3O2PA

A dual e3 mechanism for rub1 ligation to cdc53: dcn1(p)-cdc53(whb)
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
199
structure length
199
Chain Sequence
b'YPKELTQVFEHYINNNLFDIDSLVKFIEELGYNLEDLATLCLAHLLGYKKLEEPLKREDFLSTWFMQGCSTISDMQECIKTLDVKLHEDLQYFTQIYNYAFNLILDPNRKDIDTDEGIQYWKLFFQPEYPVRMEPDLLEAWFRFLRDEGKTTISKDTWRMLLLFFKRYPTIQKIISDYDETAAWPFIIDEFYECLQDQQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Defective in cullin neddylation protein 1
publication title A dual E3 mechanism for Rub1 ligation to Cdc53.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Ligase, cell cycle
total genus 68
structure length 199
sequence length 199
ec nomenclature
pdb deposition date 2010-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03556 Cullin_binding Cullin binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3o2pA01
1NWDA 4U8DA 2G9BA 3D0YB 2ZN8A 4PDZA 1K9PA 4USLA 1ALWA 5PALA 4YBHB 2FOTA 2GV5A 1TNWA 2BBMA 5I8NA 1ZMZA 2JT3A 2LM5A 3I5HB 3EVRA 4YRUA 2H61A 1PRWA 1W7JB 2B1UA 1F4QA 2MAZA 2KAVA 4JWQA 2KQYA 4MBEA 5DKRA 1MQ1A 4HREE 2FCEA 4MRXA 2ZKMX 4NDBA 1DT7B 4CFQA 1BF5A 2GGMA 3I5GB 2JTTA 1FPWA 3PN7C 1KQMB 4MZKA 1YUTA 1AK8A 1B9AA 1R2UA 4HRGA 2BBNA 2DOQA 1UHJA 1KSMA 2G2BA 2K8MB 2IS9A 2BKHB 2QACA 1MXEA 4QJ3B 1L2OC 3OX5A 1FI5A 1SPYA 1WDCB 1WLZA 1NSHA 4WQ3A 2F3ZA 2JT0A 5D69A 1QV0A 1BT6A 1QS7A 5KTYA 3TUYC 1QXPA 4XYNA 5I2QA 1YURA 1KWOC 4AQJA 1KFXS 1D1OA 4DS7A 1SNLA 1W7IB 4L9MA 4PHMA 4F0ZB 1NUBA 2LUCA 1TCOB 3EK4A 1BMOA 1SW8A 1JF2A 2LMUA 2K2FA 2PMYA 3CR5X 3DF0B 3DVEA 2LHIA 2KFGA 2LLTA 5KSZA 1XK4A 2EHBA 1UUSA 2LUXA 2P6BB 2L50A 4MLWA 2KI6C 4CLNA 1NYAA 4FQOA 3GOFA 1UHNA 4HRHA 3DVKA 5DKNA 1FI6A 3LK1A 1SYMA 1DJYA 3WXAA 1DGUA 1TNQA 1S36A 1YX8A 1H8BA 4DRWA 1Y6WA 1DJGA 2E30A 3KHEA 1K90D 2BE6A 2F2PA 4PE4A 1FBVA 1QV1A 1LA3A 2Y4QA 2D8NA 1SCMB 3LCPC 5I2OA 1PVBA 1JFKA 3DVMA 3E3RA 5AERA 5ER4X 1B7TZ 1N2DA 1QX5B 1KWOB 2MLEC 1OMRA 3SIBA 3SG2A 2QPTA 2JOJA 3PM8A 3CTNA 1A75B 3DVJA 1GQMA 2OS8C 2M0RA 3GK1A 3NSIA 2M1UA 3BUMB 1F55A 2KQ6A 1QIVA 2Y1NA 3TDUA 3SIAA 1Y1XA 1YR5A 4DIRA 4A4CA 1ZUZA 1XO5A 2CNPA 4R1EA 1CDMA 4AOMA 1K95A 2I18A 1IH0A 2ZN9A 1SBJA 2CXJA 1SL7A 1RROA 4A4BA 1EJ3A 4GFTA 2MRDA 1U5IA 1DJXA 1PK0D 1OQPA 2K7CA 4ORBB 3C1VA 3IF7A 1QTXA 1MR8A 2KYCA 2LVVA 1MF8B 3BXKA 3BUNB 4YGDB 3OB1B 1YVLA 2PSRA 2L4HA 1WRZA 2RGIA 4MEWA 4XJKA 3PALA 3VRPA 3VRNA 1ALVA 5KU1A 1AVSA 1BR1B 1DF0B 3EKJA 3BYAA 1SKTA 1UHHA 1KK8C 1CDPA 1MWNA 2OS8B 2LP3A 4OCIA 1XFZO 5AXIA 3NSOA 2BKIB 2H61C 2F8PA 4OVNF 1Y1UA 1DJHA 1AHRA 5CSNA 1N0YA 1MXLC 1NX0A 3TDZA 4C0KA 5CSFA 1G33A 1WLMA 2H2KA 1QLSA 1KFUS 1S3PA 1C7WA 2FJUB 1KK7Z 1LKJA 3NXAA 3SJSA 1PULA 3ICBA 1JC2A 3MSEB 1AJ4A 1K8UA 2NXQA 2WNDA 2K61A 3JTDC 2JPTA 2M3WA 2M97A 1K96A 1V1FA 3TDIA 1KSOA 2M1KB 2K0JA 2K7OA 1XVJA 2FCDA 3D0YA 4WRIA 4BY4A 1YX7A 5HKYA 2JWWA 1F71A 1F54A 2PRUA 1AUIB 1N65A 1XFYO 3HX4A 4YGBB 1R6PA 1XYDA 5JOLA 1SL9A 2L98A 1XK4C 1VRKA 3AKAA 3TS5C 5CPVA 1XFXO 1LVCD 3I5IC 4QJ5B 2BECA 1JSAA 1M45A 2NCOA 4JQ0D 1GJYA 2LV7A 1JF0A 1J7PA 4GGNA 4HSZA 3NSKA 1B4CA 3CZTX 1Y0VH 2I7AA 5BPJA 2KYFA 4E68A 3JTDB 2AMIA 2HF5A 2JXCA 3GK2A 2NZ0A 1SY9A 2A4JA 1S5GZ 2HPSA 2K7BA 2Y5IA 4OR9B 1J7OA 1LA0A 1BG1A 3I5FC 5HLOA 4C0JA 2HETA 3K21A 1OMDA 2EC6C 4MN0A 1QIWA 2PVBA 1BU3A 3CWGA 1QJTA 1NCYA 3OP0A 3PN7B 2M29A 1B8RA 4MZLA 2BL0C 2WORA 5F6TA 3TS5B 1F4OA 2M8UA 3SG7A 3WNXB 2WCBA 3DF0A 1BOCA 1TNPA 2WC8A 3JVTC 3SG3A 3SG5A 3KEVA 5B8IB 1KFXL 1L2OB 3CLNA 4WQ2A 3AKBA 1SMGA 4P2YB 1CLLA 4GGFC 3TUYB 1QVIY 1OZSA 1M39A 2F33A 3CGAA 2LC5A 1ODBA 1AJ5A 1JWDA 4CIDA 2OTGC 3FIAA 4I5NB 1NCZA 2BCAA 1SR6C 2LVJA 4MRYA 1EG3A 1TN4A 2SCPA 3TZ1A 1CFFA 2TN4A 4M2OA 1S6IA 1HQVA 2LE9B 1OE9B 1PALA 1UURA 2M7NA 2KOTA 3I5FB 4N1GA 2WCEA 4C0LA 3KPXA 1LINA 1RJVA 1CFCA 1NX2A 1KCYA 1IWQA 2KAYA 3IQQA 5AANA 3O2PA 2EC6B 2L51A 2KGBC 2VRGA 1RFJA 1S1EA 1G8IA 5J3XA 4YGCB 4UPGA 1XFVO 1CDLA 1RTP1 4YGAA 1FF1A 4OV2A 3D10A 3JVTB 1LXFC 3IQOA 1CFPA 2JRFA 4CPVA 3RLZA 3WHUB 3KF9A 1ZOTB 1GGWA 3PFVA 1OZOA 1DVIA 1PVAA 1U5IB 2JQ6A 3AAKA 5TNCA 1L7ZA 4PHKA 1UP5A 1EXRA 2AAOA 4YI9A 1E8AA 2OTGB 1C07A 