N65 A;  1YUT A;  3CWG A;  1XVJ A;  2KGR A;  3LL8 B;  2K2F A;  2AUC A;  2LVJ A;  3OP0 A;  1JSA A;  3NSK A;  1KSO A;  1QVI Z;  2BE4 A;  2HQW A;  2ZN8 A;  3OB2 B;  4GNK B;  1AUI B;  1MUX A;  1IH0 A;  3I5F C;  2QPT A;  2LHL A;  2LC5 A;  1J1D A;  1XYD A;  2VRG A;  5CSI A;  1K94 A;  2K7B A;  1LXF C;  5D69 A;  3HX4 A;  3DVK A;  1K9P A;  1IWQ A;  2EHB A;  4NDC A;  4U8D A;  2K61 A;  4N1F A;  1VRK A;  2WCB A;  1F4Q A;  5DKN A;  1HQV A;  2JZI A;  5KTY A;  2JPT A;  1G4Y R;  3NSL A;  1ALV A;  1ZOT B;  2L2E A;  3E3R A;  2LVI A;  4MRX A;  1BR4 B;  2M7L A;  1G33 A;  2OS8 C;  3PN7 B;  1JBA A;  4CLN A;  3TUY C;  4CFR A;  1QXP A;  2EC6 C;  1AJ4 A;  4QJ3 B;  1WRL A;  3WXA A;  2LVV A;  5HKZ A;  1J1E A;  4NDB A;  1TCO B;  3QRX A;  1K90 D;  1CFP A;  2L5X B;  1QVI Y;  1R6P A;  2FCE A;  4YBH B;  4MBE A;  2JTZ A;  1IQ3 A;  3VRO A;  2AMI A;  1KK8 B;  5AFP A;  2M29 A;  2HQ8 A;  2PSR A;  3BUX B;  2F3Z A;  1QV0 A;  1TIZ A;  1GGZ A;  3LLE A;  1QIW A;  2KI6 C;  2MBX A;  5CSN A;  1FI6 A;  3PM8 A;  3CZT X;  1S3P A;  1KCY A;  1CLM A;  1S1E A;  2LLU A;  1JF2 A;  1MF8 B;  1CM4 A;  3WHT B;  1EXR A;  1QJT A;  2M1U A;  1A75 B;  1CKK A;  2K8M B;  4QJ5 B;  1TNW A;  2NZ0 A;  4PCW A;  1K9U A;  3TDI A;  3ZWH A;  2PVB A;  3DVM A;  2E6W A;  1DGV A;  2JQ6 A;  1B8C A;  1KK7 Y;  2A4J A;  3EK4 A;  5HKY A;  1Y6W A;  1TNQ A;  1F55 A;  2O5G A;  4P2Y B;  1Y1A A;  2Y1N A;  2LCP A;  1Y1U A;  1L2O C;  4OVN F;  1XFX O;  3LCP C;  1UP5 A;  1CDP A;  1DJW A;  1QLK A;  3A4U B;  3KEV A;  1B7T Z;  1YR5 A;  1SR6 C;  4HSZ A;  4OV2 A;  1K95 A;  2ISD A;  1A2X A;  4MZJ A;  3TS5 C;  1OMV A;  1YUU A;  1GJY A;  1RFJ A;  1UHI A;  1MXL C;  2JT0 A;  2L4H A;  4XJK B;  3TDU A;  3MSE B;  1DGU A;  2B1U A;  3BYA A;  3SG6 A;  1RWY A;  2OPO A;  1REC A;  1OZS A;  2K7O A;  2KFG A;  2Q91 A;  5I2O A;  2AAO A;  1PAL A;  5HKW A;  4GPL B;  2LUC A;  1R2U A;  1SY9 A;  4ZCU A;  3IQO A;  4CFQ A;  1WDC B;  3ZNI A;  1S36 A;  1DF0 B;  3NSO A;  5PAL A;  1WLM A;  1OMR A;  1GGW A;  1G8I A;  1XK4 A;  2LVK A;  3OX6 A;  3AAJ A;  4DS7 A;  3EKJ A;  2H61 A;  2ZFD A;  3CGA A;  3GK4 X;  1UHN A;  2KNE A;  1PVB A;  2KQY A;  2Y5I A;  4PHJ A;  4N5X A;  3RM1 A;  2COL B;  2K0J A;  5K89 A;  5HLV A;  4QJ4 B;  1QX5 B;  1DMO A;  5I8N A;  1LA3 A;  5AER A;  2CCM A;  3EK8 A;  1K96 A;  4OCI A;  2CTN A;  1TNX A;  3H4S E;  1XFY O;  3O6B A;  2JOJ A;  2Y4Q A;  3NSI A;  1KSM A;  2BBM A;  2GGZ A;  4HRG A;  2OTG C;  1K93 D;  3PLF B;  4C0L A;  2ZNE A;  1KFU S;  1CFC A;  4CID A;  3AKB A;  1SRA A;  1XO5 A;  2L4I A;  1LVC D;  3I5G C;  1CFD A;  1X02 A;  2KAY A;  1NWD A;  1DJX A;  