3O2PA

A dual e3 mechanism for rub1 ligation to cdc53: dcn1(p)-cdc53(whb)
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
199
structure length
199
Chain Sequence
YPKELTQVFEHYINNNLFDIDSLVKFIEELGYNLEDLATLCLAHLLGYKKLEEPLKREDFLSTWFMQGCSTISDMQECIKTLDVKLHEDLQYFTQIYNYAFNLILDPNRKDIDTDEGIQYWKLFFQPEYPVRMEPDLLEAWFRFLRDEGKTTISKDTWRMLLLFFKRYPTIQKIISDYDETAAWPFIIDEFYECLQDQQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A dual E3 mechanism for Rub1 ligation to Cdc53.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Ligase, cell cycle
molecule keywords Defective in cullin neddylation protein 1
total genus 68
structure length 199
sequence length 199
ec nomenclature
pdb deposition date 2010-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03556 Cullin_binding Cullin binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3o2pA01
2EC6C 1L7ZA 1ZFSA 4MVFA 1HT9A 3OX5A 4HRHA 2F33A 2GGZA 1SCVA 1ZOTB 4N1FA 2KGBC 2M7LA 3KHEA 1BOCA 1KFXL 1PVAA 2NLNA 2WCEA 2Y1MA 3D0YA 1CB1A 1SCMC 3AAJA 4GAOA 2M97A 1B8LA 3VRRA 3EK8A 2FJUB 4M2QA 1D1OA 1IRJA 3I5FB 5JJGA 3KEVA 4ZCUA 3CLNA 3H4SE 4ETOA 1ALWA 1KSOA 2M29A 2L5XB 1TNWA 3VRQA 3BOWA 3A8RA 3IQOA 1J1DA 4HSZA 3VROA 1AJ4A 1M39A 1QTXA 3SG6A 4CFRA 2CXJA 1WRLA 4F0ZB 1FW4A 2VRGA 2PVBA 1ZACA 1MXEA 1KCYA 1DGUA 4JPZB 1K9KA 1BR4B 1TNPA 2HETA 1CDMA 5G08A 2COLB 3BYAA 2CT9A 3IQQA 2ZFDA 1UHHA 2KAYA 2KGRA 3WXAA 3MSEB 1IWQA 1ZMZA 5HLOA 1S6IA 2NCPA 2JNFA 4PDZA 2M1UA 1SBJA 2ZRSA 1SYMA 3DVJA 1YRUB 1YURA 2JRFA 3PM8A 1SCMB 3O6BA 3WNXB 3O4YA 2G9BA 2L98A 3OP0A 2AAOA 1QX5B 1R2UA 3DVKA 3I5FC 4GPLB 3KO0A 1BR1B 3AKBA 5AXIA 3SG7A 4WQ3A 1DVIA 1UHNA 1YUTA 3NSOA 2M1KB 1BJFA 1F4QA 1QJTA 1RJVA 1YRTB 3CS1A 2Y1NA 4N5XA 2LUCA 1H4BA 1S5GY 1M46A 3TUYC 1NX3A 1QS7A 2K8MB 1QX2A 2A4JA 2BECA 1NPQA 2K0JA 5PALA 1SR6C 2KI6D 1N65A 2H2KA 1MF8B 4L9MA 1A03A 2LV7A 4NDCA 1NIWA 2BBMA 2DOQA 5ER4X 2K2AA 3SG4A 1J55A 4YGAA 2HF5A 1B7TZ 2GGMA 4D1EA 2I18A 2WC8A 2LNKA 4MN0A 2MLEC 3DVMA 1OE9B 1J7QA 1A29A 1MR8A 2OS8C 2Q4UA 4MZKA 1NX1A 3RM1A 1QX7A 2KFHA 1XFUO 3SG5A 2I7AA 1S6JA 1SNLA 3O78A 1DMOA 4MRYA 1S3PA 2NCOA 5HYDA 1ODBA 5KU1A 2PALA 4C0JA 3PATA 4CIDA 1MXLC 1Y1UA 1OMDA 3TUYB 1B9AA 4JQ0D 1OMRA 1JBAA 2M7NA 5I2LA 1SR6B 3SJSA 4YBHB 1XK4A 1N2DA 1WLZA 2BL0B 1LKJA 4ICBA 1CKKA 2HQ8A 1C07A 2M9GA 4OVNF 3PSRA 2LAPA 1XFXO 2Y5IA 1EL4A 2M8UA 1QASA 4FTGA 2K7DA 1M45A 2EHBA 2NZ0A 1SPYA 2OS8B 3TS5C 1EG3A 2CCMA 2QACA 1PSRA 3OHMB 1VRKA 1S1EA 1RWYA 4GUKA 5DKRA 1N0YA 1SKTA 1E8AA 1TOPA 2AMIA 1K93D 4XJKA 2JT3A 1L2OB 4GFTA 1NX0A 1EJ3A 1K94A 4QJ5B 4PHJA 2JQ6A 1BU3A 1KK8C 3GOFA 1AVSA 2MAZA 3OB2B 1CLLA 3LLEA 3BUNB 3BUMB 1G8IA 1GQMA 2BL0C 2IS9A 1K90D 1CTRA 2KBMA 1V1GA 2LVKA 2L4IA 2KI4B 3CR2A 1WRZA 1JUOA 1CDLA 2GV5A 1F8HA 4M2OA 4BY5A 1KFXS 2O5GA 2JPTA 3DD4A 1A75A 4Q04A 1TRFA 2P6BB 2OTGC 5AFPA 3TS5B 1J1EA 4OKHA 1M31A 2FCDA 1K96A 1L2OC 2JT0A 2F8PA 4YI8A 4GGFC 2LM5A 1U5IA 4MRXA 2LE9B 4JWQA 4YGDB 1B1GA 1KK8B 1S36A 4E68A 4ZCVA 1PK0D 2H61A 4UPGA 4NDDA 1TCFA 1XVJA 3NXAA 2LLSA 5JOLA 1NCXA 1IQ3A 1W7JB 4PCWA 1RK9A 2KI4C 3GK1A 4MZJA 2KYFA 4NDBA 5D7FA 1OMVA 1AUIB 2B1UA 1G4YR 1C7VA 1MWNA 1F54A 1WRKA 2LANA 4CPVA 1UHIA 2OTGB 1PULA 2LVJA 4I5JA 5CSIA 1PVBA 2WNDA 2KNEA 2JXLA 3PN7B 5FYXA 3TDZA 4MZLA 1FI6A 2F3YA 4DCKA 2JNXA 5I2OA 1IG5A 4HRGA 4M2PA 3BOWB 1WDCB 2JC2A 4YGBB 1CM1A 1NYAA 1QXPA 5KTYA 1RROA 1IGVA 1DF0B 1QIVA 1AP4A 4ORAB 2ZN8A 3GK4X 2KAXA 2E30A 2L50A 1IQ5A 1XFZO 4PE1A 2RGIA 4OR9B 2JTZA 1GJYA 1YVHA 1PRWA 5CSJA 3WHUB 1F55A 2KSPA 3FS7A 3GK2A 4PE4A 3A4UB 2KAVA 2L51A 3E3RA 2MRDA 3LCPC 1XO5A 3SG3A 2Q91A 1CFCA 3PLFB 1QLSA 4QJ4B 1J7OA 1JFKA 1KK7Y 1F4OA 1PSBA 1TNQA 3BUOB 3PN7C 2CNPA 3PALA 3NSLA 4R1EA 2KOTA 2PASA 3D0YB 2LHIA 2ZNDA 1DJZA 3BQ3A 2KBIA 1WDCC 1LINA 2KQYA 3IF7A 5DKNA 3KF9A 3SG2A 3VGOA 3EK4A 3DVEA 2KHNA 4I5KA 1V1FA 1GGZA 3SIBA 4HREE 1MHOA 1DJIA 4N1GA 1FI5A 4C0KA 1HQVA 2JZIA 1BLQA 3AKAA 3OX6A 2K7CA 3CWGA 5AEQA 4AOMA 1CMGA 1RECA 2ZN9A 1H8BA 1YUSA 2BCBA 2EGDA 3K21A 4GGFA 1IJ6A 2KQ6A 4PHKA 2K7BA 1OQPA 1EH2A 1DF0A 1CNPA 2SCPA 2WCFA 2H61C 2WORA 2KYCA 2WOSA 5HKYA 2OPOA 2KI6C 3LK0A 2PMYA 1FPWA 4PHMA 3NSKA 1SRAA 2LP2A 4P5OE 1NCZA 1Y1AA 2PSRA 3BUWB 4ORCB 5HKWA 1IKUA 1B47A 2JXCA 2R2IA 4DRWA 4GNKB 1SL9A 3VRPA 4YRUA 2M0RA 1B8CA 1GGWA 1XFYO 2KFFA 1DT7B 1BG1A 1NWDA 3LK1A 1B4CA 1QIWA 5HLVA 1BMOA 1JSAA 2LMVA 2BE4A 1KFUS 3CZTX 1YTZC 1MQ1A 2AUCA 1CLBA 2L4HA 3EVUA 2HQWA 2LLUA 1BT6A 4XJKB 2F2PA 3DF0A 3BUXB 4I5LB 1QV1A 1UP5A 2CBLA 4DUQA 4CLNA 3TDIA 5KSZA 1DTLA 1SL7A 1LA0A 1TCOB 1G33A 1K2HA 2FOTA 2E6WA 1B8RA 2I2RE 1K9UA 3HCMA 1SK6D 3BXKA 1DJWA 1SY9A 1BODA 5D69A 1TN4A 5BPJA 1SW8A 2BCXA 4AQJA 1XA5A 5I2QA 1CFPA 2BE6A 4CFQA 1WY9A 4PALA 1S26D 3ZNIA 2M3WA 1KWOB 1S5GZ 2K7OA 1KSMA 2KFGA 1OOJA 1Y0VH 5IBWA 1KFUL 2LHLA 1K95A 4XYNA 4DIRA 1C7WA 2JULA 5AERA 5CSFA 1CDPA 3TDUA 3I5IB 4P2YB 2HPSA 1DJXA 2K2FA 1LXFC 2SASA 2KDHA 1QVIY 1RTP1 2BKHB 4YI9A 1SL8A 3JVTB 1RFJA 3QRXA 4C0LA 1MUXA 1JC2A 1S6CA 1DJGA 2ZNEA 3PFVA 2ZRTA 1DGVA 1J7RA 1NUBA 5CSNA 1CFFA 1KWOC 4IL1A 1KK7Z 1TTXA 1UHJA 3RLZA 4OCIA 2V53A 2I94A 2L0PA 1XK4C 2ZKMX 1AK8A 4PE7A 5GQQC 1KQVA 1NCYA 3JTDC 1OZOA 2WCBA 3EKJA 3KPXA 1NSHA 4GBAA 2ISDA 5K89A 2PRUA 1J7PA 1OZSA 1JWDA 4GGNA 1Y1XA 2BCAA 3EVVA 1ZUZA 5CPVA 4A4CA 4DS7A 1CFDA 3I5IC 2LUXA 1PALA 1KQMC 3CTNA 2MBXA 1B7TY 1CDNA 3SIAA 1YUUA 1F71A 1CMFA 3I5GC 3JVTC 1NP8A 1CM4A 2LVVA 2Y4QA 2JWWA 1FBVA 1DJYA 2LLTA 4PHNA 4USLA 3O2PA 1QATA 2MJWB 1XFWO 1UWOA 4PE0A 4YGCB 1LA3A 3FWCA 1Y6WA 1IJ5A 1AJ5A 2LP3A 2K61A 3C1VA 3JTDB 1F70A 1R6PA 3DF0B 1K8UA 3I5HC 4TNCA 3LL8B 2LMTA 4MEWA 5I8NA 1U5IB 1CLMA 3CGAA 4MLWA 2JU0A 1A2XA 1TIZA 4OV2A 2BBNA 1M63B 2LMUA 1XYDA 1X02A 1ALVA 1IH0A 1KQMB 3VRNA 4U8DA 2M49B 1UUSA 1YVLA 1JF0A 1OSAA 2FCEA 2NXQA 1W7IB 1JFJA 1WLMA 1YR5A 3I5GB 3CR5X 1JF2A 1K9PA 3HX4A 2EC6B 4FQOA 4QJ3B 1QLKA 4WRIA 1LVCD 2F3ZA 5ER5A 3ICBA 5HKZA 3FIAA 4AQIA 2LVIA 2G2BA 3TZ1A 1NX2A 3AAKA 2F2OA 2JT8A 5TNCA 1A75B 1QVIZ 1EXRA 3D10A 1TNXA 2MLFC 3CR4X 1YX8A 3F45A 3FWBA 5AANA 5B8IB 1YX7A 2LCPA 3I5HB 1QV0A 3M0WA 4I5NB 2JTTA 4BY4A 1A4PA 2MHHA 3WHTB 1UURA 3EKHA 2QPTA 3NSIA 1SMGA 2JOJA 2MA2A 4NQGA 5DKQA 2TN4A 3ZWHA 1FF1A 1AHRA 2D8NA 2CTNA 2LC5A 1XFVO 1BF5A 2BKIB 5J3XA 1DJHA 1UHKA 3EVRA 4ORBB 4MBEA 2L2EA 4A4BA 2O60A 3OB1B 1EG4A 4MSPA 3EK7A 4WQ2A 5F6TA 4YGEB 1Q80A