3BOWB 1FW4A 3GK4X 1CTRA 2GGZA 1CLBA 1DTLA 5DKQA 4TNCA 2KFFA 3M0WA 4Q04A 2CTNA 2JC2A 2BCXA 4YGEB 1M46A 2MHHA 1TIZA 1PSRA 1J7RA 3A4UB 3BUWB 5GQQC 4DCKA 4DUQA 2LMTA 1DF0A 1PSBA 1CLMA 1Q80A 3ZWHA 4ICBA 1B1GA 3I5HC 1CMFA 1G4YR 1DJWA 1F70A 2I94A 4FTGA 4PE0A 1V1GA 3CR4X 3OHMB 4ORCB 1K9UA 2M9GA 2E6WA 1TTXA 5I2LA 3FWCA 1AP4A 2LLUA 2CBLA 1X02A 2JXLA 2F3YA 3I5GC 1NX3A 1UHIA 3BUXB 4QJ4B 1XFWO 4CFRA 1K94A 1NP8A 1RWYA 3O6BA 1KK8B 1M31A 4I5LB 2L0PA 2LHLA 5CSJA 1KFUL 1SCVA 1WDCC 3ZNIA 2LP2A 3VROA 2O5GA 4PALA 1F8HA 1B7TY 3SG4A 2MLFC 3VRQA 3VGOA 5IBWA 2PALA 2K2AA 1HT9A 3VRRA 4ZCUA 4PHJA 1OOJA 1IQ3A 3NSLA 5HKZA 2MJWB 1YUSA 4IL1A 1MUXA 2CT9A 5AEQA 1CMGA 2JZIA 1B8CA 5FYXA 1EH2A 1DJIA 4MZJA 1A4PA 2LLSA 1YRTB 1TRFA 1IJ6A 3EK8A 3DD4A 5HLVA 4NDDA 3PSRA 4M2PA 1M63B 2CCMA 1S6CA 3EK7A 1IGVA 2KI6D 1SK6D 2KNEA 4GUKA 1BODA 5CSIA 2ZNDA 3A8RA 2JTZA 3OX6A 1UHKA 1QX7A 2LAPA 3CS1A 2AUCA 1J1EA 1S26D 4JPZB 2BE4A 5D7FA 5HKWA 2R2IA 1XA5A 5JJGA 1SCMC 1NX1A 2KSPA 2KAXA 1UWOA 2COLB 3I5IB 4NQGA 1YVHA 1B47A 3LK0A 1S6JA 1Y1AA 3BQ3A 1IKUA 1JUOA 1J1DA 3SG6A 2JT8A 2O60A 1NIWA 1CM1A 1ZACA 3O78A 3LLEA 1KQVA 5ER5A 1BR4B 4GPLB 1QLKA 2PASA 1BJFA 4GBAA 2L5XB 4NDCA 2JU0A 1K9KA 1RECA 2KHNA 2LANA 1NPQA 2MA2A 1KK7Y 2JNXA 3O4YA 1YUUA 1CNPA 3BUOB 4N1FA 1BLQA 2ZFDA 2WOSA 2WCFA 3FS7A 4ORAB 1CB1A 4P5OE 2KBIA 4AQIA 2KI4C 1SRAA 2OPOA 5HYDA 1ZFSA 2BL0B 1A29A 1A75A 2Y1MA 1IRJA 3CR2A 3QRXA 3EKHA 5K89A 1DMOA 2SASA 1XFUO 1YRUB 4BY5A 1CDNA 1QATA 2EGDA 4D1EA 3HCMA 1CKKA 2NLNA 1H4BA 4GAOA 1DJZA 5G08A 1K93D 2HQ8A 2I2RE 3KO0A 4PHNA 2LCPA 1JBAA 2JULA 1K2HA 1TCFA 1SR6B 5AFPA 1SL8A 4N5XA 1JFJA 1CM4A 2KFHA 1J55A 2ISDA 2MBXA 1QASA 2M49B 4XJKB 4MSPA 1A03A 1B8LA 4I5KA 2L2EA 1NCXA 4GGFA 1EG4A 1MHOA 1IG5A 4PCWA 1C7VA 2LNKA 2KI4B 3BOWA 1RK9A 1A2XA 2KBMA 2Q91A 2LVKA 1S5GY 2JNFA 1YTZC 2KGRA 2ZRTA 4ETOA 1IJ5A 3OB2B 3AAJA 1WRKA 1WY9A 4PE1A 2Q4UA 4MVFA 2L4IA 3PATA 3H4SE 2NCPA 1EL4A 1OSAA 4M2QA 1J7QA 3WHTB 2V53A 2K7DA 3F45A 2LVIA 4YI8A 3EVVA 1TOPA 3RM1A 2M7LA 1KQMC 3LL8B 1QVIZ 4I5JA 4OKHA 1IQ5A 3EVUA 3PLFB 4PE7A 2F2OA 2HQWA 1GGZA 1OMVA 2BCBA 1CFDA 2ZRSA 4GNKB 1QX2A 1TNXA 2KDHA 1DGVA 1WRLA 2ZNEA 3FWBA 2LMVA 4ZCVA
chains in the Genus database with same CATH superfamily
1NWDA 4U8DA 2G9BA 3D0YB 2ZN8A 4PDZA 1K9PA 4USLA 1IIOA 1ALWA 5PALA 4YBHB 2FOTA 1C3ZA 1TNWA 2GV5A 2BBMA 2QEBA 1ZMZA 5I8NA 2JT3A 2LM5A 3I5HB 3EVRA 4YRUA 2H61A 1PRWA 1W7JB 2QDIA 2B1UA 1F4QA 2MAZA 2KAVA 4JWQA 2KQYA 4MBEA 5DKRA 4OZDA 1MQ1A 4HREE 2FCEA 4MRXA 2ZKMX 4NDBA 1DT7B 4CFQA 2GTEA 1BF5A 2GGMA 3I5GB 2JTTA 1FPWA 3PN7C 1KQMB 4MZKA 1YUTA 1AK8A 1B9AA 1R2UA 4HRGA 2BBNA 2DOQA 1UHJA 1KSMA 2G2BA 3UNWA 2K8MB 2IS9A 2BKHB 2QACA 3R1VA 1MXEA 4QJ3B 1L2OC 3OX5A 1FI5A 1SPYA 1WDCB 1WLZA 1NSHA 4WQ3A 2F3ZA 2JT0A 5D69A 1QV0A 1BT6A 1QS7A 3S0DA 5KTYA 3TUYC 1QXPA 4XYNA 5I2QA 1TUZA 1YURA 4KYNA 1KWOC 4AQJA 1KFXS 1D1OA 4DS7A 1SNLA 1W7IB 4L9MA 4PHMA 4F0ZB 1NUBA 2LUCA 1TCOB 3EK4A 1BMOA 3B88A 1SW8A 1JF2A 2LMUA 2K2FA 2PMYA 3CR5X 2WC6A 3DF0B 3DVEA 2LHIA 2KFGA 2LLTA 5KSZA 1XK4A 2EHBA 1UUSA 2LUXA 2P6BB 1ORGA 2L50A 3PJIA 4MLWA 2KI6C 4CLNA 1NYAA 3PM2A 4FQOA 3GOFA 1UHNA 4HRHA 3DVKA 5DKNA 1FI6A 3LK1A 1C3YA 3CZ2A 1SYMA 1DJYA 3WXAA 1DGUA 1TNQA 1S36A 1YX8A 1H8BA 4DRWA 1Y6WA 2WCHA 1DJGA 2E30A 3KHEA 1K90D 2BE6A 2F2PA 4PE4A 3S0EA 1FBVA 1QV1A 1W9ZA 1LA3A 2Y4QA 2D8NA 1SCMB 3LCPC 5I2OA 1PVBA 1JFKA 3DVMA 3E3RA 1QWVA 5D3OA 5ER4X 1B7TZ 2FJYA 1N2DA 5AERA 1QX5B 1KWOB 2MLEC 1OMRA 3SIBA 2K60A 3SG2A 1SSEB 2QPTA 2JOJA 3PM8A 3CTNA 1A75B 3DVJA 1GQMA 2OS8C 2M0RA 3GK1A 3NSIA 3OBVA 2M1UA 3BUMB 3R1PA 2KQ6A 1F55A 1QIVA 2Y1NA 1TWOA 3TDUA 3SIAA 1Y1XA 1YR5A 4DIRA 3BFHA 4A4CA 1ZUZA 1XO5A 2CNPA 3D77A 4R1EA 1CDMA 4AOMA 1K95A 2I18A 1IH0A 2ZN9A 1SBJA 2CXJA 1SL7A 1RROA 4A4BA 1EJ3A 4GFTA 2MRDA 1U5IA 1DJXA 1PK0D 1OQPA 2K7CA 3L4AA 4ORBB 3C1VA 3IF7A 3EG5B 1QTXA 1MR8A 2KYCA 2LVVA 3VB1A 1MF8B 3BXKA 3BUNB 4YGDB 3OB1B 1YVLA 2P71A 1DELA 2PSRA 2L4HA 3NHTA 1WRZA 2RGIA 4MEWA 3FE6A 4XJKA 3PALA 3VRPA 3VRNA 1ALVA 5KU1A 1AVSA 1BR1B 1DF0B 3EKJA 3BYAA 1SKTA 3DXLA 1UHHA 1KK8C 1CDPA 1MWNA 2OS8B 2QEVA 2LP3A 2L5YA 4OCIA 