3O2PA

A dual e3 mechanism for rub1 ligation to cdc53: dcn1(p)-cdc53(whb)
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
199
structure length
199
Chain Sequence
YPKELTQVFEHYINNNLFDIDSLVKFIEELGYNLEDLATLCLAHLLGYKKLEEPLKREDFLSTWFMQGCSTISDMQECIKTLDVKLHEDLQYFTQIYNYAFNLILDPNRKDIDTDEGIQYWKLFFQPEYPVRMEPDLLEAWFRFLRDEGKTTISKDTWRMLLLFFKRYPTIQKIISDYDETAAWPFIIDEFYECLQDQQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Defective in cullin neddylation protein 1
publication title A dual E3 mechanism for Rub1 ligation to Cdc53.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Ligase, cell cycle
total genus 68
structure length 199
sequence length 199
ec nomenclature
pdb deposition date 2010-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03556 Cullin_binding Cullin binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3o2pA01
4JWQA 2CXJA 4HRGA 2ZFDA 1NWDA 3F45A 1M46A 2MBXA 5FYXA 1EJ3A 2LCPA 2Q4UA 1B4CA 3KPXA 3TDZA 2NZ0A 5JJGA 1IGVA 1UHNA 2MJWB 1YX8A 3HX4A 3O2PA 1CNPA 4PHKA 1DJZA 1IJ5A 2LLTA 3EK8A 2HQWA 3VRQA 4GUKA 3OB1B 1KSOA 1TRFA 4PHMA 3FIAA 2JT3A 4IL1A 1LKJA 1LA3A 1TCFA 2QPTA 1K2HA 2MLEC 2LANA 4OVNF 3SG3A 2KFHA 3VRRA 2NXQA 5IBWA 2LLSA 1BT6A 1M39A 1YR5A 1BG1A 3BUXB 2DOQA 1F54A 1D1OA 2CT9A 1NCYA 2CNPA 5PALA 2M1UA 2L98A 1K93D 1CDNA 4NDDA 2KI6C 3LK0A 1TTXA 2MRDA 1UHJA 3BUNB 5CSNA 1DJGA 1S3PA 1JWDA 1B7TY 4Q04A 1R6PA 2KDHA 1W7JB 2LVKA 4I5LB 2JNXA 3VRPA 3BOWA 1UP5A 4PE4A 3SG5A 2CCMA 2LHLA 2M3WA 1A4PA 2LC5A 1SK6D 1AUIB 4YBHB 2I2RE 4NQGA 2WCBA 2BECA 3VROA 1Y1UA 1GJYA 1KQMB 2HETA 1CFFA 3FWBA 1A2XA 1PVBA 2M7LA 3CGAA 1F55A 4GNKB 1SNLA 3I5FB 2LMVA 1KQMC 3EK4A 3I5FC 4XYNA 2BCBA 2IS9A 1QV1A 2KBMA 4PHNA 2HQ8A 4GGNA 1C07A 3WNXB 1N0YA 1ZFSA 2FCDA 1YRUB 2FCEA 1KFXS 1RJVA 1FBVA 1MWNA 4L9MA 5AFPA 4R1EA 2NCPA 1J7QA 2F3YA 2PVBA 4PE1A 3C1VA 3SIBA 1ZMZA 1VRKA 1L2OB 4ZCUA 4MZLA 2JNFA 1DJYA 2L5XB 2MA2A 4N5XA 1AHRA 2H61C 1OE9B 1B7TZ 1S36A 1DVIA 2ZN8A 3DF0A 2F33A 4MRYA 1XFZO 3SIAA 2ISDA 3DVMA 4XJKB 2LV7A 2KAYA 2L4IA 1A03A 1YRTB 1K94A 1SCVA 2KI6D 1BODA 4PALA 2K2AA 1X02A 1QX5B 4BY5A 2PMYA 4YRUA 2M8UA 1BMOA 2JXCA 5DKQA 2M9GA 5HLVA 3O4YA 3GK2A 1F71A 4QJ4B 1IRJA 1B8CA 2LP2A 1YVHA 1G4YR 1JFJA 4MN0A 2L4HA 2JTZA 4MZKA 5HLOA 3VRNA 4OCIA 5CPVA 2OTGB 1NX1A 2KHNA 3JTDC 4ORCB 1DJXA 2F8PA 5DKRA 2K7DA 2I94A 2OTGC 1FPWA 4ETOA 1JUOA 2JWWA 2LUXA 2SCPA 1OMDA 4OR9B 2NCOA 1MF8B 2EGDA 2M29A 1F70A 1XK4C 1A75B 3I5IB 1OOJA 2QACA 2M0RA 1KFUS 1QXPA 1S6JA 2KYCA 1QATA 2TN4A 3CS1A 4AQIA 2BL0C 1MXEA 4MLWA 4P5OE 1UUSA 4F0ZB 3GOFA 3K21A 3I5GB 1BF5A 3NSOA 3MSEB 4P2YB 2K8MB 1EL4A 3M0WA 4M2QA 1C7VA 3I5GC 1MXLC 4UPGA 1IWQA 3CR5X 3OX6A 5F6TA 2KI4B 2LHIA 3TS5B 1W7IB 1UURA 1CLMA 2K7CA 3OB2B 2LVVA 1MR8A 2ZKMX 1XYDA 5AERA 1AK8A 1BOCA 1CDPA 2KI4C 3SJSA 3TS5C 1BR1B 1F4QA 3RM1A 1H4BA 2BCXA 1ZOTB 3PLFB 4MZJA 3OHMB 1BLQA 2M1KB 3AKBA 4MSPA 3DD4A 1TNPA 1FI6A 2FOTA 1ALVA 1QS7A 1RFJA 4C0KA 1B1GA 3CWGA 2KGBC 3KHEA 1CMGA 5I2QA 1J55A 1Y1AA 2RGIA 5GQQC 1NX0A 2M7NA 1EG4A 3TZ1A 5AEQA 1XFYO 3VGOA 5CSIA 1LVCD 5HKZA 1EH2A 1WLMA 1LINA 2LMTA 2KFFA 1CFCA 1PVAA 2P6BB 4GBAA 1K9KA 2WORA 3EK7A 1DF0B 3FWCA 3KF9A 3PSRA 1J7OA 1NSHA 2PASA 1XO5A 2F2PA 1HQVA 2K2FA 5ER5A 5G08A 1SY9A 1B8RA 3FS7A 3SG2A 4PE0A 1AJ4A 4CLNA 3D0YB 3JVTB 1RROA 3LCPC 5CSJA 1WRLA 3CTNA 2H61A 2FJUB 3A8RA 4FQOA 3JVTC 4I5KA 1RTP1 4C0LA 5ER4X 1CFDA 1SYMA 2MLFC 1QIVA 2O60A 5I2LA 1XFWO 1JC2A 1OMVA 1TNXA 4HREE 1S5GY 1F8HA 1HT9A 1N65A 2I7AA 2MAZA 3CR2A 1GGWA 2LP3A 4HRHA 2EC6B 1J7PA 4DRWA 1ZACA 4YI9A 4XJKA 2K7OA 1DMOA 1FW4A 4PDZA 1BR4B 2AMIA 1Y6WA 1XFUO 1YURA 2BBMA 2JXLA 3CLNA 5KU1A 3EVUA 5JOLA 1BJFA 4QJ3B 1L7ZA 1YUSA 5AANA 1IQ3A 4YGCB 1L2OC 1KK7Y 2I18A 3O6BA 1QLSA 2OS8B 2EHBA 4D1EA 1IQ5A 3CR4X 2LM5A 3DVKA 1XK4A 3EKHA 3H4SE 3TUYB 2OS8C 4AQJA 2JOJA 2Y1NA 4N1FA 1UHHA 4PHJA 1ZUZA 3TUYC 1A75A 1Q80A 1C7WA 1YX7A 2JC2A 3I5HB 3BXKA 1NPQA 1KSMA 1JBAA 5AXIA 2BKIB 1E8AA 1RECA 1QX7A 1S5GZ 1GQMA 2BE4A 1DJWA 1PALA 1UWOA 2E30A 1KFUL 1CFPA 2A4JA 3DVEA 1KCYA 4WQ2A 2D8NA 1B47A 1SPYA 1U5IB 1YUTA 2L51A 1TN4A 3PM8A 5KTYA 2G2BA 2JULA 1OZSA 3BQ3A 4MRXA 2WCFA 2PALA 1IKUA 1S26D 3PN7B 2Y1MA 2LAPA 1CLLA 1QVIY 1AP4A 1DGUA 2KAXA 4AOMA 3NSIA 5TNCA 2LLUA 4ORAB 1SW8A 1M63B 5I2OA 1SL7A 4USLA 2GGZA 1CLBA 1K9UA 2L50A 1DGVA 5K89A 1NX3A 3SG7A 4I5NB 1KK7Z 2KSPA 1K8UA 1DJIA 1OQPA 1S1EA 4DUQA 1DTLA 1SL8A 1CTRA 3I5IC 2Y4QA 1B8LA 3D10A 1IH0A 3BYAA 1CKKA 5DKNA 4GGFC 1DF0A 1F4OA 2KBIA 3EVRA 4DIRA 4WRIA 4A4BA 1NYAA 1SRAA 4C0JA 1J7RA 2LNKA 2KYFA 1B9AA 2VRGA 3BUMB 3BUOB 2Q91A 1DT7B 5HYDA 2ZNDA 3D0YA 4YI8A 4WQ3A 2JRFA 2K61A 2WC8A 2V53A 1CMFA 5D7FA 5D69A 1QVIZ 4YGBB 3OP0A 1SL9A 1H8BA 3KEVA 2JU0A 1ODBA 3PALA 1A29A 3NSKA 1Y0VH 4JQ0D 2M97A 1KWOB 1ALWA 1RK9A 3IF7A 1KK8B 3ZNIA 1JSAA 2ZRSA 4HSZA 1AJ5A 1KWOC 2AAOA 4ORBB 2E6WA 1JF0A 1KK8C 2JT0A 3AAKA 2KQYA 1SR6B 2WOSA 2O5GA 2K0JA 3EVVA 1YTZC 3GK4X 1K96A 3WHUB 1JFKA 2JQ6A 1SR6C 1OMRA 1YVLA 1PSBA 1JF2A 1LA0A 1KFXL 1N2DA 4FTGA 1IJ6A 4JPZB 1TIZA 1G8IA 1TCOB 4YGAA 1TNQA 2NLNA 2GV5A 3ICBA 1K95A 2F3ZA 3TDUA 1NIWA 1OSAA 4CPVA 3LL8B 2F2OA 3O78A 4TNCA 4ICBA 4A4CA 1XVJA 4CFQA 2LUCA 4YGEB 4M2PA 2BBNA 1KQVA 2WCEA 2JZIA 2ZRTA 2EC6C 2ZN9A 3PATA 1PRWA 1V1FA 4NDCA 5B8IB 2KGRA 1CB1A 1NUBA 1MHOA 2CTNA 3NXAA 1QTXA 3IQQA 1QV0A 2KQ6A 1S6IA 2LVIA 3WHTB 1U5IA 3IQOA 1OZOA 1LXFC 1FI5A 1QASA 1SBJA 1K9PA 3SG6A 2COLB 1NP8A 3E3RA 2LMUA 2OPOA 2BE6A 2SASA 3AAJA 3KO0A 5J3XA 1WRKA 3ZWHA 4N1GA 4CFRA 1V1GA 2PSRA 4YGDB 3RLZA 1QIWA 1SCMB 2MHHA 3EKJA 1DJHA 5I8NA 1UHKA 1SCMC 3LLEA 1NCZA 1S6CA 3WXAA 1WLZA 2L2EA 3AKAA 4DCKA 1NX2A 2JTTA 1CM1A 3GK1A 2KOTA 1CM4A 4OV2A 3QRXA 3I5HC 4GAOA 4MVFA 1NCXA 1R2UA 1J1EA 2GGMA 1CDLA 4GGFA 1EG3A 3BOWB 1MQ1A 1QX2A 4NDBA 2R2IA 5CSFA 2LE9B 1WRZA 4GPLB 3OX5A 1PK0D 3CZTX 1SMGA 1XFVO 2WNDA 1K90D 4DS7A 1J1DA 1TOPA 2L0PA 4BY4A 2G9BA 1G33A 1XA5A 1M45A 2LVJA 2KFGA 1EXRA 3PN7C 4PCWA 3A4UB 5BPJA 1CDMA 1TNWA 2JPTA 1BU3A 2B1UA 2Y5IA 2JT8A 2BCAA 2KAVA 3HCMA 1IG5A 4PE7A 5KSZA 4CIDA 5HKYA 4M2OA 4GFTA 4MBEA 3BUWB 4QJ5B 2HPSA 4U8DA 1AVSA 4I5JA 3JTDB 3NSLA 1MUXA 2M49B 1RWYA 1XFXO 2H2KA 1PSRA 1WDCB 1Y1XA 2ZNEA 5HKWA 3SG4A 1QJTA 1QLKA 2KNEA 1FF1A 1M31A 1YUUA 1WDCC 3DF0B 4OKHA 2AUCA 2K7BA 2PRUA 1WY9A 3PFVA 1UHIA 3TDIA 2CBLA 4ZCVA 2HF5A 4MEWA 3DVJA 4E68A 3LK1A 1PULA 2BKHB 2BL0B 1GGZA 1SKTA
