1SMGA

Calcium-bound e41a mutant of the n-domain of chicken troponin c, nmr, 40 structures
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
90
structure length
90
Chain Sequence
ASMTDQQAEARAFLSEEMIAEFKAAFDMFDADGGGDISTKALGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMKEDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Calcium-binding protein
molecule keywords TROPONIN C
publication title Mechanism of direct coupling between binding and induced structural change in regulatory calcium binding proteins.
pubmed doi rcsb
source organism Gallus gallus
total genus 22
structure length 90
sequence length 90
ec nomenclature
pdb deposition date 1997-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13833 EF-hand_8 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1smgA00
1LA3A 4NDCA 1E8AA 2SCPA 3LL8B 4OKHA 1KK7Z 1PSRA 2E6WA 3C1VA 3LCPC 1ALVA 1S1EA 2BKIB 3GK4X 1AK8A 1BR1B 4DIRA 4PHMA 1KFXS 2GV5A 2OTGC 3FS7A 5HYDA 4MSPA 2K61A 1DGUA 1TNPA 3JVTC 3CS1A 1BT6A 1B8CA 1DF0A 2KAVA 3ICBA 3TS5C 3CTNA 2LLUA 3CR2A 2Q91A 4MZJA 3PN7C 3PLFB 2BL0B 4UPGA 1BOCA 5HLOA 1J1EA 3VRPA 1YX7A 2Y1NA 5ER4X 1ZOTB 1J55A 2FCEA 3WNXB 1WDCC 3RM1A 1QX5B 1KFUS 2NXQA 1CLMA 1Y1AA 1RECA 1NUBA 4BY4A 1DJIA 1FF1A 4NDBA 2M7LA 3OX6A 1KQVA 1XFYO 4YI8A 3CZTX 4OR9B 1CTRA 5AERA 4HRHA 2EHBA 2E30A 2LM5A 4FQOA 2L2EA 2JT3A 4I5KA 1RFJA 3D10A 2CXJA 2KBMA 3I5HC 2O60A 1CB1A 1XA5A 1QLSA 2EGDA 1SCVA 1NCXA 1TN4A 2LMUA 3EK4A 3EVUA 4PALA 4A4CA 2FJUB 1A75B 1B9AA 1QX7A 2M8UA 1QLKA 3AKBA 2Q4UA 2H2KA 2I94A 1CMGA 2K2FA 4R1EA 1F71A 1QTXA 4MN0A 3SG7A 2FOTA 1QS7A 1SRAA 2F2OA 4TNCA 3TDUA 1NX0A 1NP8A 3CR5X 2H61C 2PASA 1YVLA 4JQ0D 4DUQA 2LV7A 1K9KA 2K7BA 1IJ6A 4XJKB 1QATA 3SIBA 2KYFA 1CLLA 3OB2B 3IF7A 1MF8B 2L5XB 5DKRA 2JNXA 2MLEC 1A29A 4CPVA 1NIWA 1FI5A 2JXLA 2MRDA 3EK8A 4HRGA 1RWYA 1CMFA 2JXCA 3TZ1A 4ZCUA 2JZIA 2KI6C 1BLQA 1QASA 1QVIY 2KFHA 1MXEA 3GK2A 5JOLA 1DF0B 2K2AA 4PE0A 1QXPA 5ER5A 2LVVA 1YR5A 1DGVA 5F6TA 3EVRA 1W7IB 1OMVA 1TNQA 2EC6B 2KYCA 1JC2A 1ZMZA 1CFCA 3DVMA 2B1UA 3EKHA 4C0JA 1NPQA 4GNKB 3EKJA 2JT8A 5CSFA 1CKKA 1TNWA 1OMDA 1L2OC 4PE1A 4U8DA 2OS8B 3KO0A 3NSKA 2D8NA 2L50A 1C7VA 5HKZA 2CTNA 1F4QA 4QJ4B 1S6JA 4MBEA 1J1DA 2K7OA 2LVIA 1EXRA 4I5NB 1Q80A 5AFPA 1S6IA 4ORAB 1Y1XA 2BE6A 3PALA 3FIAA 3OB1B 4GUKA 5CSJA 2PVBA 1Y6WA 4QJ5B 1PK0D 2PSRA 1WLMA 4PDZA 1B8LA 1EG4A 2L51A 4YRUA 1G8IA 1DJZA 4C0LA 4GGFC 1OMRA 1TNXA 1JWDA 3NSLA 3H4SE 3IQOA 1NX3A 3LK0A 3GK1A 1DT7B 1UWOA 1MHOA 5KSZA 1S26D 1RK9A 1YUUA 2KGRA 2KFGA 2MHHA 2HETA 3OHMB 4MRYA 3JTDC 1JSAA 2AAOA 2ZNEA 3TUYB 3NSOA 4WQ2A 1CM1A 3A4UB 1MQ1A 1XK4C 1GGZA 2LVJA 1K96A 1V1FA 3DD4A 1W7JB 3MSEB 4DRWA 5I2OA 2R2IA 2GGMA 2M1KB 2LE9B 2ZNDA 3BYAA 3I5IC 2OS8C 4CIDA 2M0RA 3VGOA 1JBAA 3FWCA 3PSRA 1PSBA 1U5IA 1YURA 3BUNB 3F45A 1JFJA 2P6BB 2KQYA 2KI4B 2LLSA 1Y1UA 4YGEB 1TOPA 1LA0A 2K7DA 3DVEA 2BCXA 4FTGA 1M39A 4WQ3A 1PRWA 2K8MB 2LP3A 1K94A 2JRFA 4N1FA 3SG4A 3KHEA 1SR6B 1B4CA 1CNPA 3DF0A 1OZOA 5HKWA 3SG5A 4M2QA 1CLBA 1SW8A 2DOQA 2JQ6A 5CSNA 1K90D 1B8RA 2QACA 2WNDA 1EH2A 2LMTA 1OE9B 1M45A 2K0JA 1IWQA 4N1GA 2Y1MA 2F8PA 4I5JA 5CSIA 1QIWA 1HT9A 3KPXA 1TCFA 2M49B 1IGVA 2I18A 1IG5A 1J7QA 5HLVA 3I5FB 1QX2A 2G9BA 1J7OA 5AEQA 2LUXA 1S5GZ 1BU3A 5PALA 1MXLC 3E3RA 1UHKA 1ZUZA 1A03A 1KWOB 4L9MA 1QV1A 2BBNA 1N0YA 2ZFDA 1LVCD 3AKAA 4P2YB 1A2XA 2ISDA 1XFUO 1YTZC 4MZLA 2BKHB 4GAOA 3BOWA 1CDPA 2JT0A 4MVFA 1B7TZ 2VRGA 2HPSA 1LXFC 1UUSA 1EL4A 1UHIA 2KI4C 2BL0C 3ZNIA 4CFRA 1CDNA 1H4BA 1KK8B 5D7FA 2KBIA 1UURA 1L7ZA 4NQGA 4GBAA 1CFDA 1PVBA 2LCPA 1SR6C 4MZKA 1SBJA 2ZKMX 2QPTA 1BF5A 2F3YA 1MR8A 1VRKA 1K2HA 1U5IB 4ETOA 2RGIA 4GFTA 2I2RE 3M0WA 2KI6D 5HKYA 1S3PA 1IJ5A 3IQQA 3PM8A 4GGNA 1MUXA 1UHJA 5CPVA 2KAXA 2MLFC 1FW4A 3WHTB 1LINA 2ZN8A 2BECA 3AAKA 4P5OE 4NDDA 4PHNA 1SCMB 3BUOB 1XVJA 1AJ5A 1KQMB 2A4JA 1K9UA 2LAPA 2Y5IA 3DVKA 3KEVA 4MRXA 3DF0B 4OVNF 5J3XA 2Y4QA 2L4HA 1QIVA 5DKNA 5G08A 2MBXA 3O4YA 3EVVA 3I5GB 1ALWA 1EG3A 1X02A 4PHJA 4ZCVA 1WY9A 3VRNA 4MEWA 2KOTA 1GJYA 5D69A 2WORA 2SASA 1DJYA 2JU0A 2H61A 1SK6D 4XYNA 5KTYA 1M63B 1S6CA 2ZN9A 1NCZA 2KHNA 3O6BA 2HF5A 2ZRSA 3O2PA 4OV2A 1KFXL 4JWQA 2M3WA 1SNLA 2JC2A 2K7CA 2JPTA 2LVKA 1JF2A 3O78A 1F4OA 4GPLB 1YUSA 4ORBB 1TRFA 2O5GA 1BG1A 1KSMA 1DVIA 2JOJA 2KNEA 2LUCA 5AANA 1QJTA 1BODA 1GGWA 1IH0A 1KCYA 3TS5B 1AHRA 3BOWB 1YUTA 2COLB 2CNPA 3DVJA 3PN7B 2WCFA 1F54A 2EC6C 1PULA 1KFUL 2HQ8A 1JF0A 1HQVA 2M97A 3OX5A 1R6PA 1WDCB 1J7PA 1IRJA 1SCMC 4OCIA 3SIAA 1KQMC 4PE4A 1NYAA 4CFQA 1NCYA 3BXKA 3BUXB 3I5GC 2FCDA 2V53A 3CLNA 1WRLA 3PFVA 3BUWB 3ZWHA 2LHLA 2MJWB 3CR4X 2IS9A 4YGBB 4PCWA 5B8IB 2MA2A 1TIZA 2OPOA 1WLZA 1FBVA 2TN4A 4WRIA 3I5HB 2PRUA 1B47A 1F8HA 5IBWA 1WRZA 3SG6A 3KF9A 3SJSA 4Q04A 5AXIA 2LHIA 2LP2A 4M2PA 1AVSA 2F2PA 1PALA 1UP5A 4GGFA 1Y0VH 5FYXA 4AQIA 4HSZA 2WC8A 1ZFSA 1GQMA 1XFZO 1JUOA 2KFFA 1G33A 2NCOA 1RTP1 1BJFA 1IKUA 1IQ5A 1KK7Y 1KSOA 1XYDA 2BCBA 4AQJA 4CLNA 2G2BA 3VROA 1YRUB 1SL8A 3A8RA 1B1GA 3CGAA 4M2OA 1F70A 3TUYC 1XK4A 1UHHA 4N5XA 1SYMA 2LLTA 3AAJA 2KQ6A 2LANA 4F0ZB 1TTXA 1JFKA 1YRTB 3BUMB 4I5LB 2AMIA 1CDLA 2WCBA 1F55A 1SPYA 1M46A 4AOMA 1RJVA 1MWNA 1QVIZ 4D1EA 4A4BA 2CCMA 1SMGA 1NX1A 2KDHA 1OZSA 3VRQA 4YGAA 3D0YA 3FWBA 4ORCB 5DKQA 4IL1A 4DCKA 1L2OB 4YBHB 2BBMA 2GGZA 4USLA 2PALA 2KGBC 1BMOA 2F33A 1OOJA 2BCAA 1IQ3A 3HX4A 3NSIA 1N2DA 2L0PA 2LC5A 1K9PA 3TDZA 1EJ3A 1K8UA 3WXAA 1SKTA 1DTLA 2JTTA 4MLWA 4C0KA 1YVHA 2L98A 1CDMA 2AUCA 3BQ3A 2WCEA 3GOFA 1FI6A 4ICBA 2JWWA 1M31A 2JNFA 5JJGA 1DJXA 1S5GY 1C7WA 2L4IA 3LLEA 4PHKA 2LNKA 1S36A 1WRKA 2NLNA 2JTZA 1ODBA 1LKJA 1YX8A 3I5FC 4JPZB 3K21A 3NXAA 1FPWA 4YI9A 2CT9A 2CBLA 3TDIA 1KWOC 1B7TY 1NSHA 1V1GA 1OQPA 2LMVA 1OSAA 2NCPA 4YGDB 4BY5A 1DMOA 1G4YR 1SL7A 1CM4A 1C07A 3JTDB 2JULA 3OP0A 1J7RA 2PMYA 1BR4B 3SG2A 2F3ZA 2WOSA 2MAZA 3LK1A 1KK8C 1QV0A 1DJHA 1DJWA 2OTGB 1K95A 3QRXA 2KAYA 2M9GA 3WHUB 3I5IB 2I7AA 4DS7A 4YGCB 1NWDA 2HQWA 1AP4A 3VRRA 1CFPA 3JVTB 2BE4A 1DJGA 3HCMA 1R2UA 1SL9A 4E68A 5I2LA 5KU1A 3RLZA 1D1OA 1UHNA 1TCOB 1XO5A 1CFFA 1N65A 2KSPA 3CWGA 3D0YB 1SY9A 1H8BA 4HREE 5BPJA 1A4PA 2M29A 1AJ4A 5TNCA 1A75A 1NX2A 1XFWO 4PE7A 1PVAA 5GQQC 1K93D 2ZRTA 3EK7A 5I8NA 3PATA 1RROA 1XFXO 4QJ3B 2M1UA 2M7NA 5K89A 4XJKA 1XFVO 5I2QA 1ZACA 3SG3A 1AUIB 2NZ0A
