1BODA

The solution structures of mutant calbindin d9k's, as determined by nmr, show that the calcium binding site can adopt different folds
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
74
structure length
74
Chain Sequence
MKSPEELKGIFEKYDKEGDGQLSKEELKLLLQTEFPSLLKGMSTLDELFEELDKNGDGEVSFEEFQVLVKKISQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CALBINDIN D9K
publication title The solution structures of mutant calbindin D9k's, as determined by NMR, show that the calcium-binding site can adopt different folds.
pubmed doi rcsb
source organism Bos taurus
molecule tags Calcium-binding protein
total genus 6
structure length 74
sequence length 74
ec nomenclature
pdb deposition date 1993-04-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1bodA00
2Y4QA 1ZUZA 1RJVA 1BODA 1G33A 2RGIA 3CGAA 1J7PA 2JNFA 1RK9A 4AQJA 2M8UA 1XK4A 4NDCA 4PALA 3WXAA 3PN7C 3LL8B 2I2RE 4PHNA 4C0LA 4BY4A 1JC2A 2JRFA 1CM4A 2K61A 1XFUO 4FQOA 1PULA 1V1GA 1KFUS 4GNKB 2PVBA 1YRUB 3AAJA 1C7VA 1KK7Z 1LVCD 1J1EA 1MWNA 2LANA 1JF0A 4XYNA 1QVIZ 4A4CA 1UHKA 4MEWA 1CDMA 1EL4A 5FYXA 1TCOB 2LLSA 3TDZA 1UP5A 3CS1A 5D69A 2H61A 1DJIA 4WQ2A 4MZJA 3RM1A 4WRIA 1Q80A 4YGEB 1F70A 1XO5A 2L4IA 2L98A 1SBJA 1A75A 4CIDA 3O6BA 1KSOA 3FWCA 1B47A 1SR6B 1ALVA 1A4PA 1MF8B 3DVJA 3A4UB 3WHUB 1B8CA 4GFTA 1YX7A 2FCEA 3VRQA 3EK7A 2EC6B 4MN0A 1NUBA 2OS8C 4D1EA 5I2LA 4AQIA 4ETOA 2BE4A 1K90D 2HPSA 2JT8A 5KSZA 1AVSA 4N1FA 1IGVA 2F8PA 1CDNA 1DF0A 4DIRA 4PHKA 2VRGA 3O4YA 2KYCA 1H8BA 1A75B 2WCEA 1WRLA 5ER4X 1QJTA 1YVHA 2LLUA 2ZNEA 1B1GA 1F55A 2WORA 4P5OE 1Y6WA 1BJFA 4OV2A 1QX7A 4MBEA 2JTZA 5CSFA 1BLQA 5BPJA 1C07A 2JPTA 2GV5A 1NX3A 4Q04A 2ZFDA 3LK1A 2BCAA 1QIWA 2F3ZA 5KTYA 1KWOB 1OZSA 2MA2A 3PSRA 5HLOA 4ORBB 4QJ5B 2BL0C 1W7JB 3DF0A 3JTDB 3H4SE 2E30A 2MJWB 1AJ4A 1B7TY 1QV1A 1Y0VH 1IH0A 2F2OA 2M7LA 3VRRA 1E8AA 2Q91A 1OOJA 1L2OB 2MHHA 3I5HB 1PVAA 3PM8A 2TN4A 1A03A 4OR9B 1A2XA 2KGBC 1K9PA 3BUWB 1DGVA 1NX2A 1RWYA 3KEVA 4L9MA 1RECA 2O60A 1H4BA 1XYDA 2LVIA 3LK0A 3DF0B 3ZNIA 4AOMA 4C0JA 1S6IA 2JXLA 4MRYA 4HRHA 2NCOA 1DJGA 1WDCB 2LCPA 3GK1A 4I5LB 2BECA 3EK8A 4NDBA 1QXPA 5J3XA 1RROA 2K2AA 4M2QA 1XK4C 2L5XB 1FBVA 1CKKA 1B9AA 3QRXA 1CFPA 2B1UA 1N2DA 4P2YB 1DVIA 5DKNA 1UHIA 1NWDA 2WC8A 2ZRSA 4PE4A 4ZCVA 1IQ3A 3K21A 1SR6C 2FCDA 3EKJA 1JBAA 2K7OA 3CR4X 1IRJA 3OB2B 5K89A 1UUSA 4PE7A 2EC6C 2P6BB 1U5IA 3FIAA 1TN4A 1CDLA 3EVVA 2LUXA 3KF9A 1M46A 4MVFA 2H61C 2KAVA 2JT0A 1DJWA 4YI9A 2KYFA 3CR2A 1M31A 2M0RA 1F8HA 1AHRA 1Y1AA 2KI6C 4XJKA 5IBWA 1UURA 3M0WA 2CT9A 1K94A 4MLWA 3VGOA 4CPVA 2K7CA 2PRUA 4HRGA 1QX5B 2M49B 3AAKA 5KU1A 1BR4B 4MSPA 3SIBA 2LNKA 1QS7A 4PE0A 2F33A 4CFRA 3DVKA 4A4BA 1NCXA 1UHJA 3KO0A 3MSEB 1S1EA 1KWOC 2D8NA 2I18A 3D0YA 5AANA 1S3PA 1QX2A 2L2EA 1CMFA 1J7QA 1EG4A 2JULA 3EK4A 4M2OA 2LVJA 1GJYA 2KFGA 1XFXO 3NXAA 5I2OA 2BE6A 4CFQA 4JQ0D 4XJKB 1FW4A 2M1KB 2Y1MA 3JTDC 1S6CA 4DRWA 1NYAA 1RTP1 2KQYA 1QASA 3SG7A 2BBNA 2OTGC 4GUKA 2HQ8A 3LCPC 1YX8A 2CTNA 1L2OC 4DS7A 3CWGA 3HX4A 3I5HC 3OX5A 2LLTA 1CDPA 1PALA 1CM1A 3BUXB 2K2FA 2JTTA 2KNEA 1SYMA 3D0YB 3HCMA 4YGBB 1YURA 1MUXA 3AKAA 1J7RA 1KQMB 1F4OA 2LHLA 5CPVA 3TS5B 1OMVA 4YBHB 1QV0A 1TOPA 2COLB 4YGDB 1LKJA 4YGCB 2KBMA 2CNPA 2JWWA 1PK0D 1IKUA 2Y5IA 1WDCC 1YUSA 1TNQA 3OX6A 1TNWA 1NX0A 1JUOA 2MAZA 1PSBA 2ZKMX 1M63B 1OQPA 1X02A 1N65A 1DGUA 1BR1B 4F0ZB 1YVLA 1Y1UA 1S6JA 1NP8A 1SL9A 3AKBA 4MRXA 1AJ5A 1KK8B 1OSAA 2K0JA 3PLFB 3NSLA 1QLSA 4YGAA 2NXQA 3EVUA 3WHTB 2F3YA 3NSOA 4PE1A 5HYDA 2M1UA 3GK4X 2LMVA 1KFXL 2LUCA 2Y1NA 2L4HA 1DF0B 1CB1A 1ZACA 5AFPA 3I5FB 4USLA 5ER5A 2SCPA 2MBXA 3KPXA 3IF7A 1YUUA 4PHMA 4U8DA 5CSIA 2G9BA 2OTGB 2BBMA 2QPTA 3KHEA 4PDZA 1QVIY 2JT3A 2NCPA 1UHHA 2NLNA 1HT9A 2KI6D 4HREE 2ZRTA 1GGZA 2ISDA 1CFFA 1NX1A 1XVJA 1R6PA 3DVMA 2WNDA 4GGFA 1JFKA 2M97A 5JJGA 1FI5A 2L50A 1F71A 1LXFC 1CLMA 2CCMA 2AUCA 3NSIA 4ICBA 2LE9B 1IQ5A 2KQ6A 5PALA 3VRNA 3SG6A 2R2IA 3PALA 1EG3A 1K2HA 2V53A 3OB1B 4DCKA 2KOTA 2NZ0A 2JZIA 1JWDA 2KFFA 2AMIA 1K9UA 3CTNA 4GGNA 1SMGA 3NSKA 2KGRA 3SIAA 1MHOA 1SNLA 3F45A 1DJHA 2OPOA 1J1DA 4BY5A 2LVVA 2WCFA 5F6TA 2SASA 2M7NA 4QJ4B 5AEQA 1UWOA 2KAXA 3OP0A 2LAPA 4R1EA 1UHNA 2BCXA 5AXIA 4PHJA 1KQMC 1NSHA 3TS5C 1CLBA 1OZOA 2BKIB 1SPYA 1MR8A 1SCVA 3DVEA 1AUIB 1AK8A 5DKRA 2JC2A 1YTZC 2MLEC 1EH2A 4WQ3A 2JNXA 1WLZA 1WRKA 2WCBA 2PASA 5HKYA 1CNPA 2PSRA 1SY9A 4NDDA 3VROA 2G2BA 1K93D 2CBLA 2BKHB 1DJYA 5GQQC 1TCFA 2AAOA 1FF1A 1JFJA 2K7BA 1NIWA 1KK8C 2GGMA 3PFVA 2F2PA 1U5IB 3TDIA 2LP2A 1FPWA 3ZWHA 4OVNF 4ORCB 2ZN8A 5AERA 3TZ1A 5HLVA 2LM5A 1KSMA 2L0PA 1EJ3A 3FS7A 2I94A 1Y1XA 3JVTB 1BG1A 1BOCA 1KCYA 3I5FC 1JSAA 1C7WA 2Q4UA 4I5JA 1SCMB 3BXKA 2H2KA 3VRPA 1W7IB 3I5IB 4HSZA 3CLNA 1YRTB 2E6WA 4ORAB 1ZMZA 2KI4C 1S5GY 1MXEA 4I5NB 2I7AA 2HETA 5DKQA 1B7TZ 1B8LA 1SKTA 1ZFSA 1YUTA 3BYAA 3D10A 3LLEA 2LMTA 1TRFA 5I8NA 1WRZA 1IJ5A 2JXCA 3A8RA 3ICBA 2FOTA 5G08A 1IJ6A 3GK2A 1LA0A 3O2PA 1CFCA 2KSPA 1QATA 3SG3A 1DTLA 4JPZB 1XFYO 2KBIA 2DOQA 1SL7A 1MQ1A 1OMRA 2K7DA 1K9KA 4YRUA 1CFDA 1TNXA 2EGDA 1G8IA 1GQMA 1R2UA 3BQ3A 3TUYC 1QTXA 1HQVA 1V1FA 2A4JA 4OCIA 3BUOB 1S36A 2LP3A 4CLNA 1BF5A 2LMUA 1KQVA 1EXRA 2PMYA 4GGFC 5HKZA 2MRDA 2LC5A 2M3WA 1G4YR 3CZTX 3I5GB 2FJUB 5JOLA 1SW8A 1ALWA 1SRAA 2IS9A 4NQGA 2LV7A 3RLZA 5CSJA 3IQQA 3EKHA 1BU3A 4JWQA 1PSRA 2WOSA 1QIVA 2BCBA 3BOWA 2PALA 1NCZA 1BT6A 1VRKA 4IL1A 1B4CA 1AP4A 1CTRA 4PCWA 1JF2A 2KFHA 2KAYA 3PN7B 4GBAA 1L7ZA 2M29A 1IG5A 1KK7Y 1BMOA 5HKWA 3EVRA 3TDUA 2KI4B 1ODBA 1XA5A 1J7OA 1M45A 1TTXA 5CSNA 1DJZA 1FI6A 4DUQA 1TIZA 1LA3A 4MZKA 4OKHA 3SG2A 4FTGA 1CLLA 1TNPA 1MXLC 1XFZO 4ZCUA 1KFXS 3BOWB 5I2QA 2ZN9A 1S26D 1LINA 2CXJA 4N5XA 1K95A 4UPGA 2MLFC 4QJ3B 1N0YA 5D7FA 1RFJA 1IWQA 1F54A 3JVTC 1K8UA 4E68A 1GGWA 2JU0A 1DT7B 2O5GA 1SCMC 1WY9A 3BUNB 3TUYB 1J55A 1XFWO 1CMGA 3I5IC 3SJSA 4I5KA 2KHNA 1PVBA 1SK6D 2QACA 1M39A 1NCYA 2OS8B 3E3RA 2LVKA 3C1VA 4C0KA 1PRWA 1D1OA 3IQOA 4N1GA 1B8RA 1SL8A 1DMOA 1S5GZ 1WLMA 2EHBA 3WNXB 2HF5A 4GPLB 2GGZA 5TNCA 2LHIA 4MZLA 2ZNDA 3O78A 1OMDA 1YR5A 4M2PA 1F4QA 3BUMB 1XFVO 2K8MB 1NPQA 1K96A 3OHMB 3SG5A 2JOJA 3CR5X 4GAOA 4YI8A 2HQWA 1DJXA 1ZOTB 1OE9B 2L51A 2M9GA 3GOFA 1KFUL 1QLKA 2JQ6A 2BL0B 3DD4A 3FWBA 3I5GC 3PATA 3SG4A 5B8IB 1A29A 4TNCA 2KDHA
