1BODA

The solution structures of mutant calbindin d9k's, as determined by nmr, show that the calcium binding site can adopt different folds
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
74
structure length
74
Chain Sequence
MKSPEELKGIFEKYDKEGDGQLSKEELKLLLQTEFPSLLKGMSTLDELFEELDKNGDGEVSFEEFQVLVKKISQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Calcium-binding protein
molecule keywords CALBINDIN D9K
publication title The solution structures of mutant calbindin D9k's, as determined by NMR, show that the calcium-binding site can adopt different folds.
pubmed doi rcsb
source organism Bos taurus
total genus 6
structure length 74
sequence length 74
ec nomenclature
pdb deposition date 1993-04-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1bodA00
1QV1A 3CGAA 2LUXA 1DJGA 2JPTA 2L4HA 1A75B 1K90D 1YX7A 5DKQA 1SKTA 2K0JA 2K7BA 1ZMZA 2CXJA 2KAYA 3PFVA 1YVHA 4U8DA 5KTYA 2JT8A 4PALA 3LLEA 2FCEA 2JOJA 1LINA 4M2OA 1G4YR 4CFRA 3FS7A 1YR5A 1CLMA 2I7AA 1JFKA 3SIAA 2KOTA 3OX5A 1DJXA 1QIVA 1N2DA 1U5IB 1PSBA 4E68A 2KFFA 4MZJA 1K94A 1TIZA 1XVJA 1F8HA 1ZUZA 1UURA 3PM8A 1NIWA 2BKIB 1G8IA 4GBAA 2LUCA 1B7TZ 5D69A 2LAPA 1UUSA 4N1FA 2EGDA 4MLWA 5HLOA 3OB1B 3TS5C 1N65A 1OMVA 3I5HC 3CZTX 2LVJA 3KO0A 1LA3A 1W7JB 1QLSA 3M0WA 4N1GA 2JRFA 5CSIA 2KI4C 2H61C 1Y1UA 2WCEA 3BUMB 1NX0A 2CBLA 4GPLB 5DKRA 1A29A 1PALA 3ICBA 4WQ2A 4CIDA 1M46A 2ZN8A 1K9UA 4AQIA 2NZ0A 1ALVA 2LLTA 4GGFC 4P5OE 1FI5A 1MUXA 2OS8B 3GK2A 1RWYA 2Q91A 1YVLA 2I94A 3LL8B 3SG3A 1GGWA 2BE4A 2M3WA 1CTRA 2GV5A 4PHKA 1LVCD 1AHRA 3I5IB 1YUUA 2KGRA 5CPVA 1SR6B 1SRAA 3OX6A 4DUQA 2LMTA 2H61A 3TDUA 2M9GA 1M45A 2H2KA 3A4UB 4NDBA 4GGFA 3BXKA 3TZ1A 1CFCA 2KQ6A 3JVTB 3I5FC 4PHNA 2LV7A 3CWGA 1ZFSA 1QVIY 1FF1A 4YGAA 3NXAA 1YUSA 4M2QA 2PASA 3PSRA 1CMGA 1TOPA 3RM1A 4PCWA 1JUOA 5CSFA 4QJ3B 1NUBA 1OQPA 1SCVA 1WRLA 2FOTA 2JT0A 3NSOA 1F71A 5AFPA 3KF9A 5HKYA 1KQMC 2QPTA 3I5HB 1S5GY 1PVAA 2P6BB 4ORAB 4YGBB 2KI4B 1IJ6A 4P2YB 3QRXA 1MWNA 3D10A 1F70A 3BQ3A 2BCAA 4YI9A 1BU3A 2ZKMX 4M2PA 5AERA 1NCXA 1J7PA 4AOMA 1KFUL 2OPOA 3GK4X 1KK7Y 1TNWA 1F4QA 2PMYA 1L2OC 1K9KA 2ZFDA 3BOWB 4OV2A 4TNCA 4PHMA 2K7OA 2EC6B 2K7DA 1AUIB 3WXAA 4D1EA 3AAKA 1B4CA 2MLEC 1BJFA 1JF2A 1OZSA 3AKBA 1K93D 2BKHB 5FYXA 3O4YA 1BF5A 1BLQA 2PVBA 1YTZC 1S6CA 3PN7C 1DT7B 4GUKA 1UHKA 5ER4X 4QJ5B 1Q80A 1MR8A 1NX1A 2RGIA 2ZRSA 2KNEA 2K2AA 2I18A 1F4OA 2KBIA 4JPZB 2WORA 4GFTA 1BR4B 3WNXB 3EK7A 5IBWA 3TUYC 2SCPA 3FIAA 1F54A 2KGBC 1DF0A 1RK9A 2ZNEA 3NSLA 2D8NA 2KHNA 4NDDA 4YBHB 1H4BA 1B8CA 2JT3A 3BUXB 1QIWA 2KBMA 4AQJA 1TN4A 3FWCA 2JNFA 1BODA 3ZWHA 1BG1A 4PE0A 1EXRA 1B8LA 3DD4A 4DS7A 1IKUA 1HQVA 1XYDA 3AKAA 3O2PA 1EG3A 2M7LA 1IRJA 4HSZA 3SJSA 1RJVA 2WNDA 1L2OB 1NX2A 2MBXA 3JTDB 4WQ3A 1NCYA 5AXIA 1S1EA 2OTGC 1K8UA 1CLLA 3FWBA 1LXFC 3DVKA 2F8PA 4YI8A 3LK0A 2M8UA 1CDMA 1CFPA 3EVVA 4YGDB 1B7TY 1FI6A 1QATA 3IQQA 1BMOA 3BUWB 2L98A 2M29A 1EH2A 1LKJA 2AUCA 4XJKA 1JWDA 1QX2A 1XFVO 3PN7B 1HT9A 1KFXL 2CNPA 2KAXA 5ER5A 5I2LA 1BOCA 4I5JA 1MQ1A 1AVSA 1SL8A 3VRNA 1SCMC 1DJIA 1UHIA 4OR9B 1AJ5A 3VROA 1V1FA 2L51A 2MJWB 3HX4A 2KYCA 2M97A 2EHBA 2NLNA 1AJ4A 2R2IA 2BL0C 2B1UA 3NSIA 2JC2A 2LVKA 3GOFA 4CFQA 2K7CA 2QACA 1NCZA 1CNPA 1DJHA 1YX8A 2PSRA 4GGNA 1F55A 1K95A 1UHNA 3CLNA 1JF0A 1CKKA 1WRKA 1DVIA 1SW8A 1K96A 2NCOA 2M1UA 1ODBA 1R2UA 3KHEA 4XJKB 5F6TA 2LLUA 1UHJA 1SMGA 3CR4X 4PDZA 1QJTA 4C0KA 3I5GC 4OCIA 1TNQA 2L50A 1TCOB 2HETA 4DRWA 1IGVA 4DCKA 1BT6A 1L7ZA 2E6WA 3LCPC 2BCBA 2K2FA 3TS5B 1QVIZ 2JTTA 2E30A 5HLVA 4MEWA 1MF8B 1QX5B 4XYNA 1M39A 4WRIA 2JULA 1XFUO 3KPXA 3RLZA 3DVEA 1QLKA 2F2OA 5GQQC 1OZOA 3H4SE 4OKHA 1XFZO 2KI6C 3PALA 2KSPA 2HQWA 2KFHA 4PHJA 1KFUS 1J1EA 2KYFA 4MSPA 3DVMA 3BUOB 2MHHA 1D1OA 3D0YA 2LVIA 2NCPA 1X02A 1JC2A 1RROA 2F3ZA 4HRGA 1DGVA 5TNCA 1S26D 2O60A 2TN4A 5CSNA 2GGZA 4MRXA 2F3YA 5HYDA 4HREE 1C7VA 3F45A 1YRTB 4GAOA 1OMRA 2DOQA 1C07A 1SBJA 1J1DA 2PRUA 2LCPA 2KI6D 4MN0A 2LANA 3C1VA 4F0ZB 3OB2B 1A4PA 2JXCA 1KQVA 1UHHA 3I5FB 1H8BA 4CLNA 2O5GA 5D7FA 2WC8A 4C0LA 1TNXA 1NYAA 1A75A 3ZNIA 2M0RA 5JJGA 5J3XA 1AK8A 4YRUA 1KWOC 1N0YA 3PLFB 1K2HA 4OVNF 2LHIA 3OHMB 3BYAA 2Y1NA 1ZACA 2KFGA 3GK1A 3SG4A 5I8NA 5AANA 1V1GA 4I5NB 2HPSA 4N5XA 2ZN9A 2Y4QA 5I2OA 1J7OA 4IL1A 1DTLA 1KQMB 1WDCC 5HKWA 1TTXA 2MLFC 1JSAA 2ZNDA 2LVVA 2OS8C 4MZKA 3E3RA 1TRFA 1OSAA 1IWQA 3EVRA 1S5GZ 1J55A 1SL7A 3OP0A 1M63B 1CFFA 3DF0A 2LE9B 4YGCB 1QASA 4C0JA 2VRGA 2CCMA 3EKJA 3MSEB 4Q04A 1KK8C 1FBVA 1SR6C 2Y1MA 3SG7A 1JBAA 3IF7A 2V53A 3NSKA 1CFDA 2KQYA 2L2EA 1IQ3A 1DF0B 2BCXA 4PE7A 4CPVA 5BPJA 1S3PA 1SYMA 1FW4A 1XO5A 2IS9A 1NPQA 2M7NA 2MRDA 3JVTC 3TDZA 4MBEA 1KCYA 1NWDA 1RFJA 3EK8A 1EJ3A 3EK4A 4ICBA 5CSJA 3VRRA 2LMVA 1CMFA 2G2BA 5K89A 2LP2A 1KFXS 1B8RA 4A4BA 2MA2A 5B8IB 4I5LB 1S36A 1FPWA 1TNPA 1B1GA 4MZLA 1DMOA 3DF0B 1TCFA 2BBNA 5AEQA 4ORBB 3EVUA 2LP3A 2HF5A 3TUYB 1KWOB 2GGMA 1NP8A 2AMIA 3DVJA 1CB1A 1RTP1 1Y6WA 2AAOA 1B47A 4ORCB 3A8RA 1Y0VH 2LLSA 1EG4A 5HKZA 1IH0A 4MRYA 3SG5A 1WLMA 4ETOA 1YRUB 4BY5A 1YUTA 1WDCB 4NQGA 1OOJA 1SL9A 1K9PA 1XFYO 1GJYA 3AAJA 1PK0D 2EC6C 3LK1A 3CTNA 1PULA 1MXEA 2F2PA 1S6IA 3K21A 1UP5A 1KSMA 2JXLA 3VGOA 1UWOA 1IQ5A 1KK8B 2L5XB 1CDLA 2PALA 1B9AA 5KU1A 1G33A 1Y1XA 2OTGB 2FJUB 2SASA 4JQ0D 1QTXA 1PRWA 3IQOA 4ZCUA 2BBMA 1WRZA 5G08A 1PVBA 1MXLC 3EKHA 1J7QA 2I2RE 4YGEB 1DJZA 3PATA 3BOWA 1SPYA 3TDIA 1ALWA 3VRPA 1PSRA 2F33A 1SCMB 4PE4A 2LNKA 1IJ5A 4DIRA 4R1EA 1LA0A 4A4CA 1M31A 2LMUA 4FQOA 1XFWO 1XK4C 4USLA 1R6PA 4PE1A 2JTZA 1S6JA 2KAVA 2M1KB 4JWQA 2JU0A 1MHOA 2M49B 4GNKB 1QV0A 1CM1A 1XFXO 1SNLA 1VRKA 2BL0B 2G9BA 3SG2A 4ZCVA 2A4JA 1E8AA 1XA5A 2JZIA 2K61A 1SY9A 2LHLA 4NDCA 1DJYA 4HRHA 1J7RA 2LM5A 1KK7Z 2Y5IA 1QXPA 1CLBA 2L0PA 2K8MB 1C7WA 2L4IA 1GQMA 4L9MA 1AP4A 5KSZA 3CR5X 3HCMA 1OE9B 4I5KA 2CTNA 1EL4A 1NX3A 1DGUA 2COLB 4BY4A 3JTDC 1CDPA 5PALA 1SK6D 1NSHA 2JQ6A 2WOSA 1GGZA 2JNXA 2Q4UA 1XK4A 2FCDA 3SIBA 2HQ8A 1Y1AA 1RECA 2JWWA 3VRQA 5DKNA 2NXQA 3D0YB 3I5GB 3O6BA 5I2QA 3O78A 2WCFA 1CM4A 1ZOTB 3CS1A 4UPGA 3KEVA 1CDNA 2CT9A 4MVFA 4FTGA 4QJ4B 2ZRTA 1W7IB 1DJWA 3WHTB 1OMDA 2MAZA 1A2XA 1WLZA 3SG6A 2WCBA 3BUNB 1U5IA 1QX7A 3WHUB 1QS7A 2BECA 2ISDA 1KSOA 1JFJA 1IG5A 2LC5A 1BR1B 2BE6A 1A03A 1YURA 3I5IC 3CR2A 2KDHA 1WY9A 5JOLA