chains in the Genus database with same CATH superfamily
1LA3A 4NDCA 1E8AA 2SCPA 3LL8B 4OKHA 1KK7Z 1PSRA 2E6WA 3C1VA 3LCPC 1ALVA 1S1EA 2BKIB 3GK4X 1AK8A 1BR1B 4DIRA 4PHMA 1KFXS 2GV5A 2OTGC 3FS7A 3D73A 4MSPA 5HYDA 2K61A 1DGUA 1TNPA 2H8VA 3JVTC 3CS1A 3BFAA 1BT6A 1B8CA 1DF0A 2KAVA 3ICBA 3TS5C 3CTNA 2LLUA 3CR2A 2Q91A 4MZJA 3PN7C 3PLFB 2BL0B 4UPGA 1BOCA 5HLOA 1J1EA 3VRPA 1YX7A 2Y1NA 3B7AA 5ER4X 3R1VA 1ZOTB 1J55A 2FCEA 3WNXB 1WDCC 3RM1A 1QX5B 2WCLA 1KFUS 2NXQA 1CLMA 1Y1AA 2PYQA 2WCHA 1RECA 1NUBA 4BY4A 1DJIA 1FF1A 4NDBA 2M7LA 3OX6A 1KQVA 1XFYO 4YI8A 3CZTX 4OR9B 1CTRA 5AERA 3L4AA 4PT1A 4HRHA 1SSEB 3SS3A 2EHBA 2E30A 2KPHA 2LM5A 2YGUA 3OGNA 4FQOA 2L2EA 2JT3A 1TWOA 3K1EA 1RFJA 3CDNA 2CXJA 2KBMA 3D10A 2O60A 3I5HC 4I5KA 1CB1A 1XA5A 1QLSA 2EGDA 1SCVA 1NCXA 1TN4A 2LMUA 3EK4A 3EVUA 4PALA 4A4CA 2FJUB 1A75B 1B9AA 1QX7A 2M8UA 1QLKA 3AKBA 2Q4UA 2H2KA 2I94A 2JPOA 3BFBA 2K2FA 1CMGA 4R1EA 1F71A 2PQLA 1QTXA 4MN0A 3SG7A 2FOTA 1QS7A 1SRAA 2F2OA 4TNCA 3TDUA 1Z2CB 1NX0A 1NP8A 3CR5X 2H61C 2PASA 1YVLA 4JQ0D 4DUQA 2LV7A 1K9KA 1ORGA 2K7BA 1IJ6A 4XJKB 1QATA 3SIBA 2KYFA 1CLLA 3OB2B 3IF7A 1MF8B 3S0AA 2L5XB 1IIOA 5DKRA 2JNXA 2MLEC 1A29A 3CZ2A 4CPVA 1NIWA 1FI5A 2JXLA 2MRDA 3EK8A 4HRGA 1RWYA 3DYEA 1CMFA 2JXCA 3L4LA 3TZ1A 4ZCUA 3V2LA 2JZIA 2KI6C 2WCKA 1BLQA 3R1PA 1QASA 1QVIY 2KFHA 1MXEA 3GK2A 3BFHA 5JOLA 1DF0B 2K2AA 4PE0A 2QEBA 1QXPA 5ER5A 2LVVA 1YR5A 1DGVA 5F6TA 3EVRA 1W7IB 1W9ZA 3N7HA 1OMVA 1TNQA 2EC6B 2KYCA 1JC2A 1ZMZA 1CFCA 3DVMA 2B1UA 3EKHA 4C0JA 1NPQA 4GNKB 3EKJA 2JT8A 3BJHA 5CSFA 1CKKA 1TNWA 1OMDA 3R1OA 1L2OC 4PE1A 4U8DA 2OS8B 3KO0A 3O4XA 3NSKA 5EL2A 2D8NA 2L50A 1C7VA 5HKZA 2CTNA 1F4QA 4QJ4B 1DC1A 1S6JA 4MBEA 1J1DA 2K7OA 2LVIA 1EXRA 4I5NB 1Q80A 5AFPA 1S6IA 3CZ0A 2WCJA 4ORAB 3S0GA 1Y1XA 2BE6A 3R72A 3PALA 2BNXA 3FIAA 4JD9A 3OB1B 4GUKA 5CSJA 2PVBA 1Y6WA 2QDIA 4QJ5B 1PK0D 2PSRA 1WLMA 4PDZA 1B8LA 1EG4A 2L51A 2K60A 4YRUA 1G8IA 1DJZA 4C0LA 4GGFC 1OMRA 1TNXA 3D78A 1JWDA 3NSLA 3H4SE 3IQOA 1NX3A 3LK0A 3GK1A 3CABA 1DT7B 1UWOA 1MHOA 5KSZA 1S26D 1RK9A 1YUUA 2KGRA 2KFGA 3UO9A 2MHHA 2HETA 3OHMB 4MRYA 3JTDC 1JSAA 2AAOA 2ZNEA 3TUYB 3NSOA 4WQ2A 1CM1A 3A4UB 1MQ1A 1XK4C 1GGZA 2LVJA 1K96A 1V1FA 3DD4A 1W7JB 3MSEB 4DRWA 5I2OA 2R2IA 2GGMA 2M1KB 2LE9B 2ZNDA 3BYAA 3I5IC 2OS8C 4CIDA 2M0RA 3VGOA 1JBAA 3FWCA 3PSRA 1PSBA 3D76A 1U5IA 1YURA 3BUNB 3L47A 3F45A 1JFJA 4OZDA 2P6BB 3D77A 3SS5A 2KQYA 2KI4B 2LLSA 1Y1UA 4YGEB 1TOPA 1LA0A 2K7DA 3DVEA 2BCXA 2KLEA 4FTGA 1M39A 4WQ3A 1PRWA 2K8MB 2LP3A 3FE6A 1K94A 2JRFA 4N1FA 2QEVA 3KHEA 1SR6B 3SG4A 1B4CA 1CNPA 3DF0A 1OZOA 5HKWA 3SG5A 4M2QA 1CLBA 1SW8A 2DOQA 2JQ6A 5CSNA 3PJIA 1K90D 1B8RA 2QACA 2WNDA 1EH2A 2LMTA 1OE9B 1M45A 2K0JA 2FJYA 1IWQA 4N1GA 2Y1MA 2F8PA 4I5JA 5CSIA 1GM0A 1QIWA 1HT9A 3KPXA 1TCFA 2M49B 1IGVA 2I18A 1IG5A 1J7QA 4IJ7A 5HLVA 3I5FB 1QX2A 2G9BA 3S0DA 1J7OA 5AEQA 2LUXA 1S5GZ 1BU3A 5PALA 1MXLC 3E3RA 1UHKA 1ZUZA 1A03A 1KWOB 4L9MA 1QV1A 3S0EA 2BBNA 4JKTA 1N0YA 2ZFDA 1LVCD 2P71A 3AKAA 4P2YB 1A2XA 2ISDA 3S0BA 3NHTA 4F7FA 1C3YA 1XFUO 1YTZC 4MZLA 2BKHB 4GAOA 3IVTA 3BOWA 1CDPA 2JT0A 1Z4HA 4MVFA 1B7TZ 2VRGA 2HPSA 1LXFC 1UUSA 1EL4A 1UHIA 2KI4C 2BL0C 3FE8A 3ZNIA 4CFRA 1CDNA 1H4BA 3OBVA 1KK8B 5D7FA 2KBIA 1UURA 1L7ZA 4NQGA 4GBAA 1CFDA 1PVBA 3RZSA 2LCPA 1SR6C 2WCMA 4MZKA 1SBJA 2ZKMX 2QPTA 1BF5A 1OW4A 2F3YA 1MR8A 1VRKA 1K2HA 1U5IB 4ETOA 2RGIA 4GFTA 2I2RE 3M0WA 4INXA 2KI6D 5HKYA 1S3PA 1IJ5A 3IQQA 3PM8A 4GGNA 1MUXA 1P28A 1OOIX 1UHJA 3B88A 5CPVA 2KAXA 2MLFC 3CYZA 1FW4A 3WHTB 1LINA 3PM2A 2ZN8A 2BECA 3AAKA 4P5OE 4NDDA 4PHNA 1SCMB 3BUOB 1XVJA 1AJ5A 1KQMB 2A4JA 1K9UA 2LAPA 2Y5IA 3DVKA 3KEVA 4MRXA 3DF0B 4OVNF 5J3XA 2Y4QA 2L4HA 1QIVA 5DKNA 5G08A 2MBXA 3O4YA 3EVVA 3I5GB 1ALWA 1EG3A 1X02A 4PHJA 4ZCVA 1WY9A 3VRNA 4MEWA 2BAPA 2KOTA 1GJYA 5D69A 2WORA 2SASA 1DJYA 1T14A 3NGVA 2GTEA 2H61A 2JU0A 1SK6D 4XYNA 5KTYA 1M63B 1S6CA 2ZN9A 1NCZA 3DZTA 5FI6A 2KHNA 3O6BA 2HF5A 2ZRSA 2WC5A 3O2PA 4OV2A 1KFXL 4JWQA 2M3WA 1SNLA 2JC2A 2K7CA 2JPTA 2LVKA 1JF2A 3O78A 1F4OA 4FQTA 1YUSA 4GPLB 1TRFA 4ORBB 2O5GA 3SS4A 5DICA 1BG1A 1KSMA 1DVIA 2JOJA 2KNEA 2LUCA 5AANA 1QJTA 1BODA 1GGWA 1IH0A 1KCYA 3TS5B 1AHRA 3BOWB 3Q8IA 1YUTA 2COLB 2CNPA 3DVJA 3PN7B 3DXLA 2WCFA 1F54A 2EC6C 1PULA 1KFUL 2HQ8A 1JF0A 1HQVA 3UNWA 2M97A 3OX5A 1R6PA 1WDCB 1J7PA 1IRJA 1SCMC 4OCIA 3SIAA 1KQMC 4PE4A 1NYAA 4CFQA 1NCYA 3BXKA 3BUXB 3I5GC 2FCDA 2V53A 3CLNA 1WRLA 3PFVA 3BUWB 3ZWHA 2LHLA 2MJWB 3CR4X 5FI7A 2IS9A 4YGBB 4PCWA 5B8IB 2MA2A 1TIZA 2OPOA 4INWA 1WLZA 1FBVA 2TN4A 4WRIA 3I5HB 1OOHA 1DEKA 2PRUA 1B47A 1F8HA 5IBWA 1WRZA 3SG6A 3KF9A 3SJSA 4Q04A 5AXIA 2LHIA 2LP2A 4M2PA 2WC6A 1AVSA 2F2PA 1PALA 1UP5A 4GGFA 1Y0VH 5FYXA 4AQIA 4HSZA 2WC8A 1ZFSA 1GQMA 1XFZO 1JUOA 5D3OA 2KFFA 1G33A 