chains in the Genus database with same CATH superfamily
2Y4QA 1ZUZA 1RJVA 1BODA 1G33A 2RGIA 3CGAA 1J7PA 2JNFA 3VB1A 1RK9A 1OOFA 4AQJA 2M8UA 3S0EA 1XK4A 3DXLA 4NDCA 4PALA 3WXAA 3PN7C 3LL8B 2I2RE 4PHNA 4C0LA 4BY4A 1JC2A 2JRFA 1CM4A 2K61A 1C3YA 1XFUO 4FQOA 2YGUA 1PULA 1V1GA 1KFUS 4GNKB 2PVBA 3B86A 1YRUB 3AAJA 1C7VA 1GM0A 1KK7Z 1LVCD 1J1EA 1MWNA 2LANA 1JF0A 4XYNA 1QVIZ 4A4CA 1UHKA 4MEWA 1CDMA 1EL4A 5FYXA 1TCOB 2LLSA 3BFHA 3TDZA 1UP5A 3CS1A 5D69A 2H61A 1DQEA 1DJIA 4WQ2A 4FQTA 4MZJA 3RM1A 4WRIA 1Q80A 4YGEB 3S0FA 1XO5A 2L4IA 2L98A 1SBJA 1F70A 1A75A 1Z4HA 4CIDA 3O6BA 1KSOA 3FWCA 1B47A 1SR6B 1ALVA 1A4PA 1MF8B 3DVJA 3CZ0A 3A4UB 3WHUB 1B8CA 4GFTA 1YX7A 2FCEA 5I94A 3VRQA 3EK7A 2EC6B 4MN0A 1NUBA 2OS8C 3SS3A 3UO9A 5I2LA 4D1EA 4AQIA 4ETOA 2BE4A 1K90D 2HPSA 2JT8A 1DEKA 1AVSA 5KSZA 3RZSA 3N7HA 4N1FA 5FI6A 1IGVA 2F8PA 1CDNA 3D74A 5FI2A 1DF0A 2WC5A 4DIRA 4PHKA 2VRGA 3O4YA 2WCMA 2KYCA 1H8BA 1A75B 2WCEA 1WRLA 5ER4X 1QJTA 1YVHA 2LLUA 2QDIA 2ZNEA 1B1GA 1TUZA 1F55A 2WORA 4P5OE 1Y6WA 1BJFA 4OV2A 1QX7A 4MBEA 2JTZA 5CSFA 1BLQA 5BPJA 1C07A 2JPTA 2GV5A 1NX3A 2L5YA 4Q04A 2ZFDA 3NGVA 3LK1A 2BCAA 1QIWA 2F3ZA 3B88A 5KTYA 1KWOB 1OZSA 2MA2A 3DYEA 3PSRA 5HLOA 4ORBB 4PT1A 4QJ5B 3S0GA 2BL0C 1W7JB 3DF0A 3JTDB 3H4SE 2E30A 2MJWB 1AJ4A 1B7TY 1QV1A 1Y0VH 2H8VA 2WC6A 2QEHA 1IH0A 2F2OA 2M7LA 3VRRA 1E8AA 2Q91A 1OOJA 1L2OB 2MHHA 3I5HB 1PVAA 3PM8A 2TN4A 1A03A 4OR9B 1A2XA 2P71A 2KGBC 1K9PA 1DC1A 3BUWB 1DGVA 1NX2A 1RWYA 2QEBA 3KEVA 3NHIA 1RECA 4L9MA 2O60A 1TUJA 1H4BA 1XYDA 1Z2CB 2LVIA 2QEVA 3LK0A 3DF0B 3ZNIA 4AOMA 4C0JA 1S6IA 2JXLA 4MRYA 4HRHA 2NCOA 1DJGA 1WDCB 2LCPA 3GK1A 4I5LB 2BECA 3EK8A 4NDBA 1QXPA 5J3XA 1RROA 2K2AA 4M2QA 1XK4C 2L5XB 1FBVA 1CKKA 1B9AA 3O4XA 3QRXA 1CFPA 3R72A 2B1UA 1N2DA 4P2YB 1DVIA 5DKNA 1UHIA 1NWDA 2WC8A 2ZRSA 4PE4A 4ZCVA 1IQ3A 3K21A 1SR6C 2PQLA 2FCDA 3EKJA 1JBAA 2K7OA 3CR4X 3L4AA 1IRJA 3OB2B 5K89A 1UUSA 4PE7A 2EC6C 2P6BB 1U5IA 3FIAA 1TN4A 1CDLA 3EVVA 2LUXA 2GTEA 3KF9A 1M46A 3FE6A 4MVFA 3S0DA 2H61C 1OOHA 2JT0A 2KAVA 1DJWA 4YI9A 2KYFA 3CR2A 1M31A 2KLEA 2M0RA 5D3OA 1F8HA 1AHRA 2WCKA 2BAPA 1Y1AA 3PM2A 2KI6C 3CABA 4XJKA 5IBWA 1UURA 3M0WA 2CT9A 1K94A 4MLWA 3VGOA 4CPVA 2K7CA 2PRUA 4HRGA 1QX5B 2M49B 3AAKA 5KU1A 1BR4B 4INXA 4MSPA 3SIBA 2LNKA 1QS7A 4PE0A 2F33A 4CFRA 3DVKA 4A4BA 1NCXA 1OW4A 1UHJA 3KO0A 3MSEB 1S1EA 1KWOC 2D8NA 2I18A 3D0YA 5AANA 1S3PA 1QX2A 2L2EA 1CMFA 1J7QA 1EG4A 2JULA 3EK4A 4M2OA 2LVJA 3S0BA 1GJYA 2KFGA 1XFXO 3NXAA 5I2OA 2BE6A 4CFQA 4JQ0D 4XJKB 3L47A 1FW4A 2M1KB 2Y1MA 3JTDC 1S6CA 4DRWA 1NYAA 1RTP1 2KQYA 1T14A 1QASA 3SG7A 2BBNA 2OTGC 3B6XA 4GUKA 2HQ8A 3LCPC 1YX8A 2CTNA 1L2OC 4DS7A 3CWGA 3HX4A 3I5HC 3OX5A 2LLTA 1CDPA 1PALA 1CM1A 3EG5B 2BNXA 1LS8A 2K2FA 3BUXB 2JTTA 2KNEA 1SYMA 3D0YB 3HCMA 4YGBB 1YURA 1MUXA 3AKAA 1J7RA 1KQMB 1F4OA 2LHLA 5CPVA 3TS5B 1OMVA 4YBHB 3CZ2A 3CZ1A 1QV0A 1TOPA 2COLB 4YGDB 3NHTA 1LKJA 4YGCB 2KBMA 2CNPA 2JWWA 1PK0D 1IKUA 2Y5IA 1WDCC 5FI7A 2WCHA 1YUSA 2FJYA 3D76A 1TNQA 3OX6A 1TNWA 1NX0A 1JUOA 2MAZA 3V2LA 1PSBA 2ZKMX 1M63B 1TWOA 1OQPA 1X02A 1N65A 1DGUA 1BR1B 4F0ZB 1Y1UA 1YVLA 1S6JA 1NP8A 1SL9A 3AKBA 1P28A 4MRXA 1AJ5A 1KK8B 1OSAA 2K0JA 3PLFB 3NSLA 1QLSA 4YGAA 2NXQA 3EVUA 3WHTB 2F3YA 3NSOA 4PE1A 5HYDA 2M1UA 3GK4X 2LMVA 3PJIA 1KFXL 2LUCA 2Y1NA 2L4HA 1DF0B 1CB1A 1ZACA 5AFPA 3I5FB 4USLA 5ER5A 2SCPA 3FE9A 2MBXA 3KPXA 3IF7A 1YUUA 4PHMA 4U8DA 5CSIA 2G9BA 3IVTA 2OTGB 2BBMA 2QPTA 3KHEA 4PDZA 1QVIY 2JT3A 2NCPA 1UHHA 2NLNA 1HT9A 2KI6D 1IIOA 4HREE 2ZRTA 1GGZA 2ISDA 1CFFA 3SS5A 1NX1A 1XVJA 1R6PA 3DVMA 2WNDA 4GGFA 1JFKA 2M97A 5JJGA 1FI5A 2L50A 1F71A 1LXFC 1CLMA 2CCMA 2AUCA 3NSIA 4ICBA 2LE9B 1IQ5A 2KQ6A 5PALA 3VRNA 3SG6A 2R2IA 3QMEA 3PALA 1EG3A 1K2HA 2V53A 3OB1B 4DCKA 2KOTA 2NZ0A 2JZIA 1QWVA 1JWDA 2KFFA 2AMIA 1K9UA 3CTNA 4GGNA 1SMGA 3NSKA 2KGRA 3SIAA 1DELA 1MHOA 1SNLA 3F45A 1DJHA 2OPOA 1J1DA 4BY5A 2LVVA 3D78A 2WCFA 5F6TA 1OOIX 2SASA 4IJ7A 2M7NA 4QJ4B 5AEQA 3CYZA 1UWOA 2KAXA 3OP0A 2LAPA 4R1EA 1UHNA 2BCXA 3BFAA 5AXIA 4PHJA 1KQMC 1NSHA 3TS5C 1CLBA 1OZOA 2BKIB 1SPYA 1MR8A 1SCVA 3DVEA 1AUIB 1AK8A 5DKRA 2JC2A 1YTZC 2L2CA 2KLDA 2MLEC 4WQ3A 2JNXA 1EH2A 1WLZA 1WRKA 1C3ZA 2K60A 2PASA 1XFRA 2WCBA 2PSRA 5HKYA 1CNPA 1SY9A 4NDDA 3VROA 2G2BA 2ERBA 1K93D 2CBLA 2BKHB 1DJYA 5GQQC 1TCFA 2AAOA 3DZTA 3K1EA 2KPHA 1FF1A 1JFJA 2K7BA 1NIWA 1KK8C 2GGMA 3PFVA 2F2PA 1U5IB 3TDIA 2LP2A 1FPWA 3ZWHA 4OVNF 4ORCB 4JD9A 2ZN8A 5AERA 3TZ1A 3R1VA 2LM5A 1KSMA 5HLVA 2L0PA 1EJ3A 3FS7A 2I94A 3BFBA 1Y1XA 3D73A 3R1OA 3JVTB 1BG1A 1BOCA 1KCYA 3I5FC 1JSAA 1C7WA 2Q4UA 4I5JA 1OOGA 1SCMB 3BXKA 1SSEB 2H2KA 3VRPA 1W7IB 3I5IB 1W9ZA 3OBVA 3CLNA 4HSZA 1YRTB 2E6WA 3R1PA 4KYNA 1ZMZA 2KI4C 1S5GY 4ORAB 1MXEA 4I5NB 2I7AA 2HETA 5DKQA 1B7TZ 1B8LA 1SKTA 1ZFSA 1YUTA 3B87A 3BYAA 