3EK7 A;  2JXL A;  4DCK A;  1QAS A;  5HYD A;  2GGM A;  1B47 A;  1TN4 A;  1LA0 A;  3JVT B;  1A03 A;  1PVA A;  1NPQ A;  1W7J B;  2CXJ A;  2KHN A;  5CSF A;  1A29 A;  1N0Y A;  4PAL A;  1A75 A;  1BR1 B;  1RRO A;  5JJG A;  3IF7 A;  2ZND A;  3VRQ A;  5KU1 A;  1IRJ A;  2KFF A;  4F0Z B;  2FOT A;  2KYF A;  2SAS A;  3OHM B;  3CTN A;  1J7R A;  1AP4 A;  1C07 A;  1XFV O;  4A4C A;  1UHK A;  4YGA A;  1YVH A;  2JC2 A;  1AVS A;  1S5G Z;  3AKA A;  3D10 A;  3I5F B;  4PE4 A;  1BOD A;  1CFF A;  2LV7 A;  5JOL A;  4M2O A;  2H61 C;  3OX5 A;  3PN7 C;  2MJW B;  3FWC A;  1BJF A;  2IS9 A;  1YUS A;  3DF0 B;  1UUR A;  3BUW B;  3GK1 A;  1AJ5 A;  2M0R A;  3M0W A;  1WRK A;  2P6B B;  1QLS A;  1JC2 A;  1N2D A;  2BE6 A;  1YRU B;  4XJK A;  1TTX A;  3RLZ A;  2BCA A;  4GGF A;  2LE9 B; 
#chains in the Genus database with same CATH topology
 1KK8 C;  1DEL A;  1SMG A;  2BCX A;  2RGI A;  2ZKM X;  1EJ3 A;  2EGD A;  3FS7 A;  1ZMZ A;  1J7P A;  2QAC A;  2G9B A;  1F54 A;  4DRW A;  4PHJ A;  3B88 A;  1CDM A;  3D73 A;  1SNL A;  3CR4 X;  3TUY B;  2EC6 B;  2H8V A;  3CS1 A;  3KPX A;  2LP2 A;  4NDD A;  5I2Q A;  2PRU A;  2WOR A;  1L7Z A;  3UNW A;  1DJH A;  1DC1 A;  2PQL A;  1DF0 A;  1SL8 A;  1UUS A;  2LAP A;  2MHH A;  4OR9 B;  1KQV A;  2QDI A;  3CLN A;  3PAL A;  1BT6 A;  2MLE C;  2KBM A;  2M3W A;  1S5G Y;  1KQM C;  2HPS A;  3I5H B;  2BKI B;  1KFU L;  2V53 A;  3I5I C;  3KO0 A;  4KYN A;  4MLW A;  1B8L A;  1PSB A;  1UWO A;  4PHK A;  3DD4 A;  1A4P A;  1NX3 A;  1ODB A;  1Q80 A;  3C1V A;  1IGV A;  4CPV A;  1CM1 A;  1S6C A;  2BKH B;  2F2O A;  1AK8 A;  2BL0 C;  3PSR A;  3BOW B;  1TCF A;  2JT8 A;  3IQQ A;  1TWO A;  1J7O A;  1BG1 A;  3CAB A;  3FIA A;  3AAK A;  1HT9 A;  2FCD A;  2BBN A;  3GOF A;  3JTD B;  1GQM A;  2NXQ A;  2PAL A;  3DZT A;  1WRZ A;  5GQQ C;  1EH2 A;  1SCM C;  3VRP A;  2K60 A;  4YI8 A;  3CR2 A;  2L51 A;  3S0F A;  2BCB A;  5AEQ A;  1OOI X;  2HET A;  2H2K A;  1Y1X A;  2M97 A;  2KQ6 A;  3KHE A;  3SG4 A;  1CMF A;  3O78 A;  1LIN A;  1M31 A;  4C0K A;  1MXE A;  1YTZ C;  2I7A A;  2P70 A;  1C7V A;  1B8R A;  2I2R E;  1QIV A;  4L9M A;  1CLL A;  1S26 D;  2LAN A;  1WDC C;  4Q04 A;  2F8P A;  3PAT A;  4MZK A;  1DVI A;  2GV5 A;  5DKQ A;  1MQ1 A;  3OGN A;  2KLE A;  2LMV A;  3LK1 A;  4MEW A;  2WCF A;  1K2H A;  1PUL A;  2KFH A;  1FI5 A;  2F33 A;  3DVE A;  2KI4 B;  2WCE A;  4HRH A;  4BY4 A;  1B7T Y;  2LUX A;  2BAP A;  5TNC A;  3DF0 A;  1EG4 A;  1K9K A;  4TNC A;  4IJ7 A;  4IL1 A;  4DUQ A;  2BNX A;  3O4X A;  1OOG A;  4WQ2 A;  4M2P A;  3VRN A;  1DJI A;  1IJ6 A;  1BF5 A;  1QAT A;  1BMO A;  4MVF A;  1NSH A;  2M49 B;  1CTR