3O2PA

A dual e3 mechanism for rub1 ligation to cdc53: dcn1(p)-cdc53(whb)
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
199
structure length
199
Chain Sequence
YPKELTQVFEHYINNNLFDIDSLVKFIEELGYNLEDLATLCLAHLLGYKKLEEPLKREDFLSTWFMQGCSTISDMQECIKTLDVKLHEDLQYFTQIYNYAFNLILDPNRKDIDTDEGIQYWKLFFQPEYPVRMEPDLLEAWFRFLRDEGKTTISKDTWRMLLLFFKRYPTIQKIISDYDETAAWPFIIDEFYECLQDQQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase, cell cycle
molecule keywords Defective in cullin neddylation protein 1
publication title A dual E3 mechanism for Rub1 ligation to Cdc53.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 68
structure length 199
sequence length 199
ec nomenclature
pdb deposition date 2010-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03556 Cullin_binding Cullin binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3o2pA01
3EKJA 2H2KA 4QJ5B 5HYDA 1UHHA 1RECA 2A4JA 3EK4A 1SL9A 1YRTB 3RLZA 1EG4A 1TN4A 2Y5IA 1KSMA 3OB1B 1PALA 1TNQA 1Y1UA 1SCVA 2M97A 1NX1A 2KI6C 5HLOA 3WHUB 1FF1A 1YUSA 1A03A 1MQ1A 2L4HA 3EKHA 1CM1A 1CKKA 1DMOA 2AMIA 2LP3A 2F2PA 1UHJA 2GGMA 4YGEB 3D0YB 1SRAA 4GGFA 1UUSA 2JXLA 3BUOB 3DVJA 5ER4X 2KHNA 4L9MA 2KFHA 2JRFA 3NSOA 2KAYA 1QASA 2L5XB 5K89A 1J55A 1SCMC 1S6JA 2JWWA 1K96A 1DJHA 1CNPA 2F33A 2M7NA 2I18A 2Q4UA 1NCYA 2EC6C 2MRDA 1Y1XA 3DD4A 4U8DA 1TRFA 1BOCA 2LUCA 4MLWA 1XO5A 1Y1AA 1J1DA 1WRKA 3EVRA 2KFGA 3FS7A 5AERA 2PMYA 1Y6WA 3PALA 3SG2A 1DJZA 3VRPA 1K95A 1PULA 1K9PA 1YVHA 3KHEA 1YRUB 1LVCD 1UP5A 1XFZO 1AUIB 2LMVA 2LMTA 1GJYA 1FI5A 1K93D 5HKZA 1IJ5A 3ZWHA 3AKBA 4PDZA 2PALA 3ICBA 4MBEA 4BY5A 2Y1MA 5I8NA 1FW4A 1NX2A 2CXJA 1MF8B 2M8UA 3WHTB 1N65A 2NZ0A 2KAXA 1JFKA 2OTGB 3I5FB 4MVFA 4N5XA 1CLLA 2M1KB 2KI4C 4C0LA 1WRZA 1F55A 2JC2A 2K7OA 1BF5A 1NX0A 4E68A 2MLEC 1QJTA 2QPTA 2KOTA 1CLMA 2GV5A 2K7DA 1A75B 2P6BB 1XFVO 4GFTA 2I94A 3BUXB 1CDMA 1S36A 1SR6B 2JTZA 4ORAB 3SJSA 5IBWA 1JWDA 3GK1A 2M29A 3DF0B 3NSIA 1U5IB 4OVNF 2G2BA 1K9UA 4WRIA 2HF5A 4GNKB 1KQVA 2TN4A 4I5NB 3LL8B 4DCKA 1MXLC 2FCDA 2KYCA 1E8AA 1K90D 1UWOA 2LVJA 3OB2B 5I2LA 4M2PA 1PK0D 1ZMZA 2KI6D 4A4BA 4MRXA 4PE1A 3TUYC 4I5JA 5I2OA 2BE4A 1DTLA 2MJWB 5KTYA 2LM5A 1JUOA 4MEWA 1CTRA 1AVSA 1HT9A 3VRQA 3OHMB 3D10A 1PVAA 1W7JB 4I5KA 4M2QA 1N2DA 1YTZC 4GUKA 4ICBA 3EK8A 2F8PA 4GGFC 1NPQA 2K61A 5CSNA 1JF2A 4PHNA 1KK8C 1LA3A 3OX6A 2LUXA 2JOJA 2CBLA 1CDLA 3BUNB 1OMDA 1RROA 2LVKA 1H4BA 1QATA 5KU1A 4YRUA 2WCEA 5HLVA 2GGZA 4DS7A 1G8IA 1ALWA 2E6WA 3CTNA 1RK9A 4A4CA 2AUCA 1WY9A 2EC6B 2SASA 3E3RA 1LKJA 1TOPA 2EHBA 1WDCC 1XFXO 2BCXA 4AQJA 3WNXB 1XFYO 2CTNA 2L50A 1QX5B 2KNEA 2LANA 1NWDA 2ZRSA 1L7ZA 2HPSA 3CR4X 3LCPC 4PHMA 2MBXA 2ISDA 2NCOA 1F4QA 2PVBA 4XYNA 1YUTA 3O78A 1SK6D 1CDPA 1TCOB 1B1GA 2BKHB 1DJYA 3HCMA 4D1EA 2LC5A 2EGDA 3SG6A 1K2HA 2L98A 2ZN9A 3SIBA 4ETOA 1J7QA 3C1VA 4JPZB 1KSOA 2F2OA 1JC2A 1KFUS 1N0YA 3CWGA 1OE9B 3O6BA 1EH2A 2SCPA 1EG3A 1IGVA 1KFUL 2IS9A 2M1UA 1NSHA 1B47A 2WOSA 1DJGA 3GOFA 5F6TA 1DT7B 1AK8A 2LP2A 2MAZA 1B7TZ 2B1UA 2JZIA 1QLSA 2WCBA 2FOTA 2KBMA 4PHJA 1GGWA 1MR8A 1IJ6A 2JU0A 1KFXS 1S5GY 3BYAA 4PE7A 1LINA 1FI6A 5AEQA 2KI4B 1NUBA 1B8LA 4M2OA 5AANA 1KFXL 1MHOA 3VRNA 3DVKA 1NIWA 1VRKA 5ER5A 2COLB 1ZUZA 2BECA 1A29A 2BE6A 5G08A 3TDIA 1B8RA 1Q80A 3MSEB 1QV0A 2F3YA 5CSJA 2KSPA 3VROA 5PALA 2PSRA 1IG5A 3OP0A 1L2OB 4YGDB 4CPVA 3TS5C 1OZOA 1X02A 1R6PA 2K0JA 1IKUA 2LNKA 1DGVA 2KFFA 1DJWA 2BBNA 2CCMA 4GAOA 3I5HC 3JVTC 1DF0A 2FJUB 3EVUA 1S5GZ 4MZLA 4XJKA 5D69A 1KWOC 4CIDA 1S1EA 3AAJA 4YGBB 1CLBA 5AXIA 1IQ3A 3SIAA 1J1EA 4JQ0D 3TUYB 1TIZA 5CSIA 1OMRA 2BL0B 4MZKA 3FIAA 4QJ3B 4BY4A 1SY9A 4FQOA 4WQ3A 3FWBA 2ZN8A 5DKQA 4F0ZB 3PM8A 4NDDA 1QX2A 1B9AA 2LLTA 1GQMA 3TDZA 1PVBA 5BPJA 3EVVA 2CNPA 3BOWA 4OR9B 1KK8B 3K21A 1OSAA 3A4UB 4MZJA 1BT6A 1JBAA 1QIWA 1YVLA 3GK2A 4HSZA 4CLNA 1GGZA 1J7OA 1SNLA 3LLEA 2LLSA 1BMOA 1S6IA 3I5IC 3QRXA 3TZ1A 1MUXA 3AAKA 1CMGA 4YGAA 5JOLA 1J7PA 2M3WA 4DIRA 1ZACA 1D1OA 2VRGA 2ZNDA 1XK4C 2Y1NA 4PHKA 1IWQA 1UURA 1Y0VH 3DVEA 3PN7C 1OQPA 1G4YR 1M45A 4IL1A 1SMGA 2L2EA 4CFQA 5HKYA 1WRLA 3VRRA 1QVIY 2LHIA 4R1EA 4ORCB 1DGUA 2O60A 1A4PA 3BUMB 5TNCA 2NXQA 1S3PA 2HETA 2O5GA 1IRJA 2M9GA 1HQVA 3EK7A 1DJXA 2ZNEA 3RM1A 1IH0A 1AJ4A 1S26D 2QACA 1ZOTB 4ZCUA 1IQ5A 1PRWA 4Q04A 2E30A 2K7BA 3TDUA 1DF0B 1SCMB 4N1GA 2KAVA 3KEVA 3SG4A 2JT8A 2KQYA 1BR1B 2JTTA 2JXCA 1OMVA 2JPTA 1SPYA 1XVJA 2KGBC 3SG5A 1JFJA 1CMFA 1QV1A 3I5GC 1QVIZ 2ZRTA 3CLNA 2JNFA 1UHIA 2M7LA 1B7TY 1G33A 1XK4A 4AQIA 2AAOA 2K2AA 5J3XA 1CDNA 1K8UA 1SYMA 3AKAA 2K7CA 4ZCVA 1UHNA 3BOWB 3IQQA 3CR2A 1LXFC 1AJ5A 2HQWA 3VGOA 2WC8A 1CFDA 1RTP1 3TS5B 1V1FA 2OS8C 2LV7A 4FTGA 4PCWA 1KK7Y 1JF0A 4C0JA 4TNCA 2LAPA 3OX5A 1EL4A 1RWYA 2LVVA 4OCIA 1KQMC 3I5HB 3SG3A 3JVTB 4AOMA 1F8HA 1QTXA 2BCAA 3JTDC 3WXAA 1S6CA 1KWOB 4GPLB 1CFPA 2L0PA 2L51A 1QS7A 2NCPA 2KDHA 4GBAA 4C0KA 3O4YA 5GQQC 5HKWA 4CFRA 2KBIA 3CR5X 2JT0A 1M39A 2R2IA 1A75A 1OZSA 3M0WA 1CFCA 1MWNA 1QXPA 4OKHA 4YI9A 1A2XA 2KYFA 3SG7A 2RGIA 2ZFDA 3PFVA 4NDCA 1H8BA 3DF0A 1U5IA 2M0RA 3IF7A 4ORBB 1KK7Z 1TNWA 1C7WA 3PSRA 1MXEA 4HREE 2LVIA 1TCFA 1BJFA 1YX7A 5DKRA 4JWQA 1B4CA 2V53A 1CM4A 2WCFA 5D7FA 5CSFA 1KCYA 1B8CA 1M31A 2L4IA 3I5IB 4P5OE 1F70A 2JQ6A 1M63B 2NLNA 1BU3A 1ZFSA 1XA5A 3BUWB 3DVMA 3O2PA 4USLA 1F54A 4OV2A 1C07A 4PE0A 2JNXA 2KQ6A 4YGCB 2OPOA 3PN7B 1J7RA 3CS1A 3FWCA 2H61C 3CGAA 3BQ3A 5I2QA 3CZTX 5B8IB 1TNPA 2PASA 2JULA 2WORA 1YUUA 3KF9A 5AFPA 1K94A 5FYXA 1RFJA 1FPWA 3ZNIA 2ZKMX 1NX3A 1C7VA 3KO0A 4DRWA 3A8RA 4GGNA 2K2FA 1NCZA 4DUQA 1JSAA 2LCPA 4WQ2A 4MRYA 4HRHA 3LK1A 1EXRA 4MN0A 1BLQA 1SW8A 1PSRA 1CFFA 1F71A 1XFUO 1XYDA 3HX4A 2KGRA 1SKTA 2BBMA 4P2YB 1QIVA 1W7IB 5JJGA 5CPVA 2Y4QA 1QLKA 3I5GB 1DVIA 1SL8A 2D8NA 2HQ8A 1WDCB 1R2UA 3NSKA 1ODBA 4QJ4B 1YURA 2JT3A 3D0YA 2H61A 2DOQA 2MLFC 3IQOA 4HRGA 1L2OC 1QX7A 5DKNA 1BG1A 2BKIB 1NYAA 3PLFB 2BCBA 3LK0A 1TNXA 1F4OA 4NQGA 4YI8A 1FBVA 2CT9A 2WNDA 2LMUA 1EJ3A 3GK4X 2K8MB 1UHKA 2MA2A 1YR5A 4YBHB 1RJVA 1M46A 1WLZA 1WLMA 2OS8B 1NCXA 2FCEA 4N1FA 3H4SE 2OTGC 3F45A 3I5FC 3KPXA 2BL0C 2G9BA 1CB1A 3NSLA 1BODA 2Q91A 1DJIA 1KQMB 1PSBA 4MSPA 4PE4A 4XJKB 4UPGA 2I2RE 3JTDB 2LHLA 2M49B 1K9KA 1SBJA 3PATA 1BR4B 3NXAA 2MHHA 1XFWO 2I7AA 2PRUA 1TTXA 4NDBA 1V1GA 1YX8A 2LE9B 5KSZA 1AHRA 1NP8A 1OOJA 4I5LB 3BXKA 1LA0A 4PALA 1ALVA 2F3ZA 2LLUA 1SL7A 1SR6C 1AP4A