1XFZO 5AXIA 3NSOA 2BKIB 2H61C 2F8PA 4OVNF 1Y1UA 1DJHA 1AHRA 5CSNA 1N0YA 1MXLC 1NX0A 3TDZA 4C0KA 5CSFA 1G33A 1WLMA 2H2KA 1QLSA 1KFUS 1S3PA 2JPOA 1C7WA 2FJUB 1KK7Z 1OOHA 1LKJA 3NXAA 3SJSA 1PULA 3ICBA 1Z2CB 1JC2A 3MSEB 1DQEA 1AJ4A 1K8UA 2NXQA 2WNDA 2K61A 3JTDC 2JPTA 2M3WA 2M97A 1K96A 1V1FA 5FI7A 1KSOA 2M1KB 3TDIA 2K0JA 2K7OA 1XVJA 2FCDA 3D0YA 4WRIA 4BY4A 1YX7A 5HKYA 2JWWA 1F71A 1F54A 2PRUA 1AUIB 1N65A 1XFYO 4INWA 3HX4A 4YGBB 3K1EA 1R6PA 1XYDA 5JOLA 1SL9A 2L98A 1XK4C 1VRKA 3AKAA 3TS5C 3FE9A 5CPVA 1XFXO 1LVCD 3I5IC 4QJ5B 2BECA 1JSAA 1M45A 2NCOA 4JQ0D 1GJYA 2LV7A 1JF0A 1J7PA 4GGNA 4HSZA 3NSKA 3FE8A 1B4CA 3CZTX 1Y0VH 2I7AA 5BPJA 2KYFA 1DC1A 4E68A 3JTDB 2AMIA 2HF5A 2JXCA 3GK2A 2NZ0A 1SY9A 2A4JA 1S5GZ 2HPSA 2K7BA 2Y5IA 4OR9B 1J7OA 1LA0A 1BG1A 3I5FC 5HLOA 4C0JA 2HETA 2L2CA 3CABA 1TUJA 3B6XA 1OMDA 3K21A 2EC6C 4MN0A 1QIWA 2PVBA 1BU3A 3CWGA 1QJTA 1NCYA 2QEHA 3OP0A 2M29A 1B8RA 3PN7B 4MZLA 2BL0C 2WORA 2PQLA 5F6TA 3TS5B 3B86A 1F4OA 2M8UA 3SG7A 3WNXB 2WCBA 3V2LA 3DF0A 1BOCA 3BJHA 1TNPA 2WC8A 3JVTC 3SG3A 3SG5A 3KEVA 5B8IB 1KFXL 5EL2A 1L2OB 3CLNA 4WQ2A 3AKBA 1P28A 1SMGA 4P2YB 1CLLA 2WC5A 4GGFC 3TUYB 1QVIY 1OZSA 1M39A 1OOIX 2F33A 2LC5A 1ODBA 1AJ5A 3CGAA 1JWDA 4CIDA 2OTGC 3FIAA 4I5NB 1NCZA 2BCAA 1SR6C 2LVJA 4MRYA 1EG3A 1TN4A 2SCPA 4PT1A 3TZ1A 3S0FA 1CFFA 3O4XA 1GM0A 2TN4A 4M2OA 1S6IA 1HQVA 2LE9B 1OE9B 1PALA 1UURA 2M7NA 2KOTA 3I5FB 4N1GA 2WCEA 4C0LA 1Z4HA 1LINA 3KPXA 1RJVA 1CFCA 1NX2A 3S0BA 1IWQA 2KAYA 3IQQA 5AANA 1KCYA 3O2PA 2EC6B 2L51A 5FI6A 4JD9A 3D78A 2KGBC 2VRGA 1RFJA 1S1EA 1G8IA 5J3XA 4YGCB 4UPGA 1XFVO 3CZ1A 2WCKA 1CDLA 1RTP1 4YGAA 1FF1A 4OV2A 3D10A 3JVTB 1LXFC 3IQOA 3L4LA 3DYEA 1CFPA 2JRFA 4CPVA 3RLZA 3WHUB 3KF9A 3D76A 1ZOTB 1GGWA 3PFVA 1OZOA 1DVIA 1PVAA 1U5IB 2JQ6A 3AAKA 5TNCA 1L7ZA 4PHKA 1UP5A 1EXRA 2AAOA 4YI9A 1E8AA 2OTGB 1C07A 3BOWB 1FW4A 3CZ0A 3GK4X 1CTRA 2GGZA 1CLBA 1DTLA 5DKQA 4TNCA 2KFFA 3M0WA 4Q04A 2CTNA 2JC2A 2BCXA 4YGEB 1M46A 2MHHA 1TIZA 1PSRA 1J7RA 3A4UB 5HL1A 3BUWB 5GQQC 4DCKA 4DUQA 2LMTA 2WCJA 1DF0A 1PSBA 1CLMA 1Q80A 3S0GA 3ZWHA 4ICBA 1B1GA 3I5HC 1CMFA 1G4YR 1DJWA 1F70A 2I94A 4FTGA 3L47A 4PE0A 1V1GA 2WCLA 3CR4X 3OHMB 4ORCB 1K9UA 2M9GA 2E6WA 1TTXA 5I2LA 3FWCA 1AP4A 2LLUA 2CBLA 1X02A 2JXLA 2F3YA 3I5GC 1NX3A 3R1OA 2H8VA 1UHIA 3BUXB 4QJ4B 1XFWO 4CFRA 1K94A 1NP8A 1RWYA 3O6BA 1KK8B 1M31A 4I5LB 2L0PA 2LHLA 5CSJA 1KFUL 1SCVA 1WDCC 3ZNIA 2LP2A 3VROA 2O5GA 4PALA 1F8HA 3D75A 1B7TY 2ERBA 3R72A 3SG4A 2MLFC 3VRQA 3S0AA 1T14A 3VGOA 5IBWA 2PALA 2K2AA 3BFBA 1HT9A 1OW4A 3VRRA 4ZCUA 4PHJA 1OOJA 1IQ3A 3NSLA 5HKZA 2MJWB 1YUSA 4IL1A 3B87A 1MUXA 2CT9A 3SS4A 5AEQA 1CMGA 2JZIA 1B8CA 5FYXA 1EH2A 1DJIA 4MZJA 1A4PA 2LLSA 1YRTB 1TRFA 1IJ6A 3EK8A 3DD4A 3IVTA 4NDDA 5HLVA 3D73A 3PSRA 4M2PA 1M63B 2CCMA 1S6CA 3EK7A 1IGVA 2KI6D 1SK6D 2KNEA 4GUKA 1BODA 5CSIA 2ZNDA 3A8RA 2JTZA 3OX6A 1UHKA 1QX7A 2LAPA 3CS1A 2AUCA 1J1EA 1S26D 4JPZB 3N7HA 2BE4A 5D7FA 5HKWA 2R2IA 1XA5A 5JJGA 1SCMC 1NX1A 2KSPA 2KAXA 1UWOA 3SS3A 2COLB 3I5IB 4NQGA 1YVHA 1B47A 3LK0A 1S6JA 1Y1AA 3BQ3A 3QMEA 1JUOA 1IKUA 1J1DA 3SG6A 2JT8A 2O60A 1NIWA 1CM1A 1LS8A 1ZACA 2QEOA 3LLEA 3O78A 3SS5A 1KQVA 3OGNA 1BR4B 4GPLB 5ER5A 1QLKA 2PASA 1BJFA 4GBAA 2L5XB 3RZSA 4NDCA 2JU0A 1K9KA 1RECA 3NHIA 2KHNA 2LANA 1NPQA 2MA2A 1KK7Y 2JNXA 3O4YA 1YUUA 1CNPA 3BUOB 4N1FA 1BLQA 2ZFDA 2WOSA 2WCFA 3D74A 3FS7A 4ORAB 1CB1A 2BNXA 4P5OE 3CDNA 2KBIA 4AQIA 2KI4C 1SRAA 2OPOA 5HYDA 1ZFSA 2BL0B 1A29A 1A75A 2Y1MA 1IRJA 2KLEA 2KLDA 3CR2A 3QRXA 3EKHA 5K89A 1DMOA 2SASA 1XFUO 1YRUB 4BY5A 1CDNA 1QATA 2EGDA 4D1EA 3HCMA 1CKKA 2NLNA 1H4BA 5I94A 4GAOA 1DJZA 3NGVA 3DY9A 5G08A 1K93D 4IJ7A 4JKTA 2HQ8A 2I2RE 3KO0A 4PHNA 2LCPA 1XFRA 4F7FA 2JULA 1JBAA 1K2HA 1TCFA 1SR6B 5AFPA 1SL8A 4N5XA 1JFJA 1CM4A 2KFHA 1J55A 2BAPA 4FQTA 2MBXA 1QASA 2M49B 3B7AA 4MSPA 4XJKB 2ISDA 1A03A 1B8LA 4I5KA 2L2EA 1NCXA 4GGFA 1EG4A 1MHOA 1IG5A 4PCWA 3BFAA 3CYZA 2P70A 1C7VA 2LNKA 2KI4B 3BOWA 1RK9A 1A2XA 3Q8IA 2KBMA 2Q91A 2LVKA 1S5GY 2JNFA 1YTZC 2KGRA 2ZRTA 4ETOA 1IJ5A 1OOGA 3AAJA 1WRKA 1OOFA 1WY9A 2Q4UA 3OB2B 4PE1A 4MVFA 2L4IA 4INXA 3PATA 3H4SE 2NCPA 1EL4A 1OSAA 4M2QA 3UO9A 5FI2A 2V53A 2K7DA 3F45A 3WHTB 1J7QA 2LVIA 3DZTA 2KPHA 4YI8A 3EVVA 1TOPA 2PYQA 3RM1A 2M7LA 1KQMC 3LL8B 1QVIZ 4I5JA 4OKHA 1IQ5A 3EVUA 3PLFB 4PE7A 2F2OA 2HQWA 1GGZA 1OMVA 2BCBA 1CFDA 2ZRSA 4GNKB 1DEKA 1QX2A 5DICA 1TNXA 2KDHA 2WCMA 1DGVA 2YGUA 1WRLA 2ZNEA 3FWBA 2LMVA 4ZCVA