chains in the Genus database with same CATH superfamily
4JWQA 2CXJA 2WCLA 2ZFDA 4HRGA 1NWDA 3F45A 1M46A 2MBXA 5FYXA 1EJ3A 2LCPA 2Q4UA 2BAPA 3KPXA 3TDZA 1B4CA 2NZ0A 5JJGA 4INWA 1IGVA 1UHNA 2MJWB 1OOGA 1YX8A 3HX4A 3O2PA 1CNPA 4PHKA 1Z4HA 1DJZA 1IJ5A 2LLTA 3EK8A 2HQWA 3VRQA 4GUKA 3OB1B 1KSOA 1TRFA 4PHMA 3FIAA 2JT3A 4IL1A 1LKJA 1LA3A 1TCFA 2QPTA 4JKTA 1K2HA 2MLEC 2LANA 4OVNF 3SG3A 2KFHA 3OGNA 2NXQA 3VRRA 5IBWA 2LLSA 1BT6A 1M39A 1YR5A 1BG1A 2WCJA 3BUXB 2DOQA 1F54A 3CZ0A 1D1OA 2CT9A 1NCYA 2CNPA 5PALA 3DY9A 2M1UA 2L98A 1K93D 1CDNA 4NDDA 2KI6C 3LK0A 1TTXA 2MRDA 1UHJA 3BUNB 3S0DA 5CSNA 1DJGA 1S3PA 1JWDA 1B7TY 4Q04A 1R6PA 2KDHA 3N7HA 5FI7A 1W7JB 1ORGA 2LVKA 4I5LB 2JNXA 3VRPA 3BOWA 1UP5A 4PE4A 3SG5A 1C3ZA 2CCMA 2LHLA 2M3WA 1A4PA 2LC5A 1SK6D 1Z2CB 1AUIB 4YBHB 2I2RE 4NQGA 2WC6A 2WCKA 2WCBA 2BECA 3VROA 1Y1UA 1GJYA 1KQMB 2HETA 1CFFA 3FWBA 1A2XA 1PVBA 2M7LA 3CGAA 3D73A 4GNKB 1SNLA 2K60A 3I5FB 2LMVA 1KQMC 3EK4A 3I5FC 4XYNA 2BCBA 2IS9A 1QV1A 2KBMA 4PHNA 2HQ8A 4GGNA 1C07A 3WNXB 1N0YA 3S0GA 1ZFSA 2FCDA 3D75A 1YRUB 2FCEA 3SS4A 1KFXS 1RJVA 1FBVA 1MWNA 4L9MA 5AFPA 4R1EA 2NCPA 1J7QA 2F3YA 2PVBA 4PE1A 3C1VA 3SIBA 1ZMZA 1VRKA 1L2OB 4ZCUA 4MZLA 2JNFA 2ERBA 1DJYA 2L5XB 2MA2A 4N5XA 2H8VA 1AHRA 2H61C 1IIOA 1OE9B 1B7TZ 1S36A 1DVIA 2ZN8A 3DF0A 2F33A 4MRYA 5I94A 1XFZO 3SIAA 2ISDA 3DVMA 4XJKB 2LV7A 2KAYA 2L4IA 1A03A 1YRTB 1K94A 1SCVA 2KI6D 3CZ1A 3PJIA 1BODA 4PALA 2K2AA 1X02A 1QX5B 4BY5A 2PMYA 4YRUA 2M8UA 3S0FA 1BMOA 2JXCA 5DKQA 2M9GA 5HLVA 3O4YA 3R72A 3GK2A 1F71A 4QJ4B 1IRJA 1B8CA 2LP2A 1YVHA 1G4YR 2QEBA 1JFJA 4MN0A 2L4HA 2JTZA 4MZKA 5HLOA 3VRNA 4OCIA 5CPVA 2OTGB 1NX1A 2KHNA 3JTDC 4ORCB 1DJXA 2F8PA 5DKRA 2K7DA 2I94A 2OTGC 1DEKA 1FPWA 4ETOA 1JUOA 2JWWA 2LUXA 2SCPA 1OMDA 3D74A 4OR9B 2NCOA 1MF8B 2EGDA 2M29A 4INXA 1XK4C 1F70A 1A75B 3I5IB 1OOJA 2QACA 2M0RA 1KFUS 1QXPA 1S6JA 2KYCA 1QATA 2TN4A 3CS1A 3K1EA 4AQIA 2BL0C 1MXEA 4MLWA 4P5OE 1UUSA 4F0ZB 3GOFA 3K21A 3I5GB 3CYZA 1BF5A 3B86A 3NSOA 3MSEB 4P2YB 2K8MB 1EL4A 3DZTA 3M0WA 4M2QA 1C7VA 3I5GC 1MXLC 3S0EA 4UPGA 1IWQA 3CR5X 3OX6A 5F6TA 2KI4B 2LHIA 3TS5B 1W7IB 1UURA 1CLMA 2K7CA 3NHTA 3OB2B 2LVVA 1MR8A 2ZKMX 1XYDA 5AERA 1AK8A 1BOCA 1CDPA 2KI4C 3SJSA 3L4AA 3TS5C 1BR1B 1F4QA 4IJ7A 2YGUA 3RM1A 1H4BA 3CDNA 2BCXA 1ZOTB 3PLFB 4MZJA 3OHMB 1BLQA 1SSEB 2M1KB 3AKBA 4MSPA 3DD4A 1TNPA 1FI6A 2FOTA 1ALVA 1QS7A 1RFJA 4C0KA 1B1GA 3CWGA 2KGBC 3KHEA 1CMGA 5I2QA 1J55A 1Y1AA 2RGIA 5GQQC 1NX0A 2M7NA 1EG4A 3TZ1A 5AEQA 1XFYO 3VGOA 5CSIA 1LVCD 5HKZA 1EH2A 1WLMA 1LINA 2LMTA 2KFFA 1CFCA 1PVAA 2P6BB 4GBAA 1K9KA 2QEVA 2WORA 1OOHA 1DF0B 1QWVA 2JPOA 2WCHA 3EK7A 3FWCA 3KF9A 3PSRA 1J7OA 3BJHA 1NSHA 2BNXA 2PASA 1XO5A 2F2PA 1HQVA 2K2FA 5ER5A 5G08A 1SY9A 1B8RA 3FS7A 4KYNA 3SG2A 4PE0A 1AJ4A 4CLNA 1F55A 3D0YB 3JVTB 1RROA 3LCPC 5CSJA 3CABA 1WRLA 3CTNA 3O4XA 2H61A 2FJUB 3A8RA 3CZ2A 4FQOA 3JVTC 4I5KA 1RTP1 4C0LA 2L2CA 3B6XA 5ER4X 1CFDA 1SYMA 2MLFC 3SG4A 1QIVA 2O60A 5I2LA 1C3YA 1XFWO 1JC2A 1OMVA 1TNXA 4HREE 1S5GY 1F8HA 1HT9A 1N65A 2I7AA 2MAZA 3CR2A 1GGWA 2LP3A 4HRHA 2EC6B 3IVTA 1J7PA 4DRWA 3BFBA 1ZACA 4YI9A 3OBVA 4XJKA 2K7OA 5EL2A 1DMOA 1FW4A 4PDZA 2PQLA 1BR4B 2AMIA 1Y6WA 1XFUO 4FQTA 1YURA 2BBMA 2JXLA 3CLNA 5KU1A 3EVUA 3D78A 5JOLA 1BJFA 2QEOA 4QJ3B 1OOFA 1L7ZA 1YUSA 5AANA 1IQ3A 4YGCB 3Q8IA 2KLEA 1L2OC 1KK7Y 2I18A 3O6BA 1QLSA 2OS8B 2EHBA 4D1EA 1IQ5A 2KLDA 3CR4X 2LM5A 3DVKA 3BFHA 1XK4A 3EKHA 3H4SE 3TUYB 2OS8C 4AQJA 2JOJA 2Y1NA 3DYEA 1UHHA 4N1FA 4PHJA 3UO9A 4PT1A 1ZUZA 3TUYC 1A75A 1Q80A 1C7WA 1YX7A 2JC2A 3I5HB 3BXKA 1NPQA 3V2LA 1KSMA 1JBAA 5AXIA 2BKIB 1E8AA 1RECA 1QX7A 1S5GZ 1P28A 1GQMA 1DJWA 2BE4A 1PALA 1UWOA 2E30A 1KFUL 1CFPA 2A4JA 3DVEA 1KCYA 4WQ2A 2D8NA 1B47A 1SPYA 1U5IB 1YUTA 2L51A 1TN4A 3PM8A 5KTYA 2G2BA 2JULA 1OZSA 3BQ3A 4MRXA 2WCFA 2PALA 1IKUA 1S26D 3PN7B 2Y1MA 2LAPA 1CLLA 1QVIY 1AP4A 3S0BA 1DGUA 2KAXA 4AOMA 3D76A 3NSIA 5TNCA 2LLUA 2PYQA 4ORAB 1SW8A 1M63B 5I2OA 1SL7A 4USLA 2GGZA 1CLBA 1K9UA 2L50A 3B87A 1DGVA 5K89A 1NX3A 3SG7A 3FE6A 4I5NB 1KK7Z 2KSPA 1DC1A 1K8UA 1DJIA 1OQPA 1S1EA 4DUQA 1DTLA 1SL8A 1CTRA 3I5IC 3R1PA 2Y4QA 1B8LA 3D10A 1IH0A 3BYAA 1CKKA 5DKNA 3L4LA 4GGFC 1DF0A 1F4OA 2KBIA 3EVRA 4DIRA 4WRIA 4A4BA 1NYAA 1SRAA 4C0JA 1J7RA 2LNKA 2KYFA 1B9AA 2VRGA 3BUMB 3BUOB 2Q91A 1DT7B 5HYDA 2ZNDA 3D0YA 4YI8A 4WQ3A 2JRFA 4OZDA 2K61A 2WC8A 2V53A 1CMFA 5D7FA 5D69A 1QVIZ 4YGBB 3OP0A 1SL9A 1H8BA 3KEVA 2JU0A 1DQEA 1ODBA 3PALA 1A29A 3NSKA 1TWOA 1Y0VH 4JQ0D 3L47A 2M97A 1KWOB 1ALWA 1RK9A 3IF7A 1KK8B 3ZNIA 1JSAA 2ZRSA 4HSZA 1AJ5A 3R1VA 1KWOC 2AAOA 4ORBB 2E6WA 1JF0A 1KK8C 2JT0A 3AAKA 4F7FA 3BFAA 2KQYA 1SR6B 2WOSA 2O5GA 5B8IB 2K0JA 3EVVA 1YTZC 3GK4X 1K96A 3WHUB 1JFKA 1GM0A 2JQ6A 1SR6C 