chains in the Genus database with same CATH superfamily
1QV1A 3CGAA 2LUXA 1DJGA 2JPTA 2L4HA 1A75B 1K90D 1YX7A 5DKQA 1SKTA 3N7HA 2K0JA 2K7BA 1ZMZA 2CXJA 2KAYA 3PFVA 1YVHA 4U8DA 5KTYA 2JT8A 4PALA 3LLEA 2FCEA 2JOJA 3S0GA 1LINA 4M2OA 1G4YR 4CFRA 1C3YA 2QDIA 3FS7A 1YR5A 1CLMA 2I7AA 1JFKA 3SIAA 2KOTA 3OX5A 1DJXA 1QIVA 1N2DA 1U5IB 1PSBA 4E68A 2KFFA 4MZJA 1K94A 1TIZA 1XVJA 1F8HA 1OW4A 1ZUZA 1UURA 3PM8A 5JOLA 1NIWA 2BKIB 1G8IA 4GBAA 3PM2A 2LUCA 1B7TZ 5D69A 2LAPA 1UUSA 4N1FA 4INXA 2EGDA 4MLWA 5HLOA 3OB1B 3TS5C 1N65A 1OMVA 3I5HC 3CZTX 2LVJA 3KO0A 1LA3A 1W7JB 1QLSA 3M0WA 4N1GA 2JRFA 5CSIA 2KI4C 2H61C 1Y1UA 2P70A 2WCEA 3BUMB 1NX0A 2CBLA 2L5YA 4GPLB 1A29A 1PALA 2QEBA 3ICBA 4WQ2A 1M46A 2ZN8A 4CIDA 2JPOA 5HL1A 1K9UA 4AQIA 2NZ0A 1ALVA 2LLTA 4GGFC 1XFRA 4P5OE 1FI5A 1MUXA 2OS8B 3D74A 3GK2A 1RWYA 2Q91A 1YVLA 2I94A 3LL8B 3SG3A 1GGWA 2BE4A 2M3WA 1CTRA 2GV5A 4PHKA 1LVCD 1AHRA 3I5IB 1YUUA 2KGRA 5CPVA 3BFAA 1SR6B 1SRAA 3OX6A 4DUQA 1QWVA 2LMTA 3OGNA 2H61A 3TDUA 2M9GA 5DKRA 3BFBA 1M45A 2H2KA 3A4UB 4NDBA 4GGFA 3BXKA 3TZ1A 1CFCA 2KQ6A 3JVTB 3I5FC 4PHNA 2LV7A 1OOIX 1LS8A 3CWGA 1ZFSA 1QVIY 3R72A 3S0DA 4YGAA 3NXAA 1FF1A 1YUSA 4M2QA 2PASA 3PSRA 1CMGA 1TOPA 3RM1A 4PCWA 1JUOA 5CSFA 3OBVA 4QJ3B 1NUBA 1OQPA 1SCVA 1WRLA 2FOTA 2JT0A 3NSOA 2P71A 1F71A 5AFPA 1OOHA 3KF9A 3O4XA 3R1OA 5HKYA 2QEVA 3CZ2A 1KQMC 2QPTA 3BFHA 1Z4HA 3R1PA 3I5HB 1S5GY 1PVAA 2P6BB 4ORAB 4YGBB 2KI4B 1IJ6A 4P2YB 3QRXA 1MWNA 1Z2CB 3D10A 3BQ3A 2BCAA 3R1VA 1F70A 4YI9A 1BU3A 2ZKMX 4M2PA 5AERA 1NCXA 1J7PA 4AOMA 1KFUL 2OPOA 3GK4X 1KK7Y 1C3ZA 1TNWA 1F4QA 2PMYA 2WCLA 1L2OC 1K9KA 2PQLA 2ZFDA 3S0FA 3BOWB 4OV2A 4TNCA 3SS3A 4PHMA 2K7OA 2EC6B 2K7DA 1AUIB 3WXAA 4D1EA 3AAKA 1B4CA 2MLEC 1BJFA 1JF2A 5FI7A 1OZSA 3AKBA 1K93D 2BKHB 5FYXA 3O4YA 1BF5A 1BLQA 2PVBA 1YTZC 1S6CA 3PN7C 3V2LA 2BNXA 2WC6A 1DT7B 4GUKA 1UHKA 5ER4X 4QJ5B 1Q80A 1MR8A 1NX1A 2WCKA 2RGIA 2ZRSA 2KNEA 2K2AA 2I18A 1F4OA 2KBIA 4JPZB 2WORA 1DEKA 1BR4B 4GFTA 3WNXB 3EK7A 5IBWA 3B86A 3TUYC 2SCPA 3FIAA 1F54A 2KGBC 1DF0A 1RK9A 2ZNEA 3NSLA 2D8NA 2KHNA 3D78A 4NDDA 4YBHB 1H4BA 1B8CA 2JT3A 3BUXB 1QIWA 2KBMA 4AQJA 1TN4A 3FWCA 5FI2A 2JNFA 1BODA 3ZWHA 3BJHA 1BG1A 4PE0A 5DICA 1EXRA 1B8LA 3DD4A 4DS7A 1IKUA 1HQVA 1XYDA 3AKAA 3O2PA 1EG3A 2M7LA 1IRJA 4HSZA 3SJSA 1RJVA 2WNDA 1L2OB 1NX2A 2MBXA 3JTDB 1TUJA 4WQ3A 1NCYA 5AXIA 1S1EA 2OTGC 1K8UA 1CLLA 3FWBA 1LXFC 3DVKA 2F8PA 4YI8A 3LK0A 2M8UA 1CDMA 1CFPA 3EVVA 3SS5A 4YGDB 1B7TY 1FI6A 1QATA 3IQQA 1BMOA 3BUWB 2L98A 2M29A 1EH2A 1LKJA 2AUCA 2KPHA 4XJKA 1JWDA 1QX2A 1XFVO 3PN7B 1HT9A 1KFXL 2CNPA 2KAXA 5ER5A 5I2LA 2YGUA 4I5JA 1MQ1A 1AVSA 1SL8A 3VRNA 1SCMC 1BOCA 1DJIA 1UHIA 2PYQA 3DXLA 4OR9B 1AJ5A 4OZDA 1V1FA 3VROA 2L51A 2MJWB 3HX4A 2KYCA 4JD9A 2M97A 2KLDA 2EHBA 2NLNA 1AJ4A 2R2IA 2BL0C 2B1UA 3NSIA 1TUZA 2JC2A 2LVKA 3GOFA 4CFQA 2K7CA 3IVTA 2QACA 1NCZA 1CNPA 1DJHA 1YX8A 2PSRA 4GGNA 1F55A 3NGVA 1K95A 1UHNA 3CLNA 1JF0A 1CKKA 1DC1A 1WRKA 1DVIA 1SW8A 1K96A 2NCOA 2M1UA 1ODBA 1R2UA 3KHEA 4FQTA 4XJKB 5F6TA 2LLUA 1UHJA 1SMGA 3CR4X 3PJIA 3FE8A 4PDZA 1QJTA 4C0KA 2WCMA 3I5GC 1P28A 4OCIA 1TNQA 2L50A 1TCOB 2HETA 4DRWA 1IGVA 4IJ7A 4DCKA 1BT6A 1L7ZA 2E6WA 3LCPC 3RZSA 2BCBA 2K2FA 3TS5B 1QVIZ 1OOGA 2E30A 2JTTA 5HLVA 4MEWA 4F7FA 1MF8B 1QX5B 4XYNA 1M39A 4WRIA 2JULA 1XFUO 3KPXA 3B7AA 3RLZA 1OOFA 3DVEA 1QLKA 2F2OA 5GQQC 1OZOA 2H8VA 3H4SE 4OKHA 1XFZO 2KI6C 5EL2A 3PALA 2KSPA 2HQWA 2KFHA 4PHJA 1KFUS 1J1EA 2FJYA 2KYFA 3B87A 3CABA 4KYNA 4MSPA 1SSEB 3DVMA 3BUOB 2MHHA 1D1OA 3D0YA 2LVIA 2NCPA 1X02A 1JC2A 1RROA 2F3ZA 4HRGA 1DGVA 5TNCA 1S26D 2O60A 2TN4A 3NHIA 5CSNA 2GGZA 4MRXA 2F3YA 1DELA 4HREE 5HYDA 1C7VA 3F45A 1YRTB 3D75A 4GAOA 1OMRA 2DOQA 1C07A 1SBJA 1J1DA 2PRUA 2LCPA 2KI6D 4MN0A 2LANA 3C1VA 4F0ZB 3OB2B 1A4PA 2JXCA 1KQVA 1UHHA 3I5FB 1H8BA 4CLNA 2O5GA 5D7FA 2WC8A 4C0LA 1TNXA 1NYAA 1A75A 3L47A 3ZNIA 2M0RA 5JJGA 5J3XA 1AK8A 4YRUA 1KWOC 1N0YA 3PLFB 1K2HA 4OVNF 2LHIA 3OHMB 3BYAA 3QMEA 1W9ZA 1ZACA 2Y1NA 2KFGA 3GK1A 4INWA 3SG4A 5I8NA 5AANA 1V1GA 4I5NB 2HPSA 4N5XA 2ZN9A 2Y4QA 5D3OA 5I2OA 2GTEA 4IL1A 1DTLA 1KQMB 1J7OA 1WDCC 5HKWA 1TTXA 2MLFC 1JSAA 2ZNDA 2LVVA 2OS8C 4MZKA 3E3RA 1TRFA 1OSAA 1IWQA 3EVRA 1S5GZ 1J55A 1SL7A 3OP0A 3S0AA 1M63B 1CFFA 3DF0A 2LE9B 4YGCB 1QASA 4C0JA 2VRGA 2CCMA 3EKJA 3MSEB 4PT1A 1KK8C 1FBVA 1SR6C 2Y1MA 4Q04A 3SG7A 1JBAA 3IF7A 2V53A 3NSKA 1DQEA 1CFDA 2KQYA 2L2EA 1IQ3A 1DF0B 3FE9A 2BCXA 4PE7A 4CPVA 1TWOA 5BPJA 1S3PA 1SYMA 2BAPA 1FW4A 1XO5A 2IS9A 1NPQA 2M7NA 2MRDA 3JVTC 3TDZA 4MBEA 1KCYA 1NWDA 3NHTA 1RFJA 4JKTA 3EK8A 1EJ3A 3EK4A 4ICBA 5CSJA 3VRRA 2LMVA 1CMFA 2G2BA 3S0BA 5K89A 2LP2A 1KFXS 1B8RA 4A4BA 2MA2A 5B8IB 4I5LB 1S36A 1FPWA 1TNPA 1B1GA 4MZLA 1DMOA 3DF0B 1TCFA 2BBNA 5AEQA 4ORBB 3EVUA 2LP3A 2HF5A 3TUYB 1KWOB 2GGMA 