2NCOA 1RTP1 1BJFA 1XFRA 1IQ5A 2L5YA 1IKUA 1KK7Y 1KSOA 1XYDA 2BCBA 3B86A 4AQJA 4CLNA 2G2BA 3VROA 1YRUB 1SL8A 3A8RA 1B1GA 3CGAA 4M2OA 1F70A 3TUYC 1XK4A 1UHHA 4N5XA 1LS8A 2QEHA 1SYMA 2LLTA 3AAJA 2KQ6A 1OOFA 2LANA 1TTXA 4F0ZB 1JFKA 1YRTB 3BUMB 4I5LB 3S0FA 2AMIA 1CDLA 1DELA 1DQEA 2QEOA 2WCBA 3D74A 1F55A 1SPYA 1M46A 4AOMA 1RJVA 1MWNA 1QVIZ 4D1EA 4A4BA 3B6XA 2CCMA 1SMGA 1NX1A 2KDHA 1OZSA 3VRQA 4YGAA 3D0YA 3FWBA 2ERBA 4ORCB 5DKQA 4IL1A 4DCKA 1L2OB 2KLDA 4YBHB 2BBMA 2GGZA 4USLA 2PALA 2KGBC 1BMOA 2F33A 1OOJA 2BCAA 1IQ3A 3HX4A 3NSIA 5I94A 1N2DA 2L0PA 2LC5A 1K9PA 3QMEA 3TDZA 1EJ3A 1K8UA 3WXAA 1SKTA 1DTLA 2JTTA 4MLWA 3EG5B 4C0KA 1YVHA 2L98A 1CDMA 2AUCA 3BQ3A 2WCEA 3GOFA 1FI6A 4ICBA 2JWWA 1M31A 2JNFA 5JJGA 1DJXA 1S5GY 1C7WA 2L4IA 3LLEA 4PHKA 2LNKA 1S36A 3VB1A 1WRKA 2NLNA 1OOGA 2JTZA 3CZ1A 1ODBA 1LKJA 1YX8A 3I5FC 4JPZB 3K21A 1TUJA 3NXAA 1FPWA 4YI9A 1C3ZA 2CT9A 2CBLA 3TDIA 1KWOC 1B7TY 1NSHA 1V1GA 1OQPA 2LMVA 1OSAA 2NCPA 4YGDB 4BY5A 3DY9A 1DMOA 1G4YR 3NHIA 1SL7A 1CM4A 1C07A 3JTDB 2JULA 3OP0A 1J7RA 2PMYA 1BR4B 3SG2A 2F3ZA 1TUZA 2WOSA 2MAZA 3LK1A 3B87A 1KK8C 1QV0A 1DJHA 1DJWA 2OTGB 1K95A 3QRXA 2KAYA 2M9GA 3WHUB 3I5IB 2I7AA 4DS7A 4YGCB 1NWDA 1QWVA 2HQWA 1AP4A 3VRRA 1CFPA 5HL1A 3JVTB 2BE4A 1DJGA 3HCMA 1R2UA 1SL9A 4E68A 2L2CA 5I2LA 5KU1A 3RLZA 1D1OA 1UHNA 1TCOB 1XO5A 1CFFA 1N65A 2KSPA 3CWGA 3D0YB 1SY9A 1H8BA 4HREE 3D75A 5BPJA 1A4PA 2M29A 1AJ4A 5TNCA 1A75A 1NX2A 1XFWO 4PE7A 1PVAA 5GQQC 1K93D 2P70A 2ZRTA 3EK7A 5I8NA 3FE9A 3PATA 1RROA 1XFXO 4QJ3B 2M1UA 2M7NA 5FI2A 5K89A 4XJKA 1XFVO 5I2QA 1ZACA 3SG3A 1AUIB 4KYNA 2NZ0A
chains in the Genus database with same CATH topology
1LA3A 4NDCA 1E8AA 2SCPA 3LL8B 4OKHA 1KK7Z 1PSRA 2E6WA 3C1VA 3LCPC 1ALVA 1S1EA 2BKIB 3GK4X 1AK8A 1BR1B 4DIRA 4PHMA 1KFXS 2GV5A 2OTGC 3FS7A 5HYDA 4MSPA 2K61A 1DGUA 1TNPA 3JVTC 3CS1A 1BT6A 1B8CA 1DF0A 2KAVA 3ICBA 3TS5C 3CTNA 2LLUA 3CR2A 2Q91A 4MZJA 3PN7C 3PLFB 2BL0B 4UPGA 1BOCA 5HLOA 1J1EA 3VRPA 1YX7A 2Y1NA 5ER4X 1ZOTB 1J55A 2FCEA 3WNXB 1WDCC 3RM1A 1QX5B 1KFUS 2NXQA 1CLMA 1Y1AA 1RECA 1NUBA 4BY4A 1DJIA 1FF1A 4NDBA 2M7LA 3OX6A 1KQVA 1XFYO 4YI8A 3CZTX 4OR9B 1CTRA 5AERA 4HRHA 2EHBA 2E30A 2LM5A 4FQOA 2L2EA 2JT3A 4I5KA 1RFJA 3D10A 2CXJA 2KBMA 3I5HC 2O60A 1CB1A 1XA5A 1QLSA 2EGDA 1SCVA 1NCXA 1TN4A 2LMUA 3EK4A 3EVUA 4PALA 4A4CA 2FJUB 1A75B 1B9AA 1QX7A 2M8UA 1QLKA 3AKBA 2Q4UA 2H2KA 2I94A 1CMGA 2K2FA 4R1EA 1F71A 1QTXA 4MN0A 3SG7A 2FOTA 1QS7A 1SRAA 2F2OA 4TNCA 3TDUA 1NX0A 1NP8A 3CR5X 2H61C 2PASA 1YVLA 4JQ0D 4DUQA 2LV7A 1K9KA 2K7BA 1IJ6A 4XJKB 1QATA 3SIBA 2KYFA 1CLLA 3OB2B 3IF7A 1MF8B 2L5XB 5DKRA 2JNXA 2MLEC 1A29A 4CPVA 1NIWA 1FI5A 2JXLA 2MRDA 3EK8A 4HRGA 1RWYA 1CMFA 2JXCA 3TZ1A 4ZCUA 2JZIA 2KI6C 1BLQA 1QASA 1QVIY 2KFHA 1MXEA 3GK2A 5JOLA 1DF0B 2K2AA 4PE0A 1QXPA 5ER5A 2LVVA 1YR5A 1DGVA 5F6TA 3EVRA 1W7IB 1OMVA 1TNQA 2EC6B 2KYCA 1JC2A 1ZMZA 1CFCA 3DVMA 2B1UA 3EKHA 4C0JA 1NPQA 4GNKB 3EKJA 2JT8A 5CSFA 1CKKA 1TNWA 1OMDA 1L2OC 4PE1A 4U8DA 2OS8B 3KO0A 3NSKA 2D8NA 2L50A 1C7VA 5HKZA 2CTNA 1F4QA 4QJ4B 1S6JA 4MBEA 1J1DA 2K7OA 2LVIA 1EXRA 4I5NB 1Q80A 5AFPA 1S6IA 4ORAB 1Y1XA 2BE6A 3PALA 3FIAA 3OB1B 4GUKA 5CSJA 2PVBA 1Y6WA 4QJ5B 1PK0D 2PSRA 1WLMA 4PDZA 1B8LA 1EG4A 2L51A 4YRUA 1G8IA 1DJZA 4C0LA 4GGFC 1OMRA 1TNXA 1JWDA 3NSLA 3H4SE 3IQOA 1NX3A 3LK0A 3GK1A 1DT7B 1UWOA 1MHOA 5KSZA 1S26D 1RK9A 1YUUA 2KGRA 2KFGA 2MHHA 2HETA 3OHMB 4MRYA 3JTDC 1JSAA 2AAOA 2ZNEA 3TUYB 3NSOA 4WQ2A 1CM1A 3A4UB 1MQ1A 1XK4C 1GGZA 2LVJA 1K96A 1V1FA 3DD4A 1W7JB 3MSEB 4DRWA 5I2OA 2R2IA 2GGMA 2M1KB 2LE9B 2ZNDA 3BYAA 3I5IC 2OS8C 4CIDA 2M0RA 3VGOA 1JBAA 3FWCA 3PSRA 1PSBA 1U5IA 1YURA 3BUNB 3F45A 1JFJA 2P6BB 2KQYA 2KI4B 2LLSA 1Y1UA 4YGEB 1TOPA 1LA0A 2K7DA 3DVEA 2BCXA 4FTGA 1M39A 4WQ3A 1PRWA 2K8MB 2LP3A 1K94A 2JRFA 4N1FA 3SG4A 3KHEA 1SR6B 1B4CA 1CNPA 3DF0A 1OZOA 5HKWA 3SG5A 4M2QA 1CLBA 1SW8A 2DOQA 2JQ6A 5CSNA 1K90D 1B8RA 2QACA 2WNDA 1EH2A 2LMTA 1OE9B 1M45A 2K0JA 1IWQA 4N1GA 2Y1MA 2F8PA 4I5JA 5CSIA 1QIWA 1HT9A 3KPXA 1TCFA 2M49B 1IGVA 2I18A 1IG5A 1J7QA 5HLVA 3I5FB 1QX2A 2G9BA 1J7OA 5AEQA 2LUXA 1S5GZ 1BU3A 5PALA 1MXLC 3E3RA 1UHKA 1ZUZA 1A03A 1KWOB 4L9MA 1QV1A 2BBNA 1N0YA 2ZFDA 1LVCD 3AKAA 4P2YB 1A2XA 2ISDA 1XFUO 1YTZC 4MZLA 2BKHB 4GAOA 3BOWA 1CDPA 2JT0A 4MVFA 1B7TZ 2VRGA 2HPSA 1LXFC 1UUSA 1EL4A 1UHIA 2KI4C 2BL0C 3ZNIA 4CFRA 1CDNA 1H4BA 1KK8B 5D7FA 2KBIA 1UURA 1L7ZA 4NQGA 4GBAA 1CFDA 1PVBA 2LCPA 1SR6C 4MZKA 1SBJA 2ZKMX 2QPTA 1BF5A 2F3YA 1MR8A 1VRKA 1K2HA 1U5IB 4ETOA 2RGIA 4GFTA 2I2RE 3M0WA 2KI6D 5HKYA 1S3PA 1IJ5A 3IQQA 3PM8A 4GGNA 1MUXA 1UHJA 5CPVA 2KAXA 2MLFC 1FW4A 3WHTB 1LINA 2ZN8A 2BECA 3AAKA 4P5OE 4NDDA 4PHNA 1SCMB 3BUOB 1XVJA 1AJ5A 1KQMB 2A4JA 1K9UA 2LAPA 2Y5IA 3DVKA 3KEVA 4MRXA 3DF0B 4OVNF 5J3XA 2Y4QA 2L4HA 1QIVA 5DKNA 5G08A 2MBXA 3O4YA 3EVVA 3I5GB 1ALWA 1EG3A 1X02A 4PHJA 4ZCVA 1WY9A 3VRNA 4MEWA 2KOTA 1GJYA 5D69A 2WORA 2SASA 1DJYA 2JU0A 2H61A 1SK6D 4XYNA 5KTYA 1M63B 1S6CA 2ZN9A 1NCZA 2KHNA 3O6BA 2HF5A 2ZRSA 3O2PA 4OV2A 1KFXL 4JWQA 2M3WA 1SNLA 2JC2A 2K7CA 2JPTA 2LVKA 1JF2A 3O78A 1F4OA 4GPLB 1YUSA 4ORBB 1TRFA 2O5GA 1BG1A 1KSMA 1DVIA 2JOJA 2KNEA 2LUCA 5AANA 1QJTA 1BODA 1GGWA 1IH0A 1KCYA 3TS5B 1AHRA 3BOWB 1YUTA 2COLB 2CNPA 3DVJA 3PN7B 2WCFA 1F54A 2EC6C 1PULA 1KFUL 2HQ8A 1JF0A 1HQVA 2M97A 3OX5A 1R6PA 1WDCB 1J7PA 1IRJA 1SCMC 4OCIA 3SIAA 1KQMC 4PE4A 1NYAA 4CFQA 1NCYA 3BXKA 3BUXB 3I5GC 2FCDA 2V53A 3CLNA 1WRLA 3PFVA 3BUWB 3ZWHA 2LHLA 2MJWB 3CR4X 2IS9A 4YGBB 4PCWA 5B8IB 2MA2A 1TIZA 2OPOA 1WLZA 1FBVA 2TN4A 4WRIA 