3D10A 2LMTA 1TRFA 3LLEA 5I8NA 3S0AA 1WRZA 1IJ5A 2JXCA 3A8RA 3ICBA 2FOTA 5G08A 1IJ6A 3GK2A 1LA0A 3O2PA 1CFCA 2KSPA 1QATA 3SG3A 1DTLA 3D77A 2P70A 4INWA 4JPZB 1XFYO 2KBIA 2DOQA 4F7FA 1SL7A 1MQ1A 1OMRA 2K7DA 4JKTA 1K9KA 4YRUA 1CFDA 1TNXA 2EGDA 1G8IA 1GQMA 1R2UA 3BQ3A 2JPOA 3TUYC 1QTXA 3D75A 1HQVA 1V1FA 2A4JA 4OCIA 3BUOB 1S36A 2LP3A 4CLNA 1BF5A 2LMUA 3L4LA 1KQVA 1EXRA 2PMYA 4GGFC 5HKZA 2MRDA 2LC5A 2M3WA 1G4YR 3CZTX 3I5GB 2FJUB 5JOLA 1SW8A 1ALWA 1SRAA 2IS9A 3DY9A 4NQGA 2LV7A 3RLZA 5CSJA 3IQQA 3EKHA 1BU3A 4JWQA 1PSRA 2WOSA 1QIVA 2BCBA 3BOWA 2PALA 1NCZA 1BT6A 1VRKA 4IL1A 2WCJA 1B4CA 1AP4A 1CTRA 4PCWA 1JF2A 2KFHA 2KAYA 3PN7B 4GBAA 1ORGA 1L7ZA 3SS4A 2M29A 1IG5A 1KK7Y 1BMOA 5HKWA 3EVRA 3TDUA 2PYQA 2KI4B 1ODBA 3Q8IA 1XA5A 1J7OA 1M45A 3B7AA 1TTXA 5CSNA 5DICA 1DJZA 1FI6A 4DUQA 1TIZA 1LA3A 4MZKA 4OKHA 3SG2A 4FTGA 1CLLA 1TNPA 1MXLC 1XFZO 4ZCUA 1KFXS 3BOWB 5I2QA 2ZN9A 1S26D 1LINA 2CXJA 4N5XA 5HL1A 3CDNA 1K95A 4UPGA 2MLFC 4QJ3B 3UNWA 1N0YA 5D7FA 1RFJA 1IWQA 1F54A 3JVTC 1K8UA 4E68A 1GGWA 2JU0A 1DT7B 2O5GA 3BJHA 1SCMC 1WY9A 3BUNB 3TUYB 1J55A 1XFWO 1CMGA 3I5IC 3SJSA 4I5KA 2KHNA 2WCLA 1PVBA 1SK6D 2QACA 1M39A 1NCYA 4OZDA 2OS8B 3E3RA 2LVKA 2QEOA 3C1VA 4C0KA 1PRWA 1D1OA 3IQOA 4N1GA 1B8RA 1SL8A 1DMOA 1S5GZ 1WLMA 2EHBA 3WNXB 2HF5A 4GPLB 2GGZA 5TNCA 2LHIA 4MZLA 2ZNDA 3O78A 3FE8A 1OMDA 1YR5A 4M2PA 1F4QA 3BUMB 1XFVO 2K8MB 1NPQA 1K96A 3OHMB 3SG5A 2JOJA 3CR5X 4GAOA 4YI8A 2HQWA 1DJXA 1ZOTB 5EL2A 1OE9B 3OGNA 2L51A 2M9GA 3GOFA 1KFUL 1QLKA 2JQ6A 2BL0B 3DD4A 3FWBA 3I5GC 3PATA 3SG4A 5B8IB 1A29A 4TNCA 2KDHA
chains in the Genus database with same CATH topology
2Y4QA 1ZUZA 1RJVA 1BODA 1G33A 2RGIA 3CGAA 1J7PA 2JNFA 1RK9A 4AQJA 2M8UA 1XK4A 4NDCA 4PALA 3WXAA 3PN7C 3LL8B 2I2RE 4PHNA 4C0LA 4BY4A 1JC2A 2JRFA 1CM4A 2K61A 1XFUO 4FQOA 1PULA 1V1GA 1KFUS 4GNKB 2PVBA 1YRUB 3AAJA 1C7VA 1KK7Z 1LVCD 1J1EA 1MWNA 2LANA 1JF0A 4XYNA 1QVIZ 4A4CA 1UHKA 4MEWA 1CDMA 1EL4A 5FYXA 1TCOB 2LLSA 3TDZA 1UP5A 3CS1A 5D69A 2H61A 1DJIA 4WQ2A 4MZJA 3RM1A 4WRIA 1Q80A 4YGEB 1F70A 1XO5A 2L4IA 2L98A 1SBJA 1A75A 4CIDA 3O6BA 1KSOA 3FWCA 1B47A 1SR6B 1ALVA 1A4PA 1MF8B 3DVJA 3A4UB 3WHUB 1B8CA 4GFTA 1YX7A 2FCEA 3VRQA 3EK7A 2EC6B 4MN0A 1NUBA 2OS8C 4D1EA 5I2LA 4AQIA 4ETOA 2BE4A 1K90D 2HPSA 2JT8A 5KSZA 1AVSA 4N1FA 1IGVA 2F8PA 1CDNA 1DF0A 4DIRA 4PHKA 2VRGA 3O4YA 2KYCA 1H8BA 1A75B 2WCEA 1WRLA 5ER4X 1QJTA 1YVHA 2LLUA 2ZNEA 1B1GA 1F55A 2WORA 4P5OE 1Y6WA 1BJFA 4OV2A 1QX7A 4MBEA 2JTZA 5CSFA 1BLQA 5BPJA 1C07A 2JPTA 2GV5A 1NX3A 4Q04A 2ZFDA 3LK1A 2BCAA 1QIWA 2F3ZA 5KTYA 1KWOB 1OZSA 2MA2A 3PSRA 5HLOA 4ORBB 4QJ5B 2BL0C 1W7JB 3DF0A 3JTDB 3H4SE 2E30A 2MJWB 1AJ4A 1B7TY 1QV1A 1Y0VH 1IH0A 2F2OA 2M7LA 3VRRA 1E8AA 2Q91A 1OOJA 1L2OB 2MHHA 3I5HB 1PVAA 3PM8A 2TN4A 1A03A 4OR9B 1A2XA 2KGBC 1K9PA 3BUWB 1DGVA 1NX2A 1RWYA 3KEVA 4L9MA 1RECA 2O60A 1H4BA 1XYDA 2LVIA 3LK0A 3DF0B 3ZNIA 4AOMA 4C0JA 1S6IA 2JXLA 4MRYA 4HRHA 2NCOA 1DJGA 1WDCB 2LCPA 3GK1A 4I5LB 2BECA 3EK8A 4NDBA 1QXPA 5J3XA 1RROA 2K2AA 4M2QA 1XK4C 2L5XB 1FBVA 1CKKA 1B9AA 3QRXA 1CFPA 2B1UA 1N2DA 4P2YB 1DVIA 5DKNA 1UHIA 1NWDA 2WC8A 2ZRSA 4PE4A 4ZCVA 1IQ3A 3K21A 1SR6C 2FCDA 3EKJA 1JBAA 2K7OA 3CR4X 1IRJA 3OB2B 5K89A 1UUSA 4PE7A 2EC6C 2P6BB 1U5IA 3FIAA 1TN4A 1CDLA 3EVVA 2LUXA 3KF9A 1M46A 4MVFA 2H61C 2KAVA 2JT0A 1DJWA 4YI9A 2KYFA 3CR2A 1M31A 2M0RA 1F8HA 1AHRA 1Y1AA 2KI6C 4XJKA 5IBWA 1UURA 3M0WA 2CT9A 1K94A 4MLWA 3VGOA 4CPVA 2K7CA 2PRUA 4HRGA 1QX5B 2M49B 3AAKA 5KU1A 1BR4B 4MSPA 3SIBA 2LNKA 1QS7A 4PE0A 2F33A 4CFRA 3DVKA 4A4BA 1NCXA 1UHJA 3KO0A 3MSEB 1S1EA 1KWOC 2D8NA 2I18A 3D0YA 5AANA 1S3PA 1QX2A 2L2EA 1CMFA 1J7QA 1EG4A 2JULA 3EK4A 4M2OA 2LVJA 1GJYA 2KFGA 1XFXO 3NXAA 5I2OA 2BE6A 4CFQA 4JQ0D 4XJKB 1FW4A 2M1KB 2Y1MA 3JTDC 1S6CA 4DRWA 1NYAA 1RTP1 2KQYA 1QASA 3SG7A 2BBNA 2OTGC 4GUKA 2HQ8A 3LCPC 1YX8A 2CTNA 1L2OC 4DS7A 3CWGA 3HX4A 3I5HC 3OX5A 2LLTA 1CDPA 1PALA 1CM1A 3BUXB 2K2FA 2JTTA 2KNEA 1SYMA 3D0YB 3HCMA 4YGBB 1YURA 1MUXA 3AKAA 1J7RA 1KQMB 1F4OA 2LHLA 5CPVA 3TS5B 1OMVA 4YBHB 1QV0A 1TOPA 2COLB 4YGDB 1LKJA 4YGCB 2KBMA 2CNPA 2JWWA 1PK0D 1IKUA 2Y5IA 1WDCC 1YUSA 1TNQA 3OX6A 1TNWA 1NX0A 1JUOA 2MAZA 1PSBA 2ZKMX 1M63B 1OQPA 1X02A 1N65A 1DGUA 1BR1B 4F0ZB 1YVLA 1Y1UA 1S6JA 1NP8A 1SL9A 3AKBA 4MRXA 1AJ5A 1KK8B 1OSAA 2K0JA 3PLFB 3NSLA 1QLSA 4YGAA 2NXQA 3EVUA 3WHTB 2F3YA 3NSOA 4PE1A 5HYDA 2M1UA 3GK4X 2LMVA 1KFXL 2LUCA 2Y1NA 2L4HA 1DF0B 1CB1A 1ZACA 5AFPA 3I5FB 4USLA 5ER5A 2SCPA 2MBXA 3KPXA 3IF7A 1YUUA 4PHMA 4U8DA 5CSIA 2G9BA 2OTGB 2BBMA 2QPTA 3KHEA 4PDZA 1QVIY 2JT3A 2NCPA 1UHHA 2NLNA 1HT9A 2KI6D 4HREE 2ZRTA 1GGZA 2ISDA 1CFFA 1NX1A 1XVJA 1R6PA 3DVMA 2WNDA 4GGFA 1JFKA 2M97A 5JJGA 1FI5A 2L50A 1F71A 1LXFC 1CLMA 2CCMA 2AUCA 3NSIA 4ICBA 2LE9B 1IQ5A 2KQ6A 5PALA 3VRNA 3SG6A 2R2IA 3PALA 1EG3A 1K2HA 2V53A 3OB1B 4DCKA 2KOTA 2NZ0A 2JZIA 1JWDA 2KFFA 2AMIA 1K9UA 3CTNA 4GGNA 1SMGA 3NSKA 2KGRA 3SIAA 1MHOA 1SNLA 3F45A 1DJHA 2OPOA 1J1DA 4BY5A 2LVVA 2WCFA 5F6TA 2SASA 2M7NA 4QJ4B 5AEQA 1UWOA 2KAXA 3OP0A 2LAPA 4R1EA 1UHNA 2BCXA 5AXIA 4PHJA 1KQMC 1NSHA 3TS5C 1CLBA 1OZOA 2BKIB 1SPYA 1MR8A 1SCVA 3DVEA 1AUIB 1AK8A 5DKRA 2JC2A 1YTZC 2MLEC 1EH2A 4WQ3A 2JNXA 1WLZA 1WRKA 2WCBA 2PASA 5HKYA 1CNPA 2PSRA 1SY9A 4NDDA 3VROA 2G2BA 1K93D 2CBLA 2BKHB 1DJYA 5GQQC 1TCFA 2AAOA 1FF1A 1JFJA 2K7BA 1NIWA 1KK8C 2GGMA 3PFVA 2F2PA 1U5IB 3TDIA 2LP2A 1FPWA 3ZWHA 4OVNF 4ORCB 2ZN8A 5AERA 3TZ1A 5HLVA 2LM5A 1KSMA 2L0PA 1EJ3A 3FS7A 2I94A 1Y1XA 3JVTB 1BG1A 1BOCA 1KCYA 3I5FC 1JSAA 1C7WA 2Q4UA 4I5JA 1SCMB 