chains in the Genus database with same CATH superfamily
3EKJA 2H2KA 4QJ5B 5HYDA 1UHHA 1RECA 2A4JA 3PJIA 3EK4A 1SL9A 1YRTB 3RLZA 1EG4A 1TN4A 2Y5IA 1KSMA 3OB1B 1PALA 3B87A 1TNQA 1Y1UA 3UO9A 1SCVA 2M97A 1NX1A 2KI6C 5HLOA 3FE6A 3WHUB 1FF1A 1YUSA 1A03A 3O4XA 1MQ1A 2GTEA 3PM2A 2KLEA 1Z4HA 2L4HA 3EKHA 1CM1A 1CKKA 1DMOA 2AMIA 2LP3A 2F2PA 1UHJA 2GGMA 4YGEB 3D0YB 1SRAA 3BJHA 4GGFA 2WCJA 1UUSA 2JXLA 3B86A 3BUOB 3DVJA 5ER4X 2KHNA 4L9MA 2KFHA 2JRFA 3CDNA 3NSOA 2KAYA 1QASA 2L5XB 5K89A 1J55A 1TUJA 1SCMC 1S6JA 2JWWA 1K96A 1DJHA 1CNPA 2WCMA 2F33A 2M7NA 2I18A 2Q4UA 1NCYA 2EC6C 2MRDA 1Y1XA 3DD4A 4U8DA 1TRFA 1BOCA 2LUCA 4MLWA 1XO5A 1Y1AA 1J1DA 1WRKA 3EVRA 3FE8A 2KFGA 3FS7A 5AERA 2PMYA 1Y6WA 3PALA 3SG2A 1DJZA 2JPOA 3VRPA 1K95A 1PULA 1K9PA 1YVHA 3KHEA 1YRUB 1LVCD 1UP5A 1XFZO 4PT1A 1AUIB 2KPHA 2LMTA 1GJYA 2LMVA 3SS3A 1FI5A 1XFRA 1K93D 3DXLA 5HKZA 1IJ5A 3ZWHA 3AKBA 4PDZA 2PALA 3ICBA 4MBEA 4BY5A 2Y1MA 5I8NA 1FW4A 1NX2A 2CXJA 1MF8B 4F7FA 2M8UA 3WHTB 1N65A 2NZ0A 2KAXA 1JFKA 2OTGB 3I5FB 4MVFA 4N5XA 1CLLA 2M1KB 2KI4C 4C0LA 1WRZA 1F55A 4FQTA 2JC2A 2K7OA 1BF5A 1NX0A 4OZDA 1TUZA 4E68A 2MLEC 5FI7A 1QJTA 2QPTA 2KOTA 1CLMA 2GV5A 5FI2A 2K7DA 2WC5A 1A75B 2P6BB 1XFVO 4GFTA 1W9ZA 2K60A 2I94A 3BUXB 1CDMA 1S36A 1SR6B 2JTZA 4ORAB 3SJSA 5IBWA 1JWDA 3GK1A 2M29A 3DF0B 3NSIA 1U5IB 4OVNF 2G2BA 1K9UA 4WRIA 2HF5A 4GNKB 1KQVA 2TN4A 4I5NB 3LL8B 4DCKA 1MXLC 2FCDA 2KYCA 1E8AA 1K90D 1UWOA 2LVJA 3OB2B 5I2LA 4M2PA 1DELA 1PK0D 3D73A 1ZMZA 2KI6D 4A4BA 4MRXA 4PE1A 5HL1A 3TUYC 4I5JA 5I2OA 2BE4A 1DTLA 2P70A 2MJWB 5KTYA 2LM5A 1JUOA 4MEWA 1CTRA 1AVSA 1HT9A 3VRQA 3OHMB 1P28A 3D10A 1PVAA 1W7JB 4I5KA 4M2QA 1N2DA 1YTZC 4GUKA 4ICBA 3EK8A 2F8PA 4GGFC 1QWVA 1NPQA 2K61A 5CSNA 1JF2A 4PHNA 1KK8C 1LA3A 3B7AA 2LUXA 3OX6A 2JOJA 2CBLA 1CDLA 3BUNB 1OMDA 1RROA 2LVKA 1H4BA 1QATA 5KU1A 5FI6A 4YRUA 2WCEA 5HLVA 2GGZA 4DS7A 3B88A 1G8IA 1ALWA 2E6WA 3CTNA 4INWA 1RK9A 4A4CA 2AUCA 1WY9A 2L2CA 2EC6B 2SASA 3E3RA 1GM0A 1LKJA 1TOPA 2EHBA 1WDCC 1XFXO 2BCXA 4AQJA 3WNXB 1XFYO 2CTNA 2L50A 3R1PA 1QX5B 2KNEA 2LANA 1NWDA 2ZRSA 1L7ZA 2HPSA 3CR4X 3LCPC 3Q8IA 4PHMA 2MBXA 2ISDA 2NCOA 1F4QA 2PVBA 1T14A 4XYNA 3NGVA 2H8VA 1YUTA 3O78A 1SK6D 1CDPA 1TCOB 1B1GA 3CZ1A 2BKHB 1DJYA 3HCMA 4D1EA 2LC5A 2EGDA 3SG6A 1K2HA 2L98A 2ZN9A 3SIBA 4ETOA 1J7QA 3D74A 3C1VA 4JPZB 1KSOA 2F2OA 1JC2A 1KFUS 1N0YA 3CWGA 1C3ZA 1OE9B 3O6BA 1EH2A 2SCPA 1EG3A 1IGVA 1KFUL 2IS9A 2M1UA 1NSHA 1B47A 2WOSA 1DJGA 3GOFA 5F6TA 1DT7B 1C3YA 1AK8A 2LP2A 2MAZA 1B7TZ 2B1UA 2JZIA 1QLSA 2WCBA 2FOTA 2KBMA 4PHJA 1GGWA 1MR8A 1IJ6A 2JU0A 1KFXS 1S5GY 3BYAA 4PE7A 1LINA 1FI6A 5AEQA 2KI4B 1NUBA 1B8LA 4M2OA 5AANA 1KFXL 1MHOA 3VRNA 3DVKA 1NIWA 1VRKA 3BFAA 1ZUZA 2BECA 2BE6A 1A29A 2COLB 5ER5A 5G08A 1B8RA 1Q80A 3BFHA 3MSEB 1QV0A 4IJ7A 3R72A 2F3YA 5CSJA 2KSPA 3VROA 5PALA 2PSRA 1IG5A 3OP0A 1L2OB 4YGDB 4CPVA 3TS5C 3S0FA 1OZOA 1X02A 1R6PA 3DY9A 2K0JA 1IKUA 2LNKA 1DGVA 2KFFA 1DJWA 2YGUA 2KLDA 2BBNA 2CCMA 4GAOA 3I5HC 3JVTC 1DF0A 2FJUB 3EVUA 1S5GZ 4MZLA 1OOIX 4XJKA 5D69A 3V2LA 1KWOC 4CIDA 2PYQA 5DICA 1S1EA 3AAJA 4YGBB 1CLBA 2WCKA 5AXIA 1IQ3A 3SIAA 1J1EA 3L47A 4JQ0D 3TUYB 1TIZA 5CSIA 1OMRA 2BL0B 4MZKA 3FIAA 4QJ3B 4BY4A 1SY9A 1SSEB 4FQOA 4WQ3A 3FWBA 2ZN8A 5DKQA 4F0ZB 3PM8A 3D75A 4NDDA 1QX2A 1B9AA 2LLTA 1GQMA 3TDZA 1PVBA 3OGNA 5BPJA 3EVVA 2CNPA 3BOWA 4OR9B 5EL2A 1KK8B 3S0DA 4JKTA 3K21A 1OSAA 3A4UB 4MZJA 1BT6A 1JBAA 1QIWA 2QDIA 1YVLA 3GK2A 3OBVA 4HSZA 4CLNA 1GGZA 1J7OA 1IIOA 1SNLA 3LLEA 2LLSA 1BMOA 1S6IA 3I5IC 3QRXA 3CYZA 3TZ1A 1MUXA 3AAKA 1CMGA 4YGAA 5JOLA 1J7PA 3QMEA 2M3WA 4DIRA 1ZACA 1D1OA 2VRGA 2ZNDA 1XK4C 2Y1NA 3UNWA 2WCHA 1IWQA 1UURA 1Y0VH 3DVEA 3PN7C 1OQPA 1G4YR 1M45A 4IL1A 1SMGA 2L2EA 3SS5A 4CFQA 5HKYA 1WRLA 3VRRA 1QVIY 2LHIA 3D78A 4R1EA 3TDIA 4ORCB 1DGUA 3IVTA 2O60A 1A4PA 3BUMB 5TNCA 2NXQA 1LS8A 1S3PA 2HETA 2L5YA 2O5GA 3VB1A 1IRJA 1OOHA 2M9GA 1HQVA 3EK7A 1DJXA 2ZNEA 2QEVA 3RM1A 1IH0A 1AJ4A 1S26D 2QACA 1ZOTB 4ZCUA 1IQ5A 1PRWA 4Q04A 2E30A 3CZ0A 2K7BA 3TDUA 1DF0B 1SCMB 4N1GA 2KAVA 3KEVA 3SG4A 1DQEA 2JT8A 2KQYA 1BR1B 2JTTA 2JXCA 1OMVA 2JPTA 1SPYA 1XVJA 2KGBC 3SG5A 1JFJA 1CMFA 1QV1A 3I5GC 1QVIZ 2ZRTA 3CLNA 3NHTA 2JNFA 1UHIA 2M7LA 1B7TY 1G33A 1XK4A 4AQIA 2AAOA 4INXA 2K2AA 5J3XA 1CDNA 1K8UA 1SYMA 3DYEA 3AKAA 2K7CA 4ZCVA 4KYNA 1UHNA 3BOWB 3IQQA 3CR2A 1LXFC 1AJ5A 2BAPA 2HQWA 3VGOA 2WC8A 1CFDA 1RTP1 3TS5B 3S0AA 1V1FA 2OS8C 2LV7A 4FTGA 1ORGA 1KK7Y 1JF0A 4PCWA 4TNCA 2LAPA 3OX5A 3S0BA 4C0JA 3L4AA 3FE9A 1EL4A 1RWYA 2LVVA 4OCIA 1KQMC 3I5HB 3SG3A 3JVTB 5D3OA 4AOMA 1F8HA 2FJYA 1QTXA 2BCAA 3JTDC 3WXAA 1S6CA 1KWOB 4GPLB 1CFPA 2L0PA 2L51A 1QS7A 1Z2CB 5I94A 2NCPA 2KDHA 4GBAA 4C0KA 3O4YA 5GQQC 5HKWA 4CFRA 1TWOA 2KBIA 3CR5X 2JT0A 1M39A 2R2IA 1A75A 1OZSA 3M0WA 4JD9A 1CFCA 1MWNA 1OOFA 1QXPA 4OKHA 4YI9A 3SS4A 1A2XA 2KYFA 3SG7A 2RGIA 2ZFDA 3PFVA 4NDCA 1H8BA 3DF0A 1U5IA 2M0RA 3IF7A 3EG5B 4ORBB 1KK7Z 1TNWA 1C7WA 3PSRA 1MXEA 4HREE 2LVIA 1TCFA 1BJFA 1YX7A 5DKRA 4JWQA 1B4CA 2V53A 1CM4A 2WCFA 3CABA 5CSFA 5D7FA 1DC1A 1B8CA 1M31A 1KCYA 2L4IA 3I5IB 3N7HA 4P5OE 1F70A 2JQ6A 1M63B 2NLNA 1BU3A 1ZFSA 1XA5A 3BUWB 3DVMA 3O2PA 4USLA 1F54A 3CZ2A 4OV2A 1C07A 4PE0A 2JNXA 2KQ6A 4PHKA 4YGCB 2OPOA 3PN7B 1J7RA 3CS1A 3FWCA 2H61C 3CGAA 3BQ3A 5I2QA 3CZTX 5B8IB 1TNPA 2PASA 2JULA 2WORA 3L4LA 1YUUA 3KF9A 5AFPA 1K94A 5FYXA 1OW4A 1RFJA 1FPWA 3D76A 3ZNIA 2ZKMX 1NX3A 1C7VA 2WC6A 3KO0A 4DRWA 3A8RA 3S0EA 4GGNA 2K2FA 3DZTA 1NCZA 4DUQA 1JSAA 1F71A 2LCPA 4WQ2A 4MRYA 4HRHA 3LK1A 1EXRA 4MN0A 1BLQA 1SW8A 1PSRA 3BFBA 1CFFA 1XFUO 1XYDA 2QEHA 2WCLA 3HX4A 2KGRA 1SKTA 2BBMA 4P2YB 1QIVA 1W7IB 3S0GA 5JJGA 5CPVA 2Y4QA 1QLKA 3I5GB 1DVIA 1SL8A 2D8NA 2HQ8A 1WDCB 1R2UA 3NSKA 1ODBA 4QJ4B 1YURA 2JT3A 3D0YA 2H61A 2DOQA 2MLFC 3IQOA 4HRGA 1L2OC 1QX7A 5DKNA 3R1VA 1BG1A 3RZSA 2BKIB 1NYAA 2QEBA 3PLFB 2BCBA 3LK0A 1TNXA 1F4OA 1OOGA 4NQGA 4YI8A 1FBVA 2CT9A 2WNDA 2LMUA 1EJ3A 3GK4X 2K8MB 1UHKA 2MA2A 1YR5A 4YBHB 1RJVA 1M46A 1WLZA 1WLMA 2OS8B 1NCXA 2ERBA 2FCEA 4N1FA 3H4SE 2OTGC 3F45A 3I5FC 3KPXA 2BL0C 2G9BA 1CB1A 3NSLA 1BODA 2Q91A 1DJIA 1KQMB 1PSBA 3R1OA 4MSPA 4PE4A 4XJKB 4UPGA 2I2RE 2P71A 2PQLA 1DEKA 2LHLA 2M49B 3JTDB 1K9KA 3NHIA 1SBJA 3PATA 1BR4B 2BNXA 3NXAA 2MHHA 3D77A 1XFWO 2I7AA 2QEOA 2PRUA 1TTXA 4NDBA 1V1GA 1YX8A 2LE9B 5KSZA 1AHRA 1NP8A 1OOJA 4I5LB 3BXKA 1LA0A 3K1EA 4PALA 1ALVA 2F3ZA 2LLUA 1SL7A 3B6XA 1SR6C 1AP4A
chains in the Genus database with same CATH topology
3EKJA 2H2KA 4QJ5B 5HYDA 1UHHA 1RECA 2A4JA 3EK4A 1SL9A 1YRTB 3RLZA 1EG4A 1TN4A 2Y5IA 1KSMA 3OB1B 1PALA 1TNQA 1Y1UA 1SCVA 2M97A 1NX1A 2KI6C 5HLOA 3WHUB 1FF1A 1YUSA 1A03A 1MQ1A 2L4HA 3EKHA 1CM1A 1CKKA 1DMOA 2AMIA 2LP3A 2F2PA 1UHJA 2GGMA 4YGEB 3D0YB 1SRAA 4GGFA 1UUSA 2JXLA 3BUOB 3DVJA 5ER4X 2KHNA 4L9MA 2KFHA 2JRFA 3NSOA 2KAYA 1QASA 2L5XB 5K89A 1J55A 1SCMC 1S6JA 2JWWA 1K96A 1DJHA 1CNPA 2F33A 2M7NA 2I18A 2Q4UA 1NCYA 2EC6C 2MRDA 1Y1XA 3DD4A 4U8DA 1TRFA 1BOCA 2LUCA 4MLWA 1XO5A 1Y1AA 1J1DA 1WRKA 3EVRA 2KFGA 3FS7A 5AERA 2PMYA 1Y6WA 3PALA 3SG2A 1DJZA 3VRPA 1K95A 1PULA 1K9PA 1YVHA 3KHEA 1YRUB 1LVCD 1UP5A 1XFZO 1AUIB 2LMVA 2LMTA 1GJYA 1FI5A 1K93D 5HKZA 1IJ5A 3ZWHA 3AKBA 4PDZA 2PALA 3ICBA 4MBEA 4BY5A 2Y1MA 5I8NA 1FW4A 1NX2A 2CXJA 1MF8B 2M8UA 3WHTB 1N65A 2NZ0A 2KAXA 1JFKA 2OTGB 3I5FB 4MVFA 4N5XA 1CLLA 2M1KB 2KI4C 4C0LA 1WRZA 1F55A 2JC2A 2K7OA 1BF5A 1NX0A 4E68A 2MLEC 1QJTA 2QPTA 2KOTA 1CLMA 2GV5A 2K7DA 1A75B 2P6BB 1XFVO 4GFTA 2I94A 3BUXB 1CDMA 1S36A 1SR6B 2JTZA 4ORAB 3SJSA 5IBWA 1JWDA 3GK1A 2M29A 3DF0B 3NSIA 1U5IB 4OVNF 2G2BA 1K9UA 4WRIA 2HF5A 4GNKB 1KQVA 2TN4A 4I5NB 3LL8B 4DCKA 1MXLC 2FCDA 2KYCA 1E8AA 1K90D 1UWOA 2LVJA 3OB2B 5I2LA 4M2PA 1PK0D 1ZMZA 2KI6D 4A4BA 4MRXA 4PE1A 3TUYC 4I5JA 5I2OA 2BE4A 1DTLA 2MJWB 5KTYA 2LM5A 1JUOA 4MEWA 1CTRA 1AVSA 1HT9A 3VRQA 3OHMB 3D10A 1PVAA 1W7JB 4I5KA 4M2QA 1N2DA 1YTZC 4GUKA 4ICBA 3EK8A 2F8PA 4GGFC 1NPQA 2K61A 5CSNA 1JF2A 4PHNA 1KK8C 1LA3A 3OX6A 2LUXA 2JOJA 2CBLA 1CDLA 3BUNB 1OMDA 1RROA 2LVKA 1H4BA 1QATA 5KU1A 4YRUA 2WCEA 5HLVA 2GGZA 4DS7A 1G8IA 1ALWA 2E6WA 3CTNA 1RK9A 4A4CA 2AUCA 1WY9A 2EC6B 2SASA 3E3RA 1LKJA 1TOPA 2EHBA 1WDCC 1XFXO 2BCXA 4AQJA 3WNXB 1XFYO 2CTNA 2L50A 1QX5B 2KNEA 2LANA 1NWDA 2ZRSA 1L7ZA 2HPSA 3CR4X 3LCPC 4PHMA 2MBXA 2ISDA 2NCOA 1F4QA 2PVBA 4XYNA 1YUTA 3O78A 1SK6D 1CDPA 1TCOB 1B1GA 2BKHB 1DJYA 3HCMA 4D1EA 2LC5A 2EGDA 3SG6A 1K2HA 2L98A 2ZN9A 3SIBA 4ETOA 1J7QA 3C1VA 4JPZB 1KSOA 2F2OA 1JC2A 1KFUS 1N0YA 3CWGA 1OE9B 3O6BA 1EH2A 2SCPA 1EG3A 1IGVA 1KFUL 2IS9A 2M1UA 1NSHA 1B47A 2WOSA 1DJGA 3GOFA 5F6TA 1DT7B 1AK8A 2LP2A 2MAZA 1B7TZ 2B1UA 2JZIA 1QLSA 2WCBA 2FOTA 2KBMA 4PHJA 1GGWA 1MR8A 1IJ6A 2JU0A 1KFXS 1S5GY 3BYAA 4PE7A 1LINA 1FI6A 5AEQA 2KI4B 1NUBA 1B8LA 4M2OA 5AANA 1KFXL 1MHOA 3VRNA 3DVKA 1NIWA 1VRKA 5ER5A 2COLB 1ZUZA 2BECA 1A29A 2BE6A 5G08A 3TDIA 1B8RA 1Q80A 3MSEB 1QV0A 2F3YA 5CSJA 2KSPA 3VROA 5PALA 2PSRA 1IG5A 3OP0A 1L2OB 4YGDB 4CPVA 3TS5C 1OZOA 1X02A 1R6PA 2K0JA 1IKUA 2LNKA 1DGVA 2KFFA 1DJWA 2BBNA 2CCMA 4GAOA 3I5HC 3JVTC 1DF0A 2FJUB 3EVUA 1S5GZ 4MZLA 4XJKA 5D69A 1KWOC 4CIDA 1S1EA 3AAJA 4YGBB 1CLBA 5AXIA 1IQ3A 3SIAA 1J1EA 4JQ0D 3TUYB 1TIZA 5CSIA 1OMRA 2BL0B 4MZKA 3FIAA 4QJ3B 4BY4A 1SY9A 4FQOA 4WQ3A 3FWBA 2ZN8A 5DKQA 4F0ZB 3PM8A 4NDDA 1QX2A 1B9AA 2LLTA 1GQMA 3TDZA 1PVBA 5BPJA 3EVVA 2CNPA 3BOWA 4OR9B 1KK8B 3K21A 1OSAA 3A4UB 4MZJA 1BT6A 1JBAA 1QIWA 1YVLA 3GK2A 4HSZA 4CLNA 1GGZA 1J7OA 1SNLA 3LLEA 2LLSA 1BMOA 1S6IA 3I5IC 3QRXA 3TZ1A 1MUXA 3AAKA 1CMGA 4YGAA 5JOLA 1J7PA 2M3WA 4DIRA 1ZACA 1D1OA 2VRGA 2ZNDA 1XK4C 2Y1NA 4PHKA 1IWQA 1UURA 1Y0VH 3DVEA 3PN7C 1OQPA 1G4YR 1M45A 4IL1A 1SMGA 2L2EA 4CFQA 5HKYA 1WRLA 3VRRA 1QVIY 2LHIA 4R1EA 4ORCB 1DGUA 2O60A 1A4PA 3BUMB 5TNCA 2NXQA 1S3PA 2HETA 2O5GA 1IRJA 2M9GA 1HQVA 3EK7A 1DJXA 2ZNEA 3RM1A 1IH0A 1AJ4A 1S26D 2QACA 1ZOTB 4ZCUA 1IQ5A 1PRWA 4Q04A 2E30A 2K7BA 3TDUA 1DF0B 1SCMB 4N1GA 2KAVA 3KEVA 3SG4A 2JT8A 2KQYA 1BR1B 2JTTA 2JXCA 1OMVA 2JPTA 1SPYA 1XVJA 2KGBC 3SG5A 1JFJA 1CMFA 1QV1A 3I5GC 1QVIZ 2ZRTA 3CLNA 2JNFA 1UHIA 2M7LA 1B7TY 1G33A 1XK4A 4AQIA 2AAOA 2K2AA 5J3XA 1CDNA 1K8UA 1SYMA 3AKAA 2K7CA 4ZCVA 1UHNA 3BOWB 3IQQA 3CR2A 1LXFC 1AJ5A 2HQWA 3VGOA 2WC8A 1CFDA 1RTP1 3TS5B 1V1FA 2OS8C 2LV7A 4FTGA 4PCWA 1KK7Y 1JF0A 4C0JA 4TNCA 2LAPA 3OX5A 1EL4A 1RWYA 