1NP8A 2AMIA 3DVJA 1CB1A 1RTP1 1Y6WA 2AAOA 1B47A 4ORCB 3A8RA 1Y0VH 2LLSA 1EG4A 5HKZA 1IH0A 4MRYA 3SG5A 1WLMA 4ETOA 1YRUB 4BY5A 1YUTA 1GM0A 1WDCB 4NQGA 1OOJA 1SL9A 1K9PA 2ERBA 1XFYO 3B6XA 1GJYA 3AAJA 1PK0D 2EC6C 1IIOA 3LK1A 2WC5A 3CTNA 3K1EA 1PULA 1MXEA 2F2PA 1S6IA 3K21A 3SS4A 1UP5A 1KSMA 2JXLA 2WCHA 3VGOA 3CZ0A 1UWOA 1IQ5A 1KK8B 2L5XB 1CDLA 2PALA 1B9AA 5KU1A 1G33A 1Y1XA 2OTGB 2FJUB 2SASA 4JQ0D 1QTXA 1PRWA 3IQOA 4ZCUA 3VB1A 2BBMA 1WRZA 5G08A 1PVBA 3S0EA 1MXLC 3EKHA 1J7QA 2I2RE 4YGEB 1DJZA 3PATA 3CYZA 3BOWA 1SPYA 3TDIA 3DY9A 1ALWA 3D77A 1PSRA 3VRPA 2F33A 1SCMB 4PE4A 2LNKA 1IJ5A 4DIRA 4R1EA 1LA0A 4A4CA 1M31A 2LMUA 4FQOA 1XFWO 1XK4C 4USLA 1R6PA 4PE1A 2JTZA 1S6JA 2KAVA 2M1KB 4JWQA 2JU0A 1MHOA 2M49B 4GNKB 3DYEA 1QV0A 1CM1A 1XFXO 1SNLA 1VRKA 2BL0B 2G9BA 3SG2A 4ZCVA 2A4JA 1E8AA 1XA5A 2JZIA 2K61A 1SY9A 3EG5B 2LHLA 1ORGA 4NDCA 1DJYA 4HRHA 1J7RA 2LM5A 1KK7Z 2Y5IA 5FI6A 1QXPA 1CLBA 2L0PA 2K8MB 1C7WA 2L4IA 1GQMA 4L9MA 1AP4A 5KSZA 3CR5X 3D76A 1OE9B 3HCMA 2CTNA 4I5KA 3UNWA 1EL4A 1NX3A 1DGUA 2WCJA 2COLB 4BY4A 3JTDC 1CDPA 5PALA 1SK6D 1NSHA 2JQ6A 3CDNA 2WOSA 1GGZA 2JNXA 2Q4UA 1XK4A 2FCDA 3SIBA 2HQ8A 1T14A 1Y1AA 1RECA 3B88A 2JWWA 3VRQA 5DKNA 2NXQA 2QEOA 2K60A 3D0YB 3I5GB 3O6BA 5I2QA 3O78A 2L2CA 2WCFA 5I94A 1CM4A 1ZOTB 3CS1A 4UPGA 3KEVA 1CDNA 2KLEA 2QEHA 2CT9A 4MVFA 4FTGA 4QJ4B 2ZRTA 1W7IB 1DJWA 3WHTB 3UO9A 1OMDA 2MAZA 3DZTA 1A2XA 1WLZA 3SG6A 2WCBA 3BUNB 1U5IA 3FE6A 1QX7A 3WHUB 1QS7A 2BECA 2ISDA 1KSOA 1JFJA 1IG5A 2LC5A 1BR1B 2BE6A 3D73A 3Q8IA 1A03A 1YURA 3L4LA 3I5IC 3CR2A 2KDHA 1WY9A 3CZ1A 3L4AA
chains in the Genus database with same CATH topology
1QV1A 3CGAA 2LUXA 1DJGA 2JPTA 2L4HA 1A75B 1K90D 1YX7A 5DKQA 1SKTA 2K0JA 2K7BA 1ZMZA 2CXJA 2KAYA 3PFVA 1YVHA 4U8DA 5KTYA 2JT8A 4PALA 3LLEA 2FCEA 2JOJA 1LINA 4M2OA 1G4YR 4CFRA 3FS7A 1YR5A 1CLMA 2I7AA 1JFKA 3SIAA 2KOTA 3OX5A 1DJXA 1QIVA 1N2DA 1U5IB 1PSBA 4E68A 2KFFA 4MZJA 1K94A 1TIZA 1XVJA 1F8HA 1ZUZA 1UURA 3PM8A 1NIWA 2BKIB 1G8IA 4GBAA 2LUCA 1B7TZ 5D69A 2LAPA 1UUSA 4N1FA 2EGDA 4MLWA 5HLOA 3OB1B 3TS5C 1N65A 1OMVA 3I5HC 3CZTX 2LVJA 3KO0A 1LA3A 1W7JB 1QLSA 3M0WA 4N1GA 2JRFA 5CSIA 2KI4C 2H61C 1Y1UA 2WCEA 3BUMB 1NX0A 2CBLA 4GPLB 5DKRA 1A29A 1PALA 3ICBA 4WQ2A 4CIDA 1M46A 2ZN8A 1K9UA 4AQIA 2NZ0A 1ALVA 2LLTA 4GGFC 4P5OE 1FI5A 1MUXA 2OS8B 3GK2A 1RWYA 2Q91A 1YVLA 2I94A 3LL8B 3SG3A 1GGWA 2BE4A 2M3WA 1CTRA 2GV5A 4PHKA 1LVCD 1AHRA 3I5IB 1YUUA 2KGRA 5CPVA 1SR6B 1SRAA 3OX6A 4DUQA 2LMTA 2H61A 3TDUA 2M9GA 1M45A 2H2KA 3A4UB 4NDBA 4GGFA 3BXKA 3TZ1A 1CFCA 2KQ6A 3JVTB 3I5FC 4PHNA 2LV7A 3CWGA 1ZFSA 1QVIY 1FF1A 4YGAA 3NXAA 1YUSA 4M2QA 2PASA 3PSRA 1CMGA 1TOPA 3RM1A 4PCWA 1JUOA 5CSFA 4QJ3B 1NUBA 1OQPA 1SCVA 1WRLA 2FOTA 2JT0A 3NSOA 1F71A 5AFPA 3KF9A 5HKYA 1KQMC 2QPTA 3I5HB 1S5GY 1PVAA 2P6BB 4ORAB 4YGBB 2KI4B 1IJ6A 4P2YB 3QRXA 1MWNA 3D10A 1F70A 3BQ3A 2BCAA 4YI9A 1BU3A 2ZKMX 4M2PA 5AERA 1NCXA 1J7PA 4AOMA 1KFUL 2OPOA 3GK4X 1KK7Y 1TNWA 1F4QA 2PMYA 1L2OC 1K9KA 2ZFDA 3BOWB 4OV2A 4TNCA 4PHMA 2K7OA 2EC6B 2K7DA 1AUIB 3WXAA 4D1EA 3AAKA 1B4CA 2MLEC 1BJFA 1JF2A 1OZSA 3AKBA 1K93D 2BKHB 5FYXA 3O4YA 1BF5A 1BLQA 2PVBA 1YTZC 1S6CA 3PN7C 1DT7B 4GUKA 1UHKA 5ER4X 4QJ5B 1Q80A 1MR8A 1NX1A 2RGIA 2ZRSA 2KNEA 2K2AA 2I18A 1F4OA 2KBIA 4JPZB 2WORA 4GFTA 1BR4B 3WNXB 3EK7A 5IBWA 3TUYC 2SCPA 3FIAA 1F54A 2KGBC 1DF0A 1RK9A 2ZNEA 3NSLA 2D8NA 2KHNA 4NDDA 4YBHB 1H4BA 1B8CA 2JT3A 3BUXB 1QIWA 2KBMA 4AQJA 1TN4A 3FWCA 2JNFA 1BODA 3ZWHA 1BG1A 4PE0A 1EXRA 1B8LA 3DD4A 4DS7A 1IKUA 1HQVA 1XYDA 3AKAA 3O2PA 1EG3A 2M7LA 1IRJA 4HSZA 3SJSA 1RJVA 2WNDA 1L2OB 1NX2A 2MBXA 3JTDB 4WQ3A 1NCYA 5AXIA 1S1EA 2OTGC 1K8UA 1CLLA 3FWBA 1LXFC 3DVKA 2F8PA 4YI8A 3LK0A 2M8UA 1CDMA 1CFPA 3EVVA 4YGDB 1B7TY 1FI6A 1QATA 3IQQA 1BMOA 3BUWB 2L98A 2M29A 1EH2A 1LKJA 2AUCA 4XJKA 1JWDA 1QX2A 1XFVO 3PN7B 1HT9A 1KFXL 2CNPA 2KAXA 5ER5A 5I2LA 1BOCA 4I5JA 1MQ1A 1AVSA 1SL8A 3VRNA 1SCMC 1DJIA 1UHIA 4OR9B 1AJ5A 3VROA 1V1FA 2L51A 2MJWB 3HX4A 2KYCA 2M97A 2EHBA 2NLNA 1AJ4A 2R2IA 2BL0C 2B1UA 3NSIA 2JC2A 2LVKA 3GOFA 4CFQA 2K7CA 2QACA 1NCZA 1CNPA 1DJHA 1YX8A 2PSRA 4GGNA 1F55A 1K95A 1UHNA 3CLNA 1JF0A 1CKKA 1WRKA 1DVIA 1SW8A 1K96A 2NCOA 2M1UA 1ODBA 1R2UA 3KHEA 4XJKB 5F6TA 2LLUA 1UHJA 1SMGA 3CR4X 4PDZA 1QJTA 4C0KA 3I5GC 4OCIA 1TNQA 2L50A 1TCOB 2HETA 4DRWA 1IGVA 4DCKA 1BT6A 1L7ZA 2E6WA 3LCPC 2BCBA 2K2FA 3TS5B 1QVIZ 2JTTA 2E30A 5HLVA 4MEWA 1MF8B 1QX5B 4XYNA 1M39A 4WRIA 2JULA 1XFUO 3KPXA 3RLZA 3DVEA 1QLKA 2F2OA 5GQQC 1OZOA 3H4SE 4OKHA 1XFZO 2KI6C 3PALA 2KSPA 2HQWA 2KFHA 4PHJA 1KFUS 1J1EA 2KYFA 4MSPA 3DVMA 3BUOB 2MHHA 1D1OA 3D0YA 2LVIA 2NCPA 1X02A 1JC2A 1RROA 2F3ZA 4HRGA 1DGVA 5TNCA 1S26D 2O60A 2TN4A 5CSNA 2GGZA 4MRXA 2F3YA 5HYDA 4HREE 1C7VA 3F45A 1YRTB 4GAOA 1OMRA 2DOQA 1C07A 1SBJA 1J1DA 2PRUA 2LCPA 2KI6D 4MN0A 2LANA 3C1VA 4F0ZB 3OB2B 1A4PA 2JXCA 1KQVA 1UHHA 3I5FB 1H8BA 4CLNA 2O5GA 5D7FA 2WC8A 4C0LA 1TNXA 1NYAA 1A75A 3ZNIA 2M0RA 5JJGA 5J3XA 1AK8A 4YRUA 1KWOC 1N0YA 3PLFB 1K2HA 4OVNF 2LHIA 3OHMB 3BYAA 2Y1NA 1ZACA 2KFGA 3GK1A 3SG4A 5I8NA 5AANA 1V1GA 4I5NB 2HPSA 4N5XA 2ZN9A 2Y4QA 5I2OA 1J7OA 4IL1A 1DTLA 1KQMB 1WDCC 5HKWA 1TTXA 2MLFC 1JSAA 2ZNDA 2LVVA 2OS8C 4MZKA 3E3RA 1TRFA 1OSAA 1IWQA 3EVRA 1S5GZ 1J55A 1SL7A 3OP0A 1M63B 1CFFA 3DF0A 2LE9B 4YGCB 1QASA 4C0JA 2VRGA 2CCMA 3EKJA 3MSEB 4Q04A 1KK8C 1FBVA 1SR6C 2Y1MA 3SG7A 1JBAA 3IF7A 2V53A 3NSKA 1CFDA 2KQYA 2L2EA 1IQ3A 1DF0B 2BCXA 4PE7A 4CPVA 5BPJA 1S3PA 1SYMA 1FW4A 1XO5A 2IS9A 1NPQA 2M7NA 2MRDA 3JVTC 3TDZA 4MBEA 1KCYA 1NWDA 1RFJA 3EK8A 