chains in the Genus database with same CATH superfamily
2EC6C 1L7ZA 1ZFSA 3BFHA 4MVFA 1HT9A 3OX5A 4HRHA 2F33A 2GGZA 1SCVA 1ZOTB 2K60A 4N1FA 2KGBC 4IJ7A 2M7LA 5FI2A 3B6XA 3CZ1A 3KHEA 1BOCA 1KFXL 1PVAA 2NLNA 2WCEA 2Y1MA 3D0YA 1CB1A 1SCMC 3AAJA 3CYZA 2L2CA 2M97A 4GAOA 1B8LA 2P71A 3VRRA 3EK8A 2FJUB 4M2QA 1D1OA 1IRJA 3I5FB 5JJGA 3KEVA 4ZCUA 3CLNA 3H4SE 3D73A 1ALWA 1KSOA 2M29A 2L5XB 4ETOA 1TNWA 3VRQA 3SS3A 3BOWA 3A8RA 3IQOA 1J1DA 4HSZA 3VROA 2QDIA 1AJ4A 1M39A 1QTXA 3SG6A 4CFRA 2CXJA 1WRLA 4F0ZB 1FW4A 2VRGA 2PVBA 1ZACA 2P70A 2QEVA 1TWOA 1MXEA 1KCYA 1DGUA 4JPZB 1K9KA 1BR4B 1TNPA 2HETA 1CDMA 5G08A 2COLB 3BYAA 2CT9A 3IQQA 2ZFDA 1UHHA 2KAYA 2KGRA 3WXAA 3MSEB 1IWQA 1ZMZA 2PYQA 5HLOA 1OW4A 1S6IA 2JNFA 2NCPA 1P28A 1SBJA 2M1UA 1SYMA 2ZRSA 3DVJA 1YRUB 1YURA 2JRFA 3PM8A 1SCMB 3O6BA 3WNXB 3O4YA 2G9BA 2L98A 3OP0A 2AAOA 1QX5B 1R2UA 3DVKA 3I5FC 4GPLB 3KO0A 1BR1B 3AKBA 5AXIA 3SG7A 4WQ3A 1DVIA 1UHNA 1YUTA 2WCHA 2BNXA 3S0BA 3NSOA 2M1KB 1BJFA 1F4QA 1QJTA 1RJVA 1YRTB 3CS1A 2Y1NA 4N5XA 2LUCA 3CZ0A 1H4BA 1S5GY 1M46A 3L4AA 3TUYC 1NX3A 1QS7A 2K8MB 1QX2A 2A4JA 2BECA 1NPQA 2K0JA 2KLEA 3B7AA 1SR6C 2KI6D 1N65A 2H2KA 3D76A 1MF8B 1OOFA 4L9MA 1A03A 2LV7A 4NDCA 1NIWA 2BBMA 2DOQA 3S0EA 5ER4X 2K2AA 3DZTA 3SG4A 1J55A 4YGAA 1DC1A 2HF5A 1B7TZ 2GGMA 5PALA 4D1EA 2I18A 2WC8A 2LNKA 2YGUA 4MN0A 2MLEC 3DVMA 1OE9B 1J7QA 2FJYA 1A29A 3BFAA 1MR8A 2OS8C 3D77A 2Q4UA 4MZKA 2JPOA 1NX1A 3RM1A 1QX7A 2KFHA 4F7FA 1XFUO 3SG5A 2I7AA 1S6JA 1SNLA 3NGVA 3O78A 1DMOA 4MRYA 1S3PA 2NCOA 5HYDA 1ODBA 5KU1A 2GTEA 2PALA 4C0JA 3PATA 1C3ZA 2H8VA 1MXLC 2WC5A 4OZDA 1Y1UA 4CIDA 1OMDA 3TUYB 1B9AA 4JQ0D 1OMRA 1W9ZA 2M7NA 3Q8IA 5I2LA 1JBAA 1SR6B 1XFRA 3SJSA 4YBHB 1XK4A 1N2DA 1WLZA 2BL0B 1LKJA 3DYEA 4ICBA 1CKKA 2HQ8A 1C07A 2M9GA 4OVNF 3PSRA 3V2LA 2LAPA 1XFXO 2Y5IA 1EL4A 2M8UA 1QASA 4FTGA 4JKTA 2K7DA 1M45A 2EHBA 2NZ0A 1SPYA 2OS8B 3TS5C 1EG3A 2CCMA 2QACA 1PSRA 3OHMB 1VRKA 1S1EA 1RWYA 4GUKA 5DKRA 1N0YA 1SKTA 1E8AA 1TOPA 2AMIA 4KYNA 1K93D 4XJKA 2JT3A 1L2OB 4GFTA 1NX0A 1EJ3A 1K94A 3R72A 4PHJA 4QJ5B 2JQ6A 1BU3A 1KK8C 3GOFA 1AVSA 2MAZA 3OB2B 1CLLA 3BFBA 3LLEA 3R1OA 3BUNB 3BUMB 1G8IA 1GQMA 2BL0C 3SS5A 2IS9A 1K90D 1CTRA 2KBMA 1V1GA 2LVKA 2L4IA 2KI4B 3CR2A 1WRZA 4INXA 3S0AA 1JUOA 1CDLA 2GV5A 1F8HA 4M2OA 4BY5A 1KFXS 3PJIA 2O5GA 2JPTA 3DD4A 1A75A 4Q04A 3R1PA 1TRFA 2P6BB 2OTGC 5AFPA 1IIOA 3TS5B 1OOIX 1J1EA 2QEBA 4OKHA 1M31A 2FCDA 1K96A 1LS8A 3BJHA 1L2OC 2JT0A 2F8PA 4YI8A 4GGFC 2LM5A 1U5IA 4MRXA 2LE9B 4JWQA 4YGDB 1B1GA 1KK8B 1S36A 4E68A 3PM2A 1PK0D 2H61A 4ZCVA 4UPGA 4NDDA 1TCFA 1XVJA 3NXAA 2LLSA 5JOLA 1NCXA 1IQ3A 1W7JB 3L4LA 4PCWA 1RK9A 3QMEA 2KI4C 3GK1A 4MZJA 2KYFA 4NDBA 5D7FA 1OMVA 2B1UA 1AUIB 1G4YR 1C7VA 1MWNA 1F54A 1WRKA 2LANA 4CPVA 1UHIA 2OTGB 1PULA 2LVJA 4I5JA 5CSIA 1PVBA 2WNDA 2KNEA 2JXLA 2WC6A 3PN7B 3FE8A 5FYXA 4MZLA 3TDZA 1FI6A 2F3YA 4DCKA 2JNXA 5I2OA 1IG5A 4HRGA 4M2PA 3BOWB 1WDCB 2JC2A 4YGBB 1CM1A 1NYAA 2WCKA 1QXPA 5KTYA 1RROA 1SSEB 1IGVA 2ERBA 1DF0B 1QIVA 2KPHA 1AP4A 4ORAB 2ZN8A 3GK4X 2KAXA 2E30A 2L50A 1IQ5A 1XFZO 4PE1A 2RGIA 4OR9B 2JTZA 1GJYA 1YVHA 1PRWA 5CSJA 3WHUB 3DXLA 1F55A 2KSPA 3FS7A 3OBVA 3GK2A 1DQEA 4PE4A 3A4UB 2KAVA 2L51A 3E3RA 2MRDA 3LCPC 1XO5A 3SG3A 2Q91A 1CFCA 3PLFB 1QLSA 4QJ4B 1J7OA 1JFKA 1KK7Y 3S0GA 1F4OA 1PSBA 1TNQA 3BUOB 5I94A 2WCLA 3PN7C 2CNPA 3B87A 3NSLA 3PALA 4R1EA 2KOTA 2PASA 3D0YB 3O4XA 2L5YA 2LHIA 2ZNDA 1DJZA 3BQ3A 3D75A 2KBIA 1Z4HA 1WDCC 1LINA 2KQYA 3IF7A 5DKNA 3KF9A 3SG2A 3VGOA 3EK4A 3DVEA 2KHNA 4I5KA 3S0DA 1V1FA 1GGZA 3DY9A 3SIBA 4HREE 1MHOA 3D74A 1DJIA 4N1GA 1FI5A 4C0KA 1HQVA 2JZIA 1BLQA 3AKAA 3OX6A 2K7CA 3CWGA 5AEQA 4AOMA 1CMGA 1RECA 2ZN9A 1H8BA 1YUSA 2BCBA 2EGDA 3K21A 4GGFA 1IJ6A 2KQ6A 4PHKA 2K7BA 1OQPA 1EH2A 1DF0A 1CNPA 2SCPA 2WCFA 2H61C 2WORA 2KYCA 2WOSA 5HKYA 2OPOA 2KI6C 3LK0A 2PMYA 1FPWA 4PHMA 3NSKA 1SRAA 2LP2A 4P5OE 1NCZA 3FE9A 1Y1AA 2PSRA 1ORGA 3BUWB 4ORCB 3RZSA 5HKWA 3CZ2A 1IKUA 1B47A 1OOHA 2JXCA 3FE6A 2R2IA 4DRWA 4GNKB 1SL9A 3VRPA 3NHIA 4YRUA 3IVTA 5D3OA 2M0RA 1B8CA 1GGWA 1XFYO 2KFFA 1DT7B 1BG1A 1NWDA 3LK1A 1B4CA 1QIWA 5HLVA 1BMOA 4FQTA 1JSAA 2LMVA 2BE4A 1DEKA 1KFUS 3CZTX 1YTZC 1MQ1A 2AUCA 3N7HA 1CLBA 2L4HA 3EVUA 2HQWA 2LLUA 1BT6A 4XJKB 2F2PA 3DF0A 3BUXB 4I5LB 1QV1A 1C3YA 3D78A 1UP5A 2CBLA 3NHTA 4DUQA 4CLNA 3TDIA 5KSZA 1DTLA 1SL7A 1LA0A 1TCOB 1G33A 1K2HA 2FOTA 2E6WA 1B8RA 2I2RE 1K9UA 3HCMA 1SK6D 3BXKA 1DJWA 1SY9A 4INWA 1TUJA 1BODA 4JD9A 5D69A 1TN4A 5BPJA 1SW8A 2BCXA 4AQJA 1XA5A 5I2QA 1CFPA 3OGNA 2BE6A 4CFQA 1T14A 1WY9A 4PALA 1S26D 1OOGA 3ZNIA 1TUZA 2M3WA 1KWOB 1S5GZ 2K7OA 1KSMA 2KFGA 1OOJA 1Y0VH 5IBWA 1KFUL 2LHLA 3UNWA 1K95A 4XYNA 4DIRA 1C7WA 2JULA 5AERA 5CSFA 1CDPA 3TDUA 3I5IB 4P2YB 