2LVVA 4OCIA 1KQMC 3I5HB 3SG3A 3JVTB 4AOMA 1F8HA 1QTXA 2BCAA 3JTDC 3WXAA 1S6CA 1KWOB 4GPLB 1CFPA 2L0PA 2L51A 1QS7A 2NCPA 2KDHA 4GBAA 4C0KA 3O4YA 5GQQC 5HKWA 4CFRA 2KBIA 3CR5X 2JT0A 1M39A 2R2IA 1A75A 1OZSA 3M0WA 1CFCA 1MWNA 1QXPA 4OKHA 4YI9A 1A2XA 2KYFA 3SG7A 2RGIA 2ZFDA 3PFVA 4NDCA 1H8BA 3DF0A 1U5IA 2M0RA 3IF7A 4ORBB 1KK7Z 1TNWA 1C7WA 3PSRA 1MXEA 4HREE 2LVIA 1TCFA 1BJFA 1YX7A 5DKRA 4JWQA 1B4CA 2V53A 1CM4A 2WCFA 5D7FA 5CSFA 1KCYA 1B8CA 1M31A 2L4IA 3I5IB 4P5OE 1F70A 2JQ6A 1M63B 2NLNA 1BU3A 1ZFSA 1XA5A 3BUWB 3DVMA 3O2PA 4USLA 1F54A 4OV2A 1C07A 4PE0A 2JNXA 2KQ6A 4YGCB 2OPOA 3PN7B 1J7RA 3CS1A 3FWCA 2H61C 3CGAA 3BQ3A 5I2QA 3CZTX 5B8IB 1TNPA 2PASA 2JULA 2WORA 1YUUA 3KF9A 5AFPA 1K94A 5FYXA 1RFJA 1FPWA 3ZNIA 2ZKMX 1NX3A 1C7VA 3KO0A 4DRWA 3A8RA 4GGNA 2K2FA 1NCZA 4DUQA 1JSAA 2LCPA 4WQ2A 4MRYA 4HRHA 3LK1A 1EXRA 4MN0A 1BLQA 1SW8A 1PSRA 1CFFA 1F71A 1XFUO 1XYDA 3HX4A 2KGRA 1SKTA 2BBMA 4P2YB 1QIVA 1W7IB 5JJGA 5CPVA 2Y4QA 1QLKA 3I5GB 1DVIA 1SL8A 2D8NA 2HQ8A 1WDCB 1R2UA 3NSKA 1ODBA 4QJ4B 1YURA 2JT3A 3D0YA 2H61A 2DOQA 2MLFC 3IQOA 4HRGA 1L2OC 1QX7A 5DKNA 1BG1A 2BKIB 1NYAA 3PLFB 2BCBA 3LK0A 1TNXA 1F4OA 4NQGA 4YI8A 1FBVA 2CT9A 2WNDA 2LMUA 1EJ3A 3GK4X 2K8MB 1UHKA 2MA2A 1YR5A 4YBHB 1RJVA 1M46A 1WLZA 1WLMA 2OS8B 1NCXA 2FCEA 4N1FA 3H4SE 2OTGC 3F45A 3I5FC 3KPXA 2BL0C 2G9BA 1CB1A 3NSLA 1BODA 2Q91A 1DJIA 1KQMB 1PSBA 4MSPA 4PE4A 4XJKB 4UPGA 2I2RE 3JTDB 2LHLA 2M49B 1K9KA 1SBJA 3PATA 1BR4B 3NXAA 2MHHA 1XFWO 2I7AA 2PRUA 1TTXA 4NDBA 1V1GA 1YX8A 2LE9B 5KSZA 1AHRA 1NP8A 1OOJA 4I5LB 3BXKA 1LA0A 4PALA 1ALVA 2F3ZA 2LLUA 1SL7A 1SR6C 1AP4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EKJ A;  2H2K A;  4QJ5 B;  5HYD A;  1UHH A;  1REC A;  2A4J A;  3EK4 A;  1SL9 A;  1YRT B;  3RLZ A;  1EG4 A;  1TN4 A;  2Y5I A;  1KSM A;  3OB1 B;  1PAL A;  1TNQ A;  1Y1U A;  1SCV A;  2M97 A;  1NX1 A;  2KI6 C;  5HLO A;  3WHU B;  1FF1 A;  1YUS A;  1A03 A;  1MQ1 A;  2L4H A;  3EKH A;  1CM1 A;  1CKK A;  1DMO A;  2AMI A;  2LP3 A;  2F2P A;  1UHJ A;  2GGM A;  4YGE B;  3D0Y B;  1SRA A;  4GGF A;  1UUS A;  2JXL A;  3BUO B;  3DVJ A;  5ER4 X;  2KHN A;  4L9M A;  2KFH A;  2JRF A;  3NSO A;  2KAY A;  1QAS A;  2L5X B;  5K89 A;  1J55 A;  1SCM C;  1S6J A;  2JWW A;  1K96 A;  1DJH A;  1CNP A;  2F33 A;  2M7N A;  2I18 A;  2Q4U A;  1NCY A;  2EC6 C;  2MRD A;  1Y1X A;  3DD4 A;  4U8D A;  1TRF A;  1BOC A;  2LUC A;  4MLW A;  1XO5 A;  1Y1A A;  1J1D A;  1WRK A;  3EVR A;  2KFG A;  3FS7 A;  5AER A;  2PMY A;  1Y6W A;  3PAL A;  3SG2 A;  1DJZ A;  3VRP A;  1K95 A;  1PUL A;  1K9P A;  1YVH A;  3KHE A;  1YRU B;  1LVC D;  1UP5 A;  1XFZ O;  1AUI B;  2LMV A;  2LMT A;  1GJY A;  1FI5 A;  1K93 D;  5HKZ A;  1IJ5 A;  3ZWH A;  3AKB A;  4PDZ A;  2PAL A;  3ICB A;  4MBE A;  4BY5 A;  2Y1M A;  5I8N A;  1FW4 A;  1NX2 A;  2CXJ A;  1MF8 B;  2M8U A;  3WHT B;  1N65 A;  2NZ0 A;  2KAX A;  1JFK A;  2OTG B;  3I5F B;  4MVF A;  4N5X A;  1CLL A;  2M1K B;  2KI4 C;  4C0L A;  1WRZ A;  1F55 A;  2JC2 A;  2K7O A;  1BF5 A;  1NX0 A;  4E68 A;  2MLE C;  1QJT A;  2QPT A;  2KOT A;  1CLM A;  2GV5 A;  2K7D A;  1A75 B;  2P6B B;  1XFV O;  4GFT A;  2I94 A;  3BUX B;  1CDM A;  1S36 A;  1SR6 B;  2JTZ A;  4ORA B;  3SJS A;  5IBW A;  1JWD A;  3GK1 A;  2M29 A;  3DF0 B;  3NSI A;  1U5I B;  4OVN F;  2G2B A;  1K9U A;  4WRI A;  2HF5 A;  4GNK B;  1KQV A;  2TN4 A;  4I5N B;  3LL8 B;  4DCK A;  1MXL C;  2FCD A;  2KYC A;  1E8A A;  1K90 D;  1UWO A;  2LVJ A;  3OB2 B;  5I2L A;  4M2P A;  1PK0 D;  1ZMZ A;  2KI6 D;  4A4B A;  4MRX A;  4PE1 A;  3TUY C;  4I5J A;  5I2O A;  2BE4 A;  1DTL A;  2MJW B;  5KTY A;  2LM5 A;  1JUO A;  4MEW A;  1CTR A;  1AVS A;  1HT9 A;  3VRQ A;  3OHM B;  3D10 A;  1PVA A;  1W7J B;  4I5K A;  4M2Q A;  1N2D A;  1YTZ C;  4GUK A;  4ICB A;  3EK8 A;  2F8P A;  4GGF C;  1NPQ A;  2K61 A;  5CSN A;  1JF2 A;  4PHN A;  1KK8 C;  1LA3 A;  3OX6 A;  2LUX A;  2JOJ A;  2CBL A;  1CDL A;  3BUN B;  1OMD A;  1RRO A;  2LVK A;  1H4B A;  1QAT A;  5KU1 A;  4YRU A;  2WCE A;  5HLV A;  2GGZ A;  4DS7 A;  1G8I A;  1ALW A;  2E6W A;  3CTN A;  1RK9 A;  4A4C A;  2AUC A;  1WY9 A;  2EC6 B;  2SAS A;  3E3R A;  1LKJ A;  1TOP A;  2EHB A;  1WDC C;  1XFX O;  2BCX A;  4AQJ A;  3WNX B;  1XFY O;  2CTN A;  2L50 A;  1QX5 B;  2KNE A;  2LAN A;  1NWD A;  2ZRS A;  1L7Z A;  2HPS A;  3CR4 X;  3LCP C;  4PHM A;  2MBX A;  2ISD A;  2NCO A;  1F4Q A;  2PVB A;  4XYN A;  1YUT A;  3O78 A;  1SK6 D;  1CDP A;  1TCO B;  1B1G A;  2BKH B;  1DJY A;  3HCM A;  4D1E A;  2LC5 A;  2EGD A;  3SG6 A;  1K2H A;  2L98 A;  2ZN9 A;  3SIB A;  4ETO A;  1J7Q A;  3C1V A;  4JPZ B;  1KSO A;  2F2O A;  1JC2 A;  1KFU S;  1N0Y A;  3CWG A;  1OE9 B;  3O6B A;  1EH2 A;  2SCP A;  1EG3 A;  1IGV A;  1KFU L;  2IS9 A;  2M1U A;  1NSH A;  1B47 A;  2WOS A;  1DJG A;  3GOF A;  5F6T A;  1DT7 B;  1AK8 A;  2LP2 A;  2MAZ A;  1B7T Z;  2B1U A;  2JZI A;  1QLS A;  2WCB A;  2FOT A;  2KBM A;  4PHJ A;  1GGW A;  1MR8 A;  1IJ6 A;  2JU0 A;  1KFX S;  1S5G Y;  3BYA A;  4PE7 A;  1LIN A;  1FI6 A;  5AEQ A;  2KI4 B;  1NUB A;  1B8L A;  4M2O A;  5AAN A;  1KFX L;  1MHO A;  3VRN A;  3DVK A;  1NIW A;  1VRK A;  5ER5 A;  2COL B;  1ZUZ A;  2BEC A;  1A29 A;  2BE6 A;  5G08 A;  3TDI A;  1B8R A;  1Q80 A;  3MSE B;  1QV0 A;  2F3Y A;  5CSJ A;  2KSP A;  3VRO A;  5PAL A;  2PSR A;  1IG5 A;  3OP0 A;  1L2O B;  4YGD B;  4CPV A;  3TS5 C;  1OZO A;  1X02 A;  1R6P A;  2K0J A;  1IKU A;  2LNK A;  1DGV A;  2KFF A;  1DJW A;  2BBN A;  2CCM A;  4GAO A;  3I5H C;  3JVT C;  1DF0 A;  2FJU