1OMRA 1YVLA 1PSBA 1JF2A 1LA0A 1KFXL 1N2DA 4FTGA 1IJ6A 4JPZB 1TIZA 1G8IA 1TCOB 4YGAA 1TNQA 2NLNA 5FI2A 2GV5A 3ICBA 1K95A 2F3ZA 3TDUA 1NIWA 1OSAA 2QDIA 2GTEA 4CPVA 3LL8B 2F2OA 3O78A 4TNCA 4ICBA 2FJYA 1XVJA 4A4CA 4CFQA 2LUCA 1W9ZA 4YGEB 4M2PA 2BBNA 1KQVA 2WCEA 2JZIA 2ZRTA 2EC6C 2ZN9A 3EG5B 1PRWA 1V1FA 3PATA 4NDCA 1OOIX 2KGRA 1NUBA 3B7AA 1CB1A 3SS5A 1MHOA 2WCMA 1DELA 2CTNA 3NXAA 1QTXA 3S0AA 3IQQA 5DICA 1QV0A 2KQ6A 1S6IA 2LVIA 3WHTB 1U5IA 2QEHA 1OZOA 1LXFC 3IQOA 1QASA 1SBJA 3RZSA 1FI5A 1K9PA 3SG6A 2COLB 1NP8A 3E3RA 3FE9A 2LMUA 2OPOA 2BE6A 2SASA 3AAJA 3KO0A 5J3XA 1WRKA 3ZWHA 4N1GA 4CFRA 1V1GA 2PSRA 4YGDB 3RLZA 1QIWA 1SCMB 2MHHA 3EKJA 1DJHA 4JD9A 5I8NA 1UHKA 1SCMC 2P71A 3LLEA 1NCZA 1LS8A 1S6CA 3WXAA 5FI6A 1WLZA 2L2EA 3VB1A 3AKAA 4DCKA 1NX2A 2JTTA 1CM1A 3GK1A 2KOTA 1CM4A 2WC5A 4OV2A 3D77A 3QRXA 3I5HC 4GAOA 4MVFA 1NCXA 1R2UA 1J1EA 2GGMA 1CDLA 4GGFA 5KSZA 1EG3A 3BOWB 3UNWA 3PM2A 1MQ1A 1QX2A 4NDBA 3FE8A 2R2IA 3B88A 5CSFA 2LE9B 1WRZA 4GPLB 3OX5A 1FF1A 1PK0D 3CZTX 3NHIA 1SMGA 1XFVO 2WNDA 1K90D 4DS7A 1J1DA 1TOPA 2L0PA 4BY4A 2G9BA 1G33A 1T14A 1XA5A 3SS3A 1M45A 2LVJA 2KFGA 1EXRA 3PN7C 4PCWA 3A4UB 5BPJA 1CDMA 1TUJA 1TNWA 2JPTA 1BU3A 2B1UA 2P70A 2JT8A 2BCAA 2KAVA 2Y5IA 1IG5A 3HCMA 4PE7A 4CIDA 5HKYA 5D3OA 4M2OA 4GFTA 4MBEA 3BUWB 1TUZA 4QJ5B 2HPSA 4U8DA 1AVSA 4I5JA 3JTDB 3NSLA 1MUXA 2M49B 1RWYA 1XFXO 2H2KA 1PSRA 1WDCB 1Y1XA 2ZNEA 3DXLA 3QMEA 1QJTA 1QLKA 2KNEA 2KPHA 3R1OA 5HKWA 1M31A 1YUUA 1XFRA 1WDCC 3DF0B 4OKHA 2AUCA 2K7BA 2PRUA 1WY9A 3PFVA 1OW4A 1UHIA 3TDIA 5HL1A 2CBLA 4ZCVA 2HF5A 4MEWA 3DVJA 4E68A 3LK1A 1PULA 2BKHB 2BL0B 3NGVA 1GGZA 1SKTA 2L5YA
chains in the Genus database with same CATH topology
4JWQA 2CXJA 4HRGA 2ZFDA 1NWDA 3F45A 1M46A 2MBXA 5FYXA 1EJ3A 2LCPA 2Q4UA 1B4CA 3KPXA 3TDZA 2NZ0A 5JJGA 1IGVA 1UHNA 2MJWB 1YX8A 3HX4A 3O2PA 1CNPA 4PHKA 1DJZA 1IJ5A 2LLTA 3EK8A 2HQWA 3VRQA 4GUKA 3OB1B 1KSOA 1TRFA 4PHMA 3FIAA 2JT3A 4IL1A 1LKJA 1LA3A 1TCFA 2QPTA 1K2HA 2MLEC 2LANA 4OVNF 3SG3A 2KFHA 3VRRA 2NXQA 5IBWA 2LLSA 1BT6A 1M39A 1YR5A 1BG1A 3BUXB 2DOQA 1F54A 1D1OA 2CT9A 1NCYA 2CNPA 5PALA 2M1UA 2L98A 1K93D 1CDNA 4NDDA 2KI6C 3LK0A 1TTXA 2MRDA 1UHJA 3BUNB 5CSNA 1DJGA 1S3PA 1JWDA 1B7TY 4Q04A 1R6PA 2KDHA 1W7JB 2LVKA 4I5LB 2JNXA 3VRPA 3BOWA 1UP5A 4PE4A 3SG5A 2CCMA 2LHLA 2M3WA 1A4PA 2LC5A 1SK6D 1AUIB 4YBHB 2I2RE 4NQGA 2WCBA 2BECA 3VROA 1Y1UA 1GJYA 1KQMB 2HETA 1CFFA 3FWBA 1A2XA 1PVBA 2M7LA 3CGAA 1F55A 4GNKB 1SNLA 3I5FB 2LMVA 1KQMC 3EK4A 3I5FC 4XYNA 2BCBA 2IS9A 1QV1A 2KBMA 4PHNA 2HQ8A 4GGNA 1C07A 3WNXB 1N0YA 1ZFSA 2FCDA 1YRUB 2FCEA 1KFXS 1RJVA 1FBVA 1MWNA 4L9MA 5AFPA 4R1EA 2NCPA 1J7QA 2F3YA 2PVBA 4PE1A 3C1VA 3SIBA 1ZMZA 1VRKA 1L2OB 4ZCUA 4MZLA 2JNFA 1DJYA 2L5XB 2MA2A 4N5XA 1AHRA 2H61C 1OE9B 1B7TZ 1S36A 1DVIA 2ZN8A 3DF0A 2F33A 4MRYA 1XFZO 3SIAA 2ISDA 3DVMA 4XJKB 2LV7A 2KAYA 2L4IA 1A03A 1YRTB 1K94A 1SCVA 2KI6D 1BODA 4PALA 2K2AA 1X02A 1QX5B 4BY5A 2PMYA 4YRUA 2M8UA 1BMOA 2JXCA 5DKQA 2M9GA 5HLVA 3O4YA 3GK2A 1F71A 4QJ4B 1IRJA 1B8CA 2LP2A 1YVHA 1G4YR 1JFJA 4MN0A 2L4HA 2JTZA 4MZKA 5HLOA 3VRNA 4OCIA 5CPVA 2OTGB 1NX1A 2KHNA 3JTDC 4ORCB 1DJXA 2F8PA 5DKRA 2K7DA 2I94A 2OTGC 1FPWA 4ETOA 1JUOA 2JWWA 2LUXA 2SCPA 1OMDA 4OR9B 2NCOA 1MF8B 2EGDA 2M29A 1F70A 1XK4C 1A75B 3I5IB 1OOJA 2QACA 2M0RA 1KFUS 1QXPA 1S6JA 2KYCA 1QATA 2TN4A 3CS1A 4AQIA 2BL0C 1MXEA 4MLWA 4P5OE 1UUSA 4F0ZB 3GOFA 3K21A 3I5GB 1BF5A 3NSOA 3MSEB 4P2YB 2K8MB 1EL4A 3M0WA 4M2QA 1C7VA 3I5GC 1MXLC 4UPGA 1IWQA 3CR5X 3OX6A 5F6TA 2KI4B 2LHIA 3TS5B 1W7IB 1UURA 1CLMA 2K7CA 3OB2B 2LVVA 1MR8A 2ZKMX 1XYDA 5AERA 1AK8A 1BOCA 1CDPA 2KI4C 3SJSA 3TS5C 1BR1B 1F4QA 3RM1A 1H4BA 2BCXA 1ZOTB 3PLFB 4MZJA 3OHMB 1BLQA 2M1KB 3AKBA 4MSPA 3DD4A 1TNPA 1FI6A 2FOTA 1ALVA 1QS7A 1RFJA 4C0KA 1B1GA 3CWGA 2KGBC 3KHEA 1CMGA 5I2QA 1J55A 1Y1AA 2RGIA 5GQQC 1NX0A 2M7NA 1EG4A 3TZ1A 5AEQA 1XFYO 3VGOA 5CSIA 1LVCD 5HKZA 1EH2A 1WLMA 1LINA 2LMTA 2KFFA 1CFCA 1PVAA 2P6BB 4GBAA 1K9KA 2WORA 3EK7A 1DF0B 3FWCA 3KF9A 3PSRA 1J7OA 1NSHA 2PASA 1XO5A 2F2PA 1HQVA 2K2FA 5ER5A 5G08A 1SY9A 1B8RA 3FS7A 3SG2A 4PE0A 1AJ4A 4CLNA 3D0YB 3JVTB 1RROA 3LCPC 5CSJA 1WRLA 3CTNA 2H61A 2FJUB 3A8RA 4FQOA 3JVTC 4I5KA 1RTP1 4C0LA 5ER4X 1CFDA 1SYMA 2MLFC 1QIVA 2O60A 5I2LA 1XFWO 1JC2A 1OMVA 1TNXA 4HREE 1S5GY 1F8HA 1HT9A 1N65A 2I7AA 2MAZA 3CR2A 1GGWA 2LP3A 4HRHA 2EC6B 1J7PA 4DRWA 1ZACA 4YI9A 4XJKA 2K7OA 1DMOA 1FW4A 4PDZA 1BR4B 2AMIA 1Y6WA 1XFUO 1YURA 2BBMA 2JXLA 3CLNA 5KU1A 3EVUA 5JOLA 1BJFA 4QJ3B 1L7ZA 1YUSA 5AANA 1IQ3A 4YGCB 1L2OC 1KK7Y 2I18A 3O6BA 1QLSA 2OS8B 2EHBA 4D1EA 1IQ5A 3CR4X 2LM5A 3DVKA 1XK4A 3EKHA 3H4SE 3TUYB 2OS8C 4AQJA 2JOJA 2Y1NA 4N1FA 1UHHA 4PHJA 1ZUZA 3TUYC 1A75A 1Q80A 1C7WA 1YX7A 2JC2A 3I5HB 3BXKA 1NPQA 1KSMA 1JBAA 5AXIA 2BKIB 1E8AA 1RECA 1QX7A 1S5GZ 1GQMA 2BE4A 1DJWA 1PALA 1UWOA 2E30A 1KFUL 1CFPA 2A4JA 3DVEA 1KCYA 4WQ2A 2D8NA 1B47A 1SPYA 1U5IB 1YUTA 2L51A 1TN4A 3PM8A 5KTYA 2G2BA 2JULA 1OZSA 3BQ3A 4MRXA 2WCFA 2PALA 1IKUA 1S26D 3PN7B 2Y1MA 2LAPA 1CLLA 1QVIY 1AP4A 1DGUA 2KAXA 4AOMA 3NSIA 5TNCA 2LLUA 4ORAB 1SW8A 1M63B 5I2OA 1SL7A 4USLA 2GGZA 1CLBA 1K9UA 2L50A 1DGVA 5K89A 1NX3A 3SG7A 4I5NB 1KK7Z 2KSPA 1K8UA 1DJIA 1OQPA 1S1EA 4DUQA 1DTLA 1SL8A 1CTRA 3I5IC 2Y4QA 1B8LA 3D10A 1IH0A 3BYAA 1CKKA 5DKNA 4GGFC 1DF0A 1F4OA 2KBIA 3EVRA 4DIRA 4WRIA 4A4BA 1NYAA 1SRAA 4C0JA 1J7RA 2LNKA 2KYFA 1B9AA 2VRGA 3BUMB 3BUOB 2Q91A 1DT7B 5HYDA 2ZNDA 3D0YA 4YI8A 4WQ3A 2JRFA 2K61A 2WC8A 2V53A 1CMFA 5D7FA 5D69A 1QVIZ 4YGBB 3OP0A 1SL9A 1H8BA 3KEVA 2JU0A 1ODBA 3PALA 