2HPSA 1DJXA 2K2FA 1LXFC 2SASA 2KDHA 1QVIY 1RTP1 2BAPA 2BKHB 4YI9A 1SL8A 3JVTB 3R1VA 1RFJA 3QRXA 4C0LA 1MUXA 5EL2A 1JC2A 1S6CA 1DJGA 2ZNEA 3PFVA 3S0FA 3SS4A 2ZRTA 1DGVA 1J7RA 1NUBA 5CSNA 1CFFA 1KWOC 4IL1A 1KK7Z 1TTXA 2PQLA 1UHJA 3RLZA 4OCIA 2V53A 2I94A 2L0PA 1XK4C 2ZKMX 1AK8A 4PE7A 5GQQC 1KQVA 1NCYA 3JTDC 3L47A 1OZOA 2WCBA 3EKJA 3KPXA 1NSHA 4GBAA 2ISDA 3VB1A 1DELA 2PRUA 5K89A 1J7PA 1OZSA 1JWDA 4GGNA 1Y1XA 2BCAA 2QEHA 1ZUZA 3EVVA 5CPVA 5DICA 5HL1A 4A4CA 4DS7A 1CFDA 3I5IC 2LUXA 1PALA 1KQMC 1Z2CB 2WCMA 3CTNA 2WCJA 2MBXA 1B7TY 1CDNA 3SIAA 1YUUA 1F71A 1CMFA 3I5GC 3JVTC 1NP8A 1CM4A 2LVVA 2Y4QA 2JWWA 1FBVA 1DJYA 2LLTA 3EG5B 1QWVA 4PHNA 2QEOA 3O2PA 4USLA 1QATA 2MJWB 3CDNA 1XFWO 1UWOA 4PE0A 1GM0A 4YGCB 1LA3A 3FWCA 1Y6WA 1IJ5A 1AJ5A 2LP3A 2K61A 3C1VA 3CABA 3JTDB 1F70A 1R6PA 3DF0B 1K8UA 3I5HC 4TNCA 3LL8B 2LMTA 4MEWA 5I8NA 1U5IB 1CLMA 3CGAA 4MLWA 2JU0A 1A2XA 1TIZA 4OV2A 2BBNA 1M63B 2LMUA 3UO9A 1XYDA 4PDZA 1X02A 1ALVA 1IH0A 1KQMB 3VRNA 4U8DA 2M49B 1UUSA 1YVLA 3K1EA 1JF0A 1OSAA 2FCEA 2NXQA 1W7IB 1JFJA 5FI6A 1WLMA 1YR5A 3I5GB 3CR5X 1JF2A 1K9PA 3HX4A 2EC6B 4FQOA 4QJ3B 1QLKA 4WRIA 1LVCD 2F3ZA 5ER5A 3ICBA 5HKZA 3FIAA 4AQIA 2LVIA 2G2BA 3TZ1A 1NX2A 3AAKA 2F2OA 2JT8A 5TNCA 1A75B 1QVIZ 1EXRA 3D10A 1TNXA 2MLFC 3CR4X 1YX8A 3F45A 3FWBA 5AANA 5B8IB 1YX7A 2LCPA 3B86A 3I5HB 1QV0A 3M0WA 4I5NB 3B88A 2JTTA 4BY4A 1A4PA 2MHHA 3WHTB 4PT1A 1UURA 5FI7A 3EKHA 2QPTA 3NSIA 1SMGA 2JOJA 2MA2A 4NQGA 5DKQA 2TN4A 3ZWHA 1FF1A 1AHRA 2D8NA 2CTNA 2LC5A 1XFVO 1BF5A 2BKIB 5J3XA 1DJHA 1UHKA 3EVRA 4ORBB 4MBEA 2L2EA 4A4BA 2O60A 3OB1B 1EG4A 4MSPA 3EK7A 4WQ2A 5F6TA 2KLDA 4YGEB 1Q80A
chains in the Genus database with same CATH topology
2EC6C 1L7ZA 1ZFSA 4MVFA 1HT9A 3OX5A 4HRHA 2F33A 2GGZA 1SCVA 1ZOTB 4N1FA 2KGBC 2M7LA 3KHEA 1BOCA 1KFXL 1PVAA 2NLNA 2WCEA 2Y1MA 3D0YA 1CB1A 1SCMC 3AAJA 4GAOA 2M97A 1B8LA 3VRRA 3EK8A 2FJUB 4M2QA 1D1OA 1IRJA 3I5FB 5JJGA 3KEVA 4ZCUA 3CLNA 3H4SE 4ETOA 1ALWA 1KSOA 2M29A 2L5XB 1TNWA 3VRQA 3BOWA 3A8RA 3IQOA 1J1DA 4HSZA 3VROA 1AJ4A 1M39A 1QTXA 3SG6A 4CFRA 2CXJA 1WRLA 4F0ZB 1FW4A 2VRGA 2PVBA 1ZACA 1MXEA 1KCYA 1DGUA 4JPZB 1K9KA 1BR4B 1TNPA 2HETA 1CDMA 5G08A 2COLB 3BYAA 2CT9A 3IQQA 2ZFDA 1UHHA 2KAYA 2KGRA 3WXAA 3MSEB 1IWQA 1ZMZA 5HLOA 1S6IA 2NCPA 2JNFA 4PDZA 2M1UA 1SBJA 2ZRSA 1SYMA 3DVJA 1YRUB 1YURA 2JRFA 3PM8A 1SCMB 3O6BA 3WNXB 3O4YA 2G9BA 2L98A 3OP0A 2AAOA 1QX5B 1R2UA 3DVKA 3I5FC 4GPLB 3KO0A 1BR1B 3AKBA 5AXIA 3SG7A 4WQ3A 1DVIA 1UHNA 1YUTA 3NSOA 2M1KB 1BJFA 1F4QA 1QJTA 1RJVA 1YRTB 3CS1A 2Y1NA 4N5XA 2LUCA 1H4BA 1S5GY 1M46A 3TUYC 1NX3A 1QS7A 2K8MB 1QX2A 2A4JA 2BECA 1NPQA 2K0JA 5PALA 1SR6C 2KI6D 1N65A 2H2KA 1MF8B 4L9MA 1A03A 2LV7A 4NDCA 1NIWA 2BBMA 2DOQA 5ER4X 2K2AA 3SG4A 1J55A 4YGAA 2HF5A 1B7TZ 2GGMA 4D1EA 2I18A 2WC8A 2LNKA 4MN0A 2MLEC 3DVMA 1OE9B 1J7QA 1A29A 1MR8A 2OS8C 2Q4UA 4MZKA 1NX1A 3RM1A 1QX7A 2KFHA 1XFUO 3SG5A 2I7AA 1S6JA 1SNLA 3O78A 1DMOA 4MRYA 1S3PA 2NCOA 5HYDA 1ODBA 5KU1A 2PALA 4C0JA 3PATA 4CIDA 1MXLC 1Y1UA 1OMDA 3TUYB 1B9AA 4JQ0D 1OMRA 1JBAA 2M7NA 5I2LA 1SR6B 3SJSA 4YBHB 1XK4A 1N2DA 1WLZA 2BL0B 1LKJA 4ICBA 1CKKA 2HQ8A 1C07A 2M9GA 4OVNF 3PSRA 2LAPA 1XFXO 2Y5IA 1EL4A 2M8UA 1QASA 4FTGA 2K7DA 1M45A 2EHBA 2NZ0A 1SPYA 2OS8B 3TS5C 1EG3A 2CCMA 2QACA 1PSRA 3OHMB 1VRKA 1S1EA 1RWYA 4GUKA 5DKRA 1N0YA 1SKTA 1E8AA 1TOPA 2AMIA 1K93D 4XJKA 2JT3A 1L2OB 4GFTA 1NX0A 1EJ3A 1K94A 4QJ5B 4PHJA 2JQ6A 1BU3A 1KK8C 3GOFA 1AVSA 2MAZA 3OB2B 1CLLA 3LLEA 3BUNB 3BUMB 1G8IA 1GQMA 2BL0C 2IS9A 1K90D 1CTRA 2KBMA 1V1GA 2LVKA 2L4IA 2KI4B 3CR2A 1WRZA 1JUOA 1CDLA 2GV5A 1F8HA 4M2OA 4BY5A 1KFXS 2O5GA 2JPTA 3DD4A 1A75A 4Q04A 1TRFA 2P6BB 2OTGC 5AFPA 3TS5B 1J1EA 4OKHA 1M31A 2FCDA 1K96A 1L2OC 2JT0A 2F8PA 4YI8A 4GGFC 2LM5A 1U5IA 4MRXA 2LE9B 4JWQA 4YGDB 1B1GA 1KK8B 1S36A 4E68A 4ZCVA 1PK0D 2H61A 4UPGA 4NDDA 1TCFA 1XVJA 3NXAA 2LLSA 5JOLA 1NCXA 1IQ3A 1W7JB 4PCWA 1RK9A 2KI4C 3GK1A 4MZJA 2KYFA 4NDBA 5D7FA 1OMVA 1AUIB 2B1UA 1G4YR 1C7VA 1MWNA 1F54A 1WRKA 2LANA 4CPVA 1UHIA 2OTGB 1PULA 2LVJA 4I5JA 5CSIA 1PVBA 2WNDA 2KNEA 2JXLA 3PN7B 5FYXA 3TDZA 4MZLA 1FI6A 2F3YA 4DCKA 2JNXA 5I2OA 1IG5A 4HRGA 4M2PA 3BOWB 1WDCB 2JC2A 4YGBB 1CM1A 1NYAA 1QXPA 5KTYA 1RROA 1IGVA 1DF0B 1QIVA 1AP4A 4ORAB 2ZN8A 3GK4X 2KAXA 2E30A 2L50A 1IQ5A 1XFZO 4PE1A 2RGIA 4OR9B 2JTZA 1GJYA 1YVHA 1PRWA 5CSJA 3WHUB 1F55A 2KSPA 3FS7A 3GK2A 4PE4A 3A4UB 2KAVA 2L51A 3E3RA 2MRDA 3LCPC 1XO5A 3SG3A 2Q91A 1CFCA 3PLFB 1QLSA 4QJ4B 1J7OA 1JFKA 1KK7Y 1F4OA 1PSBA 1TNQA 3BUOB 3PN7C 2CNPA 3PALA 3NSLA 4R1EA 2KOTA 2PASA 3D0YB 2LHIA 2ZNDA 1DJZA 3BQ3A 2KBIA 1WDCC 1LINA 2KQYA 3IF7A 5DKNA 3KF9A 3SG2A 3VGOA 3EK4A 3DVEA 2KHNA 4I5KA 1V1FA 1GGZA 3SIBA 4HREE 1MHOA 1DJIA 4N1GA 1FI5A 4C0KA 1HQVA 2JZIA 1BLQA 3AKAA 3OX6A 2K7CA 3CWGA 5AEQA 4AOMA 1CMGA 1RECA 2ZN9A 1H8BA 1YUSA 2BCBA 2EGDA 3K21A 4GGFA 1IJ6A 2KQ6A 4PHKA 2K7BA 1OQPA 1EH2A 1DF0A 1CNPA 2SCPA 2WCFA 2H61C 2WORA 2KYCA 2WOSA 5HKYA 2OPOA 2KI6C 3LK0A 2PMYA 1FPWA 4PHMA 3NSKA 1SRAA 2LP2A 4P5OE 1NCZA 1Y1AA 2PSRA 3BUWB 4ORCB 5HKWA 1IKUA 1B47A 2JXCA 2R2IA 4DRWA 4GNKB 1SL9A 3VRPA 4YRUA 2M0RA 1B8CA 1GGWA 1XFYO 2KFFA 1DT7B 1BG1A 1NWDA 3LK1A 1B4CA 1QIWA 5HLVA 1BMOA 1JSAA 2LMVA 2BE4A 1KFUS 3CZTX 1YTZC 1MQ1A 2AUCA 1CLBA 2L4HA 3EVUA 2HQWA 2LLUA 1BT6A 4XJKB 2F2PA 3DF0A 3BUXB 4I5LB 1QV1A 1UP5A 2CBLA 4DUQA 4CLNA 3TDIA 5KSZA 1DTLA 1SL7A 1LA0A 1TCOB 1G33A 1K2HA 2FOTA 2E6WA 1B8RA 2I2RE 1K9UA 3HCMA 1SK6D 3BXKA 1DJWA 1SY9A 1BODA 5D69A 1TN4A 5BPJA 1SW8A 2BCXA 4AQJA 1XA5A 5I2QA 1CFPA 2BE6A 4CFQA 1WY9A 4PALA 