3I5HB 2PRUA 1B47A 1F8HA 5IBWA 1WRZA 3SG6A 3KF9A 3SJSA 4Q04A 5AXIA 2LHIA 2LP2A 4M2PA 1AVSA 2F2PA 1PALA 1UP5A 4GGFA 1Y0VH 5FYXA 4AQIA 4HSZA 2WC8A 1ZFSA 1GQMA 1XFZO 1JUOA 2KFFA 1G33A 2NCOA 1RTP1 1BJFA 1IKUA 1IQ5A 1KK7Y 1KSOA 1XYDA 2BCBA 4AQJA 4CLNA 2G2BA 3VROA 1YRUB 1SL8A 3A8RA 1B1GA 3CGAA 4M2OA 1F70A 3TUYC 1XK4A 1UHHA 4N5XA 1SYMA 2LLTA 3AAJA 2KQ6A 2LANA 4F0ZB 1TTXA 1JFKA 1YRTB 3BUMB 4I5LB 2AMIA 1CDLA 2WCBA 1F55A 1SPYA 1M46A 4AOMA 1RJVA 1MWNA 1QVIZ 4D1EA 4A4BA 2CCMA 1SMGA 1NX1A 2KDHA 1OZSA 3VRQA 4YGAA 3D0YA 3FWBA 4ORCB 5DKQA 4IL1A 4DCKA 1L2OB 4YBHB 2BBMA 2GGZA 4USLA 2PALA 2KGBC 1BMOA 2F33A 1OOJA 2BCAA 1IQ3A 3HX4A 3NSIA 1N2DA 2L0PA 2LC5A 1K9PA 3TDZA 1EJ3A 1K8UA 3WXAA 1SKTA 1DTLA 2JTTA 4MLWA 4C0KA 1YVHA 2L98A 1CDMA 2AUCA 3BQ3A 2WCEA 3GOFA 1FI6A 4ICBA 2JWWA 1M31A 2JNFA 5JJGA 1DJXA 1S5GY 1C7WA 2L4IA 3LLEA 4PHKA 2LNKA 1S36A 1WRKA 2NLNA 2JTZA 1ODBA 1LKJA 1YX8A 3I5FC 4JPZB 3K21A 3NXAA 1FPWA 4YI9A 2CT9A 2CBLA 3TDIA 1KWOC 1B7TY 1NSHA 1V1GA 1OQPA 2LMVA 1OSAA 2NCPA 4YGDB 4BY5A 1DMOA 1G4YR 1SL7A 1CM4A 1C07A 3JTDB 2JULA 3OP0A 1J7RA 2PMYA 1BR4B 3SG2A 2F3ZA 2WOSA 2MAZA 3LK1A 1KK8C 1QV0A 1DJHA 1DJWA 2OTGB 1K95A 3QRXA 2KAYA 2M9GA 3WHUB 3I5IB 2I7AA 4DS7A 4YGCB 1NWDA 2HQWA 1AP4A 3VRRA 1CFPA 3JVTB 2BE4A 1DJGA 3HCMA 1R2UA 1SL9A 4E68A 5I2LA 5KU1A 3RLZA 1D1OA 1UHNA 1TCOB 1XO5A 1CFFA 1N65A 2KSPA 3CWGA 3D0YB 1SY9A 1H8BA 4HREE 5BPJA 1A4PA 2M29A 1AJ4A 5TNCA 1A75A 1NX2A 1XFWO 4PE7A 1PVAA 5GQQC 1K93D 2ZRTA 3EK7A 5I8NA 3PATA 1RROA 1XFXO 4QJ3B 2M1UA 2M7NA 5K89A 4XJKA 1XFVO 5I2QA 1ZACA 3SG3A 1AUIB 2NZ0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LA3 A;  4NDC A;  1E8A A;  2SCP A;  3LL8 B;  4OKH A;  1KK7 Z;  1PSR A;  2E6W A;  3C1V A;  3LCP C;  1ALV A;  1S1E A;  2BKI B;  3GK4 X;  1AK8 A;  1BR1 B;  4DIR A;  4PHM A;  1KFX S;  2GV5 A;  2OTG C;  3FS7 A;  5HYD A;  4MSP A;  2K61 A;  1DGU A;  1TNP A;  3JVT C;  3CS1 A;  1BT6 A;  1B8C A;  1DF0 A;  2KAV A;  3ICB A;  3TS5 C;  3CTN A;  2LLU A;  3CR2 A;  2Q91 A;  4MZJ A;  3PN7 C;  3PLF B;  2BL0 B;  4UPG A;  1BOC A;  5HLO A;  1J1E A;  3VRP A;  1YX7 A;  2Y1N A;  5ER4 X;  1ZOT B;  1J55 A;  2FCE A;  3WNX B;  1WDC C;  3RM1 A;  1QX5 B;  1KFU S;  2NXQ A;  1CLM A;  1Y1A A;  1REC A;  1NUB A;  4BY4 A;  1DJI A;  1FF1 A;  4NDB A;  2M7L A;  3OX6 A;  1KQV A;  1XFY O;  4YI8 A;  3CZT X;  4OR9 B;  1CTR A;  5AER A;  4HRH A;  2EHB A;  2E30 A;  2LM5 A;  4FQO A;  2L2E A;  2JT3 A;  4I5K A;  1RFJ A;  3D10 A;  2CXJ A;  2KBM A;  3I5H C;  2O60 A;  1CB1 A;  1XA5 A;  1QLS A;  2EGD A;  1SCV A;  1NCX A;  1TN4 A;  2LMU A;  3EK4 A;  3EVU A;  4PAL A;  4A4C A;  2FJU B;  1A75 B;  1B9A A;  1QX7 A;  2M8U A;  1QLK A;  3AKB A;  2Q4U A;  2H2K A;  2I94 A;  1CMG A;  2K2F A;  4R1E A;  1F71 A;  1QTX A;  4MN0 A;  3SG7 A;  2FOT A;  1QS7 A;  1SRA A;  2F2O A;  4TNC A;  3TDU A;  1NX0 A;  1NP8 A;  3CR5 X;  2H61 C;  2PAS A;  1YVL A;  4JQ0 D;  4DUQ A;  2LV7 A;  1K9K A;  2K7B A;  1IJ6 A;  4XJK B;  1QAT A;  3SIB A;  2KYF A;  1CLL A;  3OB2 B;  3IF7 A;  1MF8 B;  2L5X B;  5DKR A;  2JNX A;  2MLE C;  1A29 A;  4CPV A;  1NIW A;  1FI5 A;  2JXL A;  2MRD A;  3EK8 A;  4HRG A;  1RWY A;  1CMF A;  2JXC A;  3TZ1 A;  4ZCU A;  2JZI A;  2KI6 C;  1BLQ A;  1QAS A;  1QVI Y;  2KFH A;  1MXE A;  3GK2 A;  5JOL A;  1DF0 B;  2K2A A;  4PE0 A;  1QXP A;  5ER5 A;  2LVV A;  1YR5 A;  1DGV A;  5F6T A;  3EVR A;  1W7I B;  1OMV A;  1TNQ A;  2EC6 B;  2KYC A;  1JC2 A;  1ZMZ A;  1CFC A;  3DVM A;  2B1U A;  3EKH A;  4C0J A;  1NPQ A;  4GNK B;  3EKJ A;  2JT8 A;  5CSF A;  1CKK A;  1TNW A;  1OMD A;  1L2O C;  4PE1 A;  4U8D A;  2OS8 B;  3KO0 A;  3NSK A;  2D8N A;  2L50 A;  1C7V A;  5HKZ A;  2CTN A;  1F4Q A;  4QJ4 B;  1S6J A;  4MBE A;  1J1D A;  2K7O A;  2LVI A;  1EXR A;  4I5N B;  1Q80 A;  5AFP A;  1S6I A;  4ORA B;  1Y1X A;  2BE6 A;  3PAL A;  3FIA A;  3OB1 B;  4GUK A;  5CSJ A;  2PVB A;  1Y6W A;  4QJ5 B;  1PK0 D;  2PSR A;  1WLM A;  4PDZ A;  1B8L A;  1EG4 A;  2L51 A;  4YRU A;  1G8I A;  1DJZ A;  4C0L A;  4GGF C;  1OMR A;  1TNX A;  1JWD A;  3NSL A;  3H4S E;  3IQO A;  1NX3 A;  3LK0 A;  3GK1 A;  1DT7 B;  1UWO A;  1MHO A;  5KSZ A;  1S26 D;  1RK9 A;  1YUU A;  2KGR A;  2KFG A;  2MHH A;  2HET A;  3OHM B;  4MRY A;  3JTD C;  1JSA A;  2AAO A;  2ZNE A;  3TUY B;  3NSO A;  4WQ2 A;  1CM1 A;  3A4U B;  1MQ1 A;  1XK4 C;  1GGZ A;  2LVJ A;  1K96 A;  1V1F A;  3DD4 A;  1W7J B;  3MSE B;  4DRW A;  5I2O A;  2R2I A;  2GGM A;  2M1K B;  2LE9 B;  2ZND A;  3BYA A;  3I5I C;  2OS8 C;  4CID A;  2M0R A;  3VGO A;  1JBA A;  3FWC A;  3PSR A;  1PSB A;  1U5I A;  1YUR A;  3BUN B;  3F45 A;  1JFJ A;  2P6B B;  2KQY A;  2KI4 B;  2LLS A;  1Y1U A;  4YGE B;  1TOP A;  1LA0 A;  2K7D A;  3DVE A;  2BCX A;  4FTG A;  1M39 A;  4WQ3 A;  1PRW A;  2K8M B;  2LP3 A;  1K94 A;  2JRF A;  4N1F A;  3SG4 A;  3KHE A;  1SR6 B;  1B4C A;  1CNP A;  3DF0 A;  1OZO A;  5HKW A;  3SG5 A;  4M2Q A;  1CLB A;  1SW8 A;  2DOQ A;  2JQ6 A;  5CSN A;  1K90 D;  1B8R A;  2QAC A;  2WND A;  1EH2 A;  2LMT A;  1OE9 B;  1M45 A;  2K0J A;  1IWQ A;  4N1G A;  2Y1M A;  2F8P A;  4I5J A;  5CSI A;  1QIW A;  1HT9 A;  3KPX A;  1TCF A;  2M49 B;  1IGV A;  2I18 A;  1IG5 A;  1J7Q A;  5HLV A;  3I5F B;  1QX2 A;  2G9B A;  1J7O A;  5AEQ A;  2LUX A;  1S5G Z;  1BU3 A;  5PAL A;  1MXL C;  3E3R A;  1UHK A;  1ZUZ A;  1A03 A;  1KWO B;  4L9M A;  1QV1 A;  2BBN A;  1N0Y A;  2ZFD A;  1LVC D;  3AKA A;  4P2Y B;  1A2X A;  2ISD A;  1XFU O;  1YTZ C;  4MZL A;  2BKH B;  4GAO A;  3BOW A;  1CDP A;  2JT0 