A;  3SIB A;  1CDN A;  1U5I A;  3R72 A;  1Z4H A;  1KWO B;  3BFA A;  2QEV A;  4YI9 A;  4E68 A;  1ZAC A;  5F6T A;  3K21 A;  3VRR A;  2JWW A;  2JRF A;  2LMU A;  2K2A A;  1PK0 D;  1XFW O;  4I5K A;  5AAN A;  2CNP A;  4C0J A;  1M63 B;  3D75 A;  2LMT A;  4ZCV A;  1M45 A;  4HRE E;  1TNP A;  1TOP A;  1AHR A;  3PJI A;  5D7F A;  2K7C A;  1EL4 A;  1SL9 A;  2ZN9 A;  3WHU B;  1OSA A;  4JPZ B;  3JVT C;  1FPW A;  1SCV A;  3UO9 A;  1F4O A;  1NCY A;  2MAZ A;  2R2I A;  3VGO A;  1H8B A;  4M2Q A;  3OB1 B;  1JFK A;  1QS7 A;  2OTG B;  2F2P A;  2JU0 A;  3PFV A;  3BUO B;  4GGN A;  3A8R A;  1UHJ A;  2PYQ A;  2CBL A;  4ORA B;  1NX2 A;  3NXA A;  4AOM A;  4WRI A;  5I2L A;  1NCX A;  1MHO A;  3I5G B;  1XK4 C;  2WC8 A;  2KAX A;  1OOJ A;  3BOW A;  4ORC B;  2D8N A;  3SG2 A;  2JUL A;  3SG7 A;  2Q4U A;  1B9A A;  4OKH A;  5DIC A;  1M46 A;  2SCP A;  3V2L A;  3B6X A;  3HCM A;  5IBW A;  2WCJ A;  3D0Y B;  1ZFS A;  3D74 A;  4F7F A;  2L98 A;  2L0P A;  4YGB B;  1OQP A;  2NCO A;  2KDH A;  2TN4 A;  1DEK A;  2L50 A;  3EVR A;  1UHH A;  2FJU B;  2O60 A;  4PE1 A;  1KFX S;  2KYC A;  4YRU A;  1CLB A;  1MWN A;  1JFJ A;  2HF5 A;  1CNP A;  5AXI A;  1SBJ A;  1U5I B;  2QEH A;  2DOQ A;  2JTT A;  3LK0 A;  4MRY A;  1XFZ O;  1YVL A;  1WLZ A;  1H4B A;  1EG3 A;  3CDN A;  4MN0 A;  3BFB A;  4YGE B;  2OS8 B;  4ORB B;  1FBV A;  1NCZ A;  2Y1M A;  1OZO A;  3BUM B;  5CPV A;  4INW A;  4GFT A;  4NQG A;  5ER4 X;  1KK7 Z;  4JKT A;  1XA5 A;  4WQ3 A;  4PT1 A;  3SIA A;  2ZRT A;  1IKU A;  5ER5 A;  5J3X A;  2WND A;  4PHN A;  3CZ1 A;  2KAV A;  1DTL A;  4FTG A;  4JWQ A;  4D1E A;  1NP8 A;  1E8A A;  2I94 A;  2KSP A;  1YX7 A;  3I5H C;  3GK2 A;  4I5J A;  3RZS A;  1V1F A;  4PDZ A;  5HL1 A;  3O4Y A;  3ICB A;  2LHI A;  2F3Y A;  2JXC A;  2MA2 A;  3CR5 X;  4I5L B;  1F71 A;  1NX1 A;  3DYE A;  2KBI A;  4BY5 A;  1CB1 A;  2LP3 A;  4GUK A;  5CSJ A;  1B1G A;  3Q8I A;  1J55 A;  4A4B A;  1F8H A;  1KQM B;  1S6J A;  3S0A A;  4MZL A;  3JTD C;  2NCP A;  1PSR A;  3SG5 A;  4UPG A;  1BOC A;  3CYZ A;  4AQJ A;  5EL2 A;  3I5I B;  1LKJ A;  1ZUZ A;  1WY9 A;  4I5N B;  2K7D A;  1RJV A;  4AQI A;  2JNX A;  1QTX A;  1CDL A;  1DJG A;  2M7N A;  2LLS A;  3PM2 A;  1IG5 A;  4XYN A;  4GGF C;  5DKR A;  2M1K B;  1NX0 A;  3EKH A;  2WCK A;  4P5O E;  4YGC B;  1V1G A;  1JF0 A;  2BL0 B;  2JT3 A;  1C7W A;  3F45 A;  1L2O B;  4PHM A;  5BPJ A;  5FYX A;  5KSZ A;  2BEC A;  2ZRS A;  1DT7 B;  1DJZ A;  4MSP A;  1W7I B;  1NIW A;  1RTP 1;  1SKT A;  2LLT A;  2PAS A;  2WC5 A;  3DVJ A;  1KFX L;  1SR6 B;  3TS5 B;  1BU3 A;  3NHI A;  1DJY A;  1T14 A;  5HLO A;  1PRW A;  1RK9 A;  1SCM B;  