1S26D 3ZNIA 2M3WA 1KWOB 1S5GZ 2K7OA 1KSMA 2KFGA 1OOJA 1Y0VH 5IBWA 1KFUL 2LHLA 1K95A 4XYNA 4DIRA 1C7WA 2JULA 5AERA 5CSFA 1CDPA 3TDUA 3I5IB 4P2YB 2HPSA 1DJXA 2K2FA 1LXFC 2SASA 2KDHA 1QVIY 1RTP1 2BKHB 4YI9A 1SL8A 3JVTB 1RFJA 3QRXA 4C0LA 1MUXA 1JC2A 1S6CA 1DJGA 2ZNEA 3PFVA 2ZRTA 1DGVA 1J7RA 1NUBA 5CSNA 1CFFA 1KWOC 4IL1A 1KK7Z 1TTXA 1UHJA 3RLZA 4OCIA 2V53A 2I94A 2L0PA 1XK4C 2ZKMX 1AK8A 4PE7A 5GQQC 1KQVA 1NCYA 3JTDC 1OZOA 2WCBA 3EKJA 3KPXA 1NSHA 4GBAA 2ISDA 5K89A 2PRUA 1J7PA 1OZSA 1JWDA 4GGNA 1Y1XA 2BCAA 3EVVA 1ZUZA 5CPVA 4A4CA 4DS7A 1CFDA 3I5IC 2LUXA 1PALA 1KQMC 3CTNA 2MBXA 1B7TY 1CDNA 3SIAA 1YUUA 1F71A 1CMFA 3I5GC 3JVTC 1NP8A 1CM4A 2LVVA 2Y4QA 2JWWA 1FBVA 1DJYA 2LLTA 4PHNA 4USLA 3O2PA 1QATA 2MJWB 1XFWO 1UWOA 4PE0A 4YGCB 1LA3A 3FWCA 1Y6WA 1IJ5A 1AJ5A 2LP3A 2K61A 3C1VA 3JTDB 1F70A 1R6PA 3DF0B 1K8UA 3I5HC 4TNCA 3LL8B 2LMTA 4MEWA 5I8NA 1U5IB 1CLMA 3CGAA 4MLWA 2JU0A 1A2XA 1TIZA 4OV2A 2BBNA 1M63B 2LMUA 1XYDA 1X02A 1ALVA 1IH0A 1KQMB 3VRNA 4U8DA 2M49B 1UUSA 1YVLA 1JF0A 1OSAA 2FCEA 2NXQA 1W7IB 1JFJA 1WLMA 1YR5A 3I5GB 3CR5X 1JF2A 1K9PA 3HX4A 2EC6B 4FQOA 4QJ3B 1QLKA 4WRIA 1LVCD 2F3ZA 5ER5A 3ICBA 5HKZA 3FIAA 4AQIA 2LVIA 2G2BA 3TZ1A 1NX2A 3AAKA 2F2OA 2JT8A 5TNCA 1A75B 1QVIZ 1EXRA 3D10A 1TNXA 2MLFC 3CR4X 1YX8A 3F45A 3FWBA 5AANA 5B8IB 1YX7A 2LCPA 3I5HB 1QV0A 3M0WA 4I5NB 2JTTA 4BY4A 1A4PA 2MHHA 3WHTB 1UURA 3EKHA 2QPTA 3NSIA 1SMGA 2JOJA 2MA2A 4NQGA 5DKQA 2TN4A 3ZWHA 1FF1A 1AHRA 2D8NA 2CTNA 2LC5A 1XFVO 1BF5A 2BKIB 5J3XA 1DJHA 1UHKA 3EVRA 4ORBB 4MBEA 2L2EA 4A4BA 2O60A 3OB1B 1EG4A 4MSPA 3EK7A 4WQ2A 5F6TA 4YGEB 1Q80A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EC6 C;  1L7Z A;  1ZFS A;  4MVF A;  1HT9 A;  3OX5 A;  4HRH A;  2F33 A;  2GGZ A;  1SCV A;  1ZOT B;  4N1F A;  2KGB C;  2M7L A;  3KHE A;  1BOC A;  1KFX L;  1PVA A;  2NLN A;  2WCE A;  2Y1M A;  3D0Y A;  1CB1 A;  1SCM C;  3AAJ A;  4GAO A;  2M97 A;  1B8L A;  3VRR A;  3EK8 A;  2FJU B;  4M2Q A;  1D1O A;  1IRJ A;  3I5F B;  5JJG A;  3KEV A;  4ZCU A;  3CLN A;  3H4S E;  4ETO A;  1ALW A;  1KSO A;  2M29 A;  2L5X B;  1TNW A;  3VRQ A;  3BOW A;  3A8R A;  3IQO A;  1J1D A;  4HSZ A;  3VRO A;  1AJ4 A;  1M39 A;  1QTX A;  3SG6 A;  4CFR A;  2CXJ A;  1WRL A;  4F0Z B;  1FW4 A;  2VRG A;  2PVB A;  1ZAC A;  1MXE A;  1KCY A;  1DGU A;  4JPZ B;  1K9K A;  1BR4 B;  1TNP A;  2HET A;  1CDM A;  5G08 A;  2COL B;  3BYA A;  2CT9 A;  3IQQ A;  2ZFD A;  1UHH A;  2KAY A;  2KGR A;  3WXA A;  3MSE B;  1IWQ A;  1ZMZ A;  5HLO A;  1S6I A;  2NCP A;  2JNF A;  4PDZ A;  2M1U A;  1SBJ A;  2ZRS A;  1SYM A;  3DVJ A;  1YRU B;  1YUR A;  2JRF A;  3PM8 A;  1SCM B;  3O6B A;  3WNX B;  3O4Y A;  2G9B A;  2L98 A;  3OP0 A;  2AAO A;  1QX5 B;  1R2U A;  3DVK A;  3I5F C;  4GPL B;  3KO0 A;  1BR1 B;  3AKB A;  5AXI A;  3SG7 A;  4WQ3 A;  1DVI A;  1UHN A;  1YUT A;  3NSO A;  2M1K B;  1BJF A;  1F4Q A;  1QJT A;  1RJV A;  1YRT B;  3CS1 A;  2Y1N A;  4N5X A;  2LUC A;  1H4B A;  1S5G Y;  1M46 A;  3TUY C;  1NX3 A;  1QS7 A;  2K8M B;  1QX2 A;  2A4J A;  2BEC A;  1NPQ A;  2K0J A;  5PAL A;  1SR6 C;  2KI6 D;  1N65 A;  2H2K A;  1MF8 B;  4L9M A;  1A03 A;  2LV7 A;  4NDC A;  1NIW A;  2BBM A;  2DOQ A;  5ER4 X;  2K2A A;  3SG4 A;  1J55 A;  4YGA A;  2HF5 A;  1B7T Z;  2GGM A;  4D1E A;  2I18 A;  2WC8 A;  2LNK A;  4MN0 A;  2MLE C;  3DVM A;  1OE9 B;  1J7Q A;  1A29 A;  1MR8 A;  2OS8 C;  2Q4U A;  4MZK A;  1NX1 A;  3RM1 A;  1QX7 A;  2KFH A;  1XFU O;  3SG5 A;  2I7A A;  1S6J A;  1SNL A;  3O78 A;  1DMO A;  4MRY A;  1S3P A;  2NCO A;  5HYD A;  1ODB A;  5KU1 A;  2PAL A;  4C0J A;  3PAT A;  4CID A;  1MXL C;  1Y1U A;  1OMD A;  3TUY B;  1B9A A;  4JQ0 D;  1OMR A;  1JBA A;  2M7N A;  5I2L A;  1SR6 B;  3SJS A;  4YBH B;  1XK4 A;  1N2D A;  1WLZ A;  2BL0 B;  1LKJ A;  4ICB A;  1CKK A;  2HQ8 A;  1C07 A;  2M9G A;  4OVN F;  3PSR A;  2LAP A;  1XFX O;  2Y5I A;  1EL4 A;  2M8U A;  1QAS A;  4FTG A;  2K7D A;  1M45 A;  2EHB A;  2NZ0 A;  1SPY A;  2OS8 B;  3TS5 C;  1EG3 A;  2CCM A;  2QAC A;  1PSR A;  3OHM B;  1VRK A;  1S1E A;  1RWY A;  4GUK A;  5DKR A;  1N0Y A;  1SKT A;  1E8A A;  1TOP A;  2AMI A;  1K93 D;  4XJK A;  2JT3 A;  1L2O B;  4GFT A;  1NX0 A;  1EJ3 A;  1K94 A;  4QJ5 B;  4PHJ A;  2JQ6 A;  1BU3 A;  1KK8 C;  3GOF A;  1AVS A;  2MAZ A;  3OB2 B;  1CLL A;  3LLE A;  3BUN B;  3BUM B;  1G8I A;  1GQM A;  2BL0 C;  2IS9 A;  1K90 D;  1CTR A;  2KBM A;  1V1G A;  2LVK A;  2L4I A;  2KI4 B;  3CR2 A;  1WRZ A;  1JUO A;  1CDL A;  2GV5 A;  1F8H A;  4M2O A;  4BY5 A;  1KFX S;  2O5G A;  2JPT A;  3DD4 A;  1A75 A;  4Q04 A;  1TRF A;  2P6B B;  2OTG C;  5AFP A;  3TS5 B;  1J1E A;  4OKH A;  1M31 A;  2FCD A;  1K96 A;  1L2O C;  2JT0 A;  2F8P A;  4YI8 A;  4GGF C;  2LM5 A;  1U5I A;  4MRX A;  2LE9 B;  4JWQ A;  4YGD B;  1B1G A;  1KK8 B;  1S36 A;  4E68 A;  4ZCV A;  1PK0 D;  2H61 A;  4UPG A;  4NDD A;  1TCF A;  1XVJ A;  3NXA A;  2LLS A;  5JOL A;  1NCX A;  1IQ3 A;  1W7J B;  4PCW A;  1RK9 A;  2KI4 C;  3GK1 A;  4MZJ A;  2KYF A;  4NDB A;  5D7F A;  1OMV A;  1AUI B;  2B1U A;  1G4Y R;  1C7V A;  1MWN A;  1F54 A;  1WRK A;  2LAN A;  4CPV A;  1UHI A;  2OTG B;  1PUL A;  2LVJ A;  4I5J A;  5CSI A;  1PVB A;  2WND A;  2KNE A;  2JXL A;  3PN7 B;  5FYX A;  3TDZ A;  4MZL A;  1FI6 A;  2F3Y A;  4DCK A;  2JNX A;  5I2O A;  1IG5 A;  4HRG A;  4M2P A;  3BOW B;  1WDC B;  2JC2 A;  4YGB B;  1CM1 A;  1NYA A;  1QXP A;  5KTY A;  1RRO A;  1IGV A;  1DF0 B;  1QIV A;  1AP4 A;  4ORA B;  2ZN8 A;  3GK4 X;  2KAX A;  2E30 A;  2L50 A;  1IQ5 A;  1XFZ O;  4PE1 A;  2RGI A;  4OR9 B;  2JTZ A;  1GJY A;  1YVH A;  1PRW A;  5CSJ A;  3WHU B;  1F55 A;  2KSP A;  3FS7 A;  3GK2 A;  4PE4 A;  3A4U B;  2KAV A;  2L51 A;  3E3R A;  2MRD A;  3LCP C;  1XO5 A;  3SG3 A;  2Q91 A;  1CFC A;  3PLF B;  1QLS A;  4QJ4 B;  1J7O A;  1JFK A;  1KK7 Y;  1F4O A;  1PSB A;  1TNQ A;  3BUO B;  3PN7 C;  2CNP A;  3PAL A;  3NSL A;  4R1E A;  2KOT A;  2PAS A;  3D0Y B;  2LHI A;  2ZND A;  1DJZ A;  3BQ3 A;  2KBI A;  1WDC C;  1LIN A;  2KQY A;  3IF7 A;  5DKN A;  3KF9 A;  3SG2 A;  3VGO A;  3EK4 A;  3DVE A;  2KHN A;  4I5K A;  1V1F A;  1GGZ A;  3SIB A;  4HRE E;  1MHO A;  1DJI A;  4N1G A;  1FI5 A;  4C0K A;  1HQV A;  2JZI A;  1BLQ A;  3AKA A;  3OX6 A;  2K7C A;  3CWG A;  5AEQ A;  4AOM A;  1CMG A;  1REC A;  2ZN9 A;  1H8B A;  1YUS A;  2BCB A;  2EGD A;  3K21 A;  4GGF A;  1IJ6 A;  2KQ6 A;  4PHK A;  2K7B A;  1OQP A;  1EH2 A;  1DF0 A;  1CNP A;  2SCP A;  2WCF A;  2H61 C;  2WOR A;  2KYC A;  2WOS A;  5HKY A;  2OPO A;  2KI6 C;  3LK0 A;  2PMY A;  1FPW A;  4PHM A;  3NSK A;  1SRA A;  2LP2 A;  4P5O E;  1NCZ A;  1Y1A A;  2PSR A;  3BUW B;  4ORC B;  5HKW A;  1IKU A;  1B47 A;  2JXC A;  2R2I A;  4DRW A;  4GNK B;  1SL9 A;  3VRP A;  4YRU A;  2M0R A;  1B8C A;  1GGW A;  1XFY O;  2KFF A;  1DT7 B;  1BG1 A;  1NWD A;  3LK1 A;  1B4C A;  1QIW A;  5HLV A;  1BMO A;  1JSA A;  2LMV A;  2BE4 A;  1KFU S;  3CZT X;  1YTZ C;  1MQ1 A;  2AUC A;  1CLB A;  2L4H A;  3EVU A;  2HQW A;  2LLU A;  1BT6 A;  4XJK B;  2F2P A;  3DF0 A;  3BUX B;  4I5L B;  1QV1 A;  1UP5 A;  2CBL A;  4DUQ A;  4CLN A;  3TDI A;  5KSZ A;  1DTL A;  1SL7 A;  1LA0 A;  1TCO B;  1G33 A;  1K2H A;  2FOT A;  2E6W A;  1B8R A;  2I2R E;  1K9U A;  3HCM A;  1SK6 D;  3BXK A;  1DJW A;  1SY9 A;  1BOD A;  5D69 A;  1TN4 A;  5BPJ A;  1SW8 A;  2BCX A;  4AQJ A;  1XA5 A;  5I2Q A;  1CFP A;  2BE6 A;  4CFQ A;  1WY9 A;  4PAL A;  1S26 D;  3ZNI A;  2M3W A;  1KWO B;  1S5G Z;  2K7O A;  1KSM A;  2KFG A;  1OOJ A;  1Y0V H;  5IBW A;  1KFU L;  2LHL A;  1K95 A;  4XYN A;  4DIR A;  1C7W A;  2JUL A;  5AER A;  5CSF A;  1CDP A;  3TDU A;  3I5I B;  4P2Y B;  2HPS A;  1DJX A;  2K2F A;  1LXF C;  2SAS A;  2KDH A;  1QVI Y;  1RTP 1;  2BKH B;  4YI9 A;  1SL8 A;  3JVT B;  1RFJ A;  3QRX A;  4C0L A;  1MUX A;  1JC2 A;  1S6C A;  1DJG A;  2ZNE A;  3PFV A;  2ZRT A;  1DGV A;  1J7R A;  1NUB A;  5CSN A;  1CFF A;  1KWO C;  4IL1 A;  1KK7 Z;  1TTX A;  1UHJ A;  3RLZ A;  4OCI A;  2V53 A;  2I94 A;  2L0P A;  1XK4 C;  2ZKM X;  1AK8 A;  4PE7 A;  5GQQ C;  1KQV A;  1NCY A;  3JTD C;  1OZO A;  2WCB A;  3EKJ A;  3KPX A;  1NSH A;  4GBA A;  2ISD A;  5K89 A;  2PRU A;  1J7P A;  1OZS A;  1JWD A;  4GGN A;  1Y1X A;  2BCA A;  3EVV A;  1ZUZ A;  5CPV A;  4A4C A;  4DS7 A;  1CFD A;  3I5I C;  2LUX A;  1PAL A;  1KQM C;  3CTN A;  2MBX A;  1B7T Y;  1CDN A;  3SIA A;  1YUU A;  1F71 A;  1CMF A;  3I5G C;  3JVT C;  1NP8 A;  1CM4 A;  2LVV A;  2Y4Q A;  2JWW A;  1FBV A;  1DJY A;  2LLT A;  4PHN A;  4USL A;  3O2P A;  1QAT A;  2MJW B;  1XFW O;  1UWO A;  4PE0 A;  4YGC B;  1LA3 A;  3FWC A;  1Y6W A;  1IJ5 A;  1AJ5 A;  2LP3 A;  2K61 A;  3C1V A;  3JTD B;  1F70 A;  1R6P A;  3DF0 B;  1K8U A;  3I5H C;  4TNC A;  3LL8 B;  2LMT A;  4MEW A;  5I8N A;  1U5I B;  1CLM A;  3CGA A;  4MLW A;  2JU0 A;  1A2X A;  1TIZ A;  4OV2 A;  2BBN A;  1M63 B;  2LMU A;  1XYD A;  1X02 A;  1ALV A;  1IH0 A;  1KQM B;  3VRN A;  4U8D A;  2M49 B;  1UUS A;  1YVL A;  1JF0 A;  1OSA A;  2FCE A;  2NXQ A;  1W7I B;  1JFJ A;  1WLM A;  1YR5 A;  3I5G B;  3CR5 X;  1JF2 A;  1K9P A;  3HX4 A;  2EC6 B;  4FQO A;  4QJ3 B;  1QLK A;  4WRI A;  1LVC D;  2F3Z A;  5ER5 A;  3ICB A;  5HKZ A;  3FIA A;  4AQI A;  2LVI A;  2G2B A;  3TZ1 A;  1NX2 A;  3AAK A;  2F2O A;  2JT8 A;  5TNC A;  1A75 B;  1QVI Z;  1EXR A;  3D10 A;  1TNX A;  2MLF C;  3CR4 X;  1YX8 A;  3F45 A;  3FWB A;  5AAN A;  5B8I B;  1YX7 A;  2LCP A;  3I5H B;  1QV0 A;  3M0W A;  4I5N B;  2JTT A;  4BY4 A;  1A4P A;  2MHH A;  3WHT B;  1UUR A;  3EKH A;  2QPT A;  3NSI A;  1SMG A;  2JOJ A;  2MA2 A;  4NQG A;  5DKQ A;  2TN4 A;  3ZWH A;  1FF1 A;  1AHR A;  2D8N A;  2CTN A;  2LC5 A;  1XFV O;  1BF5 A;  2BKI B;  5J3X A;  1DJH A;  1UHK A;  3EVR A;  4ORB B;  4MBE A;  2L2E A;  4A4B A;  2O60 A;  3OB1 B;  1EG4 A;  4MSP A;  3EK7 A;  4WQ2 A;  5F6T A;  4YGE B;  1Q80 A; 
#chains in the Genus database with same CATH topology
 2EC6 C;  1L7Z A;  1ZFS A;  3BFH A;  4MVF A;  1HT9 A;  3OX5 A;  4HRH A;  2F33 A;  2GGZ A;  1SCV A;  1ZOT B;  2K60 A;  4N1F A;  2KGB C;  4IJ7 A;  2M7L A;  5FI2 A;  3B6X A;  3CZ1 A;  3KHE A;  1BOC A;  1KFX L;  1PVA A;  2NLN A;  2WCE A;  2Y1M A;  3D0Y A;  1CB1 A;  1SCM C;  3AAJ A;  3CYZ A;  2L2C A;  2M97 A;  4GAO A;  1B8L A;  2P71 A;  3VRR A;  3EK8 A;  2FJU B;  4M2Q A;  1D1O A;  1IRJ A;  3I5F B;  5JJG A;  3KEV A;  4ZCU A;  3CLN A;  3H4S E;  3D73 A;  1ALW A;  1KSO A;  2M29 A;  2L5X B;  4ETO A;  1TNW A;  3VRQ A;  3SS3 A;  3BOW A;  3A8R A;  3IQO A;  1J1D A;  4HSZ A;  3VRO A;  2QDI A;  1AJ4 A;  1M39 A;  1QTX A;  3SG6 A;  4CFR A;  2CXJ A;  1WRL A;  4F0Z B;  1FW4 A;  2VRG A;  2PVB A;  1ZAC A;  2P70 A;  2QEV A;  1TWO A;  1MXE A;  1KCY A;  1DGU A;  4JPZ B;  1K9K A;  1BR4 B;  1TNP A;  2HET A;  1CDM A;  5G08 A;  2COL B;  3BYA A;  2CT9 A;  3IQQ A;  2ZFD A;  1UHH A;  2KAY A;  2KGR A;  3WXA A;  3MSE B;  1IWQ A;  1ZMZ A;  2PYQ A;  5HLO A;  1OW4 A;  1S6I A;  2JNF A;  2NCP A;  1P28 A;  1SBJ A;  2M1U A;  1SYM A;  2ZRS A;  3DVJ A;  1YRU B;  1YUR A;  2JRF A;  3PM8 A;  1SCM B;  3O6B A;  3WNX B;  