A;  4MVF A;  1B7T Z;  2VRG A;  2HPS A;  1LXF C;  1UUS A;  1EL4 A;  1UHI A;  2KI4 C;  2BL0 C;  3ZNI A;  4CFR A;  1CDN A;  1H4B A;  1KK8 B;  5D7F A;  2KBI A;  1UUR A;  1L7Z A;  4NQG A;  4GBA A;  1CFD A;  1PVB A;  2LCP A;  1SR6 C;  4MZK A;  1SBJ A;  2ZKM X;  2QPT A;  1BF5 A;  2F3Y A;  1MR8 A;  1VRK A;  1K2H A;  1U5I B;  4ETO A;  2RGI A;  4GFT A;  2I2R E;  3M0W A;  2KI6 D;  5HKY A;  1S3P A;  1IJ5 A;  3IQQ A;  3PM8 A;  4GGN A;  1MUX A;  1UHJ A;  5CPV A;  2KAX A;  2MLF C;  1FW4 A;  3WHT B;  1LIN A;  2ZN8 A;  2BEC A;  3AAK A;  4P5O E;  4NDD A;  4PHN A;  1SCM B;  3BUO B;  1XVJ A;  1AJ5 A;  1KQM B;  2A4J A;  1K9U A;  2LAP A;  2Y5I A;  3DVK A;  3KEV A;  4MRX A;  3DF0 B;  4OVN F;  5J3X A;  2Y4Q A;  2L4H A;  1QIV A;  5DKN A;  5G08 A;  2MBX A;  3O4Y A;  3EVV A;  3I5G B;  1ALW A;  1EG3 A;  1X02 A;  4PHJ A;  4ZCV A;  1WY9 A;  3VRN A;  4MEW A;  2KOT A;  1GJY A;  5D69 A;  2WOR A;  2SAS A;  1DJY A;  2JU0 A;  2H61 A;  1SK6 D;  4XYN A;  5KTY A;  1M63 B;  1S6C A;  2ZN9 A;  1NCZ A;  2KHN A;  3O6B A;  2HF5 A;  2ZRS A;  3O2P A;  4OV2 A;  1KFX L;  4JWQ A;  2M3W A;  1SNL A;  2JC2 A;  2K7C A;  2JPT A;  2LVK A;  1JF2 A;  3O78 A;  1F4O A;  4GPL B;  1YUS A;  4ORB B;  1TRF A;  2O5G A;  1BG1 A;  1KSM A;  1DVI A;  2JOJ A;  2KNE A;  2LUC A;  5AAN A;  1QJT A;  1BOD A;  1GGW A;  1IH0 A;  1KCY A;  3TS5 B;  1AHR A;  3BOW B;  1YUT A;  2COL B;  2CNP A;  3DVJ A;  3PN7 B;  2WCF A;  1F54 A;  2EC6 C;  1PUL A;  1KFU L;  2HQ8 A;  1JF0 A;  1HQV A;  2M97 A;  3OX5 A;  1R6P A;  1WDC B;  1J7P A;  1IRJ A;  1SCM C;  4OCI A;  3SIA A;  1KQM C;  4PE4 A;  1NYA A;  4CFQ A;  1NCY A;  3BXK A;  3BUX B;  3I5G C;  2FCD A;  2V53 A;  3CLN A;  1WRL A;  3PFV A;  3BUW B;  3ZWH A;  2LHL A;  2MJW B;  3CR4 X;  2IS9 A;  4YGB B;  4PCW A;  5B8I B;  2MA2 A;  1TIZ A;  2OPO A;  1WLZ A;  1FBV A;  2TN4 A;  4WRI A;  3I5H B;  2PRU A;  1B47 A;  1F8H A;  5IBW A;  1WRZ A;  3SG6 A;  3KF9 A;  3SJS A;  4Q04 A;  5AXI A;  2LHI A;  2LP2 A;  4M2P A;  1AVS A;  2F2P A;  1PAL A;  1UP5 A;  4GGF A;  1Y0V H;  5FYX A;  4AQI A;  4HSZ A;  2WC8 A;  1ZFS A;  1GQM A;  1XFZ O;  1JUO A;  2KFF A;  1G33 A;  2NCO A;  1RTP 1;  1BJF A;  1IKU A;  1IQ5 A;  1KK7 Y;  1KSO A;  1XYD A;  2BCB A;  4AQJ A;  4CLN A;  2G2B A;  3VRO A;  1YRU B;  1SL8 A;  3A8R A;  1B1G A;  3CGA A;  4M2O A;  1F70 A;  3TUY C;  1XK4 A;  1UHH A;  4N5X A;  1SYM A;  2LLT A;  3AAJ A;  2KQ6 A;  2LAN A;  4F0Z B;  1TTX A;  1JFK A;  1YRT B;  3BUM B;  4I5L B;  2AMI A;  1CDL A;  2WCB A;  1F55 A;  1SPY A;  1M46 A;  4AOM A;  1RJV A;  1MWN A;  1QVI Z;  4D1E A;  4A4B A;  2CCM A;  1SMG A;  1NX1 A;  2KDH A;  1OZS A;  3VRQ A;  4YGA A;  3D0Y A;  3FWB A;  4ORC B;  5DKQ A;  4IL1 A;  4DCK A;  1L2O B;  4YBH B;  2BBM A;  2GGZ A;  4USL A;  2PAL A;  2KGB C;  1BMO A;  2F33 A;  1OOJ A;  2BCA A;  1IQ3 A;  3HX4 A;  3NSI A;  1N2D A;  2L0P A;  2LC5 A;  1K9P A;  3TDZ A;  1EJ3 A;  1K8U A;  3WXA A;  1SKT A;  1DTL A;  2JTT A;  4MLW A;  4C0K A;  1YVH A;  2L98 A;  1CDM A;  2AUC A;  3BQ3 A;  2WCE A;  3GOF A;  1FI6 A;  4ICB A;  2JWW A;  1M31 A;  2JNF A;  5JJG A;  1DJX A;  1S5G Y;  1C7W A;  2L4I A;  3LLE A;  4PHK A;  2LNK A;  1S36 A;  1WRK A;  2NLN A;  2JTZ A;  1ODB A;  1LKJ A;  1YX8 A;  3I5F C;  4JPZ B;  3K21 A;  3NXA A;  1FPW A;  4YI9 A;  2CT9 A;  2CBL A;  3TDI A;  1KWO C;  1B7T Y;  1NSH A;  1V1G A;  1OQP A;  2LMV A;  1OSA A;  2NCP A;  4YGD B;  4BY5 A;  1DMO A;  1G4Y R;  1SL7 A;  1CM4 A;  1C07 A;  3JTD B;  2JUL A;  3OP0 A;  1J7R A;  2PMY A;  1BR4 B;  3SG2 A;  2F3Z A;  2WOS A;  2MAZ A;  3LK1 A;  1KK8 C;  1QV0 A;  1DJH A;  1DJW A;  2OTG B;  1K95 A;  3QRX A;  2KAY A;  2M9G A;  3WHU B;  3I5I B;  2I7A A;  4DS7 A;  4YGC B;  1NWD A;  2HQW A;  1AP4 A;  3VRR A;  1CFP A;  3JVT B;  2BE4 A;  1DJG A;  3HCM A;  1R2U A;  1SL9 A;  4E68 A;  5I2L A;  5KU1 A;  3RLZ A;  1D1O A;  1UHN A;  1TCO B;  1XO5 A;  1CFF A;  1N65 A;  2KSP A;  3CWG A;  3D0Y B;  1SY9 A;  1H8B A;  4HRE E;  5BPJ A;  1A4P A;  2M29 A;  1AJ4 A;  5TNC A;  1A75 A;  1NX2 A;  1XFW O;  4PE7 A;  1PVA A;  5GQQ C;  1K93 D;  2ZRT A;  3EK7 A;  5I8N A;  3PAT A;  1RRO A;  1XFX O;  4QJ3 B;  2M1U A;  2M7N A;  5K89 A;  4XJK A;  1XFV O;  5I2Q A;  1ZAC A;  3SG3 A;  1AUI B;  2NZ0 A; 
#chains in the Genus database with same CATH topology
 1LA3 A;  4NDC A;  1E8A A;  2SCP A;  3LL8 B;  4OKH A;  1KK7 Z;  1PSR A;  2E6W A;  3C1V A;  3LCP C;  1ALV A;  1S1E A;  2BKI B;  3GK4 X;  1AK8 A;  1BR1 B;  4DIR A;  4PHM A;  1KFX S;  2GV5 A;  2OTG C;  3FS7 A;  3D73 A;  4MSP A;  5HYD A;  2K61 A;  1DGU A;  1TNP A;  2H8V A;  3JVT C;  3CS1 A;  3BFA A;  1BT6 A;  1B8C A;  1DF0 A;  2KAV A;  3ICB A;  3TS5 C;  3CTN A;  2LLU A;  3CR2 A;  2Q91 A;  4MZJ A;  3PN7 C;  3PLF B;  2BL0 B;  4UPG A;  1BOC A;  5HLO A;  1J1E A;  3VRP A;  1YX7 A;  2Y1N A;  3B7A A;  5ER4 X;  3R1V A;  1ZOT B;  1J55 A;  2FCE A;  3WNX B;  1WDC C;  3RM1 A;  1QX5 B;  2WCL A;  1KFU S;  2NXQ A;  1CLM A;  1Y1A A;  2PYQ A;  2WCH A;  1REC A;  1NUB A;  4BY4 A;  1DJI A;  1FF1 A;  4NDB A;  2M7L A;  3OX6 A;  1KQV A;  1XFY O;  4YI8 A;  3CZT X;  4OR9 B;  1CTR A;  5AER A;  3L4A A;  4PT1 A;  4HRH A;  1SSE B;  3SS3 A;  2EHB A;  2E30 A;  2KPH A;  2LM5 A;  2YGU A;  3OGN A;  4FQO A;  2L2E A;  2JT3 A;  1TWO A;  3K1E A;  1RFJ A;  3CDN A;  2CXJ A;  2KBM A;  3D10 A;  2O60 A;  3I5H C;  4I5K A;  1CB1 A;  1XA5 A;  1QLS A;  2EGD A;  1SCV A;  1NCX A;  1TN4 A;  2LMU A;  3EK4 A;  3EVU A;  4PAL A;  4A4C A;  2FJU B;  