3SS3 A;  2KGB C;  1QX2 A;  1IQ5 A;  1SK6 D;  3O2P A;  1ALW A;  3B87 A;  3BXK A;  3FE8 A;  4ETO A;  2NLN A;  2QEO A;  3FE6 A;  5B8I B;  1JUO A;  1SW8 A;  2KOT A;  2MRD A;  4GBA A;  3EVV A;  1JWD A;  1QWV A;  1NYA A;  1S6I A;  4JD9 A;  3D0Y A;  1FF1 A;  1MR8 A;  1B4C A;  2KI4 C;  2M8U A;  2WC6 A;  4DIR A;  3OBV A;  1YX8 A;  2G2B A;  1OMD A;  2L5Y A;  2LM5 A;  3FE9 A;  1OE9 B;  4R1E A;  1J7Q A;  3BQ3 A;  3TDZ A;  2MLF C;  1NUB A;  1XFR A;  3KF9 A;  1QV1 A;  1XFU O;  4PE7 A;  3SS4 A;  3TZ1 A;  2M9G A;  2PMY A;  1KWO C;  2LNK A;  1FW4 A;  4GAO A;  3SJS A;  1SPY A;  1BLQ A;  1D1O A;  3S0B A;  1K8U A;  3L47 A;  1TRF A;  2I18 A;  3SG3 A;  1Y0V H;  1QX7 A;  3BUN B;  4OZD A;  1SYM A;  1C3Y A;  1SL7 A;  2JNF A;  2E30 A;  3B86 A;  1IJ5 A;  4ICB A;  5G08 A;  2CT9 A;  3K1E A;  4YGD B;  4N1G A;  4JQ0 D;  4PE0 A;  3FWB A;  1YRT B;  3EVU A;  2QEB A;  2KI6 D;  1F70 A;  3WNX B;  4FQO A;  1YUR A;  1M39 A;  5FI6 A;  2WOS A;  4USL A;  3DY9 A;  1N65 A;  1YUT A;  3D78 A;  3CWG A;  1XVJ A;  2KGR A;  3LL8 B;  2K2F A;  2AUC A;  2LVJ A;  3OP0 A;  1JSA A;  3NSK A;  1KSO A;  1W9Z A;  1QVI Z;  2BE4 A;  2HQW A;  2ZN8 A;  3OB2 B;  1OW4 A;  1AUI B;  4GNK B;  1MUX A;  1IH0 A;  3DXL A;  3I5F C;  2QPT A;  3CZ0 A;  2LHL A;  2LC5 A;  1J1D A;  1GM0 A;  1XYD A;  3S0D A;  2VRG A;  5CSI A;  1K94 A;  2K7B A;  1LXF C;  5D69 A;  3HX4 A;  3DVK A;  1K9P A;  1CMG A;  1IWQ A;  2EHB A;  4NDC A;  4U8D A;  2K61 A;  1DQE A;  4N1F A;  1VRK A;  2WCB A;  1F4Q A;  5DKN A;  1HQV A;  2JZI A;  5KTY A;  2JPT A;  1G4Y R;  3NSL A;  1ALV A;  1ZOT B;  2L2E A;  3E3R A;  2LVI A;  4MRX A;  1BR4 B;  2M7L A;  1G33 A;  2OS8 C;  3PN7 B;  2WCM A;  1JBA A;  4CLN A;  3TUY C;  4CFR A;  1QXP A;  2EC6 C;  2ERB A;  1AJ4 A;  4QJ3 B;  1WRL A;  3WXA A;  2LVV A;  5HKZ A;  1J1E A;  4NDB A;  1TCO B;  3QRX A;  1K90 D;  2L2C A;  1CFP A;  2L5X B;  1QVI Y;  1R6P A;  2FCE A;  4YBH B;  4MBE A;  2JTZ A;  1IQ3 A;  3VRO A;  2AMI A;  1KK8 B;  5AFP A;  2M29 A;  2HQ8 A;  2PSR A;  3BUX B;  2F3Z A;  1QV0 A;  1TIZ A;  1GGZ A;  3EG5 B;  3LLE A;  1QIW A;  3R1P A;  1IIO A;  2KI6 C;  1ORG A;  3IVT A;  5CSN A;  2MBX A;  1FI6 A;  3R1V A;  3PM8 A;  3CZT X;  5D3O A;  1S3P A;  1KCY A;  1CLM A;  1OOH A;  1S1E A;  1P28 A;  1JF2 A;  2LLU A;  1MF8 B;  1CM4 A;  2YGU A;  1EXR A;  4FQT A;  3WHT B;  1QJT A;  2M1U A;  1A75 B;  1CKK A;  2K8M B;  4QJ5 B;  1TNW A;  2NZ0 A;  4PCW A;  1K9U A;  3TDI A;  2KPH A;  3N7H A;  3ZWH A;  2PVB A;  3DVM A;  2E6W A;  1DGV A;  2JQ6 A;  1B8C A;  1KK7 Y;  2A4J A;  3EK4 A;  3S0E A;  5HKY A;  1Y6W A;  1TNQ A;  1F55 A;  2O5G A;  4P2Y B;  