3BXKA 2H2KA 3VRPA 1W7IB 3I5IB 4HSZA 3CLNA 1YRTB 2E6WA 4ORAB 1ZMZA 2KI4C 1S5GY 1MXEA 4I5NB 2I7AA 2HETA 5DKQA 1B7TZ 1B8LA 1SKTA 1ZFSA 1YUTA 3BYAA 3D10A 3LLEA 2LMTA 1TRFA 5I8NA 1WRZA 1IJ5A 2JXCA 3A8RA 3ICBA 2FOTA 5G08A 1IJ6A 3GK2A 1LA0A 3O2PA 1CFCA 2KSPA 1QATA 3SG3A 1DTLA 4JPZB 1XFYO 2KBIA 2DOQA 1SL7A 1MQ1A 1OMRA 2K7DA 1K9KA 4YRUA 1CFDA 1TNXA 2EGDA 1G8IA 1GQMA 1R2UA 3BQ3A 3TUYC 1QTXA 1HQVA 1V1FA 2A4JA 4OCIA 3BUOB 1S36A 2LP3A 4CLNA 1BF5A 2LMUA 1KQVA 1EXRA 2PMYA 4GGFC 5HKZA 2MRDA 2LC5A 2M3WA 1G4YR 3CZTX 3I5GB 2FJUB 5JOLA 1SW8A 1ALWA 1SRAA 2IS9A 4NQGA 2LV7A 3RLZA 5CSJA 3IQQA 3EKHA 1BU3A 4JWQA 1PSRA 2WOSA 1QIVA 2BCBA 3BOWA 2PALA 1NCZA 1BT6A 1VRKA 4IL1A 1B4CA 1AP4A 1CTRA 4PCWA 1JF2A 2KFHA 2KAYA 3PN7B 4GBAA 1L7ZA 2M29A 1IG5A 1KK7Y 1BMOA 5HKWA 3EVRA 3TDUA 2KI4B 1ODBA 1XA5A 1J7OA 1M45A 1TTXA 5CSNA 1DJZA 1FI6A 4DUQA 1TIZA 1LA3A 4MZKA 4OKHA 3SG2A 4FTGA 1CLLA 1TNPA 1MXLC 1XFZO 4ZCUA 1KFXS 3BOWB 5I2QA 2ZN9A 1S26D 1LINA 2CXJA 4N5XA 1K95A 4UPGA 2MLFC 4QJ3B 1N0YA 5D7FA 1RFJA 1IWQA 1F54A 3JVTC 1K8UA 4E68A 1GGWA 2JU0A 1DT7B 2O5GA 1SCMC 1WY9A 3BUNB 3TUYB 1J55A 1XFWO 1CMGA 3I5IC 3SJSA 4I5KA 2KHNA 1PVBA 1SK6D 2QACA 1M39A 1NCYA 2OS8B 3E3RA 2LVKA 3C1VA 4C0KA 1PRWA 1D1OA 3IQOA 4N1GA 1B8RA 1SL8A 1DMOA 1S5GZ 1WLMA 2EHBA 3WNXB 2HF5A 4GPLB 2GGZA 5TNCA 2LHIA 4MZLA 2ZNDA 3O78A 1OMDA 1YR5A 4M2PA 1F4QA 3BUMB 1XFVO 2K8MB 1NPQA 1K96A 3OHMB 3SG5A 2JOJA 3CR5X 4GAOA 4YI8A 2HQWA 1DJXA 1ZOTB 1OE9B 2L51A 2M9GA 3GOFA 1KFUL 1QLKA 2JQ6A 2BL0B 3DD4A 3FWBA 3I5GC 3PATA 3SG4A 5B8IB 1A29A 4TNCA 2KDHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Y4Q A;  1ZUZ A;  1RJV A;  1BOD A;  1G33 A;  2RGI A;  3CGA A;  1J7P A;  2JNF A;  1RK9 A;  4AQJ A;  2M8U A;  1XK4 A;  4NDC A;  4PAL A;  3WXA A;  3PN7 C;  3LL8 B;  2I2R E;  4PHN A;  4C0L A;  4BY4 A;  1JC2 A;  2JRF A;  1CM4 A;  2K61 A;  1XFU O;  4FQO A;  1PUL A;  1V1G A;  1KFU S;  4GNK B;  2PVB A;  1YRU B;  3AAJ A;  1C7V A;  1KK7 Z;  1LVC D;  1J1E A;  1MWN A;  2LAN A;  1JF0 A;  4XYN A;  1QVI Z;  4A4C A;  1UHK A;  4MEW A;  1CDM A;  1EL4 A;  5FYX A;  1TCO B;  2LLS A;  3TDZ A;  1UP5 A;  3CS1 A;  5D69 A;  2H61 A;  1DJI A;  4WQ2 A;  4MZJ A;  3RM1 A;  4WRI A;  1Q80 A;  4YGE B;  1F70 A;  1XO5 A;  2L4I A;  2L98 A;  1SBJ A;  1A75 A;  4CID A;  3O6B A;  1KSO A;  3FWC A;  1B47 A;  1SR6 B;  1ALV A;  1A4P A;  1MF8 B;  3DVJ A;  3A4U B;  3WHU B;  1B8C A;  4GFT A;  1YX7 A;  2FCE A;  3VRQ A;  3EK7 A;  2EC6 B;  4MN0 A;  1NUB A;  2OS8 C;  4D1E A;  5I2L A;  4AQI A;  4ETO A;  2BE4 A;  1K90 D;  2HPS A;  2JT8 A;  5KSZ A;  1AVS A;  4N1F A;  1IGV A;  2F8P A;  1CDN A;  1DF0 A;  4DIR A;  4PHK A;  2VRG A;  3O4Y A;  2KYC A;  1H8B A;  1A75 B;  2WCE A;  1WRL A;  5ER4 X;  1QJT A;  1YVH A;  2LLU A;  2ZNE A;  1B1G A;  1F55 A;  2WOR A;  4P5O E;  1Y6W A;  1BJF A;  4OV2 A;  1QX7 A;  4MBE A;  2JTZ A;  5CSF A;  1BLQ A;  5BPJ A;  1C07 A;  2JPT A;  2GV5 A;  1NX3 A;  4Q04 A;  2ZFD A;  3LK1 A;  2BCA A;  1QIW A;  2F3Z A;  5KTY A;  1KWO B;  1OZS A;  2MA2 A;  3PSR A;  5HLO A;  4ORB B;  4QJ5 B;  2BL0 C;  1W7J B;  3DF0 A;  3JTD B;  3H4S E;  2E30 A;  2MJW B;  1AJ4 A;  1B7T Y;  1QV1 A;  1Y0V H;  1IH0 A;  2F2O A;  2M7L A;  3VRR A;  1E8A A;  2Q91 A;  1OOJ A;  1L2O B;  2MHH A;  3I5H B;  1PVA A;  3PM8 A;  2TN4 A;  1A03 A;  4OR9 B;  1A2X A;  2KGB C;  1K9P A;  3BUW B;  1DGV A;  1NX2 A;  1RWY A;  3KEV A;  4L9M A;  1REC A;  2O60 A;  1H4B A;  1XYD A;  2LVI A;  3LK0 A;  3DF0 B;  3ZNI A;  4AOM A;  4C0J A;  1S6I A;  2JXL A;  4MRY A;  4HRH A;  2NCO A;  1DJG A;  1WDC B;  2LCP A;  3GK1 A;  4I5L B;  2BEC A;  3EK8 A;  4NDB A;  1QXP A;  5J3X A;  1RRO A;  2K2A A;  4M2Q A;  1XK4 C;  2L5X B;  1FBV A;  1CKK A;  1B9A A;  3QRX A;  1CFP A;  2B1U A;  1N2D A;  4P2Y B;  1DVI A;  5DKN A;  1UHI A;  1NWD A;  2WC8 A;  2ZRS A;  4PE4 A;  4ZCV A;  1IQ3 A;  3K21 A;  1SR6 C;  2FCD A;  3EKJ A;  1JBA A;  2K7O A;  3CR4 X;  1IRJ A;  3OB2 B;  5K89 A;  1UUS A;  4PE7 A;  2EC6 C;  2P6B B;  1U5I A;  3FIA A;  1TN4 A;  1CDL A;  3EVV A;  2LUX A;  3KF9 A;  1M46 A;  4MVF A;  2H61 C;  2KAV A;  2JT0 A;  1DJW A;  4YI9 A;  2KYF A;  3CR2 A;  1M31 A;  2M0R A;  1F8H A;  1AHR A;  1Y1A A;  2KI6 C;  4XJK A;  5IBW A;  1UUR A;  3M0W A;  2CT9 A;  1K94 A;  4MLW A;  3VGO A;  4CPV A;  2K7C A;  2PRU A;  4HRG A;  1QX5 B;  2M49 B;  3AAK A;  5KU1 A;  1BR4 B;  4MSP A;  3SIB A;  2LNK A;  1QS7 A;  4PE0 A;  2F33 A;  4CFR A;  3DVK A;  4A4B A;  1NCX A;  1UHJ A;  3KO0 A;  3MSE B;  1S1E A;  1KWO C;  2D8N A;  2I18 A;  3D0Y A;  5AAN A;  1S3P A;  1QX2 A;  2L2E A;  1CMF A;  1J7Q A;  1EG4 A;  2JUL A;  3EK4 A;  4M2O A;  2LVJ A;  1GJY A;  2KFG A;  1XFX O;  3NXA A;  5I2O A;  2BE6 A;  4CFQ A;  4JQ0 D;  4XJK B;  1FW4 A;  2M1K B;  2Y1M A;  3JTD C;  1S6C A;  4DRW A;  1NYA A;  1RTP 1;  2KQY A;  1QAS A;  3SG7 A;  2BBN A;  2OTG C;  4GUK A;  2HQ8 A;  3LCP C;  1YX8 A;  2CTN A;  1L2O C;  4DS7 A;  3CWG A;  3HX4 A;  3I5H C;  3OX5 A;  2LLT A;  1CDP A;  1PAL A;  1CM1 A;  3BUX B;  2K2F A;  2JTT A;  2KNE A;  1SYM A;  3D0Y B;  3HCM A;  4YGB B;  1YUR A;  1MUX A;  3AKA A;  1J7R A;  1KQM B;  1F4O A;  2LHL A;  5CPV A;  3TS5 B;  1OMV A;  4YBH B;  1QV0 A;  1TOP A;  2COL B;  4YGD B;  1LKJ A;  4YGC B;  2KBM A;  2CNP A;  2JWW A;  1PK0 D;  1IKU A;  2Y5I A;  1WDC C;  1YUS A;  1TNQ A;  3OX6 A;  1TNW A;  1NX0 A;  1JUO A;  2MAZ A;  1PSB A;  2ZKM X;  1M63 B;  1OQP A;  1X02 A;  1N65 A;  1DGU A;  1BR1 B;  4F0Z B;  1YVL A;  1Y1U A;  1S6J A;  1NP8 A;  