3O4Y A;  2G9B A;  2L98 A;  3OP0 A;  2AAO A;  1QX5 B;  1R2U A;  3DVK A;  3I5F C;  4GPL B;  3KO0 A;  1BR1 B;  3AKB A;  5AXI A;  3SG7 A;  4WQ3 A;  1DVI A;  1UHN A;  1YUT A;  2WCH A;  2BNX A;  3S0B A;  3NSO A;  2M1K B;  1BJF A;  1F4Q A;  1QJT A;  1RJV A;  1YRT B;  3CS1 A;  2Y1N A;  4N5X A;  2LUC A;  3CZ0 A;  1H4B A;  1S5G Y;  1M46 A;  3L4A A;  3TUY C;  1NX3 A;  1QS7 A;  2K8M B;  1QX2 A;  2A4J A;  2BEC A;  1NPQ A;  2K0J A;  2KLE A;  3B7A A;  1SR6 C;  2KI6 D;  1N65 A;  2H2K A;  3D76 A;  1MF8 B;  1OOF A;  4L9M A;  1A03 A;  2LV7 A;  4NDC A;  1NIW A;  2BBM A;  2DOQ A;  3S0E A;  5ER4 X;  2K2A A;  3DZT A;  3SG4 A;  1J55 A;  4YGA A;  1DC1 A;  2HF5 A;  1B7T Z;  2GGM A;  5PAL A;  4D1E A;  2I18 A;  2WC8 A;  2LNK A;  2YGU A;  4MN0 A;  2MLE C;  3DVM A;  1OE9 B;  1J7Q A;  2FJY A;  1A29 A;  3BFA A;  1MR8 A;  2OS8 C;  3D77 A;  2Q4U A;  4MZK A;  2JPO A;  1NX1 A;  3RM1 A;  1QX7 A;  2KFH A;  4F7F A;  1XFU O;  3SG5 A;  2I7A A;  1S6J A;  1SNL A;  3NGV A;  3O78 A;  1DMO A;  4MRY A;  1S3P A;  2NCO A;  5HYD A;  1ODB A;  5KU1 A;  2GTE A;  2PAL A;  4C0J A;  3PAT A;  1C3Z A;  2H8V A;  1MXL C;  2WC5 A;  4OZD A;  1Y1U A;  4CID A;  1OMD A;  3TUY B;  1B9A A;  4JQ0 D;  1OMR A;  1W9Z A;  2M7N A;  3Q8I A;  5I2L A;  1JBA A;  1SR6 B;  1XFR A;  3SJS A;  4YBH B;  1XK4 A;  1N2D A;  1WLZ A;  2BL0 B;  1LKJ A;  3DYE A;  4ICB A;  1CKK A;  2HQ8 A;  1C07 A;  2M9G A;  4OVN F;  3PSR A;  3V2L A;  2LAP A;  1XFX O;  2Y5I A;  1EL4 A;  2M8U A;  1QAS A;  4FTG A;  4JKT A;  2K7D A;  1M45 A;  2EHB A;  2NZ0 A;  1SPY A;  2OS8 B;  3TS5 C;  1EG3 A;  2CCM A;  2QAC A;  1PSR A;  3OHM B;  1VRK A;  1S1E A;  1RWY A;  4GUK A;  5DKR A;  1N0Y A;  1SKT A;  1E8A A;  1TOP A;  2AMI A;  4KYN A;  1K93 D;  4XJK A;  2JT3 A;  1L2O B;  4GFT A;  1NX0 A;  1EJ3 A;  1K94 A;  3R72 A;  4PHJ A;  4QJ5 B;  2JQ6 A;  1BU3 A;  1KK8 C;  3GOF A;  1AVS A;  2MAZ A;  3OB2 B;  1CLL A;  3BFB A;  3LLE A;  3R1O A;  3BUN B;  3BUM B;  1G8I A;  1GQM A;  2BL0 C;  3SS5 A;  2IS9 A;  1K90 D;  1CTR A;  2KBM A;  1V1G A;  2LVK A;  2L4I A;  2KI4 B;  3CR2 A;  1WRZ A;  4INX A;  3S0A A;  1JUO A;  1CDL A;  2GV5 A;  1F8H A;  4M2O A;  4BY5 A;  1KFX S;  3PJI A;  2O5G A;  2JPT A;  3DD4 A;  1A75 A;  4Q04 A;  3R1P A;  1TRF A;  2P6B B;  2OTG C;  5AFP A;  1IIO A;  3TS5 B;  1OOI X;  1J1E A;  2QEB A;  4OKH A;  1M31 A;  2FCD A;  1K96 A;  1LS8 A;  3BJH A;  1L2O C;  2JT0 A;  2F8P A;  4YI8 A;  4GGF C;  2LM5 A;  1U5I A;  4MRX A;  2LE9 B;  4JWQ A;  4YGD B;  1B1G A;  1KK8 B;  1S36 A;  4E68 A;  3PM2 A;  1PK0 D;  2H61 A;  4ZCV A;  4UPG A;  4NDD A;  1TCF A;  1XVJ A;  3NXA A;  2LLS A;  5JOL A;  1NCX A;  1IQ3 A;  1W7J B;  3L4L A;  4PCW A;  1RK9 A;  3QME A;  2KI4 C;  3GK1 A;  4MZJ A;  2KYF A;  4NDB A;  5D7F A;  1OMV A;  2B1U A;  1AUI B;  1G4Y R;  1C7V A;  1MWN A;  1F54 A;  1WRK A;  2LAN A;  4CPV A;  1UHI A;  2OTG B;  1PUL A;  2LVJ A;  4I5J A;  5CSI A;  1PVB A;  2WND A;  2KNE A;  2JXL A;  2WC6 A;  3PN7 B;  3FE8 A;  5FYX A;  4MZL A;  3TDZ A;  1FI6 A;  2F3Y A;  4DCK A;  2JNX A;  5I2O A;  1IG5 A;  4HRG A;  4M2P A;  3BOW B;  1WDC B;  2JC2 A;  4YGB B;  1CM1 A;  1NYA A;  2WCK A;  1QXP A;  5KTY A;  1RRO A;  1SSE B;  1IGV A;  2ERB A;  1DF0 B;  1QIV A;  2KPH A;  1AP4 A;  4ORA B;  2ZN8 A;  3GK4 X;  2KAX A;  2E30 A;  2L50 A;  1IQ5 A;  1XFZ O;  4PE1 A;  2RGI A;  4OR9 B;  2JTZ A;  1GJY A;  1YVH A;  1PRW A;  5CSJ A;  3WHU B;  3DXL A;  1F55 A;  2KSP A;  3FS7 A;  3OBV A;  3GK2 A;  1DQE A;  4PE4 A;  3A4U B;  2KAV A;  2L51 A;  3E3R A;  2MRD A;  3LCP C;  1XO5 A;  3SG3 A;  2Q91 A;  1CFC A;  3PLF B;  1QLS A;  4QJ4 B;  1J7O A;  1JFK A;  1KK7 Y;  3S0G A;  1F4O A;  1PSB A;  1TNQ A;  3BUO B;  5I94 A;  2WCL A;  3PN7 C;  2CNP A;  3B87 A;  3NSL A;  3PAL A;  4R1E A;  2KOT A;  2PAS A;  3D0Y B;  3O4X A;  2L5Y A;  2LHI A;  2ZND A;  1DJZ A;  3BQ3 A;  3D75 A;  2KBI A;  1Z4H A;  1WDC C;  1LIN A;  2KQY A;  3IF7 A;  5DKN A;  3KF9 A;  3SG2 A;  3VGO A;  3EK4 A;  3DVE A;  2KHN A;  4I5K A;  3S0D A;  1V1F A;  1GGZ A;  3DY9 A;  3SIB A;  4HRE E;  1MHO A;  3D74 A;  1DJI A;  4N1G A;  1FI5 A;  4C0K A;  1HQV A;  2JZI A;  1BLQ A;  3AKA A;  3OX6 A;  2K7C A;  3CWG A;  5AEQ A;  4AOM A;  1CMG A;  1REC A;  2ZN9 A;  1H8B A;  1YUS A;  2BCB A;  2EGD A;  3K21 A;  4GGF A;  1IJ6 A;  2KQ6 A;  4PHK A;  2K7B A;  1OQP A;  1EH2 A;  1DF0 A;  1CNP A;  2SCP A;  2WCF A;  2H61 C;  2WOR A;  2KYC A;  2WOS A;  5HKY A;  2OPO A;  2KI6 C;  3LK0 A;  2PMY A;  1FPW A;  4PHM A;  3NSK A;  1SRA A;  2LP2 A;  4P5O E;  1NCZ A;  3FE9 A;  1Y1A A;  2PSR A;  1ORG A;  3BUW B;  4ORC B;  3RZS A;  5HKW A;  3CZ2 A;  1IKU A;  1B47 A;  1OOH A;  2JXC A;  3FE6 A;  2R2I A;  4DRW A;  4GNK B;  1SL9 A;  3VRP A;  3NHI A;  4YRU A;  3IVT A;  5D3O A;  2M0R A;  1B8C A;  1GGW A;  1XFY O;  2KFF A;  1DT7 B;  1BG1 A;  1NWD A;  3LK1 A;  1B4C A;  1QIW A;  5HLV A;  1BMO A;  4FQT A;  1JSA A;  2LMV A;  2BE4 A;  1DEK A;  1KFU S;  3CZT X;  1YTZ C;  1MQ1 A;  2AUC A;  3N7H A;  1CLB A;  2L4H A;  3EVU A;  2HQW A;  2LLU A;  1BT6 A;  4XJK B;  2F2P A;  3DF0 A;  3BUX B;  4I5L B;  1QV1 A;  1C3Y A;  3D78 A;  1UP5 A;  2CBL A;  3NHT A;  4DUQ A;  4CLN A;  3TDI A;  5KSZ A;  1DTL A;  1SL7 A;  1LA0 A;  1TCO B;  1G33 A;  1K2H A;  2FOT A;  2E6W A;  1B8R A;  2I2R E;  1K9U A;  3HCM A;  1SK6 D;  3BXK A;  1DJW A;  1SY9 A;  4INW A;  1TUJ A;  1BOD A;  4JD9 A;  5D69 A;  1TN4 A;  5BPJ A;  1SW8 A;  2BCX A;  4AQJ A;  1XA5 A;  5I2Q A;  1CFP A;  3OGN A;  2BE6 A;  