1OOF A;  1Y1A A;  3SS5 A;  2Y1N A;  2LCP A;  1Y1U A;  1L2O C;  4OVN F;  1XFX O;  3LCP C;  2KLD A;  1UP5 A;  1CDP A;  1DJW A;  1QLK A;  3A4U B;  3KEV A;  1B7T Z;  1YR5 A;  1SR6 C;  4HSZ A;  4OV2 A;  1K95 A;  2FJY A;  1A2X A;  3D76 A;  4MZJ A;  2ISD A;  3TS5 C;  1OMV A;  1YUU A;  1GJY A;  3QME A;  1RFJ A;  1UHI A;  1MXL C;  2JT0 A;  2L4H A;  4XJK B;  3TDU A;  3MSE B;  1DGU A;  2B1U A;  3BYA A;  3VB1 A;  3L4L A;  3SG6 A;  1RWY A;  2OPO A;  1REC A;  1OZS A;  2K7O A;  2KFG A;  2Q91 A;  5I2O A;  2AAO A;  1PAL A;  5HKW A;  4GPL B;  2LUC A;  1R2U A;  1SY9 A;  4ZCU A;  3IQO A;  4CFQ A;  3CZ2 A;  1WDC B;  3ZNI A;  1S36 A;  1DF0 B;  2WCH A;  3NSO A;  5PAL A;  1WLM A;  1OMR A;  3BFH A;  2P71 A;  1GGW A;  1G8I A;  1XK4 A;  2LVK A;  3OX6 A;  2GTE A;  3AAJ A;  4DS7 A;  3EKJ A;  1Z2C B;  2H61 A;  2ZFD A;  3CGA A;  1UHN A;  2KNE A;  1PVB A;  2KQY A;  2Y5I A;  3GK4 X;  3NGV A;  4N5X A;  1TUZ A;  3RM1 A;  2COL B;  2K0J A;  5K89 A;  5HLV A;  4QJ4 B;  1QX5 B;  1DMO A;  3L4A A;  1LA3 A;  5I8N A;  5AER A;  2CCM A;  3EK8 A;  1K96 A;  2WCL A;  4OCI A;  2CTN A;  1TNX A;  3H4S E;  5I94 A;  1XFY O;  3O6B A;  2JOJ A;  2Y4Q A;  3NSI A;  5FI2 A;  1KSM A;  2BBM A;  2GGZ A;  4HRG A;  1LS8 A;  2OTG C;  1K93 D;  3PLF B;  4C0L A;  2ZNE A;  1KFU S;  1CFC A;  4CID A;  3B7A A;  3AKB A;  1SRA A;  1XO5 A;  2L4I A;  1LVC D;  3I5G C;  1CFD A;  1X02 A;  2KAY A;  1NWD A;  1DJX A;  3EK7 A;  2JPO A;  2JXL A;  4DCK A;  1QAS A;  5HYD A;  2GGM A;  1B47 A;  1TN4 A;  1LA0 A;  1C3Z A;  3JVT B;  1A03 A;  1PVA A;  1NPQ A;  1W7J B;  2CXJ A;  2KHN A;  5CSF A;  1A29 A;  1N0Y A;  4PAL A;  1A75 A;  1BR1 B;  1RRO A;  5JJG A;  3IF7 A;  2ZND A;  3VRQ A;  5FI7 A;  3BJH A;  3R1O A;  5KU1 A;  1IRJ A;  2KFF A;  4F0Z B;  2FOT A;  2KYF A;  2SAS A;  3OHM B;  3CTN A;  1J7R A;  1AP4 A;  1C07 A;  1XFV O;  4A4C A;  1UHK A;  4YGA A;  1YVH A;  2JC2 A;  1AVS A;  1S5G Z;  3AKA A;  3D10 A;  3I5F B;  4PE4 A;  1BOD A;  1CFF A;  2LV7 A;  1SSE B;  5JOL A;  4M2O A;  2H61 C;  3OX5 A;  3PN7 C;  4INX A;  2MJW B;  3D77 A;  1TUJ A;  3FWC A;  1BJF A;  2IS9 A;  1YUS A;  3DF0 B;  1UUR A;  3BUW B;  3GK1 A;  1AJ5 A;  2M0R A;  3M0W A;  1WRK A;  2P6B B;  1QLS A;  1JC2 A;  1N2D A;  2BE6 A;  1YRU B;  4XJK A;  1TTX A;  3RLZ A;  2BCA A;  3S0G A;  4GGF A;  3NHT A;  2LE9 B; 
#chains in the Genus database with same CATH homology