1SL9 A;  3AKB A;  4MRX A;  1AJ5 A;  1KK8 B;  1OSA A;  2K0J A;  3PLF B;  3NSL A;  1QLS A;  4YGA A;  2NXQ A;  3EVU A;  3WHT B;  2F3Y A;  3NSO A;  4PE1 A;  5HYD A;  2M1U A;  3GK4 X;  2LMV A;  1KFX L;  2LUC A;  2Y1N A;  2L4H A;  1DF0 B;  1CB1 A;  1ZAC A;  5AFP A;  3I5F B;  4USL A;  5ER5 A;  2SCP A;  2MBX A;  3KPX A;  3IF7 A;  1YUU A;  4PHM A;  4U8D A;  5CSI A;  2G9B A;  2OTG B;  2BBM A;  2QPT A;  3KHE A;  4PDZ A;  1QVI Y;  2JT3 A;  2NCP A;  1UHH A;  2NLN A;  1HT9 A;  2KI6 D;  4HRE E;  2ZRT A;  1GGZ A;  2ISD A;  1CFF A;  1NX1 A;  1XVJ A;  1R6P A;  3DVM A;  2WND A;  4GGF A;  1JFK A;  2M97 A;  5JJG A;  1FI5 A;  2L50 A;  1F71 A;  1LXF C;  1CLM A;  2CCM A;  2AUC A;  3NSI A;  4ICB A;  2LE9 B;  1IQ5 A;  2KQ6 A;  5PAL A;  3VRN A;  3SG6 A;  2R2I A;  3PAL A;  1EG3 A;  1K2H A;  2V53 A;  3OB1 B;  4DCK A;  2KOT A;  2NZ0 A;  2JZI A;  1JWD A;  2KFF A;  2AMI A;  1K9U A;  3CTN A;  4GGN A;  1SMG A;  3NSK A;  2KGR A;  3SIA A;  1MHO A;  1SNL A;  3F45 A;  1DJH A;  2OPO A;  1J1D A;  4BY5 A;  2LVV A;  2WCF A;  5F6T A;  2SAS A;  2M7N A;  4QJ4 B;  5AEQ A;  1UWO A;  2KAX A;  3OP0 A;  2LAP A;  4R1E A;  1UHN A;  2BCX A;  5AXI A;  4PHJ A;  1KQM C;  1NSH A;  3TS5 C;  1CLB A;  1OZO A;  2BKI B;  1SPY A;  1MR8 A;  1SCV A;  3DVE A;  1AUI B;  1AK8 A;  5DKR A;  2JC2 A;  1YTZ C;  2MLE C;  1EH2 A;  4WQ3 A;  2JNX A;  1WLZ A;  1WRK A;  2WCB A;  2PAS A;  5HKY A;  1CNP A;  2PSR A;  1SY9 A;  4NDD A;  3VRO A;  2G2B A;  1K93 D;  2CBL A;  2BKH B;  1DJY A;  5GQQ C;  1TCF A;  2AAO A;  1FF1 A;  1JFJ A;  2K7B A;  1NIW A;  1KK8 C;  2GGM A;  3PFV A;  2F2P A;  1U5I B;  3TDI A;  2LP2 A;  1FPW A;  3ZWH A;  4OVN F;  4ORC B;  2ZN8 A;  5AER A;  3TZ1 A;  5HLV A;  2LM5 A;  1KSM A;  2L0P A;  1EJ3 A;  3FS7 A;  2I94 A;  1Y1X A;  3JVT B;  1BG1 A;  1BOC A;  1KCY A;  3I5F C;  1JSA A;  1C7W A;  2Q4U A;  4I5J A;  1SCM B;  3BXK A;  2H2K A;  3VRP A;  1W7I B;  3I5I B;  4HSZ A;  3CLN A;  1YRT B;  2E6W A;  4ORA B;  1ZMZ A;  2KI4 C;  1S5G Y;  1MXE A;  4I5N B;  2I7A A;  2HET A;  5DKQ A;  1B7T Z;  1B8L A;  1SKT A;  1ZFS A;  1YUT A;  3BYA A;  3D10 A;  3LLE A;  2LMT A;  1TRF A;  5I8N A;  1WRZ A;  1IJ5 A;  2JXC A;  3A8R A;  3ICB A;  2FOT A;  5G08 A;  1IJ6 A;  3GK2 A;  1LA0 A;  3O2P A;  1CFC A;  2KSP A;  1QAT A;  3SG3 A;  1DTL A;  4JPZ B;  1XFY O;  2KBI A;  2DOQ A;  1SL7 A;  1MQ1 A;  1OMR A;  2K7D A;  1K9K A;  4YRU A;  1CFD A;  1TNX A;  2EGD A;  1G8I A;  1GQM A;  1R2U A;  3BQ3 A;  3TUY C;  1QTX A;  1HQV A;  1V1F A;  2A4J A;  4OCI A;  3BUO B;  1S36 A;  2LP3 A;  4CLN A;  1BF5 A;  2LMU A;  1KQV A;  1EXR A;  2PMY A;  4GGF C;  5HKZ A;  2MRD A;  2LC5 A;  2M3W A;  1G4Y R;  3CZT X;  3I5G B;  2FJU B;  5JOL A;  1SW8 A;  1ALW A;  1SRA A;  2IS9 A;  4NQG A;  2LV7 A;  3RLZ A;  5CSJ A;  3IQQ A;  3EKH A;  1BU3 A;  4JWQ A;  1PSR A;  2WOS A;  1QIV A;  2BCB A;  3BOW A;  2PAL A;  1NCZ A;  1BT6 A;  1VRK A;  4IL1 A;  1B4C A;  1AP4 A;  1CTR A;  4PCW A;  1JF2 A;  2KFH A;  2KAY A;  3PN7 B;  4GBA A;  1L7Z A;  2M29 A;  1IG5 A;  1KK7 Y;  1BMO A;  5HKW A;  3EVR A;  3TDU A;  2KI4 B;  1ODB A;  1XA5 A;  1J7O A;  1M45 A;  1TTX A;  5CSN A;  1DJZ A;  1FI6 A;  4DUQ A;  1TIZ A;  1LA3 A;  4MZK A;  4OKH A;  3SG2 A;  4FTG A;  1CLL A;  1TNP A;  1MXL C;  1XFZ O;  4ZCU A;  1KFX S;  3BOW B;  5I2Q A;  2ZN9 A;  1S26 D;  1LIN A;  2CXJ A;  4N5X A;  1K95 A;  4UPG A;  2MLF C;  4QJ3 B;  1N0Y A;  5D7F A;  1RFJ A;  1IWQ A;  1F54 A;  3JVT C;  1K8U A;  4E68 A;  1GGW A;  2JU0 A;  1DT7 B;  2O5G A;  1SCM C;  1WY9 A;  3BUN B;  3TUY B;  1J55 A;  1XFW O;  1CMG A;  3I5I C;  3SJS A;  4I5K A;  2KHN A;  1PVB A;  1SK6 D;  2QAC A;  1M39 A;  1NCY A;  2OS8 B;  3E3R A;  2LVK A;  3C1V A;  4C0K A;  1PRW A;  1D1O A;  3IQO A;  4N1G A;  1B8R A;  1SL8 A;  1DMO A;  1S5G Z;  1WLM A;  2EHB A;  3WNX B;  2HF5 A;  4GPL B;  2GGZ A;  5TNC A;  2LHI A;  4MZL A;  2ZND A;  3O78 A;  1OMD A;  1YR5 A;  4M2P A;  1F4Q A;  3BUM B;  1XFV O;  2K8M B;  1NPQ A;  1K96 A;  3OHM B;  3SG5 A;  2JOJ A;  3CR5 X;  4GAO A;  4YI8 A;  2HQW A;  1DJX A;  1ZOT B;  1OE9 B;  2L51 A;  2M9G A;  3GOF A;  1KFU L;  1QLK A;  2JQ6 A;  2BL0 B;  3DD4 A;  3FWB A;  3I5G C;  3PAT A;  3SG4 A;  5B8I B;  1A29 A;  4TNC A;  2KDH A; 
#chains in the Genus database with same CATH topology
 2Y4Q A;  1ZUZ A;  1RJV A;  1BOD A;  1G33 A;  2RGI A;  3CGA A;  1J7P A;  2JNF A;  3VB1 A;  1RK9 A;  1OOF A;  4AQJ A;  2M8U A;  3S0E A;  1XK4 A;  3DXL A;  4NDC A;  4PAL A;  3WXA A;  3PN7 C;  3LL8 B;  2I2R E;  4PHN A;  4C0L A;  4BY4 A;  1JC2 A;  2JRF A;  1CM4 A;  2K61 A;  1C3Y A;  1XFU O;  4FQO A;  2YGU A;  1PUL A;  1V1G A;  1KFU S;  4GNK B;  2PVB A;  3B86 A;  1YRU B;  3AAJ A;  1C7V A;  1GM0 A;  1KK7 Z;  1LVC D;  1J1E A;  1MWN A;  2LAN A;  1JF0 A;  4XYN A;  1QVI Z;  4A4C A;  1UHK A;  4MEW A;  1CDM A;  1EL4 A;  5FYX A;  1TCO B;  2LLS A;  3BFH A;  3TDZ A;  1UP5 A;  3CS1 A;  5D69 A;  2H61 A;  1DQE A;  1DJI A;  4WQ2 A;  4FQT A;  4MZJ A;  3RM1 A;  4WRI A;  1Q80 A;  4YGE B;  3S0F A;  1XO5 A;  2L4I A;  2L98 A;  1SBJ A;  1F70 A;  1A75 A;  1Z4H A;  4CID A;  3O6B A;  1KSO A;  3FWC A;  1B47 A;  1SR6 B;  1ALV A;  1A4P A;  1MF8 B;  3DVJ A;  3CZ0 A;  3A4U B;  3WHU B;  1B8C A;  4GFT A;  1YX7 A;  2FCE A;  5I94 A;  3VRQ A;  3EK7 A;  2EC6 B;  4MN0 A;  1NUB A;  2OS8 C;  3SS3 A;  3UO9 A;  5I2L A;  4D1E A;  4AQI A;  4ETO A;  2BE4 A;  1K90 D;  2HPS A;  2JT8 A;  1DEK A;  1AVS A;  5KSZ A;  3RZS A;  3N7H A;  4N1F A;  5FI6 A;  