1EJ3A 3EK4A 4ICBA 5CSJA 3VRRA 2LMVA 1CMFA 2G2BA 5K89A 2LP2A 1KFXS 1B8RA 4A4BA 2MA2A 5B8IB 4I5LB 1S36A 1FPWA 1TNPA 1B1GA 4MZLA 1DMOA 3DF0B 1TCFA 2BBNA 5AEQA 4ORBB 3EVUA 2LP3A 2HF5A 3TUYB 1KWOB 2GGMA 1NP8A 2AMIA 3DVJA 1CB1A 1RTP1 1Y6WA 2AAOA 1B47A 4ORCB 3A8RA 1Y0VH 2LLSA 1EG4A 5HKZA 1IH0A 4MRYA 3SG5A 1WLMA 4ETOA 1YRUB 4BY5A 1YUTA 1WDCB 4NQGA 1OOJA 1SL9A 1K9PA 1XFYO 1GJYA 3AAJA 1PK0D 2EC6C 3LK1A 3CTNA 1PULA 1MXEA 2F2PA 1S6IA 3K21A 1UP5A 1KSMA 2JXLA 3VGOA 1UWOA 1IQ5A 1KK8B 2L5XB 1CDLA 2PALA 1B9AA 5KU1A 1G33A 1Y1XA 2OTGB 2FJUB 2SASA 4JQ0D 1QTXA 1PRWA 3IQOA 4ZCUA 2BBMA 1WRZA 5G08A 1PVBA 1MXLC 3EKHA 1J7QA 2I2RE 4YGEB 1DJZA 3PATA 3BOWA 1SPYA 3TDIA 1ALWA 3VRPA 1PSRA 2F33A 1SCMB 4PE4A 2LNKA 1IJ5A 4DIRA 4R1EA 1LA0A 4A4CA 1M31A 2LMUA 4FQOA 1XFWO 1XK4C 4USLA 1R6PA 4PE1A 2JTZA 1S6JA 2KAVA 2M1KB 4JWQA 2JU0A 1MHOA 2M49B 4GNKB 1QV0A 1CM1A 1XFXO 1SNLA 1VRKA 2BL0B 2G9BA 3SG2A 4ZCVA 2A4JA 1E8AA 1XA5A 2JZIA 2K61A 1SY9A 2LHLA 4NDCA 1DJYA 4HRHA 1J7RA 2LM5A 1KK7Z 2Y5IA 1QXPA 1CLBA 2L0PA 2K8MB 1C7WA 2L4IA 1GQMA 4L9MA 1AP4A 5KSZA 3CR5X 3HCMA 1OE9B 4I5KA 2CTNA 1EL4A 1NX3A 1DGUA 2COLB 4BY4A 3JTDC 1CDPA 5PALA 1SK6D 1NSHA 2JQ6A 2WOSA 1GGZA 2JNXA 2Q4UA 1XK4A 2FCDA 3SIBA 2HQ8A 1Y1AA 1RECA 2JWWA 3VRQA 5DKNA 2NXQA 3D0YB 3I5GB 3O6BA 5I2QA 3O78A 2WCFA 1CM4A 1ZOTB 3CS1A 4UPGA 3KEVA 1CDNA 2CT9A 4MVFA 4FTGA 4QJ4B 2ZRTA 1W7IB 1DJWA 3WHTB 1OMDA 2MAZA 1A2XA 1WLZA 3SG6A 2WCBA 3BUNB 1U5IA 1QX7A 3WHUB 1QS7A 2BECA 2ISDA 1KSOA 1JFJA 1IG5A 2LC5A 1BR1B 2BE6A 1A03A 1YURA 3I5IC 3CR2A 2KDHA 1WY9A 5JOLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QV1 A;  3CGA A;  2LUX A;  1DJG A;  2JPT A;  2L4H A;  1A75 B;  1K90 D;  1YX7 A;  5DKQ A;  1SKT A;  2K0J A;  2K7B A;  1ZMZ A;  2CXJ A;  2KAY A;  3PFV A;  1YVH A;  4U8D A;  5KTY A;  2JT8 A;  4PAL A;  3LLE A;  2FCE A;  2JOJ A;  1LIN A;  4M2O A;  1G4Y R;  4CFR A;  3FS7 A;  1YR5 A;  1CLM A;  2I7A A;  1JFK A;  3SIA A;  2KOT A;  3OX5 A;  1DJX A;  1QIV A;  1N2D A;  1U5I B;  1PSB A;  4E68 A;  2KFF A;  4MZJ A;  1K94 A;  1TIZ A;  1XVJ A;  1F8H A;  1ZUZ A;  1UUR A;  3PM8 A;  1NIW A;  2BKI B;  1G8I A;  4GBA A;  2LUC A;  1B7T Z;  5D69 A;  2LAP A;  1UUS A;  4N1F A;  2EGD A;  4MLW A;  5HLO A;  3OB1 B;  3TS5 C;  1N65 A;  1OMV A;  3I5H C;  3CZT X;  2LVJ A;  3KO0 A;  1LA3 A;  1W7J B;  1QLS A;  3M0W A;  4N1G A;  2JRF A;  5CSI A;  2KI4 C;  2H61 C;  1Y1U A;  2WCE A;  3BUM B;  1NX0 A;  2CBL A;  4GPL B;  5DKR A;  1A29 A;  1PAL A;  3ICB A;  4WQ2 A;  4CID A;  1M46 A;  2ZN8 A;  1K9U A;  4AQI A;  2NZ0 A;  1ALV A;  2LLT A;  4GGF C;  4P5O E;  1FI5 A;  1MUX A;  2OS8 B;  3GK2 A;  1RWY A;  2Q91 A;  1YVL A;  2I94 A;  3LL8 B;  3SG3 A;  1GGW A;  2BE4 A;  2M3W A;  1CTR A;  2GV5 A;  4PHK A;  1LVC D;  1AHR A;  3I5I B;  1YUU A;  2KGR A;  5CPV A;  1SR6 B;  1SRA A;  3OX6 A;  4DUQ A;  2LMT A;  2H61 A;  3TDU A;  2M9G A;  1M45 A;  2H2K A;  3A4U B;  4NDB A;  4GGF A;  3BXK A;  3TZ1 A;  1CFC A;  2KQ6 A;  3JVT B;  3I5F C;  4PHN A;  2LV7 A;  3CWG A;  1ZFS A;  1QVI Y;  1FF1 A;  4YGA A;  3NXA A;  1YUS A;  4M2Q A;  2PAS A;  3PSR A;  1CMG A;  1TOP A;  3RM1 A;  4PCW A;  1JUO A;  5CSF A;  4QJ3 B;  1NUB A;  1OQP A;  1SCV A;  1WRL A;  2FOT A;  2JT0 A;  3NSO A;  1F71 A;  5AFP A;  3KF9 A;  5HKY A;  1KQM C;  2QPT A;  3I5H B;  1S5G Y;  1PVA A;  2P6B B;  4ORA B;  4YGB B;  2KI4 B;  1IJ6 A;  4P2Y B;  3QRX A;  1MWN A;  3D10 A;  1F70 A;  3BQ3 A;  2BCA A;  4YI9 A;  1BU3 A;  2ZKM X;  4M2P A;  5AER A;  1NCX A;  1J7P A;  4AOM A;  1KFU L;  2OPO A;  3GK4 X;  1KK7 Y;  1TNW A;  1F4Q A;  2PMY A;  1L2O C;  1K9K A;  2ZFD A;  3BOW B;  4OV2 A;  4TNC A;  4PHM A;  2K7O A;  2EC6 B;  2K7D A;  1AUI B;  3WXA A;  4D1E A;  3AAK A;  1B4C A;  2MLE C;  1BJF A;  1JF2 A;  1OZS A;  3AKB A;  1K93 D;  2BKH B;  5FYX A;  3O4Y A;  1BF5 A;  1BLQ A;  2PVB A;  1YTZ C;  1S6C A;  3PN7 C;  1DT7 B;  4GUK A;  1UHK A;  5ER4 X;  4QJ5 B;  1Q80 A;  1MR8 A;  1NX1 A;  2RGI A;  2ZRS A;  2KNE A;  2K2A A;  2I18 A;  1F4O A;  2KBI A;  4JPZ B;  2WOR A;  4GFT A;  1BR4 B;  3WNX B;  3EK7 A;  5IBW A;  3TUY C;  2SCP A;  3FIA A;  1F54 A;  2KGB C;  1DF0 A;  1RK9 A;  2ZNE A;  3NSL A;  2D8N A;  2KHN A;  4NDD A;  4YBH B;  1H4B A;  1B8C A;  2JT3 A;  3BUX B;  1QIW A;  2KBM A;  4AQJ A;  1TN4 A;  3FWC A;  2JNF A;  1BOD A;  3ZWH A;  1BG1 A;  4PE0 A;  1EXR A;  1B8L A;  3DD4 A;  4DS7 A;  1IKU A;  1HQV A;  1XYD A;  3AKA A;  3O2P A;  1EG3 A;  2M7L A;  1IRJ A;  4HSZ A;  3SJS A;  1RJV A;  2WND A;  1L2O B;  1NX2 A;  2MBX A;  3JTD B;  4WQ3 A;  1NCY A;  5AXI A;  1S1E A;  2OTG C;  1K8U A;  1CLL A;  3FWB A;  1LXF C;  3DVK A;  2F8P A;  4YI8 A;  3LK0 A;  2M8U A;  1CDM A;  1CFP A;  3EVV A;  4YGD B;  1B7T Y;  1FI6 A;  1QAT A;  3IQQ A;  1BMO A;  3BUW B;  2L98 A;  2M29 A;  1EH2 A;  1LKJ A;  2AUC A;  4XJK A;  1JWD A;  1QX2 A;  1XFV O;  3PN7 B;  1HT9 A;  1KFX L;  2CNP A;  2KAX A;  5ER5 A;  5I2L A;  1BOC A;  4I5J A;  1MQ1 A;  1AVS A;  1SL8 A;  3VRN A;  1SCM C;  1DJI A;  1UHI A;  4OR9 B;  1AJ5 A;  3VRO A;  1V1F A;  2L51 A;  2MJW B;  3HX4 A;  2KYC A;  2M97 A;  2EHB A;  2NLN A;  1AJ4 A;  2R2I A;  2BL0 C;  2B1U A;  3NSI A;  2JC2 A;  2LVK A;  3GOF A;  4CFQ A;  2K7C A;  2QAC A;  1NCZ A;  1CNP A;  1DJH A;  1YX8 A;  2PSR A;  4GGN A;  1F55 A;  1K95 A;  1UHN A;  3CLN A;  1JF0 A;  1CKK A;  1WRK A;  1DVI A;  1SW8 A;  1K96 A;  2NCO A;  2M1U A;  1ODB A;  1R2U A;  3KHE A;  4XJK B;  5F6T A;  2LLU A;  1UHJ A;  1SMG A;  3CR4 X;  4PDZ A;  1QJT