1A29A 3NSKA 1Y0VH 4JQ0D 2M97A 1KWOB 1ALWA 1RK9A 3IF7A 1KK8B 3ZNIA 1JSAA 2ZRSA 4HSZA 1AJ5A 1KWOC 2AAOA 4ORBB 2E6WA 1JF0A 1KK8C 2JT0A 3AAKA 2KQYA 1SR6B 2WOSA 2O5GA 2K0JA 3EVVA 1YTZC 3GK4X 1K96A 3WHUB 1JFKA 2JQ6A 1SR6C 1OMRA 1YVLA 1PSBA 1JF2A 1LA0A 1KFXL 1N2DA 4FTGA 1IJ6A 4JPZB 1TIZA 1G8IA 1TCOB 4YGAA 1TNQA 2NLNA 2GV5A 3ICBA 1K95A 2F3ZA 3TDUA 1NIWA 1OSAA 4CPVA 3LL8B 2F2OA 3O78A 4TNCA 4ICBA 4A4CA 1XVJA 4CFQA 2LUCA 4YGEB 4M2PA 2BBNA 1KQVA 2WCEA 2JZIA 2ZRTA 2EC6C 2ZN9A 3PATA 1PRWA 1V1FA 4NDCA 5B8IB 2KGRA 1CB1A 1NUBA 1MHOA 2CTNA 3NXAA 1QTXA 3IQQA 1QV0A 2KQ6A 1S6IA 2LVIA 3WHTB 1U5IA 3IQOA 1OZOA 1LXFC 1FI5A 1QASA 1SBJA 1K9PA 3SG6A 2COLB 1NP8A 3E3RA 2LMUA 2OPOA 2BE6A 2SASA 3AAJA 3KO0A 5J3XA 1WRKA 3ZWHA 4N1GA 4CFRA 1V1GA 2PSRA 4YGDB 3RLZA 1QIWA 1SCMB 2MHHA 3EKJA 1DJHA 5I8NA 1UHKA 1SCMC 3LLEA 1NCZA 1S6CA 3WXAA 1WLZA 2L2EA 3AKAA 4DCKA 1NX2A 2JTTA 1CM1A 3GK1A 2KOTA 1CM4A 4OV2A 3QRXA 3I5HC 4GAOA 4MVFA 1NCXA 1R2UA 1J1EA 2GGMA 1CDLA 4GGFA 1EG3A 3BOWB 1MQ1A 1QX2A 4NDBA 2R2IA 5CSFA 2LE9B 1WRZA 4GPLB 3OX5A 1PK0D 3CZTX 1SMGA 1XFVO 2WNDA 1K90D 4DS7A 1J1DA 1TOPA 2L0PA 4BY4A 2G9BA 1G33A 1XA5A 1M45A 2LVJA 2KFGA 1EXRA 3PN7C 4PCWA 3A4UB 5BPJA 1CDMA 1TNWA 2JPTA 1BU3A 2B1UA 2Y5IA 2JT8A 2BCAA 2KAVA 3HCMA 1IG5A 4PE7A 5KSZA 4CIDA 5HKYA 4M2OA 4GFTA 4MBEA 3BUWB 4QJ5B 2HPSA 4U8DA 1AVSA 4I5JA 3JTDB 3NSLA 1MUXA 2M49B 1RWYA 1XFXO 2H2KA 1PSRA 1WDCB 1Y1XA 2ZNEA 5HKWA 3SG4A 1QJTA 1QLKA 2KNEA 1FF1A 1M31A 1YUUA 1WDCC 3DF0B 4OKHA 2AUCA 2K7BA 2PRUA 1WY9A 3PFVA 1UHIA 3TDIA 2CBLA 4ZCVA 2HF5A 4MEWA 3DVJA 4E68A 3LK1A 1PULA 2BKHB 2BL0B 1GGZA 1SKTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JWQ A;  2CXJ A;  4HRG A;  2ZFD A;  1NWD A;  3F45 A;  1M46 A;  2MBX A;  5FYX A;  1EJ3 A;  2LCP A;  2Q4U A;  1B4C A;  3KPX A;  3TDZ A;  2NZ0 A;  5JJG A;  1IGV A;  1UHN A;  2MJW B;  1YX8 A;  3HX4 A;  3O2P A;  1CNP A;  4PHK A;  1DJZ A;  1IJ5 A;  2LLT A;  3EK8 A;  2HQW A;  3VRQ A;  4GUK A;  3OB1 B;  1KSO A;  1TRF A;  4PHM A;  3FIA A;  2JT3 A;  4IL1 A;  1LKJ A;  1LA3 A;  1TCF A;  2QPT A;  1K2H A;  2MLE C;  2LAN A;  4OVN F;  3SG3 A;  2KFH A;  3VRR A;  2NXQ A;  5IBW A;  2LLS A;  1BT6 A;  1M39 A;  1YR5 A;  1BG1 A;  3BUX B;  2DOQ A;  1F54 A;  1D1O A;  2CT9 A;  1NCY A;  2CNP A;  5PAL A;  2M1U A;  2L98 A;  1K93 D;  1CDN A;  4NDD A;  2KI6 C;  3LK0 A;  1TTX A;  2MRD A;  1UHJ A;  3BUN B;  5CSN A;  1DJG A;  1S3P A;  1JWD A;  1B7T Y;  4Q04 A;  1R6P A;  2KDH A;  1W7J B;  2LVK A;  4I5L B;  2JNX A;  3VRP A;  3BOW A;  1UP5 A;  4PE4 A;  3SG5 A;  2CCM A;  2LHL A;  2M3W A;  1A4P A;  2LC5 A;  1SK6 D;  1AUI B;  4YBH B;  2I2R E;  4NQG A;  2WCB A;  2BEC A;  3VRO A;  1Y1U A;  1GJY A;  1KQM B;  2HET A;  1CFF A;  3FWB A;  1A2X A;  1PVB A;  2M7L A;  3CGA A;  1F55 A;  4GNK B;  1SNL A;  3I5F B;  2LMV A;  1KQM C;  3EK4 A;  3I5F C;  4XYN A;  2BCB A;  2IS9 A;  1QV1 A;  2KBM A;  4PHN A;  2HQ8 A;  4GGN A;  1C07 A;  3WNX B;  1N0Y A;  1ZFS A;  2FCD A;  1YRU B;  2FCE A;  1KFX S;  1RJV A;  1FBV A;  1MWN A;  4L9M A;  5AFP A;  4R1E A;  2NCP A;  1J7Q A;  2F3Y A;  2PVB A;  4PE1 A;  3C1V A;  3SIB A;  1ZMZ A;  1VRK A;  1L2O B;  4ZCU A;  4MZL A;  2JNF A;  1DJY A;  2L5X B;  2MA2 A;  4N5X A;  1AHR A;  2H61 C;  1OE9 B;  1B7T Z;  1S36 A;  1DVI A;  2ZN8 A;  3DF0 A;  2F33 A;  4MRY A;  1XFZ O;  3SIA A;  2ISD A;  3DVM A;  4XJK B;  2LV7 A;  2KAY A;  2L4I A;  1A03 A;  1YRT B;  1K94 A;  1SCV A;  2KI6 D;  1BOD A;  4PAL A;  2K2A A;  1X02 A;  1QX5 B;  4BY5 A;  2PMY A;  4YRU A;  2M8U A;  1BMO A;  2JXC A;  5DKQ A;  2M9G A;  5HLV A;  3O4Y A;  3GK2 A;  1F71 A;  4QJ4 B;  1IRJ A;  1B8C A;  2LP2 A;  1YVH A;  1G4Y R;  1JFJ A;  4MN0 A;  2L4H A;  2JTZ A;  4MZK A;  5HLO A;  3VRN A;  4OCI A;  5CPV A;  2OTG B;  1NX1 A;  2KHN A;  3JTD C;  4ORC B;  1DJX A;  2F8P A;  5DKR A;  2K7D A;  2I94 A;  2OTG C;  1FPW A;  4ETO A;  1JUO A;  2JWW A;  2LUX A;  2SCP A;  1OMD A;  4OR9 B;  2NCO A;  1MF8 B;  2EGD A;  2M29 A;  1F70 A;  1XK4 C;  1A75 B;  3I5I B;  1OOJ A;  2QAC A;  2M0R A;  1KFU S;  1QXP A;  1S6J A;  2KYC A;  1QAT A;  2TN4 A;  3CS1 A;  4AQI A;  2BL0 C;  1MXE A;  4MLW A;  4P5O E;  1UUS A;  4F0Z B;  3GOF A;  3K21 A;  3I5G B;  1BF5 A;  3NSO A;  3MSE B;  4P2Y B;  2K8M B;  1EL4 A;  3M0W A;  4M2Q A;  1C7V A;  3I5G C;  1MXL C;  4UPG A;  1IWQ A;  3CR5 X;  3OX6 A;  5F6T A;  2KI4 B;  2LHI A;  3TS5 B;  1W7I B;  1UUR A;  1CLM A;  2K7C A;  3OB2 B;  2LVV A;  1MR8 A;  2ZKM X;  1XYD A;  5AER A;  1AK8 A;  1BOC A;  1CDP A;  2KI4 C;  3SJS A;  3TS5 C;  1BR1 B;  1F4Q A;  3RM1 A;  1H4B A;  2BCX A;  1ZOT B;  3PLF B;  4MZJ A;  3OHM B;  1BLQ A;  2M1K B;  3AKB A;  4MSP A;  3DD4 A;  1TNP A;  1FI6 A;  2FOT A;  1ALV A;  1QS7 A;  1RFJ A;  4C0K A;  1B1G A;  3CWG A;  2KGB C;  3KHE A;  1CMG A;  5I2Q A;  1J55 A;  1Y1A A;  2RGI A;  5GQQ C;  1NX0 A;  2M7N A;  1EG4 A;  3TZ1 A;  5AEQ A;  1XFY O;  3VGO A;  5CSI A;  1LVC D;  5HKZ A;  1EH2 A;  1WLM A;  1LIN A;  2LMT A;  2KFF A;  1CFC A;  1PVA A;  2P6B B;  4GBA A;  1K9K A;  2WOR A;  3EK7 A;  1DF0 B;  3FWC A;  3KF9 A;  3PSR A;  1J7O A;  1NSH A;  2PAS A;  1XO5 A;  2F2P A;  1HQV A;  2K2F A;  5ER5 A;  5G08 A;  1SY9 A;  1B8R A;  3FS7 A;  3SG2 A;  4PE0 A;  1AJ4 A;  4CLN A;  3D0Y B;  3JVT B;  1RRO A;  3LCP C;  5CSJ A;  1WRL A;  3CTN A;  2H61 A;  2FJU B;  3A8R A;  4FQO A;  3JVT C;  4I5K A;  1RTP 1;  4C0L A;  5ER4 X;  1CFD A;  1SYM A;  2MLF C;  1QIV A;  2O60 A;  5I2L A;  1XFW O;  1JC2 A;  1OMV A;  1TNX A;  4HRE E;  1S5G