 1KK8 C;  1SMG A;  2RGI A;  2BCX A;  2ZKM X;  1EJ3 A;  2EGD A;  3FS7 A;  1ZMZ A;  1J7P A;  2QAC A;  2G9B A;  1F54 A;  4DRW A;  1CDM A;  3TUY B;  1SNL A;  3CR4 X;  2EC6 B;  3CS1 A;  3KPX A;  2LP2 A;  4NDD A;  5I2Q A;  2PRU A;  2WOR A;  1L7Z A;  1DJH A;  1DF0 A;  1SL8 A;  1UUS A;  2LAP A;  2MHH A;  4OR9 B;  1KQV A;  3PAL A;  3CLN A;  1BT6 A;  2MLE C;  2KBM A;  2M3W A;  1S5G Y;  1KQM C;  2HPS A;  3I5H B;  2BKI B;  1KFU L;  2V53 A;  3I5I C;  3KO0 A;  4MLW A;  1B8L A;  1PSB A;  1UWO A;  4PHK A;  3DD4 A;  1A4P A;  1NX3 A;  1ODB A;  1Q80 A;  3C1V A;  1IGV A;  4CPV A;  1CM1 A;  1S6C A;  2BKH B;  2F2O A;  1AK8 A;  2BL0 C;  3PSR A;  3BOW B;  1TCF A;  2JT8 A;  3IQQ A;  1J7O A;  1BG1 A;  3FIA A;  3AAK A;  1HT9 A;  2FCD A;  2BBN A;  3GOF A;  3JTD B;  1GQM A;  2NXQ A;  2PAL A;  5GQQ C;  1WRZ A;  1EH2 A;  1SCM C;  3VRP A;  4YI8 A;  3CR2 A;  2L51 A;  2BCB A;  5AEQ A;  2HET A;  2H2K A;  1Y1X A;  2M97 A;  2KQ6 A;  3KHE A;  3SG4 A;  1CMF A;  3O78 A;  1LIN A;  1M31 A;  4C0K A;  1MXE A;  1YTZ C;  2I7A A;  1C7V A;  1B8R A;  2I2R E;  1QIV A;  4L9M A;  1CLL A;  1S26 D;  2LAN A;  1WDC C;  4Q04 A;  2F8P A;  3PAT A;  4MZK A;  1DVI A;  2GV5 A;  5DKQ A;  1MQ1 A;  2LMV A;  3LK1 A;  4MEW A;  2WCF A;  1K2H A;  1PUL A;  2KFH A;  1FI5 A;  2F33 A;  3DVE A;  2KI4 B;  2WCE A;  4HRH A;  4BY4 A;  1B7T Y;  2LUX A;  5TNC A;  3DF0 A;  1EG4 A;  1K9K A;  4TNC A;  4IL1 A;  4DUQ A;  4WQ2 A;  4M2P A;  3VRN A;  1DJI A;  1IJ6 A;  1BF5 A;  1QAT A;  1BMO A;  4MVF A;  1NSH A;  2M49 B;  1CTR A;  3SIB A;  1CDN A;  1U5I A;  1KWO B;  4YI9 A;  4E68 A;  1ZAC A;  5F6T A;  3K21 A;  3VRR A;  2JWW A;  2JRF A;  2LMU A;  2K2A A;  1PK0 D;  1XFW O;  4I5K A;  5AAN A;  2CNP A;  4C0J A;  1M63 B;  2LMT A;  4ZCV A;  1M45 A;  4HRE E;  1TNP A;  1TOP A;  1AHR A;  5D7F A;  2K7C A;  1EL4 A;  1SL9 A;  2ZN9 A;  3WHU B;  1OSA A;  4JPZ B;  3JVT C;  1FPW A;  1SCV A;  1F4O A;  1NCY A;  2MAZ A;  2R2I A;  3VGO A;  1H8B A;  4M2Q A;  3OB1 B;  1JFK A;  1QS7 A;  2OTG B;  2F2P A;  2JU0 A;  3PFV A;  3BUO B;  4GGN A;  3A8R A;  1UHJ A;  4ORA B;  2CBL A;  1NX2 A;  3NXA A;  4AOM A;  4WRI A;  5I2L A;  1NCX A;  1MHO A;  3I5G B;  1XK4 C;  2WC8 A;  2KAX A;  1OOJ A;  3BOW A;  4ORC B;  2D8N A;  3SG2 A;  2JUL A;  3SG7 A;  2Q4U A;  1B9A A;  4OKH A;  1CMG A;  1M46 A;  2SCP A;  3HCM A;  5IBW A;  3D0Y B;  1ZFS A;  2L98 A;  2L0P A;  4YGB B;  1OQP A;  2NCO A;  2KDH A;  2TN4 A;  2L50 A;  3EVR A;  1UHH A;  2FJU B;  2O60 A;  4PE1 A;  1KFX S;  2KYC A;  4YRU A;  1CLB A;  1MWN A;  1JFJ A;  2HF5 A;  1CNP A;  5AXI A;  1SBJ A;  1U5I B;  2DOQ A;  2JTT A;  3LK0 A;  4MRY A;  1XFZ O;  1YVL A;  1WLZ A;  1H4B A;  1EG3 A;  4MN0 A;  4YGE B;  2OS8 B;  4ORB B;  1FBV A;  1NCZ A;  2Y1M A;  1OZO A;  3BUM B;  5CPV A;  4GFT A;  4NQG A;  5ER4 X;  1KK7 Z;  1XA5 A;  4WQ3 A;  3SIA A;  2ZRT A;  1IKU