1A75 B;  1B9A A;  1QX7 A;  2M8U A;  1QLK A;  3AKB A;  2Q4U A;  2H2K A;  2I94 A;  2JPO A;  3BFB A;  2K2F A;  1CMG A;  4R1E A;  1F71 A;  2PQL A;  1QTX A;  4MN0 A;  3SG7 A;  2FOT A;  1QS7 A;  1SRA A;  2F2O A;  4TNC A;  3TDU A;  1Z2C B;  1NX0 A;  1NP8 A;  3CR5 X;  2H61 C;  2PAS A;  1YVL A;  4JQ0 D;  4DUQ A;  2LV7 A;  1K9K A;  1ORG A;  2K7B A;  1IJ6 A;  4XJK B;  1QAT A;  3SIB A;  2KYF A;  1CLL A;  3OB2 B;  3IF7 A;  1MF8 B;  3S0A A;  2L5X B;  1IIO A;  5DKR A;  2JNX A;  2MLE C;  1A29 A;  3CZ2 A;  4CPV A;  1NIW A;  1FI5 A;  2JXL A;  2MRD A;  3EK8 A;  4HRG A;  1RWY A;  3DYE A;  1CMF A;  2JXC A;  3L4L A;  3TZ1 A;  4ZCU A;  3V2L A;  2JZI A;  2KI6 C;  2WCK A;  1BLQ A;  3R1P A;  1QAS A;  1QVI Y;  2KFH A;  1MXE A;  3GK2 A;  3BFH A;  5JOL A;  1DF0 B;  2K2A A;  4PE0 A;  2QEB A;  1QXP A;  5ER5 A;  2LVV A;  1YR5 A;  1DGV A;  5F6T A;  3EVR A;  1W7I B;  1W9Z A;  3N7H A;  1OMV A;  1TNQ A;  2EC6 B;  2KYC A;  1JC2 A;  1ZMZ A;  1CFC A;  3DVM A;  2B1U A;  3EKH A;  4C0J A;  1NPQ A;  4GNK B;  3EKJ A;  2JT8 A;  3BJH A;  5CSF A;  1CKK A;  1TNW A;  1OMD A;  3R1O A;  1L2O C;  4PE1 A;  4U8D A;  2OS8 B;  3KO0 A;  3O4X A;  3NSK A;  5EL2 A;  2D8N A;  2L50 A;  1C7V A;  5HKZ A;  2CTN A;  1F4Q A;  4QJ4 B;  1DC1 A;  1S6J A;  4MBE A;  1J1D A;  2K7O A;  2LVI A;  1EXR A;  4I5N B;  1Q80 A;  5AFP A;  1S6I A;  3CZ0 A;  2WCJ A;  4ORA B;  3S0G A;  1Y1X A;  2BE6 A;  3R72 A;  3PAL A;  2BNX A;  3FIA A;  4JD9 A;  3OB1 B;  4GUK A;  5CSJ A;  2PVB A;  1Y6W A;  2QDI A;  4QJ5 B;  1PK0 D;  2PSR A;  1WLM A;  4PDZ A;  1B8L A;  1EG4 A;  2L51 A;  2K60 A;  4YRU A;  1G8I A;  1DJZ A;  4C0L A;  4GGF C;  1OMR A;  1TNX A;  3D78 A;  1JWD A;  3NSL A;  3H4S E;  3IQO A;  1NX3 A;  3LK0 A;  3GK1 A;  3CAB A;  1DT7 B;  1UWO A;  1MHO A;  5KSZ A;  1S26 D;  1RK9 A;  1YUU A;  2KGR A;  2KFG A;  3UO9 A;  2MHH A;  2HET A;  3OHM B;  4MRY A;  3JTD C;  1JSA A;  2AAO A;  2ZNE A;  3TUY B;  3NSO A;  4WQ2 A;  1CM1 A;  3A4U B;  1MQ1 A;  1XK4 C;  1GGZ A;  2LVJ A;  1K96 A;  1V1F A;  3DD4 A;  1W7J B;  3MSE B;  4DRW A;  5I2O A;  2R2I A;  2GGM A;  2M1K B;  2LE9 B;  2ZND A;  3BYA A;  3I5I C;  2OS8 C;  4CID A;  2M0R A;  3VGO A;  1JBA A;  3FWC A;  3PSR A;  1PSB A;  3D76 A;  1U5I A;  1YUR A;  3BUN B;  3L47 A;  3F45 A;  1JFJ A;  4OZD A;  2P6B B;  3D77 A;  3SS5 A;  2KQY A;  2KI4 B;  2LLS A;  1Y1U A;  4YGE B;  1TOP A;  1LA0 A;  2K7D A;  3DVE A;  2BCX A;  2KLE A;  4FTG A;  1M39 A;  4WQ3 A;  1PRW A;  2K8M B;  2LP3 A;  3FE6 A;  1K94 A;  2JRF A;  4N1F A;  2QEV A;  3KHE A;  1SR6 B;  3SG4 A;  1B4C A;  1CNP A;  3DF0 A;  1OZO A;  5HKW A;  3SG5 A;  4M2Q A;  1CLB A;  1SW8 A;  2DOQ A;  2JQ6 A;  5CSN A;  3PJI A;  1K90 D;  1B8R A;  2QAC A;  2WND A;  1EH2 A;  2LMT A;  1OE9 B;  1M45 A;  2K0J A;  2FJY A;  1IWQ A;  4N1G A;  2Y1M A;  2F8P A;  4I5J A;  5CSI A;  1GM0 A;  1QIW A;  1HT9 A;  3KPX A;  1TCF A;  2M49 B;  1IGV A;  2I18 A;  1IG5 A;  1J7Q A;  4IJ7 A;  5HLV A;  3I5F B;  1QX2 A;  2G9B A;  3S0D A;  1J7O A;  5AEQ A;  2LUX A;  1S5G Z;  1BU3 A;  5PAL A;  1MXL C;  3E3R A;  1UHK A;  1ZUZ A;  1A03 A;  1KWO B;  4L9M A;  1QV1 A;  3S0E A;  2BBN A;  4JKT A;  1N0Y A;  2ZFD A;  1LVC D;  2P71 A;  3AKA A;  4P2Y B;  1A2X A;  2ISD A;  3S0B A;  3NHT A;  4F7F A;  1C3Y A;  1XFU O;  1YTZ C;  4MZL A;  2BKH B;  4GAO A;  3IVT A;  3BOW A;  1CDP A;  2JT0 A;  1Z4H A;  4MVF A;  1B7T Z;  2VRG A;  2HPS A;  1LXF C;  1UUS A;  1EL4 A;  1UHI A;  2KI4 C;  2BL0 C;  3FE8 A;  3ZNI A;  4CFR A;  1CDN A;  1H4B A;  3OBV A;  1KK8 B;  5D7F A;  2KBI A;  1UUR A;  1L7Z A;  4NQG A;  4GBA A;  1CFD A;  1PVB A;  3RZS A;  2LCP A;  1SR6 C;  2WCM A;  4MZK A;  1SBJ A;  2ZKM X;  2QPT A;  1BF5 A;  1OW4 A;  2F3Y A;  1MR8 A;  1VRK A;  1K2H A;  1U5I B;  4ETO A;  2RGI A;  4GFT A;  2I2R E;  3M0W A;  4INX A;  2KI6 D;  5HKY A;  1S3P A;  1IJ5 A;  3IQQ A;  3PM8 A;  4GGN A;  1MUX A;  1P28 A;  1OOI X;  1UHJ A;  3B88 A;  5CPV A;  2KAX A;  2MLF C;  3CYZ A;  1FW4 A;  3WHT B;  1LIN A;  3PM2 A;  2ZN8 A;  2BEC A;  3AAK A;  4P5O E;  4NDD A;  4PHN A;  1SCM B;  3BUO B;  1XVJ A;  1AJ5 A;  1KQM B;  2A4J A;  1K9U A;  2LAP A;  2Y5I A;  3DVK A;  3KEV A;  4MRX A;  3DF0 B;  4OVN F;  5J3X A;  2Y4Q A;  2L4H A;  1QIV A;  5DKN A;  5G08 A;  2MBX A;  3O4Y A;  3EVV A;  3I5G B;  1ALW A;  1EG3 A;  1X02 A;  4PHJ A;  4ZCV A;  1WY9 A;  3VRN A;  4MEW A;  2BAP A;  2KOT A;  1GJY A;  5D69 A;  2WOR A;  2SAS A;  1DJY A;  1T14 A;  3NGV A;  2GTE A;  2H61 A;  2JU0 A;  1SK6 D;  4XYN A;  5KTY A;  1M63 B;  1S6C A;  2ZN9 A;  1NCZ A;  3DZT A;  5FI6 A;  2KHN A;  3O6B A;  2HF5 A;  2ZRS A;  2WC5 A;  3O2P A;  4OV2 A;  1KFX L;  4JWQ A;  2M3W A;  1SNL A;  2JC2 A;  2K7C A;  2JPT A;  2LVK A;  1JF2 A;  3O78 A;  1F4O A;  4FQT A;  1YUS A;  4GPL B;  1TRF A;  4ORB B;  2O5G A;  3SS4 A;  5DIC A;  1BG1 A;  1KSM A;  1DVI A;  2JOJ A;  2KNE A;  2LUC A;  5AAN A;  1QJT A;  1BOD A;  1GGW A;  1IH0 A;  1KCY A;  3TS5 B;  1AHR A;  3BOW B;  3Q8I A;  1YUT A;  2COL B;  2CNP A;  3DVJ A;  3PN7 B;  3DXL A;  2WCF A;  1F54 A;  2EC6 C;  1PUL A;  1KFU L;  2HQ8 A;  1JF0 A;  1HQV A;  3UNW A;  2M97 A;  3OX5 A;  1R6P A;  1WDC B;  1J7P A;  1IRJ A;  1SCM C;  4OCI A;  3SIA A;  1KQM C;  4PE4 A;  1NYA A;  4CFQ A;  1NCY A;  3BXK A;  3BUX B;  3I5G C;  2FCD A;  2V53 A;  3CLN A;  1WRL A;  3PFV A;  3BUW B;  3ZWH A;  2LHL A;  2MJW B;  3CR4 X;  5FI7 A;  2IS9 A;  4YGB B;  4PCW A;  5B8I B;  2MA2 A;  1TIZ A;  2OPO A;  4INW A;  1WLZ A;  1FBV A;  2TN4 