chains in the Genus database with same CATH topology
1NWDA 4U8DA 2G9BA 3D0YB 2ZN8A 4PDZA 1K9PA 4USLA 1ALWA 5PALA 4YBHB 2FOTA 2GV5A 1TNWA 2BBMA 5I8NA 1ZMZA 2JT3A 2LM5A 3I5HB 3EVRA 4YRUA 2H61A 1PRWA 1W7JB 2B1UA 1F4QA 2MAZA 2KAVA 4JWQA 2KQYA 4MBEA 5DKRA 1MQ1A 4HREE 2FCEA 4MRXA 2ZKMX 4NDBA 1DT7B 4CFQA 1BF5A 2GGMA 3I5GB 2JTTA 1FPWA 3PN7C 1KQMB 4MZKA 1YUTA 1AK8A 1B9AA 1R2UA 4HRGA 2BBNA 2DOQA 1UHJA 1KSMA 2G2BA 2K8MB 2IS9A 2BKHB 2QACA 1MXEA 4QJ3B 1L2OC 3OX5A 1FI5A 1SPYA 1WDCB 1WLZA 1NSHA 4WQ3A 2F3ZA 2JT0A 5D69A 1QV0A 1BT6A 1QS7A 5KTYA 3TUYC 1QXPA 4XYNA 5I2QA 1YURA 1KWOC 4AQJA 1KFXS 1D1OA 4DS7A 1SNLA 1W7IB 4L9MA 4PHMA 4F0ZB 1NUBA 2LUCA 1TCOB 3EK4A 1BMOA 1SW8A 1JF2A 2LMUA 2K2FA 2PMYA 3CR5X 3DF0B 3DVEA 2LHIA 2KFGA 2LLTA 5KSZA 1XK4A 2EHBA 1UUSA 2LUXA 2P6BB 2L50A 4MLWA 2KI6C 4CLNA 1NYAA 4FQOA 3GOFA 1UHNA 4HRHA 3DVKA 5DKNA 1FI6A 3LK1A 1SYMA 1DJYA 3WXAA 1DGUA 1TNQA 1S36A 1YX8A 1H8BA 4DRWA 1Y6WA 1DJGA 2E30A 3KHEA 1K90D 2BE6A 2F2PA 4PE4A 1FBVA 1QV1A 1LA3A 2Y4QA 2D8NA 1SCMB 3LCPC 5I2OA 1PVBA 1JFKA 3DVMA 3E3RA 5AERA 5ER4X 1B7TZ 1N2DA 1QX5B 1KWOB 2MLEC 1OMRA 3SIBA 3SG2A 2QPTA 2JOJA 3PM8A 3CTNA 1A75B 3DVJA 1GQMA 2OS8C 2M0RA 3GK1A 3NSIA 2M1UA 3BUMB 1F55A 2KQ6A 1QIVA 2Y1NA 3TDUA 3SIAA 1Y1XA 1YR5A 4DIRA 4A4CA 1ZUZA 1XO5A 2CNPA 4R1EA 1CDMA 4AOMA 1K95A 2I18A 1IH0A 2ZN9A 1SBJA 2CXJA 1SL7A 1RROA 4A4BA 1EJ3A 4GFTA 2MRDA 1U5IA 1DJXA 1PK0D 1OQPA 2K7CA 4ORBB 3C1VA 3IF7A 1QTXA 1MR8A 2KYCA 2LVVA 1MF8B 3BXKA 3BUNB 4YGDB 3OB1B 1YVLA 2PSRA 2L4HA 1WRZA 2RGIA 4MEWA 4XJKA 3PALA 3VRPA 3VRNA 1ALVA 5KU1A 1AVSA 1BR1B 1DF0B 3EKJA 3BYAA 1SKTA 1UHHA 1KK8C 1CDPA 1MWNA 2OS8B 2LP3A 4OCIA 1XFZO 5AXIA 3NSOA 2BKIB 2H61C 2F8PA 4OVNF 1Y1UA 1DJHA 1AHRA 5CSNA 1N0YA 1MXLC 1NX0A 3TDZA 4C0KA 5CSFA 1G33A 1WLMA 2H2KA 1QLSA 1KFUS 1S3PA 1C7WA 2FJUB 1KK7Z 1LKJA 3NXAA 3SJSA 1PULA 3ICBA 1JC2A 3MSEB 1AJ4A 1K8UA 2NXQA 2WNDA 2K61A 3JTDC 2JPTA 2M3WA 2M97A 1K96A 1V1FA 3TDIA 1KSOA 2M1KB 2K0JA 2K7OA 1XVJA 2FCDA 3D0YA 4WRIA 4BY4A 1YX7A 5HKYA 2JWWA 1F71A 1F54A 2PRUA 1AUIB 1N65A 1XFYO 3HX4A 4YGBB 1R6PA 1XYDA 5JOLA 1SL9A 2L98A 1XK4C 1VRKA 3AKAA 3TS5C 5CPVA 1XFXO 1LVCD 3I5IC 4QJ5B 2BECA 1JSAA 1M45A 2NCOA 4JQ0D 1GJYA 2LV7A 1JF0A 1J7PA 4GGNA 4HSZA 3NSKA 1B4CA 3CZTX 1Y0VH 2I7AA 5BPJA 2KYFA 4E68A 3JTDB 2AMIA 2HF5A 2JXCA 3GK2A 2NZ0A 1SY9A 2A4JA 1S5GZ 2HPSA 2K7BA 2Y5IA 4OR9B 1J7OA 1LA0A 1BG1A 3I5FC 5HLOA 4C0JA 2HETA 3K21A 1OMDA 2EC6C 4MN0A 1QIWA 2PVBA 1BU3A 3CWGA 1QJTA 1NCYA 3OP0A 3PN7B 2M29A 1B8RA 4MZLA 2BL0C 2WORA 5F6TA 3TS5B 1F4OA 2M8UA 3SG7A 3WNXB 2WCBA 3DF0A 1BOCA 1TNPA 2WC8A 3JVTC 3SG3A 3SG5A 3KEVA 5B8IB 1KFXL 1L2OB 3CLNA 4WQ2A 3AKBA 1SMGA 4P2YB 1CLLA 4GGFC 3TUYB 1QVIY 1OZSA 1M39A 2F33A 3CGAA 2LC5A 1ODBA 1AJ5A 1JWDA 4CIDA 2OTGC 3FIAA 4I5NB 1NCZA 2BCAA 1SR6C 2LVJA 4MRYA 1EG3A 1TN4A 2SCPA 3TZ1A 1CFFA 2TN4A 4M2OA 1S6IA 1HQVA 2LE9B 1OE9B 1PALA 1UURA 2M7NA 2KOTA 3I5FB 4N1GA 2WCEA 4C0LA 3KPXA 1LINA 1RJVA 1CFCA 1NX2A 1KCYA 1IWQA 2KAYA 3IQQA 5AANA 3O2PA 2EC6B 2L51A 2KGBC 2VRGA 1RFJA 1S1EA 1G8IA 5J3XA 4YGCB 4UPGA 1XFVO 1CDLA 1RTP1 4YGAA 1FF1A 4OV2A 3D10A 3JVTB 1LXFC 3IQOA 1CFPA 2JRFA 4CPVA 3RLZA 3WHUB 3KF9A 1ZOTB 1GGWA 3PFVA 1OZOA 1DVIA 1PVAA 1U5IB 2JQ6A 3AAKA 5TNCA 1L7ZA 4PHKA 1UP5A 1EXRA 2AAOA 4YI9A 1E8AA 2OTGB 1C07A 3BOWB 1FW4A 3GK4X 1CTRA 2GGZA 1CLBA 1DTLA 5DKQA 4TNCA 2KFFA 3M0WA 4Q04A 2CTNA 2JC2A 2BCXA 4YGEB 1M46A 2MHHA 1TIZA 1PSRA 1J7RA 3A4UB 3BUWB 5GQQC 4DCKA 4DUQA 2LMTA 1DF0A 1PSBA 1CLMA 1Q80A 3ZWHA 4ICBA 1B1GA 3I5HC 1CMFA 1G4YR 1DJWA 1F70A 2I94A 4FTGA 4PE0A 1V1GA 3CR4X 3OHMB 4ORCB 1K9UA 2M9GA 2E6WA 1TTXA 5I2LA 3FWCA 1AP4A 2LLUA 2CBLA 1X02A 2JXLA 2F3YA 3I5GC 1NX3A 1UHIA 3BUXB 4QJ4B 1XFWO 4CFRA 1K94A 1NP8A 1RWYA 3O6BA 1KK8B 1M31A 4I5LB 2L0PA 2LHLA 5CSJA 1KFUL 1SCVA 1WDCC 3ZNIA 2LP2A 3VROA 2O5GA 4PALA 1F8HA 1B7TY 