4CFQ A;  1T14 A;  1WY9 A;  4PAL A;  1S26 D;  1OOG A;  3ZNI A;  1TUZ A;  2M3W A;  1KWO B;  1S5G Z;  2K7O A;  1KSM A;  2KFG A;  1OOJ A;  1Y0V H;  5IBW A;  1KFU L;  2LHL A;  3UNW A;  1K95 A;  4XYN A;  4DIR A;  1C7W A;  2JUL A;  5AER A;  5CSF A;  1CDP A;  3TDU A;  3I5I B;  4P2Y B;  2HPS A;  1DJX A;  2K2F A;  1LXF C;  2SAS A;  2KDH A;  1QVI Y;  1RTP 1;  2BAP A;  2BKH B;  4YI9 A;  1SL8 A;  3JVT B;  3R1V A;  1RFJ A;  3QRX A;  4C0L A;  1MUX A;  5EL2 A;  1JC2 A;  1S6C A;  1DJG A;  2ZNE A;  3PFV A;  3S0F A;  3SS4 A;  2ZRT A;  1DGV A;  1J7R A;  1NUB A;  5CSN A;  1CFF A;  1KWO C;  4IL1 A;  1KK7 Z;  1TTX A;  2PQL A;  1UHJ A;  3RLZ A;  4OCI A;  2V53 A;  2I94 A;  2L0P A;  1XK4 C;  2ZKM X;  1AK8 A;  4PE7 A;  5GQQ C;  1KQV A;  1NCY A;  3JTD C;  3L47 A;  1OZO A;  2WCB A;  3EKJ A;  3KPX A;  1NSH A;  4GBA A;  2ISD A;  3VB1 A;  1DEL A;  2PRU A;  5K89 A;  1J7P A;  1OZS A;  1JWD A;  4GGN A;  1Y1X A;  2BCA A;  2QEH A;  1ZUZ A;  3EVV A;  5CPV A;  5DIC A;  5HL1 A;  4A4C A;  4DS7 A;  1CFD A;  3I5I C;  2LUX A;  1PAL A;  1KQM C;  1Z2C B;  2WCM A;  3CTN A;  2WCJ A;  2MBX A;  1B7T Y;  1CDN A;  3SIA A;  1YUU A;  1F71 A;  1CMF A;  3I5G C;  3JVT C;  1NP8 A;  1CM4 A;  2LVV A;  2Y4Q A;  2JWW A;  1FBV A;  1DJY A;  2LLT A;  3EG5 B;  1QWV A;  4PHN A;  2QEO A;  3O2P A;  4USL A;  1QAT A;  2MJW B;  3CDN A;  1XFW O;  1UWO A;  4PE0 A;  1GM0 A;  4YGC B;  1LA3 A;  3FWC A;  1Y6W A;  1IJ5 A;  1AJ5 A;  2LP3 A;  2K61 A;  3C1V A;  3CAB A;  3JTD B;  1F70 A;  1R6P A;  3DF0 B;  1K8U A;  3I5H C;  4TNC A;  3LL8 B;  2LMT A;  4MEW A;  5I8N A;  1U5I B;  1CLM A;  3CGA A;  4MLW A;  2JU0 A;  1A2X A;  1TIZ A;  4OV2 A;  2BBN A;  1M63 B;  2LMU A;  3UO9 A;  1XYD A;  4PDZ A;  1X02 A;  1ALV A;  1IH0 A;  1KQM B;  3VRN A;  4U8D A;  2M49 B;  1UUS A;  1YVL A;  3K1E A;  1JF0 A;  1OSA A;  2FCE A;  2NXQ A;  1W7I B;  1JFJ A;  5FI6 A;  1WLM A;  1YR5 A;  3I5G B;  3CR5 X;  1JF2 A;  1K9P A;  3HX4 A;  2EC6 B;  4FQO A;  4QJ3 B;  1QLK A;  4WRI A;  1LVC D;  2F3Z A;  5ER5 A;  3ICB A;  5HKZ A;  3FIA A;  4AQI A;  2LVI A;  2G2B A;  3TZ1 A;  1NX2 A;  3AAK A;  2F2O A;  2JT8 A;  5TNC A;  1A75 B;  1QVI Z;  1EXR A;  3D10 A;  1TNX A;  2MLF C;  3CR4 X;  1YX8 A;  3F45 A;  3FWB A;  5AAN A;  5B8I B;  1YX7 A;  2LCP A;  3B86 A;  3I5H B;  1QV0 A;  3M0W A;  4I5N B;  3B88 A;  2JTT A;  4BY4 A;  1A4P A;  2MHH A;  3WHT B;  4PT1 A;  1UUR A;  5FI7 A;  3EKH A;  2QPT A;  3NSI A;  1SMG A;  2JOJ A;  2MA2 A;  4NQG A;  5DKQ A;  2TN4 A;  3ZWH A;  1FF1 A;  1AHR A;  2D8N A;  2CTN A;  2LC5 A;  1XFV O;  1BF5 A;  2BKI B;  5J3X A;  1DJH A;  1UHK A;  3EVR A;  4ORB B;  4MBE A;  2L2E A;  4A4B A;  2O60 A;  3OB1 B;  1EG4 A;  4MSP A;  3EK7 A;  4WQ2 A;  5F6T A;  2KLD A;  4YGE B;  1Q80 A; 
#chains in the Genus database with same CATH homology
 2EC6 C;  1L7Z A;  1ZFS A;  4MVF A;  1HT9 A;  3OX5 A;  4HRH A;  2F33 A;  2GGZ A;  1SCV A;  1ZOT B;  4N1F A;  2KGB C;  2M7L A;  3KHE A;  1BOC A;  1KFX L;  1PVA A;  2NLN A;  2WCE A;  2Y1M A;  3D0Y A;  1CB1 A;  1SCM C;  3AAJ A;  4GAO A;  2M97 A;  1B8L A;  3VRR A;  3EK8 A;  2FJU B;  4M2Q A;  1D1O A;  1IRJ A;  3I5F B;  5JJG A;  3KEV A;  4ZCU A;  3CLN A;  3H4S E;  4ETO A;  1ALW A;  1KSO A;  2M29 A;  2L5X B;  1TNW A;  3VRQ A;  3BOW A;  3A8R A;  3IQO A;  1J1D A;  4HSZ A;  3VRO A;  1AJ4 A;  1M39 A;  1QTX A;  3SG6 A;  4CFR A;  2CXJ A;  1WRL A;  4F0Z B;  1FW4 A;  2VRG A;  2PVB A;  1ZAC A;  1MXE A;  1KCY A;  1DGU A;  4JPZ B;  1K9K A;  1BR4 B;  1TNP A;  2HET A;  1CDM A;  5G08 A;  2COL B;  3BYA A;  2CT9 A;  3IQQ A;  2ZFD A;  1UHH A;  2KAY A;  2KGR A;  3WXA A;  3MSE B;  1IWQ A;  1ZMZ A;  5HLO A;  1S6I A;  2NCP A;  2JNF A;  4PDZ A;  2M1U A;  1SBJ A;  2ZRS A;  1SYM A;  3DVJ A;  1YRU B;  1YUR A;  2JRF A;  3PM8 A;  1SCM B;  3O6B A;  3WNX B;  3O4Y A;  2G9B A;  2L98 A;  3OP0 A;  2AAO A;  1QX5 B;  1R2U A;  3DVK A;  3I5F C;  4GPL B;  3KO0 A;  1BR1 B;  3AKB A;  5AXI A;  3SG7 A;  4WQ3 A;  1DVI A;  1UHN A;  1YUT A;  3NSO A;  2M1K B;  1BJF A;  1F4Q A;  1QJT A;  1RJV A;  1YRT B;  3CS1 A;  2Y1N A;  4N5X A;  2LUC A;  1H4B A;  1S5G Y;  1M46 A;  3TUY C;  1NX3 A;  1QS7 A;  2K8M B;  1QX2 A;  2A4J A;  2BEC A;  1NPQ A;  2K0J A;  5PAL A;  1SR6 C;  2KI6 D;  1N65 A;  2H2K A;  1MF8 B;  4L9M A;  1A03 A;  2LV7 A;  4NDC A;  1NIW A;  2BBM A;  2DOQ A;  5ER4 X;  2K2A A;  3SG4 A;  1J55 A;  4YGA A;  2HF5 A;  1B7T Z;  2GGM A;  4D1E A;  2I18 A;  2WC8 A;  2LNK A;  4MN0 A;  2MLE C;  3DVM A;  1OE9 B;  1J7Q A;  1A29 A;  1MR8 A;  2OS8 C;  2Q4U A;  4MZK A;  1NX1 A;  3RM1 A;  1QX7 A;  2KFH A;  1XFU O;  3SG5 A;  2I7A A;  1S6J A;  1SNL A;  3O78 A;  1DMO A;  4MRY A;  1S3P A;  2NCO A;  5HYD A;  1ODB A;  5KU1 A;  2PAL A;  4C0J A;  3PAT A;  4CID A;  1MXL C;  1Y1U A;  1OMD A;  3TUY B;  1B9A A;  4JQ0 D;  1OMR A;  1JBA A;  2M7N A;  5I2L A;  1SR6 B;  3SJS A;  4YBH B;  1XK4 A;  1N2D A;  1WLZ A;  2BL0 B;  1LKJ A;  4ICB A;  1CKK A;  2HQ8 A;  1C07 A;  2M9G A;  4OVN F;  3PSR A;  2LAP A;  1XFX O;  2Y5I A;  1EL4 A;  2M8U A;  1QAS A;  4FTG A;  2K7D A;  1M45 A;  2EHB A;  2NZ0 A;  1SPY A;  2OS8 B;  3TS5 C;  1EG3 A;  2CCM A;  2QAC A;  1PSR A;  3OHM B;  1VRK A;  1S1E A;  1RWY A;  4GUK A;  5DKR A;  1N0Y A;  1SKT A;  1E8A A;  1TOP A;  2AMI A;  1K93 D;  4XJK A;  2JT3 A;  1L2O B;  4GFT A;  1NX0 A;  1EJ3 A;  1K94 A;  4QJ5 B;  4PHJ A;  2JQ6 A;  1BU3 A;  1KK8 C;  3GOF A;  1AVS A;  2MAZ A;  3OB2 B;  1CLL A;  3LLE A;  3BUN B;  3BUM B;  1G8I A;  1GQM A;  2BL0 