A;  4C0K A;  3I5G C;  4OCI A;  1TNQ A;  2L50 A;  1TCO B;  2HET A;  4DRW A;  1IGV A;  4DCK A;  1BT6 A;  1L7Z A;  2E6W A;  3LCP C;  2BCB A;  2K2F A;  3TS5 B;  1QVI Z;  2JTT A;  2E30 A;  5HLV A;  4MEW A;  1MF8 B;  1QX5 B;  4XYN A;  1M39 A;  4WRI A;  2JUL A;  1XFU O;  3KPX A;  3RLZ A;  3DVE A;  1QLK A;  2F2O A;  5GQQ C;  1OZO A;  3H4S E;  4OKH A;  1XFZ O;  2KI6 C;  3PAL A;  2KSP A;  2HQW A;  2KFH A;  4PHJ A;  1KFU S;  1J1E A;  2KYF A;  4MSP A;  3DVM A;  3BUO B;  2MHH A;  1D1O A;  3D0Y A;  2LVI A;  2NCP A;  1X02 A;  1JC2 A;  1RRO A;  2F3Z A;  4HRG A;  1DGV A;  5TNC A;  1S26 D;  2O60 A;  2TN4 A;  5CSN A;  2GGZ A;  4MRX A;  2F3Y A;  5HYD A;  4HRE E;  1C7V A;  3F45 A;  1YRT B;  4GAO A;  1OMR A;  2DOQ A;  1C07 A;  1SBJ A;  1J1D A;  2PRU A;  2LCP A;  2KI6 D;  4MN0 A;  2LAN A;  3C1V A;  4F0Z B;  3OB2 B;  1A4P A;  2JXC A;  1KQV A;  1UHH A;  3I5F B;  1H8B A;  4CLN A;  2O5G A;  5D7F A;  2WC8 A;  4C0L A;  1TNX A;  1NYA A;  1A75 A;  3ZNI A;  2M0R A;  5JJG A;  5J3X A;  1AK8 A;  4YRU A;  1KWO C;  1N0Y A;  3PLF B;  1K2H A;  4OVN F;  2LHI A;  3OHM B;  3BYA A;  2Y1N A;  1ZAC A;  2KFG A;  3GK1 A;  3SG4 A;  5I8N A;  5AAN A;  1V1G A;  4I5N B;  2HPS A;  4N5X A;  2ZN9 A;  2Y4Q A;  5I2O A;  1J7O A;  4IL1 A;  1DTL A;  1KQM B;  1WDC C;  5HKW A;  1TTX A;  2MLF C;  1JSA A;  2ZND A;  2LVV A;  2OS8 C;  4MZK A;  3E3R A;  1TRF A;  1OSA A;  1IWQ A;  3EVR A;  1S5G Z;  1J55 A;  1SL7 A;  3OP0 A;  1M63 B;  1CFF A;  3DF0 A;  2LE9 B;  4YGC B;  1QAS A;  4C0J A;  2VRG A;  2CCM A;  3EKJ A;  3MSE B;  4Q04 A;  1KK8 C;  1FBV A;  1SR6 C;  2Y1M A;  3SG7 A;  1JBA A;  3IF7 A;  2V53 A;  3NSK A;  1CFD A;  2KQY A;  2L2E A;  1IQ3 A;  1DF0 B;  2BCX A;  4PE7 A;  4CPV A;  5BPJ A;  1S3P A;  1SYM A;  1FW4 A;  1XO5 A;  2IS9 A;  1NPQ A;  2M7N A;  2MRD A;  3JVT C;  3TDZ A;  4MBE A;  1KCY A;  1NWD A;  1RFJ A;  3EK8 A;  1EJ3 A;  3EK4 A;  4ICB A;  5CSJ A;  3VRR A;  2LMV A;  1CMF A;  2G2B A;  5K89 A;  2LP2 A;  1KFX S;  1B8R A;  4A4B A;  2MA2 A;  5B8I B;  4I5L B;  1S36 A;  1FPW A;  1TNP A;  1B1G A;  4MZL A;  1DMO A;  3DF0 B;  1TCF A;  2BBN A;  5AEQ A;  4ORB B;  3EVU A;  2LP3 A;  2HF5 A;  3TUY B;  1KWO B;  2GGM A;  1NP8 A;  2AMI A;  3DVJ A;  1CB1 A;  1RTP 1;  1Y6W A;  2AAO A;  1B47 A;  4ORC B;  3A8R A;  1Y0V H;  2LLS A;  1EG4 A;  5HKZ A;  1IH0 A;  4MRY A;  3SG5 A;  1WLM A;  4ETO A;  1YRU B;  4BY5 A;  1YUT A;  1WDC B;  4NQG A;  1OOJ A;  1SL9 A;  1K9P A;  1XFY O;  1GJY A;  3AAJ A;  1PK0 D;  2EC6 C;  3LK1 A;  3CTN A;  1PUL A;  1MXE A;  2F2P A;  1S6I A;  3K21 A;  1UP5 A;  1KSM A;  2JXL A;  3VGO A;  1UWO A;  1IQ5 A;  1KK8 B;  2L5X B;  1CDL A;  2PAL A;  1B9A A;  5KU1 A;  1G33 A;  1Y1X A;  2OTG B;  2FJU B;  2SAS A;  4JQ0 D;  1QTX A;  1PRW A;  3IQO A;  4ZCU A;  2BBM A;  1WRZ A;  5G08 A;  1PVB A;  1MXL C;  3EKH A;  1J7Q A;  2I2R E;  4YGE B;  1DJZ A;  3PAT A;  3BOW A;  1SPY A;  3TDI A;  1ALW A;  3VRP A;  1PSR A;  2F33 A;  1SCM B;  4PE4 A;  2LNK A;  1IJ5 A;  4DIR A;  4R1E A;  1LA0 A;  4A4C A;  1M31 A;  2LMU A;  4FQO A;  1XFW O;  1XK4 C;  4USL A;  1R6P A;  4PE1 A;  2JTZ A;  1S6J A;  2KAV A;  2M1K B;  4JWQ A;  2JU0 A;  1MHO A;  2M49 B;  4GNK B;  1QV0 A;  1CM1 A;  1XFX O;  1SNL A;  1VRK A;  2BL0 B;  2G9B A;  3SG2 A;  4ZCV A;  2A4J A;  1E8A A;  1XA5 A;  2JZI A;  2K61 A;  1SY9 A;  2LHL A;  4NDC A;  1DJY A;  4HRH A;  1J7R A;  2LM5 A;  1KK7 Z;  2Y5I A;  1QXP A;  1CLB A;  2L0P A;  2K8M B;  1C7W A;  2L4I A;  1GQM A;  4L9M A;  1AP4 A;  5KSZ A;  3CR5 X;  3HCM A;  1OE9 B;  4I5K A;  2CTN A;  1EL4 A;  1NX3 A;  1DGU A;  2COL B;  4BY4 A;  3JTD C;  1CDP A;  5PAL A;  1SK6 D;  1NSH A;  2JQ6 A;  2WOS A;  1GGZ A;  2JNX A;  2Q4U A;  1XK4 A;  2FCD A;  3SIB A;  2HQ8 A;  1Y1A A;  1REC A;  2JWW A;  3VRQ A;  5DKN A;  2NXQ A;  3D0Y B;  3I5G B;  3O6B A;  5I2Q A;  3O78 A;  2WCF A;  1CM4 A;  1ZOT B;  3CS1 A;  4UPG A;  3KEV A;  1CDN A;  2CT9 A;  4MVF A;  4FTG A;  4QJ4 B;  2ZRT A;  1W7I B;  1DJW A;  3WHT B;  1OMD A;  2MAZ A;  1A2X A;  1WLZ A;  3SG6 A;  2WCB A;  3BUN B;  1U5I A;  1QX7 A;  3WHU B;  1QS7 A;  2BEC A;  2ISD A;  1KSO A;  1JFJ A;  1IG5 A;  2LC5 A;  1BR1 B;  2BE6 A;  1A03 A;  1YUR A;  3I5I C;  3CR2 A;  2KDH A;  1WY9 A;  5JOL A; 
#chains in the Genus database with same CATH topology
 1QV1 A;  3CGA A;  2LUX A;  1DJG A;  2JPT A;  2L4H A;  1A75 B;  1K90 D;  1YX7 A;  5DKQ A;  1SKT A;  3N7H A;  2K0J A;  2K7B A;  1ZMZ A;  2CXJ A;  2KAY A;  3PFV A;  1YVH A;  4U8D A;  5KTY A;  2JT8 A;  4PAL A;  3LLE A;  2FCE A;  2JOJ A;  3S0G A;  1LIN A;  4M2O A;  1G4Y R;  4CFR A;  1C3Y A;  2QDI A;  3FS7 A;  1YR5 A;  1CLM A;  2I7A A;  1JFK A;  3SIA A;  2KOT A;  3OX5 A;  1DJX A;  1QIV A;  1N2D A;  1U5I B;  1PSB A;  4E68 A;  2KFF A;  4MZJ A;  1K94 A;  1TIZ A;  1XVJ A;  1F8H A;  1OW4 A;  1ZUZ A;  1UUR A;  3PM8 A;  5JOL A;  1NIW A;  2BKI B;  1G8I A;  4GBA A;  3PM2 A;  2LUC A;  1B7T Z;  5D69 A;  2LAP A;  1UUS A;  4N1F A;  4INX A;  2EGD A;  4MLW A;  5HLO A;  3OB1 B;  3TS5 C;  1N65 A;  1OMV A;  3I5H C;  3CZT X;  2LVJ A;  3KO0 A;  1LA3 A;  1W7J B;  1QLS A;  3M0W A;  4N1G A;  2JRF A;  5CSI A;  2KI4 C;  2H61 C;  1Y1U A;  2P70 A;  2WCE A;  3BUM B;  1NX0 A;  2CBL A;  2L5Y A;  4GPL B;  1A29 A;  1PAL A;  2QEB A;  3ICB A;  4WQ2 A;  1M46 A;  2ZN8 A;  4CID A;  2JPO A;  5HL1 A;  1K9U A;  4AQI A;  2NZ0 A;  1ALV A;  2LLT A;  4GGF C;  1XFR A;  4P5O E;  1FI5 A;  1MUX A;  2OS8 B;  3D74 A;  3GK2 A;  1RWY A;  2Q91 A;  1YVL A;  