3SG4A 2MLFC 3VRQA 3VGOA 5IBWA 2PALA 2K2AA 1HT9A 3VRRA 4ZCUA 4PHJA 1OOJA 1IQ3A 3NSLA 5HKZA 2MJWB 1YUSA 4IL1A 1MUXA 2CT9A 5AEQA 1CMGA 2JZIA 1B8CA 5FYXA 1EH2A 1DJIA 4MZJA 1A4PA 2LLSA 1YRTB 1TRFA 1IJ6A 3EK8A 3DD4A 5HLVA 4NDDA 3PSRA 4M2PA 1M63B 2CCMA 1S6CA 3EK7A 1IGVA 2KI6D 1SK6D 2KNEA 4GUKA 1BODA 5CSIA 2ZNDA 3A8RA 2JTZA 3OX6A 1UHKA 1QX7A 2LAPA 3CS1A 2AUCA 1J1EA 1S26D 4JPZB 2BE4A 5D7FA 5HKWA 2R2IA 1XA5A 5JJGA 1SCMC 1NX1A 2KSPA 2KAXA 1UWOA 2COLB 3I5IB 4NQGA 1YVHA 1B47A 3LK0A 1S6JA 1Y1AA 3BQ3A 1IKUA 1JUOA 1J1DA 3SG6A 2JT8A 2O60A 1NIWA 1CM1A 1ZACA 3O78A 3LLEA 1KQVA 5ER5A 1BR4B 4GPLB 1QLKA 2PASA 1BJFA 4GBAA 2L5XB 4NDCA 2JU0A 1K9KA 1RECA 2KHNA 2LANA 1NPQA 2MA2A 1KK7Y 2JNXA 3O4YA 1YUUA 1CNPA 3BUOB 4N1FA 1BLQA 2ZFDA 2WOSA 2WCFA 3FS7A 4ORAB 1CB1A 4P5OE 2KBIA 4AQIA 2KI4C 1SRAA 2OPOA 5HYDA 1ZFSA 2BL0B 1A29A 1A75A 2Y1MA 1IRJA 3CR2A 3QRXA 3EKHA 5K89A 1DMOA 2SASA 1XFUO 1YRUB 4BY5A 1CDNA 1QATA 2EGDA 4D1EA 3HCMA 1CKKA 2NLNA 1H4BA 4GAOA 1DJZA 5G08A 1K93D 2HQ8A 2I2RE 3KO0A 4PHNA 2LCPA 1JBAA 2JULA 1K2HA 1TCFA 1SR6B 5AFPA 1SL8A 4N5XA 1JFJA 1CM4A 2KFHA 1J55A 2ISDA 2MBXA 1QASA 2M49B 4XJKB 4MSPA 1A03A 1B8LA 4I5KA 2L2EA 1NCXA 4GGFA 1EG4A 1MHOA 1IG5A 4PCWA 1C7VA 2LNKA 2KI4B 3BOWA 1RK9A 1A2XA 2KBMA 2Q91A 2LVKA 1S5GY 2JNFA 1YTZC 2KGRA 2ZRTA 4ETOA 1IJ5A 3OB2B 3AAJA 1WRKA 1WY9A 4PE1A 2Q4UA 4MVFA 2L4IA 3PATA 3H4SE 2NCPA 1EL4A 1OSAA 4M2QA 1J7QA 3WHTB 2V53A 2K7DA 3F45A 2LVIA 4YI8A 3EVVA 1TOPA 3RM1A 2M7LA 1KQMC 3LL8B 1QVIZ 4I5JA 4OKHA 1IQ5A 3EVUA 3PLFB 4PE7A 2F2OA 2HQWA 1GGZA 1OMVA 2BCBA 1CFDA 2ZRSA 4GNKB 1QX2A 1TNXA 2KDHA 1DGVA 1WRLA 2ZNEA 3FWBA 2LMVA 4ZCVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NWD A;  4U8D A;  2G9B A;  3D0Y B;  2ZN8 A;  4PDZ A;  1K9P A;  4USL A;  1ALW A;  5PAL A;  4YBH B;  2FOT A;  2GV5 A;  1TNW A;  2BBM A;  5I8N A;  1ZMZ A;  2JT3 A;  2LM5 A;  3I5H B;  3EVR A;  4YRU A;  2H61 A;  1PRW A;  1W7J B;  2B1U A;  1F4Q A;  2MAZ A;  2KAV A;  4JWQ A;  2KQY A;  4MBE A;  5DKR A;  1MQ1 A;  4HRE E;  2FCE A;  4MRX A;  2ZKM X;  4NDB A;  1DT7 B;  4CFQ A;  1BF5 A;  2GGM A;  3I5G B;  2JTT A;  1FPW A;  3PN7 C;  1KQM B;  4MZK A;  1YUT A;  1AK8 A;  1B9A A;  1R2U A;  4HRG A;  2BBN A;  2DOQ A;  1UHJ A;  1KSM A;  2G2B A;  2K8M B;  2IS9 A;  2BKH B;  2QAC A;  1MXE A;  4QJ3 B;  1L2O C;  3OX5 A;  1FI5 A;  1SPY A;  1WDC B;  1WLZ A;  1NSH A;  4WQ3 A;  2F3Z A;  2JT0 A;  5D69 A;  1QV0 A;  1BT6 A;  1QS7 A;  5KTY A;  3TUY C;  1QXP A;  4XYN A;  5I2Q A;  1YUR A;  1KWO C;  4AQJ A;  1KFX S;  1D1O A;  4DS7 A;  1SNL A;  1W7I B;  4L9M A;  4PHM A;  4F0Z B;  1NUB A;  2LUC A;  1TCO B;  3EK4 A;  1BMO A;  1SW8 A;  1JF2 A;  2LMU A;  2K2F A;  2PMY A;  3CR5 X;  3DF0 B;  3DVE A;  2LHI A;  2KFG A;  2LLT A;  5KSZ A;  1XK4 A;  2EHB A;  1UUS A;  2LUX A;  2P6B B;  2L50 A;  4MLW A;  2KI6 C;  4CLN A;  1NYA A;  4FQO A;  3GOF A;  1UHN A;  4HRH A;  3DVK A;  5DKN A;  1FI6 A;  3LK1 A;  1SYM A;  1DJY A;  3WXA A;  1DGU A;  1TNQ A;  1S36 A;  1YX8 A;  1H8B A;  4DRW A;  1Y6W A;  1DJG A;  2E30 A;  3KHE A;  1K90 D;  2BE6 A;  2F2P A;  4PE4 A;  1FBV A;  1QV1 A;  1LA3 A;  2Y4Q A;  2D8N A;  1SCM B;  3LCP C;  5I2O A;  1PVB A;  1JFK A;  3DVM A;  3E3R A;  5AER A;  5ER4 X;  1B7T Z;  1N2D A;  1QX5 B;  1KWO B;  2MLE C;  1OMR A;  3SIB A;  3SG2 A;  2QPT A;  2JOJ A;  3PM8 A;  3CTN A;  1A75 B;  3DVJ A;  1GQM A;  2OS8 C;  2M0R A;  3GK1 A;  3NSI A;  2M1U A;  3BUM B;  1F55 A;  2KQ6 A;  1QIV A;  2Y1N A;  3TDU A;  3SIA A;  1Y1X A;  1YR5 A;  4DIR A;  4A4C A;  1ZUZ A;  1XO5 A;  2CNP A;  4R1E A;  1CDM A;  4AOM A;  1K95 A;  2I18 A;  1IH0 A;  2ZN9 A;  1SBJ A;  2CXJ A;  1SL7 A;  1RRO A;  4A4B A;  1EJ3 A;  4GFT A;  2MRD A;  1U5I A;  1DJX A;  1PK0 D;  1OQP A;  2K7C A;  4ORB B;  3C1V A;  3IF7 A;  1QTX A;  1MR8 A;  2KYC A;  2LVV A;  1MF8 B;  3BXK A;  3BUN B;  4YGD B;  3OB1 B;  1YVL A;  2PSR A;  2L4H A;  1WRZ A;  2RGI A;  4MEW A;  4XJK A;  3PAL A;  3VRP A;  3VRN A;  1ALV A;  5KU1 A;  1AVS A;  1BR1 B;  1DF0 B;  3EKJ A;  3BYA A;  1SKT A;  1UHH A;  1KK8 C;  1CDP A;  1MWN A;  2OS8 B;  2LP3 A;  4OCI A;  1XFZ O;  