B;  3EVU A;  1S5G Z;  4MZL A;  4XJK A;  5D69 A;  1KWO C;  4CID A;  1S1E A;  3AAJ A;  4YGB B;  1CLB A;  5AXI A;  1IQ3 A;  3SIA A;  1J1E A;  4JQ0 D;  3TUY B;  1TIZ A;  5CSI A;  1OMR A;  2BL0 B;  4MZK A;  3FIA A;  4QJ3 B;  4BY4 A;  1SY9 A;  4FQO A;  4WQ3 A;  3FWB A;  2ZN8 A;  5DKQ A;  4F0Z B;  3PM8 A;  4NDD A;  1QX2 A;  1B9A A;  2LLT A;  1GQM A;  3TDZ A;  1PVB A;  5BPJ A;  3EVV A;  2CNP A;  3BOW A;  4OR9 B;  1KK8 B;  3K21 A;  1OSA A;  3A4U B;  4MZJ A;  1BT6 A;  1JBA A;  1QIW A;  1YVL A;  3GK2 A;  4HSZ A;  4CLN A;  1GGZ A;  1J7O A;  1SNL A;  3LLE A;  2LLS A;  1BMO A;  1S6I A;  3I5I C;  3QRX A;  3TZ1 A;  1MUX A;  3AAK A;  1CMG A;  4YGA A;  5JOL A;  1J7P A;  2M3W A;  4DIR A;  1ZAC A;  1D1O A;  2VRG A;  2ZND A;  1XK4 C;  2Y1N A;  4PHK A;  1IWQ A;  1UUR A;  1Y0V H;  3DVE A;  3PN7 C;  1OQP A;  1G4Y R;  1M45 A;  4IL1 A;  1SMG A;  2L2E A;  4CFQ A;  5HKY A;  1WRL A;  3VRR A;  1QVI Y;  2LHI A;  4R1E A;  4ORC B;  1DGU A;  2O60 A;  1A4P A;  3BUM B;  5TNC A;  2NXQ A;  1S3P A;  2HET A;  2O5G A;  1IRJ A;  2M9G A;  1HQV A;  3EK7 A;  1DJX A;  2ZNE A;  3RM1 A;  1IH0 A;  1AJ4 A;  1S26 D;  2QAC A;  1ZOT B;  4ZCU A;  1IQ5 A;  1PRW A;  4Q04 A;  2E30 A;  2K7B A;  3TDU A;  1DF0 B;  1SCM B;  4N1G A;  2KAV A;  3KEV A;  3SG4 A;  2JT8 A;  2KQY A;  1BR1 B;  2JTT A;  2JXC A;  1OMV A;  2JPT A;  1SPY A;  1XVJ A;  2KGB C;  3SG5 A;  1JFJ A;  1CMF A;  1QV1 A;  3I5G C;  1QVI Z;  2ZRT A;  3CLN A;  2JNF A;  1UHI A;  2M7L A;  1B7T Y;  1G33 A;  1XK4 A;  4AQI A;  2AAO A;  2K2A A;  5J3X A;  1CDN A;  1K8U A;  1SYM A;  3AKA A;  2K7C A;  4ZCV A;  1UHN A;  3BOW B;  3IQQ A;  3CR2 A;  1LXF C;  1AJ5 A;  2HQW A;  3VGO A;  2WC8 A;  1CFD A;  1RTP 1;  3TS5 B;  1V1F A;  2OS8 C;  2LV7 A;  4FTG A;  4PCW A;  1KK7 Y;  1JF0 A;  4C0J A;  4TNC A;  2LAP A;  3OX5 A;  1EL4 A;  1RWY A;  2LVV A;  4OCI A;  1KQM C;  3I5H B;  3SG3 A;  3JVT B;  4AOM A;  1F8H A;  1QTX A;  2BCA A;  3JTD C;  3WXA A;  1S6C A;  1KWO B;  4GPL B;  1CFP A;  2L0P A;  2L51 A;  1QS7 A;  2NCP A;  2KDH A;  4GBA A;  4C0K A;  3O4Y A;  5GQQ C;  5HKW A;  4CFR A;  2KBI A;  3CR5 X;  2JT0 A;  1M39 A;  2R2I A;  1A75 A;  1OZS A;  3M0W A;  1CFC A;  1MWN A;  1QXP A;  4OKH A;  4YI9 A;  1A2X A;  2KYF A;  3SG7 A;  2RGI A;  2ZFD A;  3PFV A;  4NDC A;  1H8B A;  3DF0 A;  1U5I A;  2M0R A;  3IF7 A;  4ORB B;  1KK7 Z;  1TNW A;  1C7W A;  3PSR A;  1MXE A;  4HRE E;  2LVI A;  1TCF A;  1BJF A;  1YX7 A;  5DKR A;  4JWQ A;  1B4C A;  2V53 A;  1CM4 A;  2WCF A;  5D7F A;  5CSF A;  1KCY A;  1B8C A;  1M31 A;  2L4I A;  3I5I B;  4P5O E;  1F70 A;  2JQ6 A;  1M63 B;  2NLN A;  1BU3 A;  1ZFS A;  1XA5 A;  3BUW B;  3DVM A;  3O2P A;  4USL A;  1F54 A;  4OV2 A;  1C07 A;  4PE0 A;  2JNX A;  2KQ6 A;  4YGC B;  2OPO A;  3PN7 B;  1J7R A;  3CS1 A;  3FWC A;  2H61 C;  3CGA A;  3BQ3 A;  5I2Q A;  3CZT X;  5B8I B;  1TNP A;  2PAS A;  2JUL A;  2WOR A;  1YUU A;  3KF9 A;  5AFP A;  1K94 A;  5FYX A;  1RFJ A;  1FPW A;  3ZNI A;  2ZKM X;  1NX3 A;  1C7V A;  3KO0 A;  4DRW A;  3A8R A;  4GGN A;  2K2F A;  1NCZ A;  4DUQ A;  1JSA A;  2LCP A;  4WQ2 A;  4MRY A;  4HRH A;  3LK1 A;  1EXR A;  4MN0 A;  1BLQ A;  1SW8 A;  1PSR A;  1CFF A;  1F71 A;  1XFU O;  1XYD A;  3HX4 A;  2KGR A;  1SKT A;  2BBM A;  4P2Y B;  1QIV A;  1W7I B;  5JJG A;  5CPV A;  2Y4Q A;  1QLK A;  3I5G B;  1DVI A;  1SL8 A;  2D8N A;  2HQ8 A;  1WDC B;  1R2U A;  3NSK A;  1ODB A;  4QJ4 B;  1YUR A;  2JT3 A;  3D0Y A;  2H61 A;  2DOQ A;  2MLF C;  3IQO A;  4HRG A;  1L2O C;  1QX7 A;  5DKN A;  1BG1 A;  2BKI B;  1NYA A;  3PLF B;  2BCB A;  3LK0 A;  1TNX A;  1F4O A;  4NQG A;  4YI8 A;  1FBV A;  2CT9 A;  2WND A;  2LMU A;  1EJ3 A;  3GK4 X;  2K8M B;  1UHK A;  2MA2 A;  1YR5 A;  4YBH B;  1RJV A;  1M46 A;  1WLZ A;  1WLM A;  2OS8 B;  1NCX A;  2FCE A;  4N1F A;  3H4S E;  2OTG C;  3F45 A;  3I5F C;  3KPX A;  2BL0 C;  2G9B A;  1CB1 A;  3NSL A;  1BOD A;  2Q91 A;  1DJI A;  1KQM B;  1PSB A;  4MSP A;  4PE4 A;  4XJK B;  4UPG A;  2I2R E;  3JTD B;  2LHL A;  2M49 B;  1K9K A;  1SBJ A;  3PAT A;  1BR4 B;  3NXA A;  2MHH A;  1XFW O;  2I7A A;  2PRU A;  1TTX A;  4NDB A;  1V1G A;  1YX8 A;  2LE9 B;  5KSZ A;  1AHR A;  1NP8 A;  1OOJ A;  4I5L B;  3BXK A;  1LA0 A;  4PAL A;  1ALV A;  2F3Z A;  2LLU A;  1SL7 A;  1SR6 C;  1AP4 A; 
#chains in the Genus database with same CATH topology
 3EKJ A;  2H2K A;  4QJ5 B;  5HYD A;  1UHH A;  1REC A;  2A4J A;  3PJI A;  3EK4 A;  1SL9 A;  1YRT B;  3RLZ A;  1EG4 A;  1TN4 A;  2Y5I A;  1KSM A;  3OB1 B;  1PAL A;  3B87 A;  1TNQ A;  1Y1U A;  3UO9 A;  1SCV A;  2M97 A;  1NX1 A;  2KI6 C;  5HLO A;  3FE6 A;  3WHU B;  1FF1 A;  1YUS A;  1A03 A;  3O4X A;  1MQ1 A;  2GTE A;  3PM2 A;  2KLE A;  1Z4H A;  2L4H A;  3EKH A;  1CM1 A;  1CKK A;  1DMO A;  2AMI A;  2LP3 A;  2F2P A;  1UHJ A;  2GGM A;  4YGE B;  3D0Y B;  1SRA A;  3BJH A;  4GGF A;  2WCJ A;  1UUS A;  2JXL A;  3B86 A;  3BUO B;  3DVJ A;  5ER4 X;  2KHN A;  4L9M A;  2KFH A;  2JRF A;  3CDN A;  3NSO A;  2KAY A;  1QAS A;  2L5X B;  5K89 A;  1J55 A;  1TUJ A;  1SCM C;  1S6J A;  2JWW A;  1K96 A;  1DJH A;  1CNP A;  2WCM A;  2F33 A;  2M7N A;  2I18 A;  2Q4U A;  1NCY A;  2EC6 C;  2MRD A;  1Y1X A;  3DD4 A;  4U8D A;  1TRF A;  1BOC A;  2LUC A;  4MLW A;  1XO5 A;  1Y1A A;  1J1D A;  1WRK A;  3EVR A;  3FE8 A;  2KFG A;  3FS7 A;  5AER A;  2PMY A;  1Y6W A;  3PAL A;  3SG2 A;  1DJZ A;  2JPO A;  3VRP A;  1K95 A;  1PUL A;  1K9P A;  1YVH A;  3KHE A;  1YRU B;  1LVC D;  1UP5 A;  1XFZ O;  4PT1 A;  1AUI B;  2KPH