1IGV A;  2F8P A;  1CDN A;  3D74 A;  5FI2 A;  1DF0 A;  2WC5 A;  4DIR A;  4PHK A;  2VRG A;  3O4Y A;  2WCM A;  2KYC A;  1H8B A;  1A75 B;  2WCE A;  1WRL A;  5ER4 X;  1QJT A;  1YVH A;  2LLU A;  2QDI A;  2ZNE A;  1B1G A;  1TUZ A;  1F55 A;  2WOR A;  4P5O E;  1Y6W A;  1BJF A;  4OV2 A;  1QX7 A;  4MBE A;  2JTZ A;  5CSF A;  1BLQ A;  5BPJ A;  1C07 A;  2JPT A;  2GV5 A;  1NX3 A;  2L5Y A;  4Q04 A;  2ZFD A;  3NGV A;  3LK1 A;  2BCA A;  1QIW A;  2F3Z A;  3B88 A;  5KTY A;  1KWO B;  1OZS A;  2MA2 A;  3DYE A;  3PSR A;  5HLO A;  4ORB B;  4PT1 A;  4QJ5 B;  3S0G A;  2BL0 C;  1W7J B;  3DF0 A;  3JTD B;  3H4S E;  2E30 A;  2MJW B;  1AJ4 A;  1B7T Y;  1QV1 A;  1Y0V H;  2H8V A;  2WC6 A;  2QEH A;  1IH0 A;  2F2O A;  2M7L A;  3VRR A;  1E8A A;  2Q91 A;  1OOJ A;  1L2O B;  2MHH A;  3I5H B;  1PVA A;  3PM8 A;  2TN4 A;  1A03 A;  4OR9 B;  1A2X A;  2P71 A;  2KGB C;  1K9P A;  1DC1 A;  3BUW B;  1DGV A;  1NX2 A;  1RWY A;  2QEB A;  3KEV A;  3NHI A;  1REC A;  4L9M A;  2O60 A;  1TUJ A;  1H4B A;  1XYD A;  1Z2C B;  2LVI A;  2QEV A;  3LK0 A;  3DF0 B;  3ZNI A;  4AOM A;  4C0J A;  1S6I A;  2JXL A;  4MRY A;  4HRH A;  2NCO A;  1DJG A;  1WDC B;  2LCP A;  3GK1 A;  4I5L B;  2BEC A;  3EK8 A;  4NDB A;  1QXP A;  5J3X A;  1RRO A;  2K2A A;  4M2Q A;  1XK4 C;  2L5X B;  1FBV A;  1CKK A;  1B9A A;  3O4X A;  3QRX A;  1CFP A;  3R72 A;  2B1U A;  1N2D A;  4P2Y B;  1DVI A;  5DKN A;  1UHI A;  1NWD A;  2WC8 A;  2ZRS A;  4PE4 A;  4ZCV A;  1IQ3 A;  3K21 A;  1SR6 C;  2PQL A;  2FCD A;  3EKJ A;  1JBA A;  2K7O A;  3CR4 X;  3L4A A;  1IRJ A;  3OB2 B;  5K89 A;  1UUS A;  4PE7 A;  2EC6 C;  2P6B B;  1U5I A;  3FIA A;  1TN4 A;  1CDL A;  3EVV A;  2LUX A;  2GTE A;  3KF9 A;  1M46 A;  3FE6 A;  4MVF A;  3S0D A;  2H61 C;  1OOH A;  2JT0 A;  2KAV A;  1DJW A;  4YI9 A;  2KYF A;  3CR2 A;  1M31 A;  2KLE A;  2M0R A;  5D3O A;  1F8H A;  1AHR A;  2WCK A;  2BAP A;  1Y1A A;  3PM2 A;  2KI6 C;  3CAB A;  4XJK A;  5IBW A;  1UUR A;  3M0W A;  2CT9 A;  1K94 A;  4MLW A;  3VGO A;  4CPV A;  2K7C A;  2PRU A;  4HRG A;  1QX5 B;  2M49 B;  3AAK A;  5KU1 A;  1BR4 B;  4INX A;  4MSP A;  3SIB A;  2LNK A;  1QS7 A;  4PE0 A;  2F33 A;  4CFR A;  3DVK A;  4A4B A;  1NCX A;  1OW4 A;  1UHJ A;  3KO0 A;  3MSE B;  1S1E A;  1KWO C;  2D8N A;  2I18 A;  3D0Y A;  5AAN A;  1S3P A;  1QX2 A;  2L2E A;  1CMF A;  1J7Q A;  1EG4 A;  2JUL A;  3EK4 A;  4M2O A;  2LVJ A;  3S0B A;  1GJY A;  2KFG A;  1XFX O;  3NXA A;  5I2O A;  2BE6 A;  4CFQ A;  4JQ0 D;  4XJK B;  3L47 A;  1FW4 A;  2M1K B;  2Y1M A;  3JTD C;  1S6C A;  4DRW A;  1NYA A;  1RTP 1;  2KQY A;  1T14 A;  1QAS A;  3SG7 A;  2BBN A;  2OTG C;  3B6X A;  4GUK A;  2HQ8 A;  3LCP C;  1YX8 A;  2CTN A;  1L2O C;  4DS7 A;  3CWG A;  3HX4 A;  3I5H C;  3OX5 A;  2LLT A;  1CDP A;  1PAL A;  1CM1 A;  3EG5 B;  2BNX A;  1LS8 A;  2K2F A;  3BUX B;  2JTT A;  2KNE A;  1SYM A;  3D0Y B;  3HCM A;  4YGB B;  1YUR A;  1MUX A;  3AKA A;  1J7R A;  1KQM B;  1F4O A;  2LHL A;  5CPV A;  3TS5 B;  1OMV A;  4YBH B;  3CZ2 A;  3CZ1 A;  1QV0 A;  1TOP A;  2COL B;  4YGD B;  3NHT A;  1LKJ A;  4YGC B;  2KBM A;  2CNP A;  2JWW A;  1PK0 D;  1IKU A;  2Y5I A;  1WDC C;  5FI7 A;  2WCH A;  1YUS A;  2FJY A;  3D76 A;  1TNQ A;  3OX6 A;  1TNW A;  1NX0 A;  1JUO A;  2MAZ A;  3V2L A;  1PSB A;  2ZKM X;  1M63 B;  1TWO A;  1OQP A;  1X02 A;  1N65 A;  1DGU A;  1BR1 B;  4F0Z B;  1Y1U A;  1YVL A;  1S6J A;  1NP8 A;  1SL9 A;  3AKB A;  1P28 A;  4MRX A;  1AJ5 A;  1KK8 B;  1OSA A;  2K0J A;  3PLF B;  3NSL A;  1QLS A;  4YGA A;  2NXQ A;  3EVU A;  3WHT B;  2F3Y A;  3NSO A;  4PE1 A;  5HYD A;  2M1U A;  3GK4 X;  2LMV A;  3PJI A;  1KFX L;  2LUC A;  2Y1N A;  2L4H A;  1DF0 B;  1CB1 A;  1ZAC A;  5AFP A;  3I5F B;  4USL A;  5ER5 A;  2SCP A;  3FE9 A;  2MBX A;  3KPX A;  3IF7 A;  1YUU A;  4PHM A;  4U8D A;  5CSI A;  2G9B A;  3IVT A;  2OTG B;  2BBM A;  2QPT A;  3KHE A;  4PDZ A;  1QVI Y;  2JT3 A;  2NCP A;  1UHH A;  2NLN A;  1HT9 A;  2KI6 D;  1IIO A;  4HRE E;  2ZRT A;  1GGZ A;  2ISD A;  1CFF A;  3SS5 A;  1NX1 A;  1XVJ A;  1R6P A;  3DVM A;  2WND A;  4GGF A;  1JFK A;  2M97 A;  5JJG A;  1FI5 A;  2L50 A;  1F71 A;  1LXF C;  1CLM A;  2CCM A;  2AUC A;  3NSI A;  4ICB A;  2LE9 B;  1IQ5 A;  2KQ6 A;  5PAL A;  3VRN A;  3SG6 A;  2R2I A;  3QME A;  3PAL A;  1EG3 A;  1K2H A;  2V53 A;  3OB1 B;  4DCK A;  2KOT A;  2NZ0 A;  2JZI A;  1QWV A;  1JWD A;  2KFF A;  2AMI A;  1K9U A;  3CTN A;  4GGN A;  1SMG A;  3NSK A;  2KGR A;  3SIA A;  1DEL A;  1MHO A;  1SNL A;  3F45 A;  1DJH A;  2OPO A;  1J1D A;  4BY5 A;  2LVV A;  3D78 A;  2WCF A;  5F6T A;  1OOI X;  2SAS A;  4IJ7 A;  2M7N A;  4QJ4 B;  5AEQ A;  3CYZ A;  1UWO A;  2KAX A;  3OP0 A;  2LAP A;  4R1E A;  1UHN A;  2BCX A;  3BFA A;  5AXI A;  4PHJ A;  1KQM C;  1NSH A;  3TS5 C;  1CLB A;  1OZO A;  2BKI B;  1SPY A;  1MR8 A;  1SCV A;  3DVE A;  1AUI B;  1AK8 A;  5DKR A;  2JC2 A;  1YTZ C;  2L2C A;  2KLD A;  2MLE C;  4WQ3 A;  2JNX A;  1EH2 A;  1WLZ A;  1WRK A;  1C3Z A;  2K60 A;  2PAS A;  1XFR A;  2WCB A;  2PSR A;  5HKY A;  1CNP A;  1SY9 A;  4NDD A;  3VRO A;  2G2B A;  2ERB A;  1K93 D;  2CBL A;  2BKH B;  1DJY A;  5GQQ C;  1TCF A;  2AAO A;  3DZT A;  3K1E A;  2KPH A;  1FF1 A;  1JFJ A;  2K7B A;  1NIW A;  1KK8 C;  2GGM A;  3PFV A;  2F2P A;  1U5I B;  3TDI A;  2LP2 A;  1FPW A;  3ZWH A;  4OVN F;  4ORC B;  4JD9 A;  2ZN8 A;  5AER A;  3TZ1 A;  3R1V A;  2LM5 A;  1KSM A;  5HLV A;  2L0P A;  1EJ3 A;  3FS7 A;  2I94 A;  3BFB A;  1Y1X A;  3D73 A;  3R1O A;  3JVT B;  1BG1 A;  