2I94 A;  3LL8 B;  3SG3 A;  1GGW A;  2BE4 A;  2M3W A;  1CTR A;  2GV5 A;  4PHK A;  1LVC D;  1AHR A;  3I5I B;  1YUU A;  2KGR A;  5CPV A;  3BFA A;  1SR6 B;  1SRA A;  3OX6 A;  4DUQ A;  1QWV A;  2LMT A;  3OGN A;  2H61 A;  3TDU A;  2M9G A;  5DKR A;  3BFB A;  1M45 A;  2H2K A;  3A4U B;  4NDB A;  4GGF A;  3BXK A;  3TZ1 A;  1CFC A;  2KQ6 A;  3JVT B;  3I5F C;  4PHN A;  2LV7 A;  1OOI X;  1LS8 A;  3CWG A;  1ZFS A;  1QVI Y;  3R72 A;  3S0D A;  4YGA A;  3NXA A;  1FF1 A;  1YUS A;  4M2Q A;  2PAS A;  3PSR A;  1CMG A;  1TOP A;  3RM1 A;  4PCW A;  1JUO A;  5CSF A;  3OBV A;  4QJ3 B;  1NUB A;  1OQP A;  1SCV A;  1WRL A;  2FOT A;  2JT0 A;  3NSO A;  2P71 A;  1F71 A;  5AFP A;  1OOH A;  3KF9 A;  3O4X A;  3R1O A;  5HKY A;  2QEV A;  3CZ2 A;  1KQM C;  2QPT A;  3BFH A;  1Z4H A;  3R1P A;  3I5H B;  1S5G Y;  1PVA A;  2P6B B;  4ORA B;  4YGB B;  2KI4 B;  1IJ6 A;  4P2Y B;  3QRX A;  1MWN A;  1Z2C B;  3D10 A;  3BQ3 A;  2BCA A;  3R1V A;  1F70 A;  4YI9 A;  1BU3 A;  2ZKM X;  4M2P A;  5AER A;  1NCX A;  1J7P A;  4AOM A;  1KFU L;  2OPO A;  3GK4 X;  1KK7 Y;  1C3Z A;  1TNW A;  1F4Q A;  2PMY A;  2WCL A;  1L2O C;  1K9K A;  2PQL A;  2ZFD A;  3S0F A;  3BOW B;  4OV2 A;  4TNC A;  3SS3 A;  4PHM A;  2K7O A;  2EC6 B;  2K7D A;  1AUI B;  3WXA A;  4D1E A;  3AAK A;  1B4C A;  2MLE C;  1BJF A;  1JF2 A;  5FI7 A;  1OZS A;  3AKB A;  1K93 D;  2BKH B;  5FYX A;  3O4Y A;  1BF5 A;  1BLQ A;  2PVB A;  1YTZ C;  1S6C A;  3PN7 C;  3V2L A;  2BNX A;  2WC6 A;  1DT7 B;  4GUK A;  1UHK A;  5ER4 X;  4QJ5 B;  1Q80 A;  1MR8 A;  1NX1 A;  2WCK A;  2RGI A;  2ZRS A;  2KNE A;  2K2A A;  2I18 A;  1F4O A;  2KBI A;  4JPZ B;  2WOR A;  1DEK A;  1BR4 B;  4GFT A;  3WNX B;  3EK7 A;  5IBW A;  3B86 A;  3TUY C;  2SCP A;  3FIA A;  1F54 A;  2KGB C;  1DF0 A;  1RK9 A;  2ZNE A;  3NSL A;  2D8N A;  2KHN A;  3D78 A;  4NDD A;  4YBH B;  1H4B A;  1B8C A;  2JT3 A;  3BUX B;  1QIW A;  2KBM A;  4AQJ A;  1TN4 A;  3FWC A;  5FI2 A;  2JNF A;  1BOD A;  3ZWH A;  3BJH A;  1BG1 A;  4PE0 A;  5DIC A;  1EXR A;  1B8L A;  3DD4 A;  4DS7 A;  1IKU A;  1HQV A;  1XYD A;  3AKA A;  3O2P A;  1EG3 A;  2M7L A;  1IRJ A;  4HSZ A;  3SJS A;  1RJV A;  2WND A;  1L2O B;  1NX2 A;  2MBX A;  3JTD B;  1TUJ A;  4WQ3 A;  1NCY A;  5AXI A;  1S1E A;  2OTG C;  1K8U A;  1CLL A;  3FWB A;  1LXF C;  3DVK A;  2F8P A;  4YI8 A;  3LK0 A;  2M8U A;  1CDM A;  1CFP A;  3EVV A;  3SS5 A;  4YGD B;  1B7T Y;  1FI6 A;  1QAT A;  3IQQ A;  1BMO A;  3BUW B;  2L98 A;  2M29 A;  1EH2 A;  1LKJ A;  2AUC A;  2KPH A;  4XJK A;  1JWD A;  1QX2 A;  1XFV O;  3PN7 B;  1HT9 A;  1KFX L;  2CNP A;  2KAX A;  5ER5 A;  5I2L A;  2YGU A;  4I5J A;  1MQ1 A;  1AVS A;  1SL8 A;  3VRN A;  1SCM C;  1BOC A;  1DJI A;  1UHI A;  2PYQ A;  3DXL A;  4OR9 B;  1AJ5 A;  4OZD A;  1V1F A;  3VRO A;  2L51 A;  2MJW B;  3HX4 A;  2KYC A;  4JD9 A;  2M97 A;  2KLD A;  2EHB A;  2NLN A;  1AJ4 A;  2R2I A;  2BL0 C;  2B1U A;  3NSI A;  1TUZ A;  2JC2 A;  2LVK A;  3GOF A;  4CFQ A;  2K7C A;  3IVT A;  2QAC A;  1NCZ A;  1CNP A;  1DJH A;  1YX8 A;  2PSR A;  4GGN A;  1F55 A;  3NGV A;  1K95 A;  1UHN A;  3CLN A;  1JF0 A;  1CKK A;  1DC1 A;  1WRK A;  1DVI A;  1SW8 A;  1K96 A;  2NCO A;  2M1U A;  1ODB A;  1R2U A;  3KHE A;  4FQT A;  4XJK B;  5F6T A;  2LLU A;  1UHJ A;  1SMG A;  3CR4 X;  3PJI A;  3FE8 A;  4PDZ A;  1QJT A;  4C0K A;  2WCM A;  3I5G C;  1P28 A;  4OCI A;  1TNQ A;  2L50 A;  1TCO B;  2HET A;  4DRW A;  1IGV A;  4IJ7 A;  4DCK A;  1BT6 A;  1L7Z A;  2E6W A;  3LCP C;  3RZS A;  2BCB A;  2K2F A;  3TS5 B;  1QVI Z;  1OOG A;  2E30 A;  2JTT A;  5HLV A;  4MEW A;  4F7F A;  1MF8 B;  1QX5 B;  4XYN A;  1M39 A;  4WRI A;  2JUL A;  1XFU O;  3KPX A;  3B7A A;  3RLZ A;  1OOF A;  3DVE A;  1QLK A;  2F2O A;  5GQQ C;  1OZO A;  2H8V A;  3H4S E;  4OKH A;  1XFZ O;  2KI6 C;  5EL2 A;  3PAL A;  2KSP A;  2HQW A;  2KFH A;  4PHJ A;  1KFU S;  1J1E A;  2FJY A;  2KYF A;  3B87 A;  3CAB A;  4KYN A;  4MSP A;  1SSE B;  3DVM A;  3BUO B;  2MHH A;  1D1O A;  3D0Y A;  2LVI A;  2NCP A;  1X02 A;  1JC2 A;  1RRO A;  2F3Z A;  4HRG A;  1DGV A;  5TNC A;  1S26 D;  2O60 A;  2TN4 A;  3NHI A;  5CSN A;  2GGZ A;  4MRX A;  2F3Y A;  1DEL A;  4HRE E;  5HYD A;  1C7V A;  3F45 A;  1YRT B;  3D75 A;  4GAO A;  1OMR A;  2DOQ A;  1C07 A;  1SBJ A;  1J1D A;  2PRU A;  2LCP A;  2KI6 D;  4MN0 A;  2LAN A;  3C1V A;  4F0Z B;  3OB2 B;  1A4P A;  2JXC A;  1KQV A;  1UHH A;  3I5F B;  1H8B A;  4CLN A;  2O5G A;  5D7F A;  2WC8 A;  4C0L A;  1TNX A;  1NYA A;  1A75 A;  3L47 A;  3ZNI A;  2M0R A;  5JJG A;  5J3X A;  1AK8 A;  4YRU A;  1KWO C;  1N0Y A;  3PLF B;  1K2H A;  4OVN F;  2LHI A;  3OHM B;  3BYA A;  3QME A;  1W9Z A;  1ZAC A;  2Y1N A;  2KFG A;  3GK1 A;  4INW A;  3SG4 A;  5I8N A;  5AAN A;  1V1G A;  4I5N B;  2HPS A;  4N5X A;  2ZN9 A;  2Y4Q A;  5D3O A;  5I2O A;  2GTE A;  4IL1 A;  1DTL A;  1KQM B;  1J7O A;  1WDC C;  5HKW A;  1TTX A;  2MLF C;  1JSA A;  2ZND A;  2LVV A;  2OS8 C;  4MZK A;  3E3R A;  1TRF A;  1OSA A;  1IWQ A;  3EVR A;  1S5G Z;  1J55 A;  1SL7 A;  3OP0 A;  3S0A A;  1M63 B;  1CFF A;  3DF0 A;  2LE9 B;  4YGC B;  1QAS A;  4C0J A;  2VRG A;  2CCM A;  3EKJ A;  3MSE B;  4PT1 A;  1KK8 C;  1FBV A;  1SR6 C;  2Y1M A;  4Q04 A;  3SG7 A;  1JBA A;  3IF7 A;  2V53 A;  3NSK A;  1DQE A;  1CFD A;  2KQY A;  2L2E A;  1IQ3 A;  1DF0 B;  3FE9 A;  2BCX A;  4PE7 A;  4CPV A;  1TWO A;  5BPJ A;  1S3P A;  1SYM A;  2BAP A;  1FW4 A;  1XO5 A;  2IS9 A;  1NPQ A;  2M7N A;  2MRD A;  3JVT C;  3TDZ A;  4MBE A;  1KCY A;  1NWD A;  