A;  2LMT A;  1GJY A;  2LMV A;  3SS3 A;  1FI5 A;  1XFR A;  1K93 D;  3DXL A;  5HKZ A;  1IJ5 A;  3ZWH A;  3AKB A;  4PDZ A;  2PAL A;  3ICB A;  4MBE A;  4BY5 A;  2Y1M A;  5I8N A;  1FW4 A;  1NX2 A;  2CXJ A;  1MF8 B;  4F7F A;  2M8U A;  3WHT B;  1N65 A;  2NZ0 A;  2KAX A;  1JFK A;  2OTG B;  3I5F B;  4MVF A;  4N5X A;  1CLL A;  2M1K B;  2KI4 C;  4C0L A;  1WRZ A;  1F55 A;  4FQT A;  2JC2 A;  2K7O A;  1BF5 A;  1NX0 A;  4OZD A;  1TUZ A;  4E68 A;  2MLE C;  5FI7 A;  1QJT A;  2QPT A;  2KOT A;  1CLM A;  2GV5 A;  5FI2 A;  2K7D A;  2WC5 A;  1A75 B;  2P6B B;  1XFV O;  4GFT A;  1W9Z A;  2K60 A;  2I94 A;  3BUX B;  1CDM A;  1S36 A;  1SR6 B;  2JTZ A;  4ORA B;  3SJS A;  5IBW A;  1JWD A;  3GK1 A;  2M29 A;  3DF0 B;  3NSI A;  1U5I B;  4OVN F;  2G2B A;  1K9U A;  4WRI A;  2HF5 A;  4GNK B;  1KQV A;  2TN4 A;  4I5N B;  3LL8 B;  4DCK A;  1MXL C;  2FCD A;  2KYC A;  1E8A A;  1K90 D;  1UWO A;  2LVJ A;  3OB2 B;  5I2L A;  4M2P A;  1DEL A;  1PK0 D;  3D73 A;  1ZMZ A;  2KI6 D;  4A4B A;  4MRX A;  4PE1 A;  5HL1 A;  3TUY C;  4I5J A;  5I2O A;  2BE4 A;  1DTL A;  2P70 A;  2MJW B;  5KTY A;  2LM5 A;  1JUO A;  4MEW A;  1CTR A;  1AVS A;  1HT9 A;  3VRQ A;  3OHM B;  1P28 A;  3D10 A;  1PVA A;  1W7J B;  4I5K A;  4M2Q A;  1N2D A;  1YTZ C;  4GUK A;  4ICB A;  3EK8 A;  2F8P A;  4GGF C;  1QWV A;  1NPQ A;  2K61 A;  5CSN A;  1JF2 A;  4PHN A;  1KK8 C;  1LA3 A;  3B7A A;  2LUX A;  3OX6 A;  2JOJ A;  2CBL A;  1CDL A;  3BUN B;  1OMD A;  1RRO A;  2LVK A;  1H4B A;  1QAT A;  5KU1 A;  5FI6 A;  4YRU A;  2WCE A;  5HLV A;  2GGZ A;  4DS7 A;  3B88 A;  1G8I A;  1ALW A;  2E6W A;  3CTN A;  4INW A;  1RK9 A;  4A4C A;  2AUC A;  1WY9 A;  2L2C A;  2EC6 B;  2SAS A;  3E3R A;  1GM0 A;  1LKJ A;  1TOP A;  2EHB A;  1WDC C;  1XFX O;  2BCX A;  4AQJ A;  3WNX B;  1XFY O;  2CTN A;  2L50 A;  3R1P A;  1QX5 B;  2KNE A;  2LAN A;  1NWD A;  2ZRS A;  1L7Z A;  2HPS A;  3CR4 X;  3LCP C;  3Q8I A;  4PHM A;  2MBX A;  2ISD A;  2NCO A;  1F4Q A;  2PVB A;  1T14 A;  4XYN A;  3NGV A;  2H8V A;  1YUT A;  3O78 A;  1SK6 D;  1CDP A;  1TCO B;  1B1G A;  3CZ1 A;  2BKH B;  1DJY A;  3HCM A;  4D1E A;  2LC5 A;  2EGD A;  3SG6 A;  1K2H A;  2L98 A;  2ZN9 A;  3SIB A;  4ETO A;  1J7Q A;  3D74 A;  3C1V A;  4JPZ B;  1KSO A;  2F2O A;  1JC2 A;  1KFU S;  1N0Y A;  3CWG A;  1C3Z A;  1OE9 B;  3O6B A;  1EH2 A;  2SCP A;  1EG3 A;  1IGV A;  1KFU L;  2IS9 A;  2M1U A;  1NSH A;  1B47 A;  2WOS A;  1DJG A;  3GOF A;  5F6T A;  1DT7 B;  1C3Y A;  1AK8 A;  2LP2 A;  2MAZ A;  1B7T Z;  2B1U A;  2JZI A;  1QLS A;  2WCB A;  2FOT A;  2KBM A;  4PHJ A;  1GGW A;  1MR8 A;  1IJ6 A;  2JU0 A;  1KFX S;  1S5G Y;  3BYA A;  4PE7 A;  1LIN A;  1FI6 A;  5AEQ A;  2KI4 B;  1NUB A;  1B8L A;  4M2O A;  5AAN A;  1KFX L;  1MHO A;  3VRN A;  3DVK A;  1NIW A;  1VRK A;  3BFA A;  1ZUZ A;  2BEC A;  2BE6 A;  1A29 A;  2COL B;  5ER5 A;  5G08 A;  1B8R A;  1Q80 A;  3BFH A;  3MSE B;  1QV0 A;  4IJ7 A;  3R72 A;  2F3Y A;  5CSJ A;  2KSP A;  3VRO A;  5PAL A;  2PSR A;  1IG5 A;  3OP0 A;  1L2O B;  4YGD B;  4CPV A;  3TS5 C;  3S0F A;  1OZO A;  1X02 A;  1R6P A;  3DY9 A;  2K0J A;  1IKU A;  2LNK A;  1DGV A;  2KFF A;  1DJW A;  2YGU A;  2KLD A;  2BBN A;  2CCM A;  4GAO A;  3I5H C;  3JVT C;  1DF0 A;  2FJU B;  3EVU A;  1S5G Z;  4MZL A;  1OOI X;  4XJK A;  5D69 A;  3V2L A;  1KWO C;  4CID A;  2PYQ A;  5DIC A;  1S1E A;  3AAJ A;  4YGB B;  1CLB A;  2WCK A;  5AXI A;  1IQ3 A;  3SIA A;  1J1E A;  3L47 A;  4JQ0 D;  3TUY B;  1TIZ A;  5CSI A;  1OMR A;  2BL0 B;  4MZK A;  3FIA A;  4QJ3 B;  4BY4 A;  1SY9 A;  1SSE B;  4FQO A;  4WQ3 A;  3FWB A;  2ZN8 A;  5DKQ A;  4F0Z B;  3PM8 A;  3D75 A;  4NDD A;  1QX2 A;  1B9A A;  2LLT A;  1GQM A;  3TDZ A;  1PVB A;  3OGN A;  5BPJ A;  3EVV A;  2CNP A;  3BOW A;  4OR9 B;  5EL2 A;  1KK8 B;  3S0D A;  4JKT A;  3K21 A;  1OSA A;  3A4U B;  4MZJ A;  1BT6 A;  1JBA A;  1QIW A;  2QDI A;  1YVL A;  3GK2 A;  3OBV A;  4HSZ A;  4CLN A;  1GGZ A;  1J7O A;  1IIO A;  1SNL A;  3LLE A;  2LLS A;  1BMO A;  1S6I A;  3I5I C;  3QRX A;  3CYZ A;  3TZ1 A;  1MUX A;  3AAK A;  1CMG A;  4YGA A;  5JOL A;  1J7P A;  3QME A;  2M3W A;  4DIR A;  1ZAC A;  1D1O A;  2VRG A;  2ZND A;  1XK4 C;  2Y1N A;  3UNW A;  2WCH A;  1IWQ A;  1UUR A;  1Y0V H;  3DVE A;  3PN7 C;  1OQP A;  1G4Y R;  1M45 A;  4IL1 A;  1SMG A;  2L2E A;  3SS5 A;  4CFQ A;  5HKY A;  1WRL A;  3VRR A;  1QVI Y;  2LHI A;  3D78 A;  4R1E A;  3TDI A;  4ORC B;  1DGU A;  3IVT A;  2O60 A;  1A4P A;  3BUM B;  5TNC A;  2NXQ A;  1LS8 A;  1S3P A;  2HET A;  2L5Y A;  2O5G A;  3VB1 A;  1IRJ A;  1OOH A;  2M9G A;  1HQV A;  3EK7 A;  1DJX A;  2ZNE A;  2QEV A;  3RM1 A;  1IH0 A;  1AJ4 A;  1S26 D;  2QAC A;  1ZOT B;  4ZCU A;  1IQ5 A;  1PRW A;  4Q04 A;  2E30 A;  3CZ0 A;  2K7B A;  3TDU A;  1DF0 B;  1SCM B;  4N1G A;  2KAV A;  3KEV A;  3SG4 A;  1DQE A;  2JT8 A;  2KQY A;  1BR1 B;  2JTT A;  2JXC A;  1OMV A;  2JPT A;  1SPY A;  1XVJ A;  2KGB C;  3SG5 A;  1JFJ A;  1CMF A;  1QV1 A;  3I5G C;  1QVI Z;  2ZRT A;  3CLN A;  3NHT A;  2JNF A;  1UHI A;  2M7L A;  1B7T Y;  1G33 A;  1XK4 A;  4AQI A;  2AAO A;  4INX A;  2K2A A;  5J3X A;  1CDN A;  1K8U A;  1SYM A;  3DYE A;  3AKA A;  2K7C A;  4ZCV A;  4KYN A;  1UHN A;  3BOW B;  3IQQ A;  3CR2 A;  1LXF C;  1AJ5 A;  2BAP A;  2HQW A;  3VGO A;  2WC8 A;  1CFD A;  1RTP 1;  3TS5 B;  3S0A A;  1V1F A;  2OS8 C;  2LV7 A;  4FTG A;  1ORG A;  1KK7 Y;  1JF0 A;  4PCW A;  4TNC A;  2LAP A;  3OX5 A;  3S0B A;  4C0J A;  3L4A A;  3FE9 A;  1EL4 A;  1RWY A;  2LVV A;  4OCI A;  1KQM C;  