A;  4WRI A;  3I5H B;  1OOH A;  1DEK A;  2PRU A;  1B47 A;  1F8H A;  5IBW A;  1WRZ A;  3SG6 A;  3KF9 A;  3SJS A;  4Q04 A;  5AXI A;  2LHI A;  2LP2 A;  4M2P A;  2WC6 A;  1AVS A;  2F2P A;  1PAL A;  1UP5 A;  4GGF A;  1Y0V H;  5FYX A;  4AQI A;  4HSZ A;  2WC8 A;  1ZFS A;  1GQM A;  1XFZ O;  1JUO A;  5D3O A;  2KFF A;  1G33 A;  2NCO A;  1RTP 1;  1BJF A;  1XFR A;  1IQ5 A;  2L5Y A;  1IKU A;  1KK7 Y;  1KSO A;  1XYD A;  2BCB A;  3B86 A;  4AQJ A;  4CLN A;  2G2B A;  3VRO A;  1YRU B;  1SL8 A;  3A8R A;  1B1G A;  3CGA A;  4M2O A;  1F70 A;  3TUY C;  1XK4 A;  1UHH A;  4N5X A;  1LS8 A;  2QEH A;  1SYM A;  2LLT A;  3AAJ A;  2KQ6 A;  1OOF A;  2LAN A;  1TTX A;  4F0Z B;  1JFK A;  1YRT B;  3BUM B;  4I5L B;  3S0F A;  2AMI A;  1CDL A;  1DEL A;  1DQE A;  2QEO A;  2WCB A;  3D74 A;  1F55 A;  1SPY A;  1M46 A;  4AOM A;  1RJV A;  1MWN A;  1QVI Z;  4D1E A;  4A4B A;  3B6X A;  2CCM A;  1SMG A;  1NX1 A;  2KDH A;  1OZS A;  3VRQ A;  4YGA A;  3D0Y A;  3FWB A;  2ERB A;  4ORC B;  5DKQ A;  4IL1 A;  4DCK A;  1L2O B;  2KLD A;  4YBH B;  2BBM A;  2GGZ A;  4USL A;  2PAL A;  2KGB C;  1BMO A;  2F33 A;  1OOJ A;  2BCA A;  1IQ3 A;  3HX4 A;  3NSI A;  5I94 A;  1N2D A;  2L0P A;  2LC5 A;  1K9P A;  3QME A;  3TDZ A;  1EJ3 A;  1K8U A;  3WXA A;  1SKT A;  1DTL A;  2JTT A;  4MLW A;  3EG5 B;  4C0K A;  1YVH A;  2L98 A;  1CDM A;  2AUC A;  3BQ3 A;  2WCE A;  3GOF A;  1FI6 A;  4ICB A;  2JWW A;  1M31 A;  2JNF A;  5JJG A;  1DJX A;  1S5G Y;  1C7W A;  2L4I A;  3LLE A;  4PHK A;  2LNK A;  1S36 A;  3VB1 A;  1WRK A;  2NLN A;  1OOG A;  2JTZ A;  3CZ1 A;  1ODB A;  1LKJ A;  1YX8 A;  3I5F C;  4JPZ B;  3K21 A;  1TUJ A;  3NXA A;  1FPW A;  4YI9 A;  1C3Z A;  2CT9 A;  2CBL A;  3TDI A;  1KWO C;  1B7T Y;  1NSH A;  1V1G A;  1OQP A;  2LMV A;  1OSA A;  2NCP A;  4YGD B;  4BY5 A;  3DY9 A;  1DMO A;  1G4Y R;  3NHI A;  1SL7 A;  1CM4 A;  1C07 A;  3JTD B;  2JUL A;  3OP0 A;  1J7R A;  2PMY A;  1BR4 B;  3SG2 A;  2F3Z A;  1TUZ A;  2WOS A;  2MAZ A;  3LK1 A;  3B87 A;  1KK8 C;  1QV0 A;  1DJH A;  1DJW A;  2OTG B;  1K95 A;  3QRX A;  2KAY A;  2M9G A;  3WHU B;  3I5I B;  2I7A A;  4DS7 A;  4YGC B;  1NWD A;  1QWV A;  2HQW A;  1AP4 A;  3VRR A;  1CFP A;  5HL1 A;  3JVT B;  2BE4 A;  1DJG A;  3HCM A;  1R2U A;  1SL9 A;  4E68 A;  2L2C A;  5I2L A;  5KU1 A;  3RLZ A;  1D1O A;  1UHN A;  1TCO B;  1XO5 A;  1CFF A;  1N65 A;  2KSP A;  3CWG A;  3D0Y B;  1SY9 A;  1H8B A;  4HRE E;  3D75 A;  5BPJ A;  1A4P A;  2M29 A;  1AJ4 A;  5TNC A;  1A75 A;  1NX2 A;  1XFW O;  4PE7 A;  1PVA A;  5GQQ C;  1K93 D;  2P70 A;  2ZRT A;  3EK7 A;  5I8N A;  3FE9 A;  3PAT A;  1RRO A;  1XFX O;  4QJ3 B;  2M1U A;  2M7N A;  5FI2 A;  5K89 A;  4XJK A;  1XFV O;  5I2Q A;  1ZAC A;  3SG3 A;  1AUI B;  4KYN A;  2NZ0 A; 
#chains in the Genus database with same CATH homology
 1LA3 A;  4NDC A;  1E8A A;  2SCP A;  3LL8 B;  4OKH A;  1KK7 Z;  1PSR A;  2E6W A;  3C1V A;  3LCP C;  1ALV A;  1S1E A;  2BKI B;  3GK4 X;  1AK8 A;  1BR1 B;  4DIR A;  4PHM A;  1KFX S;  2GV5 A;  2OTG C;  3FS7 A;  5HYD A;  4MSP A;  2K61 A;  1DGU A;  1TNP A;  3JVT C;  3CS1 A;  1BT6 A;  1B8C A;  1DF0 A;  2KAV A;  3ICB A;  3TS5 C;  3CTN A;  2LLU A;  3CR2 A;  2Q91 A;  4MZJ A;  3PN7 C;  3PLF B;  2BL0 B;  4UPG A;  1BOC A;  5HLO A;  1J1E A;  3VRP A;  1YX7 A;  2Y1N A;  5ER4 X;  1ZOT B;  1J55 A;  2FCE A;  3WNX B;  1WDC C;  3RM1 A;  1QX5 B;  1KFU S;  2NXQ A;  1CLM A;  1Y1A A;  1REC A;  1NUB A;  4BY4 A;  1DJI A;  1FF1 A;  4NDB A;  2M7L A;  3OX6 A;  1KQV A;  1XFY O;  4YI8 A;  3CZT X;  4OR9 B;  1CTR A;  5AER A;  4HRH A;  2EHB A;  2E30 A;  2LM5 A;  4FQO A;  2L2E A;  2JT3 A;  4I5K A;  1RFJ A;  3D10 A;  2CXJ A;  2KBM A;  3I5H C;  2O60 A;  1CB1 A;  1XA5 A;  1QLS A;  2EGD A;  1SCV A;  1NCX A;  1TN4 A;  2LMU A;  3EK4 A;  3EVU A;  4PAL A;  4A4C A;  2FJU B;  1A75 B;  1B9A A;  1QX7 A;  2M8U A;  1QLK A;  3AKB A;  2Q4U A;  2H2K A;  2I94 A;  1CMG A;  2K2F A;  4R1E A;  1F71 A;  1QTX A;  4MN0 A;  3SG7 A;  2FOT A;  1QS7 A;  1SRA A;  2F2O A;  4TNC A;  3TDU A;  1NX0 A;  1NP8 A;  3CR5 X;  2H61 C;  2PAS A;  1YVL A;  4JQ0 D;  4DUQ A;  2LV7 A;  1K9K A;  2K7B A;  1IJ6 A;  4XJK B;  1QAT A;  3SIB A;  2KYF A;  1CLL A;  3OB2 B;  3IF7 A;  1MF8 B;  2L5X B;  5DKR A;  2JNX A;  2MLE C;  1A29 A;  4CPV A;  1NIW A;  1FI5 A;  2JXL A;  2MRD A;  3EK8 A;  4HRG A;  1RWY A;  1CMF A;  2JXC A;  3TZ1 A;  4ZCU A;  2JZI A;  2KI6 C;  1BLQ A;  1QAS A;  1QVI Y;  2KFH A;  1MXE A;  3GK2 A;  5JOL A;  1DF0 B;  2K2A A;  4PE0 A;  1QXP A;  5ER5 A;  2LVV A;  1YR5 A;  1DGV A;  5F6T A;  3EVR A;  1W7I B;  1OMV A;  1TNQ A;  2EC6 B;  2KYC A;  1JC2 A;  1ZMZ A;  1CFC A;  3DVM A;  2B1U A;  3EKH A;  4C0J A;  1NPQ A;  4GNK B;  3EKJ A;  2JT8 A;  5CSF A;  1CKK A;  1TNW A;  1OMD A;  1L2O C;  4PE1 A;  4U8D A;  2OS8 B;  3KO0 A;  3NSK A;  2D8N A;  2L50 A;  1C7V A;  5HKZ A;  2CTN A;  1F4Q A;  4QJ4 B;  1S6J A;  4MBE A;  1J1D A;  2K7O A;  2LVI A;  1EXR A;  4I5N B;  1Q80 A;  5AFP A;  1S6I A;  4ORA B;  1Y1X A;  2BE6 A;  3PAL A;  3FIA A;  3OB1 B;  4GUK A;  5CSJ A;  2PVB A;  1Y6W A;  4QJ5 B;  1PK0 D;  2PSR A;  1WLM A;  4PDZ A;  1B8L A;  1EG4 A;  2L51 A;  4YRU A;  1G8I A;  1DJZ A;  4C0L A;  4GGF C;  1OMR A;  1TNX A;  1JWD A;  3NSL A;  3H4S E;  3IQO A;  1NX3 A;  3LK0 A;  3GK1 A;  1DT7 B;  1UWO A;  1MHO A;  5KSZ A;  1S26 D;  1RK9 A;  1YUU A;  2KGR A;  2KFG A;  2MHH A;  2HET A;  3OHM B;  4MRY A;  3JTD C;  1JSA A;  2AAO A;  2ZNE A;  3TUY B;  3NSO A;  4WQ2 A;  1CM1 A;  3A4U B;  