3NHT A;  1RFJ A;  4JKT A;  3EK8 A;  1EJ3 A;  3EK4 A;  4ICB A;  5CSJ A;  3VRR A;  2LMV A;  1CMF A;  2G2B A;  3S0B A;  5K89 A;  2LP2 A;  1KFX S;  1B8R A;  4A4B A;  2MA2 A;  5B8I B;  4I5L B;  1S36 A;  1FPW A;  1TNP A;  1B1G A;  4MZL A;  1DMO A;  3DF0 B;  1TCF A;  2BBN A;  5AEQ A;  4ORB B;  3EVU A;  2LP3 A;  2HF5 A;  3TUY B;  1KWO B;  2GGM A;  1NP8 A;  2AMI A;  3DVJ A;  1CB1 A;  1RTP 1;  1Y6W A;  2AAO A;  1B47 A;  4ORC B;  3A8R A;  1Y0V H;  2LLS A;  1EG4 A;  5HKZ A;  1IH0 A;  4MRY A;  3SG5 A;  1WLM A;  4ETO A;  1YRU B;  4BY5 A;  1YUT A;  1GM0 A;  1WDC B;  4NQG A;  1OOJ A;  1SL9 A;  1K9P A;  2ERB A;  1XFY O;  3B6X A;  1GJY A;  3AAJ A;  1PK0 D;  2EC6 C;  1IIO A;  3LK1 A;  2WC5 A;  3CTN A;  3K1E A;  1PUL A;  1MXE A;  2F2P A;  1S6I A;  3K21 A;  3SS4 A;  1UP5 A;  1KSM A;  2JXL A;  2WCH A;  3VGO A;  3CZ0 A;  1UWO A;  1IQ5 A;  1KK8 B;  2L5X B;  1CDL A;  2PAL A;  1B9A A;  5KU1 A;  1G33 A;  1Y1X A;  2OTG B;  2FJU B;  2SAS A;  4JQ0 D;  1QTX A;  1PRW A;  3IQO A;  4ZCU A;  3VB1 A;  2BBM A;  1WRZ A;  5G08 A;  1PVB A;  3S0E A;  1MXL C;  3EKH A;  1J7Q A;  2I2R E;  4YGE B;  1DJZ A;  3PAT A;  3CYZ A;  3BOW A;  1SPY A;  3TDI A;  3DY9 A;  1ALW A;  3D77 A;  1PSR A;  3VRP A;  2F33 A;  1SCM B;  4PE4 A;  2LNK A;  1IJ5 A;  4DIR A;  4R1E A;  1LA0 A;  4A4C A;  1M31 A;  2LMU A;  4FQO A;  1XFW O;  1XK4 C;  4USL A;  1R6P A;  4PE1 A;  2JTZ A;  1S6J A;  2KAV A;  2M1K B;  4JWQ A;  2JU0 A;  1MHO A;  2M49 B;  4GNK B;  3DYE A;  1QV0 A;  1CM1 A;  1XFX O;  1SNL A;  1VRK A;  2BL0 B;  2G9B A;  3SG2 A;  4ZCV A;  2A4J A;  1E8A A;  1XA5 A;  2JZI A;  2K61 A;  1SY9 A;  3EG5 B;  2LHL A;  1ORG A;  4NDC A;  1DJY A;  4HRH A;  1J7R A;  2LM5 A;  1KK7 Z;  2Y5I A;  5FI6 A;  1QXP A;  1CLB A;  2L0P A;  2K8M B;  1C7W A;  2L4I A;  1GQM A;  4L9M A;  1AP4 A;  5KSZ A;  3CR5 X;  3D76 A;  1OE9 B;  3HCM A;  2CTN A;  4I5K A;  3UNW A;  1EL4 A;  1NX3 A;  1DGU A;  2WCJ A;  2COL B;  4BY4 A;  3JTD C;  1CDP A;  5PAL A;  1SK6 D;  1NSH A;  2JQ6 A;  3CDN A;  2WOS A;  1GGZ A;  2JNX A;  2Q4U A;  1XK4 A;  2FCD A;  3SIB A;  2HQ8 A;  1T14 A;  1Y1A A;  1REC A;  3B88 A;  2JWW A;  3VRQ A;  5DKN A;  2NXQ A;  2QEO A;  2K60 A;  3D0Y B;  3I5G B;  3O6B A;  5I2Q A;  3O78 A;  2L2C A;  2WCF A;  5I94 A;  1CM4 A;  1ZOT B;  3CS1 A;  4UPG A;  3KEV A;  1CDN A;  2KLE A;  2QEH A;  2CT9 A;  4MVF A;  4FTG A;  4QJ4 B;  2ZRT A;  1W7I B;  1DJW A;  3WHT B;  3UO9 A;  1OMD A;  2MAZ A;  3DZT A;  1A2X A;  1WLZ A;  3SG6 A;  2WCB A;  3BUN B;  1U5I A;  3FE6 A;  1QX7 A;  3WHU B;  1QS7 A;  2BEC A;  2ISD A;  1KSO A;  1JFJ A;  1IG5 A;  2LC5 A;  1BR1 B;  2BE6 A;  3D73 A;  3Q8I A;  1A03 A;  1YUR A;  3L4L A;  3I5I C;  3CR2 A;  2KDH A;  1WY9 A;  3CZ1 A;  3L4A A; 
#chains in the Genus database with same CATH homology
 1QV1 A;  3CGA A;  2LUX A;  1DJG A;  2JPT A;  2L4H A;  1A75 B;  1K90 D;  1YX7 A;  5DKQ A;  1SKT A;  2K0J A;  2K7B A;  1ZMZ A;  2CXJ A;  2KAY A;  3PFV A;  1YVH A;  4U8D A;  5KTY A;  2JT8 A;  4PAL A;  3LLE A;  2FCE A;  2JOJ A;  1LIN A;  4M2O A;  1G4Y R;  4CFR A;  3FS7 A;  1YR5 A;  1CLM A;  2I7A A;  1JFK A;  3SIA A;  2KOT A;  3OX5 A;  1DJX A;  1QIV A;  1N2D A;  1U5I B;  1PSB A;  4E68 A;  2KFF A;  4MZJ A;  1K94 A;  1TIZ A;  1XVJ A;  1F8H A;  1ZUZ A;  1UUR A;  3PM8 A;  1NIW A;  2BKI B;  1G8I A;  4GBA A;  2LUC A;  1B7T Z;  5D69 A;  2LAP A;  1UUS A;  4N1F A;  2EGD A;  4MLW A;  5HLO A;  3OB1 B;  3TS5 C;  1N65 A;  1OMV A;  3I5H C;  3CZT X;  2LVJ A;  3KO0 A;  1LA3 A;  1W7J B;  1QLS A;  3M0W A;  4N1G A;  2JRF A;  5CSI A;  2KI4 C;  2H61 C;  1Y1U A;  2WCE A;  3BUM B;  1NX0 A;  2CBL A;  4GPL B;  5DKR A;  1A29 A;  1PAL A;  3ICB A;  4WQ2 A;  4CID A;  1M46 A;  2ZN8 A;  1K9U A;  4AQI A;  2NZ0 A;  1ALV A;  2LLT A;  4GGF C;  4P5O E;  1FI5 A;  1MUX A;  2OS8 B;  3GK2 A;  1RWY A;  2Q91 A;  1YVL A;  2I94 A;  3LL8 B;  3SG3 A;  1GGW A;  2BE4 A;  2M3W A;  1CTR A;  2GV5 A;  4PHK A;  1LVC D;  1AHR A;  3I5I B;  1YUU A;  2KGR A;  5CPV A;  1SR6 B;  1SRA A;  3OX6 A;  4DUQ A;  2LMT A;  2H61 A;  3TDU A;  2M9G A;  1M45 A;  2H2K A;  3A4U B;  4NDB A;  4GGF A;  3BXK A;  3TZ1 A;  1CFC A;  2KQ6 A;  3JVT B;  3I5F C;  4PHN A;  2LV7 A;  3CWG A;  1ZFS A;  1QVI Y;  1FF1 A;  4YGA A;  3NXA A;  1YUS A;  4M2Q A;  2PAS A;  3PSR A;  1CMG A;  1TOP A;  3RM1 A;  4PCW A;  1JUO A;  5CSF A;  4QJ3 B;  1NUB A;  1OQP A;  1SCV A;  1WRL A;  2FOT A;  2JT0 A;  3NSO A;  1F71 A;  5AFP A;  3KF9 A;  5HKY A;  1KQM C;  2QPT A;  3I5H B;  1S5G Y;  1PVA A;  2P6B B;  4ORA B;  4YGB B;  2KI4 B;  1IJ6 A;  4P2Y B;  3QRX A;  1MWN A;  3D10 A;  1F70 A;  3BQ3 A;  2BCA A;  4YI9 A;  1BU3 A;  2ZKM X;  4M2P A;  5AER A;  1NCX A;  1J7P A;  4AOM A;  1KFU L;  2OPO A;  3GK4 X;  1KK7 Y;  1TNW A;  1F4Q A;  2PMY A;  1L2O C;  1K9K A;  2ZFD A;  3BOW B;  4OV2 A;  4TNC A;  4PHM A;  2K7O A;  2EC6 B;  2K7D A;  1AUI B;  3WXA A;  4D1E A;  3AAK A;  1B4C A;  2MLE C;  1BJF A;  1JF2 A;  1OZS A;  3AKB A;  1K93 D;  2BKH B;  5FYX A;  3O4Y A;  1BF5 A;  1BLQ A;  2PVB A;  1YTZ C;  1S6C A;  3PN7 C;  1DT7 B;  4GUK A;  1UHK A;  5ER4 X;  4QJ5 B;  1Q80 A;  1MR8 A;  1NX1 A;  2RGI A;  2ZRS A;  2KNE A;  2K2A A;  2I18 A;  1F4O A;  2KBI A;  4JPZ B;  2WOR A;  4GFT A;  1BR4 B;  3WNX B;  3EK7 A;  5IBW A;  3TUY C;  2SCP A;  3FIA A;  1F54 A;  2KGB C;  1DF0 A;  1RK9 A;  2ZNE A;  3NSL A;  2D8N A;  2KHN A;  4NDD A;  4YBH B;  1H4B A;  1B8C A;  2JT3 A;  3BUX B;  1QIW A;  2KBM A;  4AQJ A;  1TN4 A;  3FWC A;  2JNF