3I5H B;  3SG3 A;  3JVT B;  5D3O A;  4AOM A;  1F8H A;  2FJY A;  1QTX A;  2BCA A;  3JTD C;  3WXA A;  1S6C A;  1KWO B;  4GPL B;  1CFP A;  2L0P A;  2L51 A;  1QS7 A;  1Z2C B;  5I94 A;  2NCP A;  2KDH A;  4GBA A;  4C0K A;  3O4Y A;  5GQQ C;  5HKW A;  4CFR A;  1TWO A;  2KBI A;  3CR5 X;  2JT0 A;  1M39 A;  2R2I A;  1A75 A;  1OZS A;  3M0W A;  4JD9 A;  1CFC A;  1MWN A;  1OOF A;  1QXP A;  4OKH A;  4YI9 A;  3SS4 A;  1A2X A;  2KYF A;  3SG7 A;  2RGI A;  2ZFD A;  3PFV A;  4NDC A;  1H8B A;  3DF0 A;  1U5I A;  2M0R A;  3IF7 A;  3EG5 B;  4ORB B;  1KK7 Z;  1TNW A;  1C7W A;  3PSR A;  1MXE A;  4HRE E;  2LVI A;  1TCF A;  1BJF A;  1YX7 A;  5DKR A;  4JWQ A;  1B4C A;  2V53 A;  1CM4 A;  2WCF A;  3CAB A;  5CSF A;  5D7F A;  1DC1 A;  1B8C A;  1M31 A;  1KCY A;  2L4I A;  3I5I B;  3N7H A;  4P5O E;  1F70 A;  2JQ6 A;  1M63 B;  2NLN A;  1BU3 A;  1ZFS A;  1XA5 A;  3BUW B;  3DVM A;  3O2P A;  4USL A;  1F54 A;  3CZ2 A;  4OV2 A;  1C07 A;  4PE0 A;  2JNX A;  2KQ6 A;  4PHK A;  4YGC B;  2OPO A;  3PN7 B;  1J7R A;  3CS1 A;  3FWC A;  2H61 C;  3CGA A;  3BQ3 A;  5I2Q A;  3CZT X;  5B8I B;  1TNP A;  2PAS A;  2JUL A;  2WOR A;  3L4L A;  1YUU A;  3KF9 A;  5AFP A;  1K94 A;  5FYX A;  1OW4 A;  1RFJ A;  1FPW A;  3D76 A;  3ZNI A;  2ZKM X;  1NX3 A;  1C7V A;  2WC6 A;  3KO0 A;  4DRW A;  3A8R A;  3S0E A;  4GGN A;  2K2F A;  3DZT A;  1NCZ A;  4DUQ A;  1JSA A;  1F71 A;  2LCP A;  4WQ2 A;  4MRY A;  4HRH A;  3LK1 A;  1EXR A;  4MN0 A;  1BLQ A;  1SW8 A;  1PSR A;  3BFB A;  1CFF A;  1XFU O;  1XYD A;  2QEH A;  2WCL A;  3HX4 A;  2KGR A;  1SKT A;  2BBM A;  4P2Y B;  1QIV A;  1W7I B;  3S0G A;  5JJG A;  5CPV A;  2Y4Q A;  1QLK A;  3I5G B;  1DVI A;  1SL8 A;  2D8N A;  2HQ8 A;  1WDC B;  1R2U A;  3NSK A;  1ODB A;  4QJ4 B;  1YUR A;  2JT3 A;  3D0Y A;  2H61 A;  2DOQ A;  2MLF C;  3IQO A;  4HRG A;  1L2O C;  1QX7 A;  5DKN A;  3R1V A;  1BG1 A;  3RZS A;  2BKI B;  1NYA A;  2QEB A;  3PLF B;  2BCB A;  3LK0 A;  1TNX A;  1F4O A;  1OOG A;  4NQG A;  4YI8 A;  1FBV A;  2CT9 A;  2WND A;  2LMU A;  1EJ3 A;  3GK4 X;  2K8M B;  1UHK A;  2MA2 A;  1YR5 A;  4YBH B;  1RJV A;  1M46 A;  1WLZ A;  1WLM A;  2OS8 B;  1NCX A;  2ERB A;  2FCE A;  4N1F A;  3H4S E;  2OTG C;  3F45 A;  3I5F C;  3KPX A;  2BL0 C;  2G9B A;  1CB1 A;  3NSL A;  1BOD A;  2Q91 A;  1DJI A;  1KQM B;  1PSB A;  3R1O A;  4MSP A;  4PE4 A;  4XJK B;  4UPG A;  2I2R E;  2P71 A;  2PQL A;  1DEK A;  2LHL A;  2M49 B;  3JTD B;  1K9K A;  3NHI A;  1SBJ A;  3PAT A;  1BR4 B;  2BNX A;  3NXA A;  2MHH A;  3D77 A;  1XFW O;  2I7A A;  2QEO A;  2PRU A;  1TTX A;  4NDB A;  1V1G A;  1YX8 A;  2LE9 B;  5KSZ A;  1AHR A;  1NP8 A;  1OOJ A;  4I5L B;  3BXK A;  1LA0 A;  3K1E A;  4PAL A;  1ALV A;  2F3Z A;  2LLU A;  1SL7 A;  3B6X A;  1SR6 C;  1AP4 A; 
#chains in the Genus database with same CATH homology
 3EKJ A;  2H2K A;  4QJ5 B;  5HYD A;  1UHH A;  1REC A;  2A4J A;  3EK4 A;  1SL9 A;  1YRT B;  3RLZ A;  1EG4 A;  1TN4 A;  2Y5I A;  1KSM A;  3OB1 B;  1PAL A;  1TNQ A;  1Y1U A;  1SCV A;  2M97 A;  1NX1 A;  2KI6 C;  5HLO A;  3WHU B;  1FF1 A;  1YUS A;  1A03 A;  1MQ1 A;  2L4H A;  3EKH A;  1CM1 A;  1CKK A;  1DMO A;  2AMI A;  2LP3 A;  2F2P A;  1UHJ A;  2GGM A;  4YGE B;  3D0Y B;  1SRA A;  4GGF A;  1UUS A;  2JXL A;  3BUO B;  3DVJ A;  5ER4 X;  2KHN A;  4L9M A;  2KFH A;  2JRF A;  3NSO A;  2KAY A;  1QAS A;  2L5X B;  5K89 A;  1J55 A;  1SCM C;  1S6J A;  2JWW A;  1K96 A;  1DJH A;  1CNP A;  2F33 A;  2M7N A;  2I18 A;  2Q4U A;  1NCY A;  2EC6 C;  2MRD A;  1Y1X A;  3DD4 A;  4U8D A;  1TRF A;  1BOC A;  2LUC A;  4MLW A;  1XO5 A;  1Y1A A;  1J1D A;  1WRK A;  3EVR A;  2KFG A;  3FS7 A;  5AER A;  2PMY A;  1Y6W A;  3PAL A;  3SG2 A;  1DJZ A;  3VRP A;  1K95 A;  1PUL A;  1K9P A;  1YVH A;  3KHE A;  1YRU B;  1LVC D;  1UP5 A;  1XFZ O;  1AUI B;  2LMV A;  2LMT A;  1GJY A;  1FI5 A;  1K93 D;  5HKZ A;  1IJ5 A;  3ZWH A;  3AKB A;  4PDZ A;  2PAL A;  3ICB A;  4MBE A;  4BY5 A;  2Y1M A;  5I8N A;  1FW4 A;  1NX2 A;  2CXJ A;  1MF8 B;  2M8U A;  3WHT B;  1N65 A;  2NZ0 A;  2KAX A;  1JFK A;  2OTG B;  3I5F B;  4MVF A;  4N5X A;  1CLL A;  2M1K B;  2KI4 C;  4C0L A;  1WRZ A;  1F55 A;  2JC2 A;  2K7O A;  1BF5 A;  1NX0 A;  4E68 A;  2MLE C;  1QJT A;  2QPT A;  2KOT A;  1CLM A;  2GV5 A;  2K7D A;  1A75 B;  2P6B B;  1XFV O;  4GFT A;  2I94 A;  3BUX B;  1CDM A;  1S36 A;  1SR6 B;  2JTZ A;  4ORA B;  3SJS A;  5IBW A;  1JWD A;  3GK1 A;  2M29 A;  3DF0 B;  3NSI A;  1U5I B;  4OVN F;  2G2B A;  1K9U A;  4WRI A;  2HF5 A;  4GNK B;  1KQV A;  2TN4 A;  4I5N B;  3LL8 B;  4DCK A;  1MXL C;  2FCD A;  2KYC A;  1E8A A;  1K90 D;  1UWO A;  2LVJ A;  3OB2 B;  5I2L A;  4M2P A;  1PK0 D;  1ZMZ A;  2KI6 D;  4A4B A;  4MRX A;  4PE1 A;  3TUY C;  4I5J A;  5I2O A;  2BE4 A;  1DTL A;  2MJW B;  5KTY A;  2LM5 A;  1JUO A;  4MEW A;  1CTR A;  1AVS A;  1HT9 A;  3VRQ A;  3OHM B;  3D10 A;  1PVA A;  1W7J B;  4I5K A;  4M2Q A;  1N2D A;  1YTZ C;  4GUK A;  4ICB A;  3EK8 A;  2F8P A;  4GGF C;  1NPQ A;  2K61 A;  5CSN A;  1JF2 A;  4PHN A;  1KK8 C;  1LA3 A;  3OX6 A;  2LUX A;  2JOJ A;  2CBL A;  1CDL A;  3BUN B;  1OMD A;  1RRO A;  2LVK A;  1H4B A;  1QAT A;  5KU1 A;  4YRU A;  2WCE A;  5HLV A;  2GGZ A;  4DS7 A;  1G8I A;  1ALW A;  2E6W A;  3CTN A;  1RK9 A;  4A4C A;  2AUC A;  1WY9 A;  2EC6 B;  2SAS A;  3E3R A;  1LKJ A;  1TOP A;  2EHB A;  1WDC C;  1XFX O;  2BCX A;  4AQJ A;  3WNX B;  1XFY O;  2CTN A;  2L50 A;  1QX5 B;  2KNE A;  2LAN A;  1NWD A;  2ZRS A;  1L7Z A;  2HPS A;  3CR4 X;  3LCP C;  4PHM A;  2MBX