Y;  1F8H A;  1HT9 A;  1N65 A;  2I7A A;  2MAZ A;  3CR2 A;  1GGW A;  2LP3 A;  4HRH A;  2EC6 B;  1J7P A;  4DRW A;  1ZAC A;  4YI9 A;  4XJK A;  2K7O A;  1DMO A;  1FW4 A;  4PDZ A;  1BR4 B;  2AMI A;  1Y6W A;  1XFU O;  1YUR A;  2BBM A;  2JXL A;  3CLN A;  5KU1 A;  3EVU A;  5JOL A;  1BJF A;  4QJ3 B;  1L7Z A;  1YUS A;  5AAN A;  1IQ3 A;  4YGC B;  1L2O C;  1KK7 Y;  2I18 A;  3O6B A;  1QLS A;  2OS8 B;  2EHB A;  4D1E A;  1IQ5 A;  3CR4 X;  2LM5 A;  3DVK A;  1XK4 A;  3EKH A;  3H4S E;  3TUY B;  2OS8 C;  4AQJ A;  2JOJ A;  2Y1N A;  4N1F A;  1UHH A;  4PHJ A;  1ZUZ A;  3TUY C;  1A75 A;  1Q80 A;  1C7W A;  1YX7 A;  2JC2 A;  3I5H B;  3BXK A;  1NPQ A;  1KSM A;  1JBA A;  5AXI A;  2BKI B;  1E8A A;  1REC A;  1QX7 A;  1S5G Z;  1GQM A;  2BE4 A;  1DJW A;  1PAL A;  1UWO A;  2E30 A;  1KFU L;  1CFP A;  2A4J A;  3DVE A;  1KCY A;  4WQ2 A;  2D8N A;  1B47 A;  1SPY A;  1U5I B;  1YUT A;  2L51 A;  1TN4 A;  3PM8 A;  5KTY A;  2G2B A;  2JUL A;  1OZS A;  3BQ3 A;  4MRX A;  2WCF A;  2PAL A;  1IKU A;  1S26 D;  3PN7 B;  2Y1M A;  2LAP A;  1CLL A;  1QVI Y;  1AP4 A;  1DGU A;  2KAX A;  4AOM A;  3NSI A;  5TNC A;  2LLU A;  4ORA B;  1SW8 A;  1M63 B;  5I2O A;  1SL7 A;  4USL A;  2GGZ A;  1CLB A;  1K9U A;  2L50 A;  1DGV A;  5K89 A;  1NX3 A;  3SG7 A;  4I5N B;  1KK7 Z;  2KSP A;  1K8U A;  1DJI A;  1OQP A;  1S1E A;  4DUQ A;  1DTL A;  1SL8 A;  1CTR A;  3I5I C;  2Y4Q A;  1B8L A;  3D10 A;  1IH0 A;  3BYA A;  1CKK A;  5DKN A;  4GGF C;  1DF0 A;  1F4O A;  2KBI A;  3EVR A;  4DIR A;  4WRI A;  4A4B A;  1NYA A;  1SRA A;  4C0J A;  1J7R A;  2LNK A;  2KYF A;  1B9A A;  2VRG A;  3BUM B;  3BUO B;  2Q91 A;  1DT7 B;  5HYD A;  2ZND A;  3D0Y A;  4YI8 A;  4WQ3 A;  2JRF A;  2K61 A;  2WC8 A;  2V53 A;  1CMF A;  5D7F A;  5D69 A;  1QVI Z;  4YGB B;  3OP0 A;  1SL9 A;  1H8B A;  3KEV A;  2JU0 A;  1ODB A;  3PAL A;  1A29 A;  3NSK A;  1Y0V H;  4JQ0 D;  2M97 A;  1KWO B;  1ALW A;  1RK9 A;  3IF7 A;  1KK8 B;  3ZNI A;  1JSA A;  2ZRS A;  4HSZ A;  1AJ5 A;  1KWO C;  2AAO A;  4ORB B;  2E6W A;  1JF0 A;  1KK8 C;  2JT0 A;  3AAK A;  2KQY A;  1SR6 B;  2WOS A;  2O5G A;  2K0J A;  3EVV A;  1YTZ C;  3GK4 X;  1K96 A;  3WHU B;  1JFK A;  2JQ6 A;  1SR6 C;  1OMR A;  1YVL A;  1PSB A;  1JF2 A;  1LA0 A;  1KFX L;  1N2D A;  4FTG A;  1IJ6 A;  4JPZ B;  1TIZ A;  1G8I A;  1TCO B;  4YGA A;  1TNQ A;  2NLN A;  2GV5 A;  3ICB A;  1K95 A;  2F3Z A;  3TDU A;  1NIW A;  1OSA A;  4CPV A;  3LL8 B;  2F2O A;  3O78 A;  4TNC A;  4ICB A;  4A4C A;  1XVJ A;  4CFQ A;  2LUC A;  4YGE B;  4M2P A;  2BBN A;  1KQV A;  2WCE A;  2JZI A;  2ZRT A;  2EC6 C;  2ZN9 A;  3PAT A;  1PRW A;  1V1F A;  4NDC A;  5B8I B;  2KGR A;  1CB1 A;  1NUB A;  1MHO A;  2CTN A;  3NXA A;  1QTX A;  3IQQ A;  1QV0 A;  2KQ6 A;  1S6I A;  2LVI A;  3WHT B;  1U5I A;  3IQO A;  1OZO A;  1LXF C;  1FI5 A;  1QAS A;  1SBJ A;  1K9P A;  3SG6 A;  2COL B;  1NP8 A;  3E3R A;  2LMU A;  2OPO A;  2BE6 A;  2SAS A;  3AAJ A;  3KO0 A;  5J3X A;  1WRK A;  3ZWH A;  4N1G A;  4CFR A;  1V1G A;  2PSR A;  4YGD B;  3RLZ A;  1QIW A;  1SCM B;  2MHH A;  3EKJ A;  1DJH A;  5I8N A;  1UHK A;  1SCM C;  3LLE A;  1NCZ A;  1S6C A;  3WXA A;  1WLZ A;  2L2E A;  3AKA A;  4DCK A;  1NX2 A;  2JTT A;  1CM1 A;  3GK1 A;  2KOT A;  1CM4 A;  4OV2 A;  3QRX A;  3I5H C;  4GAO A;  4MVF A;  1NCX A;  1R2U A;  1J1E A;  2GGM A;  1CDL A;  4GGF A;  1EG3 A;  3BOW B;  1MQ1 A;  1QX2 A;  4NDB A;  2R2I A;  5CSF A;  2LE9 B;  1WRZ A;  4GPL B;  3OX5 A;  1PK0 D;  3CZT X;  1SMG A;  1XFV O;  2WND A;  1K90 D;  4DS7 A;  1J1D A;  1TOP A;  2L0P A;  4BY4 A;  2G9B A;  1G33 A;  1XA5 A;  1M45 A;  2LVJ A;  2KFG A;  1EXR A;  3PN7 C;  4PCW A;  3A4U B;  5BPJ A;  1CDM A;  1TNW A;  2JPT A;  1BU3 A;  2B1U A;  2Y5I A;  2JT8 A;  2BCA A;  2KAV A;  3HCM A;  1IG5 A;  4PE7 A;  5KSZ A;  4CID A;  5HKY A;  4M2O A;  4GFT A;  4MBE A;  3BUW B;  4QJ5 B;  2HPS A;  4U8D A;  1AVS A;  4I5J A;  3JTD B;  3NSL A;  1MUX A;  2M49 B;  1RWY A;  1XFX O;  2H2K A;  1PSR A;  1WDC B;  1Y1X A;  2ZNE A;  5HKW A;  3SG4 A;  1QJT A;  1QLK A;  2KNE A;  1FF1 A;  1M31 A;  1YUU A;  1WDC C;  3DF0 B;  4OKH A;  2AUC A;  2K7B A;  2PRU A;  1WY9 A;  3PFV A;  1UHI A;  3TDI A;  2CBL A;  4ZCV A;  2HF5 A;  4MEW A;  3DVJ A;  4E68 A;  3LK1 A;  1PUL A;  2BKH B;  2BL0 B;  1GGZ A;  1SKT A; 
#chains in the Genus database with same CATH topology
 4JWQ A;  2CXJ A;  2WCL A;  2ZFD A;  4HRG A;  1NWD A;  3F45 A;  1M46 A;  2MBX A;  5FYX A;  1EJ3 A;  2LCP A;  2Q4U A;  2BAP A;  3KPX A;  3TDZ A;  1B4C A;  2NZ0 A;  5JJG A;  4INW A;  1IGV A;  1UHN A;  2MJW B;  1OOG A;  1YX8 A;  3HX4 A;  3O2P A;  1CNP A;  4PHK A;  1Z4H A;  1DJZ A;  1IJ5 A;  2LLT A;  3EK8 A;  2HQW A;  3VRQ A;  4GUK A;  3OB1 B;  1KSO A;  1TRF A;  4PHM A;  3FIA A;  2JT3 A;  4IL1 A;  1LKJ A;  1LA3 A;  1TCF A;  2QPT A;  4JKT A;  1K2H A;  2MLE C;  2LAN A;  4OVN F;  3SG3 A;  2KFH A;  3OGN A;  2NXQ A;  3VRR A;  5IBW A;  2LLS A;  1BT6 A;  1M39 A;  1YR5 A;  1BG1 A;  2WCJ A;  3BUX B;  2DOQ A;  1F54 A;  3CZ0 A;  1D1O A;  2CT9 A;  1NCY A;  2CNP A;  5PAL A;  3DY9 A;  2M1U A;  2L98 A;  1K93 D;  1CDN A;  4NDD A;  2KI6 C;  3LK0 A;  1TTX A;  2MRD A;  1UHJ A;  3BUN B;  3S0D A;  5CSN A;  1DJG A;  1S3P A;  1JWD A;  1B7T Y;  4Q04 A;  1R6P A;  2KDH A;  3N7H A;  5FI7 A;  1W7J B;  1ORG A;  2LVK A;  4I5L B;  2JNX A;  3VRP A;  3BOW A;  1UP5 A;  4PE4 A;  3SG5 A;  1C3Z A;  2CCM A;  2LHL A;  2M3W A;  1A4P A;  2LC5 A;  1SK6 D;  1Z2C B;  1AUI B;  4YBH B;  2I2R E;  4NQG A;  2WC6 A;  2WCK A;  