5AXI A;  3NSO A;  2BKI B;  2H61 C;  2F8P A;  4OVN F;  1Y1U A;  1DJH A;  1AHR A;  5CSN A;  1N0Y A;  1MXL C;  1NX0 A;  3TDZ A;  4C0K A;  5CSF A;  1G33 A;  1WLM A;  2H2K A;  1QLS A;  1KFU S;  1S3P A;  1C7W A;  2FJU B;  1KK7 Z;  1LKJ A;  3NXA A;  3SJS A;  1PUL A;  3ICB A;  1JC2 A;  3MSE B;  1AJ4 A;  1K8U A;  2NXQ A;  2WND A;  2K61 A;  3JTD C;  2JPT A;  2M3W A;  2M97 A;  1K96 A;  1V1F A;  3TDI A;  1KSO A;  2M1K B;  2K0J A;  2K7O A;  1XVJ A;  2FCD A;  3D0Y A;  4WRI A;  4BY4 A;  1YX7 A;  5HKY A;  2JWW A;  1F71 A;  1F54 A;  2PRU A;  1AUI B;  1N65 A;  1XFY O;  3HX4 A;  4YGB B;  1R6P A;  1XYD A;  5JOL A;  1SL9 A;  2L98 A;  1XK4 C;  1VRK A;  3AKA A;  3TS5 C;  5CPV A;  1XFX O;  1LVC D;  3I5I C;  4QJ5 B;  2BEC A;  1JSA A;  1M45 A;  2NCO A;  4JQ0 D;  1GJY A;  2LV7 A;  1JF0 A;  1J7P A;  4GGN A;  4HSZ A;  3NSK A;  1B4C A;  3CZT X;  1Y0V H;  2I7A A;  5BPJ A;  2KYF A;  4E68 A;  3JTD B;  2AMI A;  2HF5 A;  2JXC A;  3GK2 A;  2NZ0 A;  1SY9 A;  2A4J A;  1S5G Z;  2HPS A;  2K7B A;  2Y5I A;  4OR9 B;  1J7O A;  1LA0 A;  1BG1 A;  3I5F C;  5HLO A;  4C0J A;  2HET A;  3K21 A;  1OMD A;  2EC6 C;  4MN0 A;  1QIW A;  2PVB A;  1BU3 A;  3CWG A;  1QJT A;  1NCY A;  3OP0 A;  3PN7 B;  2M29 A;  1B8R A;  4MZL A;  2BL0 C;  2WOR A;  5F6T A;  3TS5 B;  1F4O A;  2M8U A;  3SG7 A;  3WNX B;  2WCB A;  3DF0 A;  1BOC A;  1TNP A;  2WC8 A;  3JVT C;  3SG3 A;  3SG5 A;  3KEV A;  5B8I B;  1KFX L;  1L2O B;  3CLN A;  4WQ2 A;  3AKB A;  1SMG A;  4P2Y B;  1CLL A;  4GGF C;  3TUY B;  1QVI Y;  1OZS A;  1M39 A;  2F33 A;  3CGA A;  2LC5 A;  1ODB A;  1AJ5 A;  1JWD A;  4CID A;  2OTG C;  3FIA A;  4I5N B;  1NCZ A;  2BCA A;  1SR6 C;  2LVJ A;  4MRY A;  1EG3 A;  1TN4 A;  2SCP A;  3TZ1 A;  1CFF A;  2TN4 A;  4M2O A;  1S6I A;  1HQV A;  2LE9 B;  1OE9 B;  1PAL A;  1UUR A;  2M7N A;  2KOT A;  3I5F B;  4N1G A;  2WCE A;  4C0L A;  3KPX A;  1LIN A;  1RJV A;  1CFC A;  1NX2 A;  1KCY A;  1IWQ A;  2KAY A;  3IQQ A;  5AAN A;  3O2P A;  2EC6 B;  2L51 A;  2KGB C;  2VRG A;  1RFJ A;  1S1E A;  1G8I A;  5J3X A;  4YGC B;  4UPG A;  1XFV O;  1CDL A;  1RTP 1;  4YGA A;  1FF1 A;  4OV2 A;  3D10 A;  3JVT B;  1LXF C;  3IQO A;  1CFP A;  2JRF A;  4CPV A;  3RLZ A;  3WHU B;  3KF9 A;  1ZOT B;  1GGW A;  3PFV A;  1OZO A;  1DVI A;  1PVA A;  1U5I B;  2JQ6 A;  3AAK A;  5TNC A;  1L7Z A;  4PHK A;  1UP5 A;  1EXR A;  2AAO A;  4YI9 A;  1E8A A;  2OTG B;  1C07 A;  3BOW B;  1FW4 A;  3GK4 X;  1CTR A;  2GGZ A;  1CLB A;  1DTL A;  5DKQ A;  4TNC A;  2KFF A;  3M0W A;  4Q04 A;  2CTN A;  2JC2 A;  2BCX A;  4YGE B;  1M46 A;  2MHH A;  1TIZ A;  1PSR A;  1J7R A;  3A4U B;  3BUW B;  5GQQ C;  4DCK A;  4DUQ A;  2LMT A;  1DF0 A;  1PSB A;  1CLM A;  1Q80 A;  3ZWH A;  4ICB A;  1B1G A;  3I5H C;  1CMF A;  1G4Y R;  1DJW A;  1F70 A;  2I94 A;  4FTG A;  4PE0 A;  1V1G A;  3CR4 X;  3OHM B;  4ORC B;  1K9U A;  2M9G A;  2E6W A;  1TTX A;  5I2L A;  3FWC A;  1AP4 A;  2LLU A;  2CBL A;  1X02 A;  2JXL A;  2F3Y A;  3I5G C;  1NX3 A;  1UHI A;  3BUX B;  4QJ4 B;  1XFW O;  4CFR A;  1K94 A;  1NP8 A;  1RWY A;  3O6B A;  1KK8 B;  1M31 A;  4I5L B;  2L0P A;  2LHL A;  5CSJ A;  1KFU L;  1SCV A;  1WDC C;  3ZNI A;  2LP2 A;  3VRO A;  2O5G A;  4PAL A;  1F8H A;  1B7T Y;  3SG4 A;  2MLF C;  3VRQ A;  3VGO A;  5IBW A;  2PAL A;  2K2A A;  1HT9 A;  3VRR A;  4ZCU A;  4PHJ A;  1OOJ A;  1IQ3 A;  3NSL A;  5HKZ A;  2MJW B;  1YUS A;  4IL1 A;  1MUX A;  2CT9 A;  5AEQ A;  1CMG A;  2JZI A;  1B8C A;  5FYX A;  1EH2 A;  1DJI A;  4MZJ A;  1A4P A;  2LLS A;  1YRT B;  1TRF A;  1IJ6 A;  3EK8 A;  3DD4 A;  5HLV A;  4NDD A;  3PSR A;  4M2P A;  1M63 B;  2CCM A;  1S6C A;  3EK7 A;  1IGV A;  2KI6 D;  1SK6 D;  2KNE A;  4GUK A;  1BOD A;  5CSI A;  2ZND A;  3A8R A;  2JTZ A;  3OX6 A;  1UHK A;  1QX7 A;  2LAP A;  3CS1 A;  2AUC A;  1J1E A;  1S26 D;  4JPZ B;  2BE4 A;  5D7F A;  5HKW A;  2R2I A;  1XA5 A;  5JJG A;  1SCM C;  1NX1 A;  2KSP A;  2KAX A;  1UWO A;  2COL B;  3I5I B;  4NQG A;  1YVH A;  1B47 A;  3LK0 A;  1S6J A;  1Y1A A;  3BQ3 A;  1IKU A;  1JUO A;  1J1D A;  3SG6 A;  2JT8 A;  2O60 A;  1NIW A;  1CM1 A;  1ZAC A;  3O78 A;  3LLE