A;  1BOD A;  3ZWH A;  1BG1 A;  4PE0 A;  1EXR A;  1B8L A;  3DD4 A;  4DS7 A;  1IKU A;  1HQV A;  1XYD A;  3AKA A;  3O2P A;  1EG3 A;  2M7L A;  1IRJ A;  4HSZ A;  3SJS A;  1RJV A;  2WND A;  1L2O B;  1NX2 A;  2MBX A;  3JTD B;  4WQ3 A;  1NCY A;  5AXI A;  1S1E A;  2OTG C;  1K8U A;  1CLL A;  3FWB A;  1LXF C;  3DVK A;  2F8P A;  4YI8 A;  3LK0 A;  2M8U A;  1CDM A;  1CFP A;  3EVV A;  4YGD B;  1B7T Y;  1FI6 A;  1QAT A;  3IQQ A;  1BMO A;  3BUW B;  2L98 A;  2M29 A;  1EH2 A;  1LKJ A;  2AUC A;  4XJK A;  1JWD A;  1QX2 A;  1XFV O;  3PN7 B;  1HT9 A;  1KFX L;  2CNP A;  2KAX A;  5ER5 A;  5I2L A;  1BOC A;  4I5J A;  1MQ1 A;  1AVS A;  1SL8 A;  3VRN A;  1SCM C;  1DJI A;  1UHI A;  4OR9 B;  1AJ5 A;  3VRO A;  1V1F A;  2L51 A;  2MJW B;  3HX4 A;  2KYC A;  2M97 A;  2EHB A;  2NLN A;  1AJ4 A;  2R2I A;  2BL0 C;  2B1U A;  3NSI A;  2JC2 A;  2LVK A;  3GOF A;  4CFQ A;  2K7C A;  2QAC A;  1NCZ A;  1CNP A;  1DJH A;  1YX8 A;  2PSR A;  4GGN A;  1F55 A;  1K95 A;  1UHN A;  3CLN A;  1JF0 A;  1CKK A;  1WRK A;  1DVI A;  1SW8 A;  1K96 A;  2NCO A;  2M1U A;  1ODB A;  1R2U A;  3KHE A;  4XJK B;  5F6T A;  2LLU A;  1UHJ A;  1SMG A;  3CR4 X;  4PDZ A;  1QJT A;  4C0K A;  3I5G C;  4OCI A;  1TNQ A;  2L50 A;  1TCO B;  2HET A;  4DRW A;  1IGV A;  4DCK A;  1BT6 A;  1L7Z A;  2E6W A;  3LCP C;  2BCB A;  2K2F A;  3TS5 B;  1QVI Z;  2JTT A;  2E30 A;  5HLV A;  4MEW A;  1MF8 B;  1QX5 B;  4XYN A;  1M39 A;  4WRI A;  2JUL A;  1XFU O;  3KPX A;  3RLZ A;  3DVE A;  1QLK A;  2F2O A;  5GQQ C;  1OZO A;  3H4S E;  4OKH A;  1XFZ O;  2KI6 C;  3PAL A;  2KSP A;  2HQW A;  2KFH A;  4PHJ A;  1KFU S;  1J1E A;  2KYF A;  4MSP A;  3DVM A;  3BUO B;  2MHH A;  1D1O A;  3D0Y A;  2LVI A;  2NCP A;  1X02 A;  1JC2 A;  1RRO A;  2F3Z A;  4HRG A;  1DGV A;  5TNC A;  1S26 D;  2O60 A;  2TN4 A;  5CSN A;  2GGZ A;  4MRX A;  2F3Y A;  5HYD A;  4HRE E;  1C7V A;  3F45 A;  1YRT B;  4GAO A;  1OMR A;  2DOQ A;  1C07 A;  1SBJ A;  1J1D A;  2PRU A;  2LCP A;  2KI6 D;  4MN0 A;  2LAN A;  3C1V A;  4F0Z B;  3OB2 B;  1A4P A;  2JXC A;  1KQV A;  1UHH A;  3I5F B;  1H8B A;  4CLN A;  2O5G A;  5D7F A;  2WC8 A;  4C0L A;  1TNX A;  1NYA A;  1A75 A;  3ZNI A;  2M0R A;  5JJG A;  5J3X A;  1AK8 A;  4YRU A;  1KWO C;  1N0Y A;  3PLF B;  1K2H A;  4OVN F;  2LHI A;  3OHM B;  3BYA A;  2Y1N A;  1ZAC A;  2KFG A;  3GK1 A;  3SG4 A;  5I8N A;  5AAN A;  1V1G A;  4I5N B;  2HPS A;  4N5X A;  2ZN9 A;  2Y4Q A;  5I2O A;  1J7O A;  4IL1 A;  1DTL A;  1KQM B;  1WDC C;  5HKW A;  1TTX A;  2MLF C;  1JSA A;  2ZND A;  2LVV A;  2OS8 C;  4MZK A;  3E3R A;  1TRF A;  1OSA A;  1IWQ A;  3EVR A;  1S5G Z;  1J55 A;  1SL7 A;  3OP0 A;  1M63 B;  1CFF A;  3DF0 A;  2LE9 B;  4YGC B;  1QAS A;  4C0J A;  2VRG A;  2CCM A;  3EKJ A;  3MSE B;  4Q04 A;  1KK8 C;  1FBV A;  1SR6 C;  2Y1M A;  3SG7 A;  1JBA A;  3IF7 A;  2V53 A;  3NSK A;  1CFD A;  2KQY A;  2L2E A;  1IQ3 A;  1DF0 B;  2BCX A;  4PE7 A;  4CPV A;  5BPJ A;  1S3P A;  1SYM A;  1FW4 A;  1XO5 A;  2IS9 A;  1NPQ A;  2M7N A;  2MRD A;  3JVT C;  3TDZ A;  4MBE A;  1KCY A;  1NWD A;  1RFJ A;  3EK8 A;  1EJ3 A;  3EK4 A;  4ICB A;  5CSJ A;  3VRR A;  2LMV A;  1CMF A;  2G2B A;  5K89 A;  2LP2 A;  1KFX S;  1B8R A;  4A4B A;  2MA2 A;  5B8I B;  4I5L B;  1S36 A;  1FPW A;  1TNP A;  1B1G A;  4MZL A;  1DMO A;  3DF0 B;  1TCF A;  2BBN A;  5AEQ A;  4ORB B;  3EVU A;  2LP3 A;  2HF5 A;  3TUY B;  1KWO B;  2GGM A;  1NP8 A;  2AMI A;  3DVJ A;  1CB1 A;  1RTP 1;  1Y6W A;  2AAO A;  1B47 A;  4ORC B;  3A8R A;  1Y0V H;  2LLS A;  1EG4 A;  5HKZ A;  1IH0 A;  4MRY A;  3SG5 A;  1WLM A;  4ETO A;  1YRU B;  4BY5 A;  1YUT A;  1WDC B;  4NQG A;  1OOJ A;  1SL9 A;  1K9P A;  1XFY O;  1GJY A;  3AAJ A;  1PK0 D;  2EC6 C;  3LK1 A;  3CTN A;  1PUL A;  1MXE A;  2F2P A;  1S6I A;  3K21 A;  1UP5 A;  1KSM A;  2JXL A;  3VGO A;  1UWO A;  1IQ5 A;  1KK8 B;  2L5X B;  1CDL A;  2PAL A;  1B9A A;  5KU1 A;  1G33 A;  1Y1X A;  2OTG B;  2FJU B;  2SAS A;  4JQ0 D;  1QTX A;  1PRW A;  3IQO A;  4ZCU A;  2BBM A;  1WRZ A;  5G08 A;  1PVB A;  1MXL C;  3EKH A;  1J7Q A;  2I2R E;  4YGE B;  1DJZ A;  3PAT A;  3BOW A;  1SPY A;  3TDI A;  1ALW A;  3VRP A;  1PSR A;  2F33 A;  1SCM B;  4PE4 A;  2LNK A;  1IJ5 A;  4DIR A;  4R1E A;  1LA0 A;  4A4C A;  1M31 A;  2LMU A;  4FQO A;  1XFW O;  1XK4 C;  4USL A;  1R6P A;  4PE1 A;  2JTZ A;  1S6J A;  2KAV A;  2M1K B;  4JWQ A;  2JU0 A;  1MHO A;  2M49 B;  4GNK B;  1QV0 A;  1CM1 A;  1XFX O;  1SNL A;  1VRK A;  2BL0 B;  2G9B A;  3SG2 A;  4ZCV A;  2A4J A;  1E8A A;  1XA5 A;  2JZI A;  2K61 A;  1SY9 A;  2LHL A;  4NDC A;  1DJY A;  4HRH A;  1J7R A;  2LM5 A;  1KK7 Z;  2Y5I A;  1QXP A;  1CLB A;  2L0P A;  2K8M B;  1C7W A;  2L4I A;  1GQM A;  4L9M A;  1AP4 A;  5KSZ A;  3CR5 X;  3HCM A;  1OE9 B;  4I5K A;  2CTN A;  1EL4 A;  1NX3 A;  1DGU A;  2COL B;  4BY4 A;  3JTD C;  1CDP A;  5PAL A;  1SK6 D;  1NSH A;  2JQ6 A;  2WOS A;  1GGZ A;  2JNX A;  2Q4U A;  1XK4 A;  2FCD A;  3SIB A;  2HQ8 A;  1Y1A A;  1REC A;  2JWW A;  3VRQ A;  5DKN A;  2NXQ A;  3D0Y B;  3I5G B;  3O6B A;  5I2Q A;  3O78 A;  2WCF A;  1CM4 A;  1ZOT B;  3CS1 A;  4UPG A;  3KEV A;  1CDN A;  2CT9 A;  4MVF A;  4FTG A;  4QJ4 B;  2ZRT A;  1W7I B;  1DJW A;  3WHT B;  1OMD A;  2MAZ A;  1A2X A;  1WLZ A;  3SG6 A;  2WCB A;  3BUN B;  1U5I A;  1QX7 A;  3WHU B;  1QS7 A;  2BEC A;  2ISD A;  1KSO A;  1JFJ A;  1IG5 A;  2LC5 A;  1BR1 B;  2BE6 A;  1A03 A;  1YUR A;  3I5I C;  3CR2 A;  2KDH A;  1WY9 A;  5JOL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...