C;  2IS9 A;  1K90 D;  1CTR A;  2KBM A;  1V1G A;  2LVK A;  2L4I A;  2KI4 B;  3CR2 A;  1WRZ A;  1JUO A;  1CDL A;  2GV5 A;  1F8H A;  4M2O A;  4BY5 A;  1KFX S;  2O5G A;  2JPT A;  3DD4 A;  1A75 A;  4Q04 A;  1TRF A;  2P6B B;  2OTG C;  5AFP A;  3TS5 B;  1J1E A;  4OKH A;  1M31 A;  2FCD A;  1K96 A;  1L2O C;  2JT0 A;  2F8P A;  4YI8 A;  4GGF C;  2LM5 A;  1U5I A;  4MRX A;  2LE9 B;  4JWQ A;  4YGD B;  1B1G A;  1KK8 B;  1S36 A;  4E68 A;  4ZCV A;  1PK0 D;  2H61 A;  4UPG A;  4NDD A;  1TCF A;  1XVJ A;  3NXA A;  2LLS A;  5JOL A;  1NCX A;  1IQ3 A;  1W7J B;  4PCW A;  1RK9 A;  2KI4 C;  3GK1 A;  4MZJ A;  2KYF A;  4NDB A;  5D7F A;  1OMV A;  1AUI B;  2B1U A;  1G4Y R;  1C7V A;  1MWN A;  1F54 A;  1WRK A;  2LAN A;  4CPV A;  1UHI A;  2OTG B;  1PUL A;  2LVJ A;  4I5J A;  5CSI A;  1PVB A;  2WND A;  2KNE A;  2JXL A;  3PN7 B;  5FYX A;  3TDZ A;  4MZL A;  1FI6 A;  2F3Y A;  4DCK A;  2JNX A;  5I2O A;  1IG5 A;  4HRG A;  4M2P A;  3BOW B;  1WDC B;  2JC2 A;  4YGB B;  1CM1 A;  1NYA A;  1QXP A;  5KTY A;  1RRO A;  1IGV A;  1DF0 B;  1QIV A;  1AP4 A;  4ORA B;  2ZN8 A;  3GK4 X;  2KAX A;  2E30 A;  2L50 A;  1IQ5 A;  1XFZ O;  4PE1 A;  2RGI A;  4OR9 B;  2JTZ A;  1GJY A;  1YVH A;  1PRW A;  5CSJ A;  3WHU B;  1F55 A;  2KSP A;  3FS7 A;  3GK2 A;  4PE4 A;  3A4U B;  2KAV A;  2L51 A;  3E3R A;  2MRD A;  3LCP C;  1XO5 A;  3SG3 A;  2Q91 A;  1CFC A;  3PLF B;  1QLS A;  4QJ4 B;  1J7O A;  1JFK A;  1KK7 Y;  1F4O A;  1PSB A;  1TNQ A;  3BUO B;  3PN7 C;  2CNP A;  3PAL A;  3NSL A;  4R1E A;  2KOT A;  2PAS A;  3D0Y B;  2LHI A;  2ZND A;  1DJZ A;  3BQ3 A;  2KBI A;  1WDC C;  1LIN A;  2KQY A;  3IF7 A;  5DKN A;  3KF9 A;  3SG2 A;  3VGO A;  3EK4 A;  3DVE A;  2KHN A;  4I5K A;  1V1F A;  1GGZ A;  3SIB A;  4HRE E;  1MHO A;  1DJI A;  4N1G A;  1FI5 A;  4C0K A;  1HQV A;  2JZI A;  1BLQ A;  3AKA A;  3OX6 A;  2K7C A;  3CWG A;  5AEQ A;  4AOM A;  1CMG A;  1REC A;  2ZN9 A;  1H8B A;  1YUS A;  2BCB A;  2EGD A;  3K21 A;  4GGF A;  1IJ6 A;  2KQ6 A;  4PHK A;  2K7B A;  1OQP A;  1EH2 A;  1DF0 A;  1CNP A;  2SCP A;  2WCF A;  2H61 C;  2WOR A;  2KYC A;  2WOS A;  5HKY A;  2OPO A;  2KI6 C;  3LK0 A;  2PMY A;  1FPW A;  4PHM A;  3NSK A;  1SRA A;  2LP2 A;  4P5O E;  1NCZ A;  1Y1A A;  2PSR A;  3BUW B;  4ORC B;  5HKW A;  1IKU A;  1B47 A;  2JXC A;  2R2I A;  4DRW A;  4GNK B;  1SL9 A;  3VRP A;  4YRU A;  2M0R A;  1B8C A;  1GGW A;  1XFY O;  2KFF A;  1DT7 B;  1BG1 A;  1NWD A;  3LK1 A;  1B4C A;  1QIW A;  5HLV A;  1BMO A;  1JSA A;  2LMV A;  2BE4 A;  1KFU S;  3CZT X;  1YTZ C;  1MQ1 A;  2AUC A;  1CLB A;  2L4H A;  3EVU A;  2HQW A;  2LLU A;  1BT6 A;  4XJK B;  2F2P A;  3DF0 A;  3BUX B;  4I5L B;  1QV1 A;  1UP5 A;  2CBL A;  4DUQ A;  4CLN A;  3TDI A;  5KSZ A;  1DTL A;  1SL7 A;  1LA0 A;  1TCO B;  1G33 A;  1K2H A;  2FOT A;  2E6W A;  1B8R A;  2I2R E;  1K9U A;  3HCM A;  1SK6 D;  3BXK A;  1DJW A;  1SY9 A;  1BOD A;  5D69 A;  1TN4 A;  5BPJ A;  1SW8 A;  2BCX A;  4AQJ A;  1XA5 A;  5I2Q A;  1CFP A;  2BE6 A;  4CFQ A;  1WY9 A;  4PAL A;  1S26 D;  3ZNI A;  2M3W A;  1KWO B;  1S5G Z;  2K7O A;  1KSM A;  2KFG A;  1OOJ A;  1Y0V H;  5IBW A;  1KFU L;  2LHL A;  1K95 A;  4XYN A;  4DIR A;  1C7W A;  2JUL A;  5AER A;  5CSF A;  1CDP A;  3TDU A;  3I5I B;  4P2Y B;  2HPS A;  1DJX A;  2K2F A;  1LXF C;  2SAS A;  2KDH A;  1QVI Y;  1RTP 1;  2BKH B;  4YI9 A;  1SL8 A;  3JVT B;  1RFJ A;  3QRX A;  4C0L A;  1MUX A;  1JC2 A;  1S6C A;  1DJG A;  2ZNE A;  3PFV A;  2ZRT A;  1DGV A;  1J7R A;  1NUB A;  5CSN A;  1CFF A;  1KWO C;  4IL1 A;  1KK7 Z;  1TTX A;  1UHJ A;  3RLZ A;  4OCI A;  2V53 A;  2I94 A;  2L0P A;  1XK4 C;  2ZKM X;  1AK8 A;  4PE7 A;  5GQQ C;  1KQV A;  1NCY A;  3JTD C;  1OZO A;  2WCB A;  3EKJ A;  3KPX A;  1NSH A;  4GBA A;  2ISD A;  5K89 A;  2PRU A;  1J7P A;  1OZS A;  1JWD A;  4GGN A;  1Y1X A;  2BCA A;  3EVV A;  1ZUZ A;  5CPV A;  4A4C A;  4DS7 A;  1CFD A;  3I5I C;  2LUX A;  1PAL A;  1KQM C;  3CTN A;  2MBX A;  1B7T Y;  1CDN A;  3SIA A;  1YUU A;  1F71 A;  1CMF A;  3I5G C;  3JVT C;  1NP8 A;  1CM4 A;  2LVV A;  2Y4Q A;  2JWW A;  1FBV A;  1DJY A;  2LLT A;  4PHN A;  4USL A;  3O2P A;  1QAT A;  2MJW B;  1XFW O;  1UWO A;  4PE0 A;  4YGC B;  1LA3 A;  3FWC A;  1Y6W A;  1IJ5 A;  1AJ5 A;  2LP3 A;  2K61 A;  3C1V A;  3JTD B;  1F70 A;  1R6P A;  3DF0 B;  1K8U A;  3I5H C;  4TNC A;  3LL8 B;  2LMT A;  4MEW A;  5I8N A;  1U5I B;  1CLM A;  3CGA A;  4MLW A;  2JU0 A;  1A2X A;  1TIZ A;  4OV2 A;  2BBN A;  1M63 B;  2LMU A;  1XYD A;  1X02 A;  1ALV A;  1IH0 A;  1KQM B;  3VRN A;  4U8D A;  2M49 B;  1UUS A;  1YVL A;  1JF0 A;  1OSA A;  2FCE A;  2NXQ A;  1W7I B;  1JFJ A;  1WLM A;  1YR5 A;  3I5G B;  3CR5 X;  1JF2 A;  1K9P A;  3HX4 A;  2EC6 B;  4FQO A;  4QJ3 B;  1QLK A;  4WRI A;  1LVC D;  2F3Z A;  5ER5 A;  3ICB A;  5HKZ A;  3FIA A;  4AQI A;  2LVI A;  2G2B A;  3TZ1 A;  1NX2 A;  3AAK A;  2F2O A;  2JT8 A;  5TNC A;  1A75 B;  1QVI Z;  1EXR A;  3D10 A;  1TNX A;  2MLF C;  3CR4 X;  1YX8 A;  3F45 A;  3FWB A;  5AAN A;  5B8I B;  1YX7 A;  2LCP A;  3I5H B;  1QV0 A;  3M0W A;  4I5N B;  2JTT A;  4BY4 A;  1A4P A;  2MHH A;  3WHT B;  1UUR A;  3EKH A;  2QPT A;  3NSI A;  1SMG A;  2JOJ A;  2MA2 A;  4NQG A;  5DKQ A;  2TN4 A;  3ZWH A;  1FF1 A;  1AHR A;  2D8N A;  2CTN A;  2LC5 A;  1XFV O;  1BF5 A;  2BKI B;  5J3X A;  1DJH A;  1UHK A;  3EVR A;  4ORB B;  4MBE A;  2L2E A;  4A4B A;  2O60 A;  3OB1 B;  1EG4 A;  4MSP A;  3EK7 A;  4WQ2 A;  5F6T A;  4YGE B;  1Q80 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...