A;  1KQV A;  5ER5 A;  1BR4 B;  4GPL B;  1QLK A;  2PAS A;  1BJF A;  4GBA A;  2L5X B;  4NDC A;  2JU0 A;  1K9K A;  1REC A;  2KHN A;  2LAN A;  1NPQ A;  2MA2 A;  1KK7 Y;  2JNX A;  3O4Y A;  1YUU A;  1CNP A;  3BUO B;  4N1F A;  1BLQ A;  2ZFD A;  2WOS A;  2WCF A;  3FS7 A;  4ORA B;  1CB1 A;  4P5O E;  2KBI A;  4AQI A;  2KI4 C;  1SRA A;  2OPO A;  5HYD A;  1ZFS A;  2BL0 B;  1A29 A;  1A75 A;  2Y1M A;  1IRJ A;  3CR2 A;  3QRX A;  3EKH A;  5K89 A;  1DMO A;  2SAS A;  1XFU O;  1YRU B;  4BY5 A;  1CDN A;  1QAT A;  2EGD A;  4D1E A;  3HCM A;  1CKK A;  2NLN A;  1H4B A;  4GAO A;  1DJZ A;  5G08 A;  1K93 D;  2HQ8 A;  2I2R E;  3KO0 A;  4PHN A;  2LCP A;  1JBA A;  2JUL A;  1K2H A;  1TCF A;  1SR6 B;  5AFP A;  1SL8 A;  4N5X A;  1JFJ A;  1CM4 A;  2KFH A;  1J55 A;  2ISD A;  2MBX A;  1QAS A;  2M49 B;  4XJK B;  4MSP A;  1A03 A;  1B8L A;  4I5K A;  2L2E A;  1NCX A;  4GGF A;  1EG4 A;  1MHO A;  1IG5 A;  4PCW A;  1C7V A;  2LNK A;  2KI4 B;  3BOW A;  1RK9 A;  1A2X A;  2KBM A;  2Q91 A;  2LVK A;  1S5G Y;  2JNF A;  1YTZ C;  2KGR A;  2ZRT A;  4ETO A;  1IJ5 A;  3OB2 B;  3AAJ A;  1WRK A;  1WY9 A;  4PE1 A;  2Q4U A;  4MVF A;  2L4I A;  3PAT A;  3H4S E;  2NCP A;  1EL4 A;  1OSA A;  4M2Q A;  1J7Q A;  3WHT B;  2V53 A;  2K7D A;  3F45 A;  2LVI A;  4YI8 A;  3EVV A;  1TOP A;  3RM1 A;  2M7L A;  1KQM C;  3LL8 B;  1QVI Z;  4I5J A;  4OKH A;  1IQ5 A;  3EVU A;  3PLF B;  4PE7 A;  2F2O A;  2HQW A;  1GGZ A;  1OMV A;  2BCB A;  1CFD A;  2ZRS A;  4GNK B;  1QX2 A;  1TNX A;  2KDH A;  1DGV A;  1WRL A;  2ZNE A;  3FWB A;  2LMV A;  4ZCV A; 
#chains in the Genus database with same CATH topology
 1NWD A;  4U8D A;  2G9B A;  3D0Y B;  2ZN8 A;  4PDZ A;  1K9P A;  4USL A;  1IIO A;  1ALW A;  5PAL A;  4YBH B;  2FOT A;  1C3Z A;  1TNW A;  2GV5 A;  2BBM A;  2QEB A;  1ZMZ A;  5I8N A;  2JT3 A;  2LM5 A;  3I5H B;  3EVR A;  4YRU A;  2H61 A;  1PRW A;  1W7J B;  2QDI A;  2B1U A;  1F4Q A;  2MAZ A;  2KAV A;  4JWQ A;  2KQY A;  4MBE A;  5DKR A;  4OZD A;  1MQ1 A;  4HRE E;  2FCE A;  4MRX A;  2ZKM X;  4NDB A;  1DT7 B;  4CFQ A;  2GTE A;  1BF5 A;  2GGM A;  3I5G B;  2JTT A;  1FPW A;  3PN7 C;  1KQM B;  4MZK A;  1YUT A;  1AK8 A;  1B9A A;  1R2U A;  4HRG A;  2BBN A;  2DOQ A;  1UHJ A;  1KSM A;  2G2B A;  3UNW A;  2K8M B;  2IS9 A;  2BKH B;  2QAC A;  3R1V A;  1MXE A;  4QJ3 B;  1L2O C;  3OX5 A;  1FI5 A;  1SPY A;  1WDC B;  1WLZ A;  1NSH A;  4WQ3 A;  2F3Z A;  2JT0 A;  5D69 A;  1QV0 A;  1BT6 A;  1QS7 A;  3S0D A;  5KTY A;  3TUY C;  1QXP A;  4XYN A;  5I2Q A;  1TUZ A;  1YUR A;  4KYN A;  1KWO C;  4AQJ A;  1KFX S;  1D1O A;  4DS7 A;  1SNL A;  1W7I B;  4L9M A;  4PHM A;  4F0Z B;  1NUB A;  2LUC A;  1TCO B;  3EK4 A;  1BMO A;  3B88 A;  1SW8 A;  1JF2 A;  2LMU A;  2K2F A;  2PMY A;  3CR5 X;  2WC6 A;  3DF0 B;  3DVE A;  2LHI A;  2KFG A;  2LLT A;  5KSZ A;  1XK4 A;  2EHB A;  1UUS A;  2LUX A;  2P6B B;  1ORG A;  2L50 A;  3PJI A;  4MLW A;  2KI6 C;  4CLN A;  1NYA A;  3PM2 A;  4FQO A;  3GOF A;  1UHN A;  4HRH A;  3DVK A;  5DKN A;  1FI6 A;  3LK1 A;  1C3Y A;  3CZ2 A;  1SYM A;  1DJY A;  3WXA A;  1DGU A;  1TNQ A;  1S36 A;  1YX8 A;  1H8B A;  4DRW A;  1Y6W A;  2WCH A;  1DJG A;  2E30 A;  3KHE A;  1K90 D;  2BE6 A;  2F2P A;  4PE4 A;  3S0E A;  1FBV A;  1QV1 A;  1W9Z A;  1LA3 A;  2Y4Q A;  2D8N A;  1SCM B;  3LCP C;  5I2O A;  1PVB A;  1JFK A;  3DVM A;  3E3R A;  1QWV A;  5D3O A;  5ER4 X;  1B7T Z;  2FJY A;  1N2D A;  5AER A;  1QX5 B;  1KWO B;  2MLE C;  1OMR A;  3SIB A;  2K60 A;  3SG2 A;  1SSE B;  2QPT A;  2JOJ A;  3PM8 A;  3CTN A;  1A75 B;  3DVJ A;  1GQM A;  2OS8 C;  2M0R A;  3GK1 A;  3NSI A;  3OBV A;  2M1U A;  3BUM B;  3R1P A;  2KQ6 A;  1F55 A;  1QIV A;  2Y1N A;  1TWO A;  3TDU A;  3SIA A;  1Y1X A;  1YR5 A;  4DIR A;  3BFH A;  4A4C A;  1ZUZ A;  1XO5 A;  2CNP A;  3D77 A;  4R1E A;  1CDM A;  4AOM A;  1K95 A;  2I18 A;  1IH0 A;  2ZN9 A;  1SBJ A;  2CXJ A;  1SL7 A;  1RRO A;  4A4B A;  1EJ3 A;  4GFT A;  2MRD A;  1U5I A;  1DJX A;  1PK0 D;  1OQP A;  2K7C A;  3L4A A;  4ORB B;  3C1V A;  3IF7 A;  3EG5 B;  1QTX A;  1MR8 A;  2KYC A;  2LVV A;  3VB1 A;  1MF8 B;  3BXK A;  3BUN B;  