A;  2ISD A;  2NCO A;  1F4Q A;  2PVB A;  4XYN A;  1YUT A;  3O78 A;  1SK6 D;  1CDP A;  1TCO B;  1B1G A;  2BKH B;  1DJY A;  3HCM A;  4D1E A;  2LC5 A;  2EGD A;  3SG6 A;  1K2H A;  2L98 A;  2ZN9 A;  3SIB A;  4ETO A;  1J7Q A;  3C1V A;  4JPZ B;  1KSO A;  2F2O A;  1JC2 A;  1KFU S;  1N0Y A;  3CWG A;  1OE9 B;  3O6B A;  1EH2 A;  2SCP A;  1EG3 A;  1IGV A;  1KFU L;  2IS9 A;  2M1U A;  1NSH A;  1B47 A;  2WOS A;  1DJG A;  3GOF A;  5F6T A;  1DT7 B;  1AK8 A;  2LP2 A;  2MAZ A;  1B7T Z;  2B1U A;  2JZI A;  1QLS A;  2WCB A;  2FOT A;  2KBM A;  4PHJ A;  1GGW A;  1MR8 A;  1IJ6 A;  2JU0 A;  1KFX S;  1S5G Y;  3BYA A;  4PE7 A;  1LIN A;  1FI6 A;  5AEQ A;  2KI4 B;  1NUB A;  1B8L A;  4M2O A;  5AAN A;  1KFX L;  1MHO A;  3VRN A;  3DVK A;  1NIW A;  1VRK A;  5ER5 A;  2COL B;  1ZUZ A;  2BEC A;  1A29 A;  2BE6 A;  5G08 A;  3TDI A;  1B8R A;  1Q80 A;  3MSE B;  1QV0 A;  2F3Y A;  5CSJ A;  2KSP A;  3VRO A;  5PAL A;  2PSR A;  1IG5 A;  3OP0 A;  1L2O B;  4YGD B;  4CPV A;  3TS5 C;  1OZO A;  1X02 A;  1R6P A;  2K0J A;  1IKU A;  2LNK A;  1DGV A;  2KFF A;  1DJW A;  2BBN A;  2CCM A;  4GAO A;  3I5H C;  3JVT C;  1DF0 A;  2FJU B;  3EVU A;  1S5G Z;  4MZL A;  4XJK A;  5D69 A;  1KWO C;  4CID A;  1S1E A;  3AAJ A;  4YGB B;  1CLB A;  5AXI A;  1IQ3 A;  3SIA A;  1J1E A;  4JQ0 D;  3TUY B;  1TIZ A;  5CSI A;  1OMR A;  2BL0 B;  4MZK A;  3FIA A;  4QJ3 B;  4BY4 A;  1SY9 A;  4FQO A;  4WQ3 A;  3FWB A;  2ZN8 A;  5DKQ A;  4F0Z B;  3PM8 A;  4NDD A;  1QX2 A;  1B9A A;  2LLT A;  1GQM A;  3TDZ A;  1PVB A;  5BPJ A;  3EVV A;  2CNP A;  3BOW A;  4OR9 B;  1KK8 B;  3K21 A;  1OSA A;  3A4U B;  4MZJ A;  1BT6 A;  1JBA A;  1QIW A;  1YVL A;  3GK2 A;  4HSZ A;  4CLN A;  1GGZ A;  1J7O A;  1SNL A;  3LLE A;  2LLS A;  1BMO A;  1S6I A;  3I5I C;  3QRX A;  3TZ1 A;  1MUX A;  3AAK A;  1CMG A;  4YGA A;  5JOL A;  1J7P A;  2M3W A;  4DIR A;  1ZAC A;  1D1O A;  2VRG A;  2ZND A;  1XK4 C;  2Y1N A;  4PHK A;  1IWQ A;  1UUR A;  1Y0V H;  3DVE A;  3PN7 C;  1OQP A;  1G4Y R;  1M45 A;  4IL1 A;  1SMG A;  2L2E A;  4CFQ A;  5HKY A;  1WRL A;  3VRR A;  1QVI Y;  2LHI A;  4R1E A;  4ORC B;  1DGU A;  2O60 A;  1A4P A;  3BUM B;  5TNC A;  2NXQ A;  1S3P A;  2HET A;  2O5G A;  1IRJ A;  2M9G A;  1HQV A;  3EK7 A;  1DJX A;  2ZNE A;  3RM1 A;  1IH0 A;  1AJ4 A;  1S26 D;  2QAC A;  1ZOT B;  4ZCU A;  1IQ5 A;  1PRW A;  4Q04 A;  2E30 A;  2K7B A;  3TDU A;  1DF0 B;  1SCM B;  4N1G A;  2KAV A;  3KEV A;  3SG4 A;  2JT8 A;  2KQY A;  1BR1 B;  2JTT A;  2JXC A;  1OMV A;  2JPT A;  1SPY A;  1XVJ A;  2KGB C;  3SG5 A;  1JFJ A;  1CMF A;  1QV1 A;  3I5G C;  1QVI Z;  2ZRT A;  3CLN A;  2JNF A;  1UHI A;  2M7L A;  1B7T Y;  1G33 A;  1XK4 A;  4AQI A;  2AAO A;  2K2A A;  5J3X A;  1CDN A;  1K8U A;  1SYM A;  3AKA A;  2K7C A;  4ZCV A;  1UHN A;  3BOW B;  3IQQ A;  3CR2 A;  1LXF C;  1AJ5 A;  2HQW A;  3VGO A;  2WC8 A;  1CFD A;  1RTP 1;  3TS5 B;  1V1F A;  2OS8 C;  2LV7 A;  4FTG A;  4PCW A;  1KK7 Y;  1JF0 A;  4C0J A;  4TNC A;  2LAP A;  3OX5 A;  1EL4 A;  1RWY A;  2LVV A;  4OCI A;  1KQM C;  3I5H B;  3SG3 A;  3JVT B;  4AOM A;  1F8H A;  1QTX A;  2BCA A;  3JTD C;  3WXA A;  1S6C A;  1KWO B;  4GPL B;  1CFP A;  2L0P A;  2L51 A;  1QS7 A;  2NCP A;  2KDH A;  4GBA A;  4C0K A;  3O4Y A;  5GQQ C;  5HKW A;  4CFR A;  2KBI A;  3CR5 X;  2JT0 A;  1M39 A;  2R2I A;  1A75 A;  1OZS A;  3M0W A;  1CFC A;  1MWN A;  1QXP A;  4OKH A;  4YI9 A;  1A2X A;  2KYF A;  3SG7 A;  2RGI A;  2ZFD A;  3PFV A;  4NDC A;  1H8B A;  3DF0 A;  1U5I A;  2M0R A;  3IF7 A;  4ORB B;  1KK7 Z;  1TNW A;  1C7W A;  3PSR A;  1MXE A;  4HRE E;  2LVI A;  1TCF A;  1BJF A;  1YX7 A;  5DKR A;  4JWQ A;  1B4C A;  2V53 A;  1CM4 A;  2WCF A;  5D7F A;  5CSF A;  1KCY A;  1B8C A;  1M31 A;  2L4I A;  3I5I B;  4P5O E;  1F70 A;  2JQ6 A;  1M63 B;  2NLN A;  1BU3 A;  1ZFS A;  1XA5 A;  3BUW B;  3DVM A;  3O2P A;  4USL A;  1F54 A;  4OV2 A;  1C07 A;  4PE0 A;  2JNX A;  2KQ6 A;  4YGC B;  2OPO A;  3PN7 B;  1J7R A;  3CS1 A;  3FWC A;  2H61 C;  3CGA A;  3BQ3 A;  5I2Q A;  3CZT X;  5B8I B;  1TNP A;  2PAS A;  2JUL A;  2WOR A;  1YUU A;  3KF9 A;  5AFP A;  1K94 A;  5FYX A;  1RFJ A;  1FPW A;  3ZNI A;  2ZKM X;  1NX3 A;  1C7V A;  3KO0 A;  4DRW A;  3A8R A;  4GGN A;  2K2F A;  1NCZ A;  4DUQ A;  1JSA A;  2LCP A;  4WQ2 A;  4MRY A;  4HRH A;  3LK1 A;  1EXR A;  4MN0 A;  1BLQ A;  1SW8 A;  1PSR A;  1CFF A;  1F71 A;  1XFU O;  1XYD A;  3HX4 A;  2KGR A;  1SKT A;  2BBM A;  4P2Y B;  1QIV A;  1W7I B;  5JJG A;  5CPV A;  2Y4Q A;  1QLK A;  3I5G B;  1DVI A;  1SL8 A;  2D8N A;  2HQ8 A;  1WDC B;  1R2U A;  3NSK A;  1ODB A;  4QJ4 B;  1YUR A;  2JT3 A;  3D0Y A;  2H61 A;  2DOQ A;  2MLF C;  3IQO A;  4HRG A;  1L2O C;  1QX7 A;  5DKN A;  1BG1 A;  2BKI B;  1NYA A;  3PLF B;  2BCB A;  3LK0 A;  1TNX A;  1F4O A;  4NQG A;  4YI8 A;  1FBV A;  2CT9 A;  2WND A;  2LMU A;  1EJ3 A;  3GK4 X;  2K8M B;  1UHK A;  2MA2 A;  1YR5 A;  4YBH B;  1RJV A;  1M46 A;  1WLZ A;  1WLM A;  2OS8 B;  1NCX A;  2FCE A;  4N1F A;  3H4S E;  2OTG C;  3F45 A;  3I5F C;  3KPX A;  2BL0 C;  2G9B A;  1CB1 A;  3NSL A;  1BOD A;  2Q91 A;  1DJI A;  1KQM B;  1PSB A;  4MSP A;  4PE4 A;  4XJK B;  4UPG A;  2I2R E;  3JTD B;  2LHL A;  2M49 B;  1K9K A;  1SBJ A;  3PAT A;  1BR4 B;  3NXA A;  2MHH A;  1XFW O;  2I7A A;  2PRU A;  1TTX A;  4NDB A;  1V1G A;  1YX8 A;  2LE9 B;  5KSZ A;  1AHR A;  1NP8 A;  1OOJ A;  4I5L B;  3BXK A;  1LA0 A;  4PAL A;  1ALV A;  2F3Z A;  2LLU A;  1SL7 A;  1SR6 C;  1AP4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...