2WCB A;  2BEC A;  3VRO A;  1Y1U A;  1GJY A;  1KQM B;  2HET A;  1CFF A;  3FWB A;  1A2X A;  1PVB A;  2M7L A;  3CGA A;  3D73 A;  4GNK B;  1SNL A;  2K60 A;  3I5F B;  2LMV A;  1KQM C;  3EK4 A;  3I5F C;  4XYN A;  2BCB A;  2IS9 A;  1QV1 A;  2KBM A;  4PHN A;  2HQ8 A;  4GGN A;  1C07 A;  3WNX B;  1N0Y A;  3S0G A;  1ZFS A;  2FCD A;  3D75 A;  1YRU B;  2FCE A;  3SS4 A;  1KFX S;  1RJV A;  1FBV A;  1MWN A;  4L9M A;  5AFP A;  4R1E A;  2NCP A;  1J7Q A;  2F3Y A;  2PVB A;  4PE1 A;  3C1V A;  3SIB A;  1ZMZ A;  1VRK A;  1L2O B;  4ZCU A;  4MZL A;  2JNF A;  2ERB A;  1DJY A;  2L5X B;  2MA2 A;  4N5X A;  2H8V A;  1AHR A;  2H61 C;  1IIO A;  1OE9 B;  1B7T Z;  1S36 A;  1DVI A;  2ZN8 A;  3DF0 A;  2F33 A;  4MRY A;  5I94 A;  1XFZ O;  3SIA A;  2ISD A;  3DVM A;  4XJK B;  2LV7 A;  2KAY A;  2L4I A;  1A03 A;  1YRT B;  1K94 A;  1SCV A;  2KI6 D;  3CZ1 A;  3PJI A;  1BOD A;  4PAL A;  2K2A A;  1X02 A;  1QX5 B;  4BY5 A;  2PMY A;  4YRU A;  2M8U A;  3S0F A;  1BMO A;  2JXC A;  5DKQ A;  2M9G A;  5HLV A;  3O4Y A;  3R72 A;  3GK2 A;  1F71 A;  4QJ4 B;  1IRJ A;  1B8C A;  2LP2 A;  1YVH A;  1G4Y R;  2QEB A;  1JFJ A;  4MN0 A;  2L4H A;  2JTZ A;  4MZK A;  5HLO A;  3VRN A;  4OCI A;  5CPV A;  2OTG B;  1NX1 A;  2KHN A;  3JTD C;  4ORC B;  1DJX A;  2F8P A;  5DKR A;  2K7D A;  2I94 A;  2OTG C;  1DEK A;  1FPW A;  4ETO A;  1JUO A;  2JWW A;  2LUX A;  2SCP A;  1OMD A;  3D74 A;  4OR9 B;  2NCO A;  1MF8 B;  2EGD A;  2M29 A;  4INX A;  1XK4 C;  1F70 A;  1A75 B;  3I5I B;  1OOJ A;  2QAC A;  2M0R A;  1KFU S;  1QXP A;  1S6J A;  2KYC A;  1QAT A;  2TN4 A;  3CS1 A;  3K1E A;  4AQI A;  2BL0 C;  1MXE A;  4MLW A;  4P5O E;  1UUS A;  4F0Z B;  3GOF A;  3K21 A;  3I5G B;  3CYZ A;  1BF5 A;  3B86 A;  3NSO A;  3MSE B;  4P2Y B;  2K8M B;  1EL4 A;  3DZT A;  3M0W A;  4M2Q A;  1C7V A;  3I5G C;  1MXL C;  3S0E A;  4UPG A;  1IWQ A;  3CR5 X;  3OX6 A;  5F6T A;  2KI4 B;  2LHI A;  3TS5 B;  1W7I B;  1UUR A;  1CLM A;  2K7C A;  3NHT A;  3OB2 B;  2LVV A;  1MR8 A;  2ZKM X;  1XYD A;  5AER A;  1AK8 A;  1BOC A;  1CDP A;  2KI4 C;  3SJS A;  3L4A A;  3TS5 C;  1BR1 B;  1F4Q A;  4IJ7 A;  2YGU A;  3RM1 A;  1H4B A;  3CDN A;  2BCX A;  1ZOT B;  3PLF B;  4MZJ A;  3OHM B;  1BLQ A;  1SSE B;  2M1K B;  3AKB A;  4MSP A;  3DD4 A;  1TNP A;  1FI6 A;  2FOT A;  1ALV A;  1QS7 A;  1RFJ A;  4C0K A;  1B1G A;  3CWG A;  2KGB C;  3KHE A;  1CMG A;  5I2Q A;  1J55 A;  1Y1A A;  2RGI A;  5GQQ C;  1NX0 A;  2M7N A;  1EG4 A;  3TZ1 A;  5AEQ A;  1XFY O;  3VGO A;  5CSI A;  1LVC D;  5HKZ A;  1EH2 A;  1WLM A;  1LIN A;  2LMT A;  2KFF A;  1CFC A;  1PVA A;  2P6B B;  4GBA A;  1K9K A;  2QEV A;  2WOR A;  1OOH A;  1DF0 B;  1QWV A;  2JPO A;  2WCH A;  3EK7 A;  3FWC A;  3KF9 A;  3PSR A;  1J7O A;  3BJH A;  1NSH A;  2BNX A;  2PAS A;  1XO5 A;  2F2P A;  1HQV A;  2K2F A;  5ER5 A;  5G08 A;  1SY9 A;  1B8R A;  3FS7 A;  4KYN A;  3SG2 A;  4PE0 A;  1AJ4 A;  4CLN A;  1F55 A;  3D0Y B;  3JVT B;  1RRO A;  3LCP C;  5CSJ A;  3CAB A;  1WRL A;  3CTN A;  3O4X A;  2H61 A;  2FJU B;  3A8R A;  3CZ2 A;  4FQO A;  3JVT C;  4I5K A;  1RTP 1;  4C0L A;  2L2C A;  3B6X A;  5ER4 X;  1CFD A;  1SYM A;  2MLF C;  3SG4 A;  1QIV A;  2O60 A;  5I2L A;  1C3Y A;  1XFW O;  1JC2 A;  1OMV A;  1TNX A;  4HRE E;  1S5G Y;  1F8H A;  1HT9 A;  1N65 A;  2I7A A;  2MAZ A;  3CR2 A;  1GGW A;  2LP3 A;  4HRH A;  2EC6 B;  3IVT A;  1J7P A;  4DRW A;  3BFB A;  1ZAC A;  4YI9 A;  3OBV A;  4XJK A;  2K7O A;  5EL2 A;  1DMO A;  1FW4 A;  4PDZ A;  2PQL A;  1BR4 B;  2AMI A;  1Y6W A;  1XFU O;  4FQT A;  1YUR A;  2BBM A;  2JXL A;  3CLN A;  5KU1 A;  3EVU A;  3D78 A;  5JOL A;  1BJF A;  2QEO A;  4QJ3 B;  1OOF A;  1L7Z A;  1YUS A;  5AAN A;  1IQ3 A;  4YGC B;  3Q8I A;  2KLE A;  1L2O C;  1KK7 Y;  2I18 A;  3O6B A;  1QLS A;  2OS8 B;  2EHB A;  4D1E A;  1IQ5 A;  2KLD A;  3CR4 X;  2LM5 A;  3DVK A;  3BFH A;  1XK4 A;  3EKH A;  3H4S E;  3TUY B;  2OS8 C;  4AQJ A;  2JOJ A;  2Y1N A;  3DYE A;  1UHH A;  4N1F A;  4PHJ A;  3UO9 A;  4PT1 A;  1ZUZ A;  3TUY C;  1A75 A;  1Q80 A;  1C7W A;  1YX7 A;  2JC2 A;  3I5H B;  3BXK A;  1NPQ A;  3V2L A;  1KSM A;  1JBA A;  5AXI A;  2BKI B;  1E8A A;  1REC A;  1QX7 A;  1S5G Z;  1P28 A;  1GQM A;  1DJW A;  2BE4 A;  1PAL A;  1UWO A;  2E30 A;  1KFU L;  1CFP A;  2A4J A;  3DVE A;  1KCY A;  4WQ2 A;  2D8N A;  1B47 A;  1SPY A;  1U5I B;  1YUT A;  2L51 A;  1TN4 A;  3PM8 A;  5KTY A;  2G2B A;  2JUL A;  1OZS A;  3BQ3 A;  4MRX A;  2WCF A;  2PAL A;  1IKU A;  1S26 D;  3PN7 B;  2Y1M A;  2LAP A;  1CLL A;  1QVI Y;  1AP4 A;  3S0B A;  1DGU A;  2KAX A;  4AOM A;  3D76 A;  3NSI A;  5TNC A;  2LLU A;  2PYQ A;  4ORA B;  1SW8 A;  1M63 B;  5I2O A;  1SL7 A;  4USL A;  2GGZ A;  1CLB A;  1K9U A;  2L50 A;  3B87 A;  1DGV A;  5K89 A;  1NX3 A;  3SG7 A;  3FE6 A;  4I5N B;  1KK7 Z;  2KSP A;  1DC1 A;  1K8U A;  1DJI A;  1OQP A;  1S1E A;  4DUQ A;  1DTL A;  1SL8 A;  1CTR A;  3I5I C;  3R1P A;  2Y4Q A;  1B8L A;  3D10 A;  1IH0 A;  3BYA A;  1CKK A;  5DKN A;  3L4L A;  4GGF C;  1DF0 A;  1F4O A;  2KBI A;  3EVR A;  4DIR A;  4WRI A;  4A4B A;  1NYA A;  1SRA A;  4C0J A;  1J7R A;  2LNK A;  2KYF A;  1B9A A;  2VRG A;  3BUM B;  3BUO B;  2Q91 A;  1DT7 B;  5HYD A;  2ZND A;  3D0Y A;  4YI8 A;  4WQ3 A;  2JRF A;  4OZD A;  2K61 A;  2WC8 A;  2V53 A;  1CMF A;  5D7F A;  5D69 A;  1QVI Z;  4YGB B;  3OP0 A;  1SL9 A;  1H8B A;  3KEV A;  2JU0 A;  1DQE A;  1ODB A;  3PAL A;  1A29 A;  3NSK A;  1TWO A;  1Y0V H;  4JQ0 D;  3L47 A;  2M97 A;  1KWO B;  1ALW A;  1RK9 A;  3IF7 A;  1KK8 B;  