1BOC A;  1KCY A;  3I5F C;  1JSA A;  1C7W A;  2Q4U A;  4I5J A;  1OOG A;  1SCM B;  3BXK A;  1SSE B;  2H2K A;  3VRP A;  1W7I B;  3I5I B;  1W9Z A;  3OBV A;  3CLN A;  4HSZ A;  1YRT B;  2E6W A;  3R1P A;  4KYN A;  1ZMZ A;  2KI4 C;  1S5G Y;  4ORA B;  1MXE A;  4I5N B;  2I7A A;  2HET A;  5DKQ A;  1B7T Z;  1B8L A;  1SKT A;  1ZFS A;  1YUT A;  3B87 A;  3BYA A;  3D10 A;  2LMT A;  1TRF A;  3LLE A;  5I8N A;  3S0A A;  1WRZ A;  1IJ5 A;  2JXC A;  3A8R A;  3ICB A;  2FOT A;  5G08 A;  1IJ6 A;  3GK2 A;  1LA0 A;  3O2P A;  1CFC A;  2KSP A;  1QAT A;  3SG3 A;  1DTL A;  3D77 A;  2P70 A;  4INW A;  4JPZ B;  1XFY O;  2KBI A;  2DOQ A;  4F7F A;  1SL7 A;  1MQ1 A;  1OMR A;  2K7D A;  4JKT A;  1K9K A;  4YRU A;  1CFD A;  1TNX A;  2EGD A;  1G8I A;  1GQM A;  1R2U A;  3BQ3 A;  2JPO A;  3TUY C;  1QTX A;  3D75 A;  1HQV A;  1V1F A;  2A4J A;  4OCI A;  3BUO B;  1S36 A;  2LP3 A;  4CLN A;  1BF5 A;  2LMU A;  3L4L A;  1KQV A;  1EXR A;  2PMY A;  4GGF C;  5HKZ A;  2MRD A;  2LC5 A;  2M3W A;  1G4Y R;  3CZT X;  3I5G B;  2FJU B;  5JOL A;  1SW8 A;  1ALW A;  1SRA A;  2IS9 A;  3DY9 A;  4NQG A;  2LV7 A;  3RLZ A;  5CSJ A;  3IQQ A;  3EKH A;  1BU3 A;  4JWQ A;  1PSR A;  2WOS A;  1QIV A;  2BCB A;  3BOW A;  2PAL A;  1NCZ A;  1BT6 A;  1VRK A;  4IL1 A;  2WCJ A;  1B4C A;  1AP4 A;  1CTR A;  4PCW A;  1JF2 A;  2KFH A;  2KAY A;  3PN7 B;  4GBA A;  1ORG A;  1L7Z A;  3SS4 A;  2M29 A;  1IG5 A;  1KK7 Y;  1BMO A;  5HKW A;  3EVR A;  3TDU A;  2PYQ A;  2KI4 B;  1ODB A;  3Q8I A;  1XA5 A;  1J7O A;  1M45 A;  3B7A A;  1TTX A;  5CSN A;  5DIC A;  1DJZ A;  1FI6 A;  4DUQ A;  1TIZ A;  1LA3 A;  4MZK A;  4OKH A;  3SG2 A;  4FTG A;  1CLL A;  1TNP A;  1MXL C;  1XFZ O;  4ZCU A;  1KFX S;  3BOW B;  5I2Q A;  2ZN9 A;  1S26 D;  1LIN A;  2CXJ A;  4N5X A;  5HL1 A;  3CDN A;  1K95 A;  4UPG A;  2MLF C;  4QJ3 B;  3UNW A;  1N0Y A;  5D7F A;  1RFJ A;  1IWQ A;  1F54 A;  3JVT C;  1K8U A;  4E68 A;  1GGW A;  2JU0 A;  1DT7 B;  2O5G A;  3BJH A;  1SCM C;  1WY9 A;  3BUN B;  3TUY B;  1J55 A;  1XFW O;  1CMG A;  3I5I C;  3SJS A;  4I5K A;  2KHN A;  2WCL A;  1PVB A;  1SK6 D;  2QAC A;  1M39 A;  1NCY A;  4OZD A;  2OS8 B;  3E3R A;  2LVK A;  2QEO A;  3C1V A;  4C0K A;  1PRW A;  1D1O A;  3IQO A;  4N1G A;  1B8R A;  1SL8 A;  1DMO A;  1S5G Z;  1WLM A;  2EHB A;  3WNX B;  2HF5 A;  4GPL B;  2GGZ A;  5TNC A;  2LHI A;  4MZL A;  2ZND A;  3O78 A;  3FE8 A;  1OMD A;  1YR5 A;  4M2P A;  1F4Q A;  3BUM B;  1XFV O;  2K8M B;  1NPQ A;  1K96 A;  3OHM B;  3SG5 A;  2JOJ A;  3CR5 X;  4GAO A;  4YI8 A;  2HQW A;  1DJX A;  1ZOT B;  5EL2 A;  1OE9 B;  3OGN A;  2L51 A;  2M9G A;  3GOF A;  1KFU L;  1QLK A;  2JQ6 A;  2BL0 B;  3DD4 A;  3FWB A;  3I5G C;  3PAT A;  3SG4 A;  5B8I B;  1A29 A;  4TNC A;  2KDH A; 
#chains in the Genus database with same CATH homology
 2Y4Q A;  1ZUZ A;  1RJV A;  1BOD A;  1G33 A;  2RGI A;  3CGA A;  1J7P A;  2JNF A;  1RK9 A;  4AQJ A;  2M8U A;  1XK4 A;  4NDC A;  4PAL A;  3WXA A;  3PN7 C;  3LL8 B;  2I2R E;  4PHN A;  4C0L A;  4BY4 A;  1JC2 A;  2JRF A;  1CM4 A;  2K61 A;  1XFU O;  4FQO A;  1PUL A;  1V1G A;  1KFU S;  4GNK B;  2PVB A;  1YRU B;  3AAJ A;  1C7V A;  1KK7 Z;  1LVC D;  1J1E A;  1MWN A;  2LAN A;  1JF0 A;  4XYN A;  1QVI Z;  4A4C A;  1UHK A;  4MEW A;  1CDM A;  1EL4 A;  5FYX A;  1TCO B;  2LLS A;  3TDZ A;  1UP5 A;  3CS1 A;  5D69 A;  2H61 A;  1DJI A;  4WQ2 A;  4MZJ A;  3RM1 A;  4WRI A;  1Q80 A;  4YGE B;  1F70 A;  1XO5 A;  2L4I A;  2L98 A;  1SBJ A;  1A75 A;  4CID A;  3O6B A;  1KSO A;  3FWC A;  1B47 A;  1SR6 B;  1ALV A;  1A4P A;  1MF8 B;  3DVJ A;  3A4U B;  3WHU B;  1B8C A;  4GFT A;  1YX7 A;  2FCE A;  3VRQ A;  3EK7 A;  2EC6 B;  4MN0 A;  1NUB A;  2OS8 C;  4D1E A;  5I2L A;  4AQI A;  4ETO A;  2BE4 A;  1K90 D;  2HPS A;  2JT8 A;  5KSZ A;  1AVS A;  4N1F A;  1IGV A;  2F8P A;  1CDN A;  1DF0 A;  4DIR A;  4PHK A;  2VRG A;  3O4Y A;  2KYC A;  1H8B A;  1A75 B;  2WCE A;  1WRL A;  5ER4 X;  1QJT A;  1YVH A;  2LLU A;  2ZNE A;  1B1G A;  1F55 A;  2WOR A;  4P5O E;  1Y6W A;  1BJF A;  4OV2 A;  1QX7 A;  4MBE A;  2JTZ A;  5CSF A;  1BLQ A;  5BPJ A;  1C07 A;  2JPT A;  2GV5 A;  1NX3 A;  4Q04 A;  2ZFD A;  3LK1 A;  2BCA A;  1QIW A;  2F3Z A;  5KTY A;  1KWO B;  1OZS A;  2MA2 A;  3PSR A;  5HLO A;  4ORB B;  4QJ5 B;  2BL0 C;  1W7J B;  3DF0 A;  3JTD B;  3H4S E;  2E30 A;  2MJW B;  1AJ4 A;  1B7T Y;  1QV1 A;  1Y0V H;  1IH0 A;  2F2O A;  2M7L A;  3VRR A;  1E8A A;  2Q91 A;  1OOJ A;  1L2O B;  2MHH A;  3I5H B;  1PVA A;  3PM8 A;  2TN4 A;  1A03 A;  4OR9 B;  1A2X A;  2KGB C;  1K9P A;  3BUW B;  1DGV A;  1NX2 A;  1RWY A;  3KEV A;  4L9M A;  1REC A;  2O60 A;  1H4B A;  1XYD A;  2LVI A;  3LK0 A;  3DF0 B;  3ZNI A;  4AOM A;  4C0J A;  1S6I A;  2JXL A;  4MRY A;  4HRH A;  2NCO A;  1DJG A;  1WDC B;  2LCP A;  3GK1 A;  4I5L B;  2BEC A;  3EK8 A;  4NDB A;  1QXP A;  5J3X A;  1RRO A;  2K2A A;  4M2Q A;  1XK4 C;  2L5X B;  1FBV A;  1CKK A;  1B9A A;  3QRX A;  1CFP A;  2B1U A;  1N2D A;  4P2Y B;  1DVI A;  5DKN A;  1UHI A;  1NWD A;  2WC8 A;  2ZRS A;  4PE4 A;  4ZCV A;  1IQ3 A;  3K21 A;  1SR6 C;  2FCD A;  3EKJ A;  1JBA A;  2K7O A;  3CR4 X;  1IRJ A;  3OB2 B;  5K89 A;  1UUS A;  4PE7 A;  2EC6 C;  2P6B B;  1U5I A;  3FIA A;  1TN4 A;  1CDL A;  3EVV A;  2LUX A;  3KF9 A;  1M46 A;  4MVF A;  2H61 C;  2KAV A;  2JT0 A;  1DJW A;  4YI9 A;  2KYF A;  3CR2 A;  1M31 A;  2M0R A;  1F8H A;  1AHR A;  1Y1A A;  2KI6 C;  4XJK A;  5IBW A;  1UUR A;  3M0W A;  2CT9 A;  1K94 A;  4MLW A;  3VGO A;  4CPV A;  2K7C A;  2PRU