1MQ1 A;  1XK4 C;  1GGZ A;  2LVJ A;  1K96 A;  1V1F A;  3DD4 A;  1W7J B;  3MSE B;  4DRW A;  5I2O A;  2R2I A;  2GGM A;  2M1K B;  2LE9 B;  2ZND A;  3BYA A;  3I5I C;  2OS8 C;  4CID A;  2M0R A;  3VGO A;  1JBA A;  3FWC A;  3PSR A;  1PSB A;  1U5I A;  1YUR A;  3BUN B;  3F45 A;  1JFJ A;  2P6B B;  2KQY A;  2KI4 B;  2LLS A;  1Y1U A;  4YGE B;  1TOP A;  1LA0 A;  2K7D A;  3DVE A;  2BCX A;  4FTG A;  1M39 A;  4WQ3 A;  1PRW A;  2K8M B;  2LP3 A;  1K94 A;  2JRF A;  4N1F A;  3SG4 A;  3KHE A;  1SR6 B;  1B4C A;  1CNP A;  3DF0 A;  1OZO A;  5HKW A;  3SG5 A;  4M2Q A;  1CLB A;  1SW8 A;  2DOQ A;  2JQ6 A;  5CSN A;  1K90 D;  1B8R A;  2QAC A;  2WND A;  1EH2 A;  2LMT A;  1OE9 B;  1M45 A;  2K0J A;  1IWQ A;  4N1G A;  2Y1M A;  2F8P A;  4I5J A;  5CSI A;  1QIW A;  1HT9 A;  3KPX A;  1TCF A;  2M49 B;  1IGV A;  2I18 A;  1IG5 A;  1J7Q A;  5HLV A;  3I5F B;  1QX2 A;  2G9B A;  1J7O A;  5AEQ A;  2LUX A;  1S5G Z;  1BU3 A;  5PAL A;  1MXL C;  3E3R A;  1UHK A;  1ZUZ A;  1A03 A;  1KWO B;  4L9M A;  1QV1 A;  2BBN A;  1N0Y A;  2ZFD A;  1LVC D;  3AKA A;  4P2Y B;  1A2X A;  2ISD A;  1XFU O;  1YTZ C;  4MZL A;  2BKH B;  4GAO A;  3BOW A;  1CDP A;  2JT0 A;  4MVF A;  1B7T Z;  2VRG A;  2HPS A;  1LXF C;  1UUS A;  1EL4 A;  1UHI A;  2KI4 C;  2BL0 C;  3ZNI A;  4CFR A;  1CDN A;  1H4B A;  1KK8 B;  5D7F A;  2KBI A;  1UUR A;  1L7Z A;  4NQG A;  4GBA A;  1CFD A;  1PVB A;  2LCP A;  1SR6 C;  4MZK A;  1SBJ A;  2ZKM X;  2QPT A;  1BF5 A;  2F3Y A;  1MR8 A;  1VRK A;  1K2H A;  1U5I B;  4ETO A;  2RGI A;  4GFT A;  2I2R E;  3M0W A;  2KI6 D;  5HKY A;  1S3P A;  1IJ5 A;  3IQQ A;  3PM8 A;  4GGN A;  1MUX A;  1UHJ A;  5CPV A;  2KAX A;  2MLF C;  1FW4 A;  3WHT B;  1LIN A;  2ZN8 A;  2BEC A;  3AAK A;  4P5O E;  4NDD A;  4PHN A;  1SCM B;  3BUO B;  1XVJ A;  1AJ5 A;  1KQM B;  2A4J A;  1K9U A;  2LAP A;  2Y5I A;  3DVK A;  3KEV A;  4MRX A;  3DF0 B;  4OVN F;  5J3X A;  2Y4Q A;  2L4H A;  1QIV A;  5DKN A;  5G08 A;  2MBX A;  3O4Y A;  3EVV A;  3I5G B;  1ALW A;  1EG3 A;  1X02 A;  4PHJ A;  4ZCV A;  1WY9 A;  3VRN A;  4MEW A;  2KOT A;  1GJY A;  5D69 A;  2WOR A;  2SAS A;  1DJY A;  2JU0 A;  2H61 A;  1SK6 D;  4XYN A;  5KTY A;  1M63 B;  1S6C A;  2ZN9 A;  1NCZ A;  2KHN A;  3O6B A;  2HF5 A;  2ZRS A;  3O2P A;  4OV2 A;  1KFX L;  4JWQ A;  2M3W A;  1SNL A;  2JC2 A;  2K7C A;  2JPT A;  2LVK A;  1JF2 A;  3O78 A;  1F4O A;  4GPL B;  1YUS A;  4ORB B;  1TRF A;  2O5G A;  1BG1 A;  1KSM A;  1DVI A;  2JOJ A;  2KNE A;  2LUC A;  5AAN A;  1QJT A;  1BOD A;  1GGW A;  1IH0 A;  1KCY A;  3TS5 B;  1AHR A;  3BOW B;  1YUT A;  2COL B;  2CNP A;  3DVJ A;  3PN7 B;  2WCF A;  1F54 A;  2EC6 C;  1PUL A;  1KFU L;  2HQ8 A;  1JF0 A;  1HQV A;  2M97 A;  3OX5 A;  1R6P A;  1WDC B;  1J7P A;  1IRJ A;  1SCM C;  4OCI A;  3SIA A;  1KQM C;  4PE4 A;  1NYA A;  4CFQ A;  1NCY A;  3BXK A;  3BUX B;  3I5G C;  2FCD A;  2V53 A;  3CLN A;  1WRL A;  3PFV A;  3BUW B;  3ZWH A;  2LHL A;  2MJW B;  3CR4 X;  2IS9 A;  4YGB B;  4PCW A;  5B8I B;  2MA2 A;  1TIZ A;  2OPO A;  1WLZ A;  1FBV A;  2TN4 A;  4WRI A;  3I5H B;  2PRU A;  1B47 A;  1F8H A;  5IBW A;  1WRZ A;  3SG6 A;  3KF9 A;  3SJS A;  4Q04 A;  5AXI A;  2LHI A;  2LP2 A;  4M2P A;  1AVS A;  2F2P A;  1PAL A;  1UP5 A;  4GGF A;  1Y0V H;  5FYX A;  4AQI A;  4HSZ A;  2WC8 A;  1ZFS A;  1GQM A;  1XFZ O;  1JUO A;  2KFF A;  1G33 A;  2NCO A;  1RTP 1;  1BJF A;  1IKU A;  1IQ5 A;  1KK7 Y;  1KSO A;  1XYD A;  2BCB A;  4AQJ A;  4CLN A;  2G2B A;  3VRO A;  1YRU B;  1SL8 A;  3A8R A;  1B1G A;  3CGA A;  4M2O A;  1F70 A;  3TUY C;  1XK4 A;  1UHH A;  4N5X A;  1SYM A;  2LLT A;  3AAJ A;  2KQ6 A;  2LAN A;  4F0Z B;  1TTX A;  1JFK A;  1YRT B;  3BUM B;  4I5L B;  2AMI A;  1CDL A;  2WCB A;  1F55 A;  1SPY A;  1M46 A;  4AOM A;  1RJV A;  1MWN A;  1QVI Z;  4D1E A;  4A4B A;  2CCM A;  1SMG A;  1NX1 A;  2KDH A;  1OZS A;  3VRQ A;  4YGA A;  3D0Y A;  3FWB A;  4ORC B;  5DKQ A;  4IL1 A;  4DCK A;  1L2O B;  4YBH B;  2BBM A;  2GGZ A;  4USL A;  2PAL A;  2KGB C;  1BMO A;  2F33 A;  1OOJ A;  2BCA A;  1IQ3 A;  3HX4 A;  3NSI A;  1N2D A;  2L0P A;  2LC5 A;  1K9P A;  3TDZ A;  1EJ3 A;  1K8U A;  3WXA A;  1SKT A;  1DTL A;  2JTT A;  4MLW A;  4C0K A;  1YVH A;  2L98 A;  1CDM A;  2AUC A;  3BQ3 A;  2WCE A;  3GOF A;  1FI6 A;  4ICB A;  2JWW A;  1M31 A;  2JNF A;  5JJG A;  1DJX A;  1S5G Y;  1C7W A;  2L4I A;  3LLE A;  4PHK A;  2LNK A;  1S36 A;  1WRK A;  2NLN A;  2JTZ A;  1ODB A;  1LKJ A;  1YX8 A;  3I5F C;  4JPZ B;  3K21 A;  3NXA A;  1FPW A;  4YI9 A;  2CT9 A;  2CBL A;  3TDI A;  1KWO C;  1B7T Y;  1NSH A;  1V1G A;  1OQP A;  2LMV A;  1OSA A;  2NCP A;  4YGD B;  4BY5 A;  1DMO A;  1G4Y R;  1SL7 A;  1CM4 A;  1C07 A;  3JTD B;  2JUL A;  3OP0 A;  1J7R A;  2PMY A;  1BR4 B;  3SG2 A;  2F3Z A;  2WOS A;  2MAZ A;  3LK1 A;  1KK8 C;  1QV0 A;  1DJH A;  1DJW A;  2OTG B;  1K95 A;  3QRX A;  2KAY A;  2M9G A;  3WHU B;  3I5I B;  2I7A A;  4DS7 A;  4YGC B;  1NWD A;  2HQW A;  1AP4 A;  3VRR A;  1CFP A;  3JVT B;  2BE4 A;  1DJG A;  3HCM A;  1R2U A;  1SL9 A;  4E68 A;  5I2L A;  5KU1 A;  3RLZ A;  1D1O A;  1UHN A;  1TCO B;  1XO5 A;  1CFF A;  1N65 A;  2KSP A;  3CWG A;  3D0Y B;  1SY9 A;  1H8B A;  4HRE E;  5BPJ A;  1A4P A;  2M29 A;  1AJ4 A;  5TNC A;  1A75 A;  1NX2 A;  1XFW O;  4PE7 A;  1PVA A;  5GQQ C;  1K93 D;  2ZRT A;  3EK7 A;  5I8N A;  3PAT A;  1RRO A;  1XFX O;  4QJ3 B;  2M1U A;  2M7N A;  5K89 A;  4XJK A;  1XFV O;  5I2Q A;  1ZAC A;  3SG3 A;  1AUI B;  2NZ0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...