3ZNI A;  1JSA A;  2ZRS A;  4HSZ A;  1AJ5 A;  3R1V A;  1KWO C;  2AAO A;  4ORB B;  2E6W A;  1JF0 A;  1KK8 C;  2JT0 A;  3AAK A;  4F7F A;  3BFA A;  2KQY A;  1SR6 B;  2WOS A;  2O5G A;  5B8I B;  2K0J A;  3EVV A;  1YTZ C;  3GK4 X;  1K96 A;  3WHU B;  1JFK A;  1GM0 A;  2JQ6 A;  1SR6 C;  1OMR A;  1YVL A;  1PSB A;  1JF2 A;  1LA0 A;  1KFX L;  1N2D A;  4FTG A;  1IJ6 A;  4JPZ B;  1TIZ A;  1G8I A;  1TCO B;  4YGA A;  1TNQ A;  2NLN A;  5FI2 A;  2GV5 A;  3ICB A;  1K95 A;  2F3Z A;  3TDU A;  1NIW A;  1OSA A;  2QDI A;  2GTE A;  4CPV A;  3LL8 B;  2F2O A;  3O78 A;  4TNC A;  4ICB A;  2FJY A;  1XVJ A;  4A4C A;  4CFQ A;  2LUC A;  1W9Z A;  4YGE B;  4M2P A;  2BBN A;  1KQV A;  2WCE A;  2JZI A;  2ZRT A;  2EC6 C;  2ZN9 A;  3EG5 B;  1PRW A;  1V1F A;  3PAT A;  4NDC A;  1OOI X;  2KGR A;  1NUB A;  3B7A A;  1CB1 A;  3SS5 A;  1MHO A;  2WCM A;  1DEL A;  2CTN A;  3NXA A;  1QTX A;  3S0A A;  3IQQ A;  5DIC A;  1QV0 A;  2KQ6 A;  1S6I A;  2LVI A;  3WHT B;  1U5I A;  2QEH A;  1OZO A;  1LXF C;  3IQO A;  1QAS A;  1SBJ A;  3RZS A;  1FI5 A;  1K9P A;  3SG6 A;  2COL B;  1NP8 A;  3E3R A;  3FE9 A;  2LMU A;  2OPO A;  2BE6 A;  2SAS A;  3AAJ A;  3KO0 A;  5J3X A;  1WRK A;  3ZWH A;  4N1G A;  4CFR A;  1V1G A;  2PSR A;  4YGD B;  3RLZ A;  1QIW A;  1SCM B;  2MHH A;  3EKJ A;  1DJH A;  4JD9 A;  5I8N A;  1UHK A;  1SCM C;  2P71 A;  3LLE A;  1NCZ A;  1LS8 A;  1S6C A;  3WXA A;  5FI6 A;  1WLZ A;  2L2E A;  3VB1 A;  3AKA A;  4DCK A;  1NX2 A;  2JTT A;  1CM1 A;  3GK1 A;  2KOT A;  1CM4 A;  2WC5 A;  4OV2 A;  3D77 A;  3QRX A;  3I5H C;  4GAO A;  4MVF A;  1NCX A;  1R2U A;  1J1E A;  2GGM A;  1CDL A;  4GGF A;  5KSZ A;  1EG3 A;  3BOW B;  3UNW A;  3PM2 A;  1MQ1 A;  1QX2 A;  4NDB A;  3FE8 A;  2R2I A;  3B88 A;  5CSF A;  2LE9 B;  1WRZ A;  4GPL B;  3OX5 A;  1FF1 A;  1PK0 D;  3CZT X;  3NHI A;  1SMG A;  1XFV O;  2WND A;  1K90 D;  4DS7 A;  1J1D A;  1TOP A;  2L0P A;  4BY4 A;  2G9B A;  1G33 A;  1T14 A;  1XA5 A;  3SS3 A;  1M45 A;  2LVJ A;  2KFG A;  1EXR A;  3PN7 C;  4PCW A;  3A4U B;  5BPJ A;  1CDM A;  1TUJ A;  1TNW A;  2JPT A;  1BU3 A;  2B1U A;  2P70 A;  2JT8 A;  2BCA A;  2KAV A;  2Y5I A;  1IG5 A;  3HCM A;  4PE7 A;  4CID A;  5HKY A;  5D3O A;  4M2O A;  4GFT A;  4MBE A;  3BUW B;  1TUZ A;  4QJ5 B;  2HPS A;  4U8D A;  1AVS A;  4I5J A;  3JTD B;  3NSL A;  1MUX A;  2M49 B;  1RWY A;  1XFX O;  2H2K A;  1PSR A;  1WDC B;  1Y1X A;  2ZNE A;  3DXL A;  3QME A;  1QJT A;  1QLK A;  2KNE A;  2KPH A;  3R1O A;  5HKW A;  1M31 A;  1YUU A;  1XFR A;  1WDC C;  3DF0 B;  4OKH A;  2AUC A;  2K7B A;  2PRU A;  1WY9 A;  3PFV A;  1OW4 A;  1UHI A;  3TDI A;  5HL1 A;  2CBL A;  4ZCV A;  2HF5 A;  4MEW A;  3DVJ A;  4E68 A;  3LK1 A;  1PUL A;  2BKH B;  2BL0 B;  3NGV A;  1GGZ A;  1SKT A;  2L5Y A; 
#chains in the Genus database with same CATH homology
 4JWQ A;  2CXJ A;  4HRG A;  2ZFD A;  1NWD A;  3F45 A;  1M46 A;  2MBX A;  5FYX A;  1EJ3 A;  2LCP A;  2Q4U A;  1B4C A;  3KPX A;  3TDZ A;  2NZ0 A;  5JJG A;  1IGV A;  1UHN A;  2MJW B;  1YX8 A;  3HX4 A;  3O2P A;  1CNP A;  4PHK A;  1DJZ A;  1IJ5 A;  2LLT A;  3EK8 A;  2HQW A;  3VRQ A;  4GUK A;  3OB1 B;  1KSO A;  1TRF A;  4PHM A;  3FIA A;  2JT3 A;  4IL1 A;  1LKJ A;  1LA3 A;  1TCF A;  2QPT A;  1K2H A;  2MLE C;  2LAN A;  4OVN F;  3SG3 A;  2KFH A;  3VRR A;  2NXQ A;  5IBW A;  2LLS A;  1BT6 A;  1M39 A;  1YR5 A;  1BG1 A;  3BUX B;  2DOQ A;  1F54 A;  1D1O A;  2CT9 A;  1NCY A;  2CNP A;  5PAL A;  2M1U A;  2L98 A;  1K93 D;  1CDN A;  4NDD A;  2KI6 C;  3LK0 A;  1TTX A;  2MRD A;  1UHJ A;  3BUN B;  5CSN A;  1DJG A;  1S3P A;  1JWD A;  1B7T Y;  4Q04 A;  1R6P A;  2KDH A;  1W7J B;  2LVK A;  4I5L B;  2JNX A;  3VRP A;  3BOW A;  1UP5 A;  4PE4 A;  3SG5 A;  2CCM A;  2LHL A;  2M3W A;  1A4P A;  2LC5 A;  1SK6 D;  1AUI B;  4YBH B;  2I2R E;  4NQG A;  2WCB A;  2BEC A;  3VRO A;  1Y1U A;  1GJY A;  1KQM B;  2HET A;  1CFF A;  3FWB A;  1A2X A;  1PVB A;  2M7L A;  3CGA A;  1F55 A;  4GNK B;  1SNL A;  3I5F B;  2LMV A;  1KQM C;  3EK4 A;  3I5F C;  4XYN A;  2BCB A;  2IS9 A;  1QV1 A;  2KBM A;  4PHN A;  2HQ8 A;  4GGN A;  1C07 A;  3WNX B;  1N0Y A;  1ZFS A;  2FCD A;  1YRU B;  2FCE A;  1KFX S;  1RJV A;  1FBV A;  1MWN A;  4L9M A;  5AFP A;  4R1E A;  2NCP A;  1J7Q A;  2F3Y A;  2PVB A;  4PE1 A;  3C1V A;  3SIB A;  1ZMZ A;  1VRK A;  1L2O B;  4ZCU A;  4MZL A;  2JNF A;  1DJY A;  2L5X B;  2MA2 A;  4N5X A;  1AHR A;  2H61 C;  1OE9 B;  1B7T Z;  1S36 A;  1DVI A;  2ZN8 A;  3DF0 A;  2F33 A;  4MRY A;  1XFZ O;  3SIA A;  2ISD A;  3DVM A;  4XJK B;  2LV7 A;  2KAY A;  2L4I A;  1A03 A;  1YRT B;  1K94 A;  1SCV A;  2KI6 D;  1BOD A;  4PAL A;  2K2A A;  1X02 A;  1QX5 B;  4BY5 A;  2PMY A;  4YRU A;  2M8U A;  1BMO A;  2JXC A;  5DKQ A;  2M9G A;  5HLV A;  3O4Y A;  3GK2 A;  1F71 A;  4QJ4 B;  1IRJ A;  1B8C A;  2LP2 A;  1YVH A;  1G4Y R;  1JFJ A;  4MN0 A;  2L4H A;  2JTZ A;  4MZK A;  5HLO A;  3VRN A;  4OCI A;  5CPV A;  2OTG B;  1NX1 A;  2KHN A;  3JTD C;  4ORC B;  1DJX A;  2F8P A;  5DKR A;  2K7D A;  2I94 A;  2OTG C;  1FPW A;  4ETO A;  1JUO A;  2JWW A;  2LUX A;  2SCP A;  1OMD A;  4OR9 B;  2NCO A;  1MF8 B;  2EGD A;  2M29 A;  1F70 A;  1XK4 C;  1A75 B;  3I5I B;  1OOJ A;  2QAC A;  2M0R A;  1KFU S;  1QXP A;  1S6J A;  2KYC A;  1QAT A;  2TN4 A;  3CS1 A;  4AQI A;  2BL0 C;  1MXE A;  4MLW A;  4P5O E;  1UUS A;  4F0Z B;  3GOF A;  3K21 A;  3I5G B;  1BF5 A;  3NSO A;  3MSE B;  4P2Y B;  2K8M B;  1EL4 A;  3M0W A;  4M2Q A;  1C7V A;  3I5G C;  1MXL C;  4UPG A;  1IWQ A;  3CR5 X;  3OX6 