A;  5ER5 A;  5J3X A;  2WND A;  4PHN A;  4D1E A;  2KAV A;  1DTL A;  4FTG A;  4JWQ A;  1NP8 A;  1E8A A;  2I94 A;  2KSP A;  1YX7 A;  3I5H C;  3GK2 A;  4I5J A;  1V1F A;  4PDZ A;  3O4Y A;  3ICB A;  2LHI A;  2F3Y A;  2JXC A;  2MA2 A;  3CR5 X;  4I5L B;  1F71 A;  1NX1 A;  2KBI A;  4BY5 A;  1CB1 A;  2LP3 A;  4GUK A;  5CSJ A;  1B1G A;  1J55 A;  4A4B A;  1F8H A;  1KQM B;  1S6J A;  4MZL A;  3JTD C;  2NCP A;  1PSR A;  3SG5 A;  4UPG A;  1BOC A;  4AQJ A;  3I5I B;  1LKJ A;  1ZUZ A;  1WY9 A;  4I5N B;  2K7D A;  1RJV A;  4AQI A;  2JNX A;  1QTX A;  1CDL A;  1DJG A;  2M7N A;  2LLS A;  1IG5 A;  4XYN A;  4GGF C;  5DKR A;  2M1K B;  1NX0 A;  3EKH A;  4P5O E;  4YGC B;  1V1G A;  2BL0 B;  1JF0 A;  2JT3 A;  1C7W A;  3F45 A;  1L2O B;  4PHM A;  5BPJ A;  5FYX A;  5KSZ A;  2BEC A;  2ZRS A;  1DT7 B;  1DJZ A;  4MSP A;  1W7I B;  1NIW A;  1RTP 1;  1SKT A;  2LLT A;  2PAS A;  3DVJ A;  1KFX L;  1SR6 B;  3TS5 B;  1BU3 A;  1DJY A;  5HLO A;  1PRW A;  1RK9 A;  1SCM B;  2KGB C;  1QX2 A;  1IQ5 A;  1SK6 D;  3O2P A;  1ALW A;  3BXK A;  4ETO A;  2NLN A;  5B8I B;  1JUO A;  1SW8 A;  2KOT A;  2MRD A;  4GBA A;  3EVV A;  1JWD A;  1NYA A;  1S6I A;  3D0Y A;  1FF1 A;  1MR8 A;  1B4C A;  2KI4 C;  2M8U A;  4DIR A;  1YX8 A;  2G2B A;  1OMD A;  2LM5 A;  1OE9 B;  4R1E A;  1J7Q A;  3BQ3 A;  3TDZ A;  2MLF C;  1NUB A;  3KF9 A;  1QV1 A;  1XFU O;  4PE7 A;  3TZ1 A;  2M9G A;  2PMY A;  1KWO C;  2LNK A;  1FW4 A;  4GAO A;  3SJS A;  1SPY A;  1BLQ A;  1D1O A;  1K8U A;  1TRF A;  2I18 A;  3SG3 A;  1Y0V H;  1QX7 A;  3BUN B;  1SYM A;  1SL7 A;  2JNF A;  2E30 A;  1IJ5 A;  4ICB A;  5G08 A;  2CT9 A;  4YGD B;  4N1G A;  4JQ0 D;  4PE0 A;  3FWB A;  1YRT B;  3EVU A;  2KI6 D;  1F70 A;  3WNX B;  4FQO A;  1YUR A;  1M39 A;  2WOS A;  4USL A;  1N65 A;  1YUT A;  3CWG A;  1XVJ A;  2KGR A;  3LL8 B;  2K2F A;  2AUC A;  2LVJ A;  3OP0 A;  1JSA A;  3NSK A;  1KSO A;  1QVI Z;  2BE4 A;  2HQW A;  2ZN8 A;  3OB2 B;  4GNK B;  1AUI B;  1MUX A;  1IH0 A;  3I5F C;  2QPT A;  2LHL A;  2LC5 A;  1J1D A;  1XYD A;  2VRG A;  5CSI A;  1K94 A;  2K7B A;  1LXF C;  5D69 A;  3HX4 A;  3DVK A;  1K9P A;  1IWQ A;  2EHB A;  4NDC A;  4U8D A;  2K61 A;  4N1F A;  1VRK A;  2WCB A;  1F4Q A;  5DKN A;  1HQV A;  2JZI A;  5KTY A;  2JPT A;  1G4Y R;  3NSL A;  1ALV A;  1ZOT B;  2L2E A;  3E3R A;  2LVI A;  4MRX A;  1BR4 B;  2M7L A;  1G33 A;  2OS8 C;  3PN7 B;  1JBA A;  4CLN A;  3TUY C;  4CFR A;  1QXP A;  2EC6 C;  1AJ4 A;  4QJ3 B;  1WRL A;  3WXA A;  2LVV A;  5HKZ A;  1J1E A;  4NDB A;  1TCO B;  3QRX A;  1K90 D;  1CFP A;  2L5X B;  1QVI Y;  1R6P A;  2FCE A;  4YBH B;  4MBE A;  2JTZ A;  1IQ3 A;  