A;  4HRG A;  1QX5 B;  2M49 B;  3AAK A;  5KU1 A;  1BR4 B;  4MSP A;  3SIB A;  2LNK A;  1QS7 A;  4PE0 A;  2F33 A;  4CFR A;  3DVK A;  4A4B A;  1NCX A;  1UHJ A;  3KO0 A;  3MSE B;  1S1E A;  1KWO C;  2D8N A;  2I18 A;  3D0Y A;  5AAN A;  1S3P A;  1QX2 A;  2L2E A;  1CMF A;  1J7Q A;  1EG4 A;  2JUL A;  3EK4 A;  4M2O A;  2LVJ A;  1GJY A;  2KFG A;  1XFX O;  3NXA A;  5I2O A;  2BE6 A;  4CFQ A;  4JQ0 D;  4XJK B;  1FW4 A;  2M1K B;  2Y1M A;  3JTD C;  1S6C A;  4DRW A;  1NYA A;  1RTP 1;  2KQY A;  1QAS A;  3SG7 A;  2BBN A;  2OTG C;  4GUK A;  2HQ8 A;  3LCP C;  1YX8 A;  2CTN A;  1L2O C;  4DS7 A;  3CWG A;  3HX4 A;  3I5H C;  3OX5 A;  2LLT A;  1CDP A;  1PAL A;  1CM1 A;  3BUX B;  2K2F A;  2JTT A;  2KNE A;  1SYM A;  3D0Y B;  3HCM A;  4YGB B;  1YUR A;  1MUX A;  3AKA A;  1J7R A;  1KQM B;  1F4O A;  2LHL A;  5CPV A;  3TS5 B;  1OMV A;  4YBH B;  1QV0 A;  1TOP A;  2COL B;  4YGD B;  1LKJ A;  4YGC B;  2KBM A;  2CNP A;  2JWW A;  1PK0 D;  1IKU A;  2Y5I A;  1WDC C;  1YUS A;  1TNQ A;  3OX6 A;  1TNW A;  1NX0 A;  1JUO A;  2MAZ A;  1PSB A;  2ZKM X;  1M63 B;  1OQP A;  1X02 A;  1N65 A;  1DGU A;  1BR1 B;  4F0Z B;  1YVL A;  1Y1U A;  1S6J A;  1NP8 A;  1SL9 A;  3AKB A;  4MRX A;  1AJ5 A;  1KK8 B;  1OSA A;  2K0J A;  3PLF B;  3NSL A;  1QLS A;  4YGA A;  2NXQ A;  3EVU A;  3WHT B;  2F3Y A;  3NSO A;  4PE1 A;  5HYD A;  2M1U A;  3GK4 X;  2LMV A;  1KFX L;  2LUC A;  2Y1N A;  2L4H A;  1DF0 B;  1CB1 A;  1ZAC A;  5AFP A;  3I5F B;  4USL A;  5ER5 A;  2SCP A;  2MBX A;  3KPX A;  3IF7 A;  1YUU A;  4PHM A;  4U8D A;  5CSI A;  2G9B A;  2OTG B;  2BBM A;  2QPT A;  3KHE A;  4PDZ A;  1QVI Y;  2JT3 A;  2NCP A;  1UHH A;  2NLN A;  1HT9 A;  2KI6 D;  4HRE E;  2ZRT A;  1GGZ A;  2ISD A;  1CFF A;  1NX1 A;  1XVJ A;  1R6P A;  3DVM A;  2WND A;  4GGF A;  1JFK A;  2M97 A;  5JJG A;  1FI5 A;  2L50 A;  1F71 A;  1LXF C;  1CLM A;  2CCM A;  2AUC A;  3NSI A;  4ICB A;  2LE9 B;  1IQ5 A;  2KQ6 A;  5PAL A;  3VRN A;  3SG6 A;  2R2I A;  3PAL A;  1EG3 A;  1K2H A;  2V53 A;  3OB1 B;  4DCK A;  2KOT A;  2NZ0 A;  2JZI A;  1JWD A;  2KFF A;  2AMI A;  1K9U A;  3CTN A;  4GGN A;  1SMG A;  3NSK A;  2KGR A;  3SIA A;  1MHO A;  1SNL A;  3F45 A;  1DJH A;  2OPO A;  1J1D A;  4BY5 A;  2LVV A;  2WCF A;  5F6T A;  2SAS A;  2M7N A;  4QJ4 B;  5AEQ A;  1UWO A;  2KAX A;  3OP0 A;  2LAP A;  4R1E A;  1UHN A;  2BCX A;  5AXI A;  4PHJ A;  1KQM C;  1NSH A;  3TS5 C;  1CLB A;  1OZO A;  2BKI B;  1SPY A;  1MR8 A;  1SCV A;  3DVE A;  1AUI B;  1AK8 A;  5DKR A;  2JC2 A;  1YTZ C;  2MLE C;  1EH2 A;  4WQ3 A;  2JNX A;  1WLZ A;  1WRK A;  2WCB A;  2PAS A;  5HKY A;  1CNP A;  2PSR A;  1SY9 A;  4NDD A;  3VRO A;  2G2B A;  1K93 D;  2CBL A;  2BKH B;  1DJY A;  5GQQ C;  1TCF A;  2AAO A;  1FF1 A;  1JFJ A;  2K7B A;  1NIW A;  1KK8 C;  2GGM A;  3PFV A;  2F2P A;  1U5I B;  3TDI A;  2LP2 A;  1FPW A;  3ZWH A;  4OVN F;  4ORC B;  2ZN8 A;  5AER A;  3TZ1 A;  5HLV A;  2LM5 A;  1KSM A;  2L0P A;  1EJ3 A;  3FS7 A;  2I94 A;  1Y1X A;  3JVT B;  1BG1 A;  1BOC A;  1KCY A;  3I5F C;  1JSA A;  1C7W A;  2Q4U A;  4I5J A;  1SCM B;  3BXK A;  2H2K A;  3VRP A;  1W7I B;  3I5I B;  4HSZ A;  3CLN A;  1YRT B;  2E6W A;  4ORA B;  1ZMZ A;  2KI4 C;  1S5G Y;  1MXE A;  4I5N B;  2I7A A;  2HET A;  5DKQ A;  1B7T Z;  1B8L A;  1SKT A;  1ZFS A;  1YUT A;  3BYA A;  3D10 A;  3LLE A;  2LMT A;  1TRF A;  5I8N A;  1WRZ A;  1IJ5 A;  2JXC A;  3A8R A;  3ICB A;  2FOT A;  5G08 A;  1IJ6 A;  3GK2 A;  1LA0 A;  3O2P A;  1CFC A;  2KSP A;  1QAT A;  3SG3 A;  1DTL A;  4JPZ B;  1XFY O;  2KBI A;  2DOQ A;  1SL7 A;  1MQ1 A;  1OMR A;  2K7D A;  1K9K A;  4YRU A;  1CFD A;  1TNX A;  2EGD A;  1G8I A;  1GQM A;  1R2U A;  3BQ3 A;  3TUY C;  1QTX A;  1HQV A;  1V1F A;  2A4J A;  4OCI A;  3BUO B;  1S36 A;  2LP3 A;  4CLN A;  1BF5 A;  2LMU A;  1KQV A;  1EXR A;  2PMY A;  4GGF C;  5HKZ A;  2MRD A;  2LC5 A;  2M3W A;  1G4Y R;  3CZT X;  3I5G B;  2FJU B;  5JOL A;  1SW8 A;  1ALW A;  1SRA A;  2IS9 A;  4NQG A;  2LV7 A;  3RLZ A;  5CSJ A;  3IQQ A;  3EKH A;  1BU3 A;  4JWQ A;  1PSR A;  2WOS A;  1QIV A;  2BCB A;  3BOW A;  2PAL A;  1NCZ A;  1BT6 A;  1VRK A;  4IL1 A;  1B4C A;  1AP4 A;  1CTR A;  4PCW A;  1JF2 A;  2KFH A;  2KAY A;  3PN7 B;  4GBA A;  1L7Z A;  2M29 A;  1IG5 A;  1KK7 Y;  1BMO A;  5HKW A;  3EVR A;  3TDU A;  2KI4 B;  1ODB A;  1XA5 A;  1J7O A;  1M45 A;  1TTX A;  5CSN A;  1DJZ A;  1FI6 A;  4DUQ A;  1TIZ A;  1LA3 A;  4MZK A;  4OKH A;  3SG2 A;  4FTG A;  1CLL A;  1TNP A;  1MXL C;  1XFZ O;  4ZCU A;  1KFX S;  3BOW B;  5I2Q A;  2ZN9 A;  1S26 D;  1LIN A;  2CXJ A;  4N5X A;  1K95 A;  4UPG A;  2MLF C;  4QJ3 B;  1N0Y A;  5D7F A;  1RFJ A;  1IWQ A;  1F54 A;  3JVT C;  1K8U A;  4E68 A;  1GGW A;  2JU0 A;  1DT7 B;  2O5G A;  1SCM C;  1WY9 A;  3BUN B;  3TUY B;  1J55 A;  1XFW O;  1CMG A;  3I5I C;  3SJS A;  4I5K A;  2KHN A;  1PVB A;  1SK6 D;  2QAC A;  1M39 A;  1NCY A;  2OS8 B;  3E3R A;  2LVK A;  3C1V A;  4C0K A;  1PRW A;  1D1O A;  3IQO A;  4N1G A;  1B8R A;  1SL8 A;  1DMO A;  1S5G Z;  1WLM A;  2EHB A;  3WNX B;  2HF5 A;  4GPL B;  2GGZ A;  5TNC A;  2LHI A;  4MZL A;  2ZND A;  3O78 A;  1OMD A;  1YR5 A;  4M2P A;  1F4Q A;  3BUM B;  1XFV O;  2K8M B;  1NPQ A;  1K96 A;  3OHM B;  3SG5 A;  2JOJ A;  3CR5 X;  4GAO A;  4YI8 A;  2HQW A;  1DJX A;  1ZOT B;  1OE9 B;  2L51 A;  2M9G A;  3GOF A;  1KFU L;  1QLK A;  2JQ6 A;  2BL0 B;  3DD4 A;  3FWB A;  3I5G C;  3PAT A;  3SG4 A;  5B8I B;  1A29 A;  4TNC A;  2KDH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...