A;  5F6T A;  2KI4 B;  2LHI A;  3TS5 B;  1W7I B;  1UUR A;  1CLM A;  2K7C A;  3OB2 B;  2LVV A;  1MR8 A;  2ZKM X;  1XYD A;  5AER A;  1AK8 A;  1BOC A;  1CDP A;  2KI4 C;  3SJS A;  3TS5 C;  1BR1 B;  1F4Q A;  3RM1 A;  1H4B A;  2BCX A;  1ZOT B;  3PLF B;  4MZJ A;  3OHM B;  1BLQ A;  2M1K B;  3AKB A;  4MSP A;  3DD4 A;  1TNP A;  1FI6 A;  2FOT A;  1ALV A;  1QS7 A;  1RFJ A;  4C0K A;  1B1G A;  3CWG A;  2KGB C;  3KHE A;  1CMG A;  5I2Q A;  1J55 A;  1Y1A A;  2RGI A;  5GQQ C;  1NX0 A;  2M7N A;  1EG4 A;  3TZ1 A;  5AEQ A;  1XFY O;  3VGO A;  5CSI A;  1LVC D;  5HKZ A;  1EH2 A;  1WLM A;  1LIN A;  2LMT A;  2KFF A;  1CFC A;  1PVA A;  2P6B B;  4GBA A;  1K9K A;  2WOR A;  3EK7 A;  1DF0 B;  3FWC A;  3KF9 A;  3PSR A;  1J7O A;  1NSH A;  2PAS A;  1XO5 A;  2F2P A;  1HQV A;  2K2F A;  5ER5 A;  5G08 A;  1SY9 A;  1B8R A;  3FS7 A;  3SG2 A;  4PE0 A;  1AJ4 A;  4CLN A;  3D0Y B;  3JVT B;  1RRO A;  3LCP C;  5CSJ A;  1WRL A;  3CTN A;  2H61 A;  2FJU B;  3A8R A;  4FQO A;  3JVT C;  4I5K A;  1RTP 1;  4C0L A;  5ER4 X;  1CFD A;  1SYM A;  2MLF C;  1QIV A;  2O60 A;  5I2L A;  1XFW O;  1JC2 A;  1OMV A;  1TNX A;  4HRE E;  1S5G Y;  1F8H A;  1HT9 A;  1N65 A;  2I7A A;  2MAZ A;  3CR2 A;  1GGW A;  2LP3 A;  4HRH A;  2EC6 B;  1J7P A;  4DRW A;  1ZAC A;  4YI9 A;  4XJK A;  2K7O A;  1DMO A;  1FW4 A;  4PDZ A;  1BR4 B;  2AMI A;  1Y6W A;  1XFU O;  1YUR A;  2BBM A;  2JXL A;  3CLN A;  5KU1 A;  3EVU A;  5JOL A;  1BJF A;  4QJ3 B;  1L7Z A;  1YUS A;  5AAN A;  1IQ3 A;  4YGC B;  1L2O C;  1KK7 Y;  2I18 A;  3O6B A;  1QLS A;  2OS8 B;  2EHB A;  4D1E A;  1IQ5 A;  3CR4 X;  2LM5 A;  3DVK A;  1XK4 A;  3EKH A;  3H4S E;  3TUY B;  2OS8 C;  4AQJ A;  2JOJ A;  2Y1N A;  4N1F A;  1UHH A;  4PHJ A;  1ZUZ A;  3TUY C;  1A75 A;  1Q80 A;  1C7W A;  1YX7 A;  2JC2 A;  3I5H B;  3BXK A;  1NPQ A;  1KSM A;  1JBA A;  5AXI A;  2BKI B;  1E8A A;  1REC A;  1QX7 A;  1S5G Z;  1GQM A;  2BE4 A;  1DJW A;  1PAL A;  1UWO A;  2E30 A;  1KFU L;  1CFP A;  2A4J A;  3DVE A;  1KCY A;  4WQ2 A;  2D8N A;  1B47 A;  1SPY A;  1U5I B;  1YUT A;  2L51 A;  1TN4 A;  3PM8 A;  5KTY A;  2G2B A;  2JUL A;  1OZS A;  3BQ3 A;  4MRX A;  2WCF A;  2PAL A;  1IKU A;  1S26 D;  3PN7 B;  2Y1M A;  2LAP A;  1CLL A;  1QVI Y;  1AP4 A;  1DGU A;  2KAX A;  4AOM A;  3NSI A;  5TNC A;  2LLU A;  4ORA B;  1SW8 A;  1M63 B;  5I2O A;  1SL7 A;  4USL A;  2GGZ A;  1CLB A;  1K9U A;  2L50 A;  1DGV A;  5K89 A;  1NX3 A;  3SG7 A;  4I5N B;  1KK7 Z;  2KSP A;  1K8U A;  1DJI A;  1OQP A;  1S1E A;  4DUQ A;  1DTL A;  1SL8 A;  1CTR A;  3I5I C;  2Y4Q A;  1B8L A;  3D10 A;  1IH0 A;  3BYA A;  1CKK A;  5DKN A;  4GGF C;  1DF0 A;  1F4O A;  2KBI A;  3EVR A;  4DIR A;  4WRI A;  4A4B A;  1NYA A;  1SRA A;  4C0J A;  1J7R A;  2LNK A;  2KYF A;  1B9A A;  2VRG A;  3BUM B;  3BUO B;  2Q91 A;  1DT7 B;  5HYD A;  2ZND A;  3D0Y A;  4YI8 A;  4WQ3 A;  2JRF A;  2K61 A;  2WC8 A;  2V53 A;  1CMF A;  5D7F A;  5D69 A;  1QVI Z;  4YGB B;  3OP0 A;  1SL9 A;  1H8B A;  3KEV A;  2JU0 A;  1ODB A;  3PAL A;  1A29 A;  3NSK A;  1Y0V H;  4JQ0 D;  2M97 A;  1KWO B;  1ALW A;  1RK9 A;  3IF7 A;  1KK8 B;  3ZNI A;  1JSA A;  2ZRS A;  4HSZ A;  1AJ5 A;  1KWO C;  2AAO A;  4ORB B;  2E6W A;  1JF0 A;  1KK8 C;  2JT0 A;  3AAK A;  2KQY A;  1SR6 B;  2WOS A;  2O5G A;  2K0J A;  3EVV A;  1YTZ C;  3GK4 X;  1K96 A;  3WHU B;  1JFK A;  2JQ6 A;  1SR6 C;  1OMR A;  1YVL A;  1PSB A;  1JF2 A;  1LA0 A;  1KFX L;  1N2D A;  4FTG A;  1IJ6 A;  4JPZ B;  1TIZ A;  1G8I A;  1TCO B;  4YGA A;  1TNQ A;  2NLN A;  2GV5 A;  3ICB A;  1K95 A;  2F3Z A;  3TDU A;  1NIW A;  1OSA A;  4CPV A;  3LL8 B;  2F2O A;  3O78 A;  4TNC A;  4ICB A;  4A4C A;  1XVJ A;  4CFQ A;  2LUC A;  4YGE B;  4M2P A;  2BBN A;  1KQV A;  2WCE A;  2JZI A;  2ZRT A;  2EC6 C;  2ZN9 A;  3PAT A;  1PRW A;  1V1F A;  4NDC A;  5B8I B;  2KGR A;  1CB1 A;  1NUB A;  1MHO A;  2CTN A;  3NXA A;  1QTX A;  3IQQ A;  1QV0 A;  2KQ6 A;  1S6I A;  2LVI A;  3WHT B;  1U5I A;  3IQO A;  1OZO A;  1LXF C;  1FI5 A;  1QAS A;  1SBJ A;  1K9P A;  3SG6 A;  2COL B;  1NP8 A;  3E3R A;  2LMU A;  2OPO A;  2BE6 A;  2SAS A;  3AAJ A;  3KO0 A;  5J3X A;  1WRK A;  3ZWH A;  4N1G A;  4CFR A;  1V1G A;  2PSR A;  4YGD B;  3RLZ A;  1QIW A;  1SCM B;  2MHH A;  3EKJ A;  1DJH A;  5I8N A;  1UHK A;  1SCM C;  3LLE A;  1NCZ A;  1S6C A;  3WXA A;  1WLZ A;  2L2E A;  3AKA A;  4DCK A;  1NX2 A;  2JTT A;  1CM1 A;  3GK1 A;  2KOT A;  1CM4 A;  4OV2 A;  3QRX A;  3I5H C;  4GAO A;  4MVF A;  1NCX A;  1R2U A;  1J1E A;  2GGM A;  1CDL A;  4GGF A;  1EG3 A;  3BOW B;  1MQ1 A;  1QX2 A;  4NDB A;  2R2I A;  5CSF A;  2LE9 B;  1WRZ A;  4GPL B;  3OX5 A;  1PK0 D;  3CZT X;  1SMG A;  1XFV O;  2WND A;  1K90 D;  4DS7 A;  1J1D A;  1TOP A;  2L0P A;  4BY4 A;  2G9B A;  1G33 A;  1XA5 A;  1M45 A;  2LVJ A;  2KFG A;  1EXR A;  3PN7 C;  4PCW A;  3A4U B;  5BPJ A;  1CDM A;  1TNW A;  2JPT A;  1BU3 A;  2B1U A;  2Y5I A;  2JT8 A;  2BCA A;  2KAV A;  3HCM A;  1IG5 A;  4PE7 A;  5KSZ A;  4CID A;  5HKY A;  4M2O A;  4GFT A;  4MBE A;  3BUW B;  4QJ5 B;  2HPS A;  4U8D A;  1AVS A;  4I5J A;  3JTD B;  3NSL A;  1MUX A;  2M49 B;  1RWY A;  1XFX O;  2H2K A;  1PSR A;  1WDC B;  1Y1X A;  2ZNE A;  5HKW A;  3SG4 A;  1QJT A;  1QLK A;  2KNE A;  1FF1 A;  1M31 A;  1YUU A;  1WDC C;  3DF0 B;  4OKH A;  2AUC A;  2K7B A;  2PRU A;  1WY9 A;  3PFV A;  1UHI A;  3TDI A;  2CBL A;  4ZCV A;  2HF5 A;  4MEW A;  3DVJ A;  4E68 A;  3LK1 A;  1PUL A;  2BKH B;  2BL0 B;  1GGZ A;  1SKT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...