3VRO A;  2AMI A;  1KK8 B;  5AFP A;  2M29 A;  2HQ8 A;  2PSR A;  3BUX B;  2F3Z A;  1QV0 A;  1TIZ A;  1GGZ A;  3LLE A;  1QIW A;  2KI6 C;  2MBX A;  5CSN A;  1FI6 A;  3PM8 A;  3CZT X;  1S3P A;  1KCY A;  1CLM A;  1S1E A;  2LLU A;  1JF2 A;  1MF8 B;  1CM4 A;  3WHT B;  1EXR A;  1QJT A;  2M1U A;  1A75 B;  1CKK A;  2K8M B;  4QJ5 B;  1TNW A;  2NZ0 A;  4PCW A;  1K9U A;  3TDI A;  3ZWH A;  2PVB A;  3DVM A;  2E6W A;  1DGV A;  2JQ6 A;  1B8C A;  1KK7 Y;  2A4J A;  3EK4 A;  5HKY A;  1Y6W A;  1TNQ A;  1F55 A;  2O5G A;  4P2Y B;  1Y1A A;  2Y1N A;  2LCP A;  1Y1U A;  1L2O C;  4OVN F;  1XFX O;  3LCP C;  1UP5 A;  1CDP A;  1DJW A;  1QLK A;  3A4U B;  3KEV A;  1B7T Z;  1YR5 A;  1SR6 C;  4HSZ A;  4OV2 A;  1K95 A;  2ISD A;  1A2X A;  4MZJ A;  3TS5 C;  1OMV A;  1YUU A;  1GJY A;  1RFJ A;  1UHI A;  1MXL C;  2JT0 A;  2L4H A;  4XJK B;  3TDU A;  3MSE B;  1DGU A;  2B1U A;  3BYA A;  3SG6 A;  1RWY A;  2OPO A;  1REC A;  1OZS A;  2K7O A;  2KFG A;  2Q91 A;  5I2O A;  2AAO A;  1PAL A;  5HKW A;  4GPL B;  2LUC A;  1R2U A;  1SY9 A;  4ZCU A;  3IQO A;  4CFQ A;  1WDC B;  3ZNI A;  1S36 A;  1DF0 B;  3NSO A;  5PAL A;  1WLM A;  1OMR A;  1GGW A;  1G8I A;  1XK4 A;  2LVK A;  3OX6 A;  3AAJ A;  4DS7 A;  3EKJ A;  2H61 A;  2ZFD A;  3CGA A;  3GK4 X;  1UHN A;  2KNE A;  1PVB A;  2KQY A;  2Y5I A;  4PHJ A;  4N5X A;  3RM1 A;  2COL B;  2K0J A;  5K89 A;  5HLV A;  4QJ4 B;  1QX5 B;  1DMO A;  5I8N A;  1LA3 A;  5AER A;  2CCM A;  3EK8 A;  1K96 A;  4OCI A;  2CTN A;  1TNX A;  3H4S E;  1XFY O;  3O6B A;  2JOJ A;  2Y4Q A;  3NSI A;  1KSM A;  2BBM A;  2GGZ A;  4HRG A;  2OTG C;  1K93 D;  3PLF B;  4C0L A;  2ZNE A;  1KFU S;  1CFC A;  4CID A;  3AKB A;  1SRA A;  1XO5 A;  2L4I A;  1LVC D;  3I5G C;  1CFD A;  1X02 A;  2KAY A;  1NWD A;  1DJX A;  3EK7 A;  2JXL A;  4DCK A;  1QAS A;  5HYD A;  2GGM A;  1B47 A;  1TN4 A;  1LA0 A;  3JVT B;  1A03 A;  1PVA A;  1NPQ A;  1W7J B;  2CXJ A;  2KHN A;  5CSF A;  1A29 A;  1N0Y A;  4PAL A;  1A75 A;  1BR1 B;  1RRO A;  5JJG A;  3IF7 A;  2ZND A;  3VRQ A;  5KU1 A;  1IRJ A;  2KFF A;  4F0Z B;  2FOT A;  2KYF A;  2SAS A;  3OHM B;  3CTN A;  1J7R A;  1AP4 A;  1C07 A;  1XFV O;  4A4C A;  1UHK A;  4YGA A;  1YVH A;  2JC2 A;  1AVS A;  1S5G Z;  3AKA A;  3D10 A;  3I5F B;  4PE4 A;  1BOD A;  1CFF A;  2LV7 A;  5JOL A;  4M2O A;  2H61 C;  3OX5 A;  3PN7 C;  2MJW B;  3FWC A;  1BJF A;  2IS9 A;  1YUS A;  3DF0 B;  1UUR A;  3BUW B;  3GK1 A;  1AJ5 A;  2M0R A;  3M0W A;  1WRK A;  2P6B B;  1QLS A;  1JC2 A;  1N2D A;  2BE6 A;  1YRU B;  4XJK A;  1TTX A;  3RLZ A;  2BCA A;  4GGF A;  2LE9 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...