4YGD B;  3OB1 B;  1YVL A;  2P71 A;  1DEL A;  2PSR A;  2L4H A;  3NHT A;  1WRZ A;  2RGI A;  4MEW A;  3FE6 A;  4XJK A;  3PAL A;  3VRP A;  3VRN A;  1ALV A;  5KU1 A;  1AVS A;  1BR1 B;  1DF0 B;  3EKJ A;  3BYA A;  1SKT A;  3DXL A;  1UHH A;  1KK8 C;  1CDP A;  1MWN A;  2OS8 B;  2QEV A;  2LP3 A;  2L5Y A;  4OCI A;  1XFZ O;  5AXI A;  3NSO A;  2BKI B;  2H61 C;  2F8P A;  4OVN F;  1Y1U A;  1DJH A;  1AHR A;  5CSN A;  1N0Y A;  1MXL C;  1NX0 A;  3TDZ A;  4C0K A;  5CSF A;  1G33 A;  1WLM A;  2H2K A;  1QLS A;  1KFU S;  1S3P A;  2JPO A;  1C7W A;  2FJU B;  1KK7 Z;  1OOH A;  1LKJ A;  3NXA A;  3SJS A;  1PUL A;  3ICB A;  1Z2C B;  1JC2 A;  3MSE B;  1DQE A;  1AJ4 A;  1K8U A;  2NXQ A;  2WND A;  2K61 A;  3JTD C;  2JPT A;  2M3W A;  2M97 A;  1K96 A;  1V1F A;  5FI7 A;  1KSO A;  2M1K B;  3TDI A;  2K0J A;  2K7O A;  1XVJ A;  2FCD A;  3D0Y A;  4WRI A;  4BY4 A;  1YX7 A;  5HKY A;  2JWW A;  1F71 A;  1F54 A;  2PRU A;  1AUI B;  1N65 A;  1XFY O;  4INW A;  3HX4 A;  4YGB B;  3K1E A;  1R6P A;  1XYD A;  5JOL A;  1SL9 A;  2L98 A;  1XK4 C;  1VRK A;  3AKA A;  3TS5 C;  3FE9 A;  5CPV A;  1XFX O;  1LVC D;  3I5I C;  4QJ5 B;  2BEC A;  1JSA A;  1M45 A;  2NCO A;  4JQ0 D;  1GJY A;  2LV7 A;  1JF0 A;  1J7P A;  4GGN A;  4HSZ A;  3NSK A;  3FE8 A;  1B4C A;  3CZT X;  1Y0V H;  2I7A A;  5BPJ A;  2KYF A;  1DC1 A;  4E68 A;  3JTD B;  2AMI A;  2HF5 A;  2JXC A;  3GK2 A;  2NZ0 A;  1SY9 A;  2A4J A;  1S5G Z;  2HPS A;  2K7B A;  2Y5I A;  4OR9 B;  1J7O A;  1LA0 A;  1BG1 A;  3I5F C;  5HLO A;  4C0J A;  2HET A;  2L2C A;  3CAB A;  1TUJ A;  3B6X A;  1OMD A;  3K21 A;  2EC6 C;  4MN0 A;  1QIW A;  2PVB A;  1BU3 A;  3CWG A;  1QJT A;  1NCY A;  2QEH A;  3OP0 A;  2M29 A;  1B8R A;  3PN7 B;  4MZL A;  2BL0 C;  2WOR A;  2PQL A;  5F6T A;  3TS5 B;  3B86 A;  1F4O A;  2M8U A;  3SG7 A;  3WNX B;  2WCB A;  3V2L A;  3DF0 A;  1BOC A;  3BJH A;  1TNP A;  2WC8 A;  3JVT C;  3SG3 A;  3SG5 A;  3KEV A;  5B8I B;  1KFX L;  5EL2 A;  1L2O B;  3CLN A;  4WQ2 A;  3AKB A;  1P28 A;  1SMG A;  4P2Y B;  1CLL A;  2WC5 A;  4GGF C;  3TUY B;  1QVI Y;  1OZS A;  1M39 A;  1OOI X;  2F33 A;  2LC5 A;  1ODB A;  1AJ5 A;  3CGA A;  1JWD A;  4CID A;  2OTG C;  3FIA A;  4I5N B;  1NCZ A;  2BCA A;  1SR6 C;  2LVJ A;  4MRY A;  1EG3 A;  1TN4 A;  2SCP A;  4PT1 A;  3TZ1 A;  3S0F A;  1CFF A;  3O4X A;  1GM0 A;  2TN4 A;  4M2O A;  1S6I A;  1HQV A;  2LE9 B;  1OE9 B;  1PAL A;  1UUR A;  2M7N A;  2KOT A;  3I5F B;  4N1G A;  2WCE A;  4C0L A;  1Z4H A;  1LIN A;  3KPX A;  1RJV A;  1CFC A;  1NX2 A;  3S0B A;  1IWQ A;  2KAY A;  3IQQ A;  5AAN A;  1KCY A;  3O2P A;  2EC6 B;  2L51 A;  5FI6 A;  4JD9 A;  3D78 A;  2KGB C;  2VRG A;  1RFJ A;  1S1E A;  1G8I A;  5J3X A;  4YGC B;  4UPG A;  1XFV O;  3CZ1 A;  2WCK A;  1CDL A;  1RTP 1;  4YGA A;  1FF1 A;  4OV2 A;  3D10 A;  3JVT B;  1LXF C;  3IQO A;  3L4L A;  3DYE A;  1CFP A;  2JRF A;  4CPV A;  3RLZ A;  3WHU B;  3KF9 A;  3D76 A;  1ZOT B;  1GGW A;  3PFV A;  1OZO A;  1DVI A;  1PVA A;  1U5I B;  2JQ6 A;  3AAK A;  5TNC A;  1L7Z A;  4PHK A;  1UP5 A;  1EXR A;  2AAO A;  4YI9 A;  1E8A A;  2OTG B;  1C07 A;  3BOW B;  1FW4 A;  3CZ0 A;  3GK4 X;  1CTR A;  2GGZ A;  1CLB A;  1DTL A;  5DKQ A;  4TNC A;  2KFF A;  3M0W A;  4Q04 A;  2CTN A;  2JC2 A;  2BCX A;  4YGE B;  1M46 A;  2MHH A;  1TIZ A;  1PSR A;  1J7R A;  3A4U B;  5HL1 A;  3BUW B;  5GQQ C;  4DCK A;  4DUQ A;  2LMT A;  2WCJ A;  1DF0 A;  1PSB A;  1CLM A;  1Q80 A;  3S0G A;  3ZWH A;  4ICB A;  1B1G A;  3I5H C;  1CMF A;  1G4Y R;  1DJW A;  1F70 A;  2I94 A;  4FTG A;  3L47 A;  4PE0 A;  1V1G A;  2WCL A;  3CR4 X;  3OHM B;  4ORC B;  1K9U A;  2M9G A;  2E6W A;  1TTX A;  5I2L A;  3FWC A;  1AP4 A;  2LLU A;  2CBL A;  1X02 A;  2JXL A;  2F3Y A;  3I5G C;  1NX3 A;  3R1O A;  2H8V A;  1UHI A;  3BUX B;  4QJ4 B;  1XFW O;  4CFR A;  1K94 A;  1NP8 A;  1RWY A;  3O6B A;  1KK8 B;  1M31 A;  4I5L B;  2L0P A;  2LHL A;  5CSJ A;  1KFU L;  1SCV A;  1WDC C;  3ZNI A;  2LP2 A;  3VRO A;  2O5G A;  4PAL A;  1F8H A;  3D75 A;  1B7T Y;  2ERB A;  3R72 A;  3SG4 A;  2MLF C;  3VRQ A;  3S0A A;  1T14 A;  3VGO A;  5IBW A;  2PAL A;  2K2A A;  3BFB A;  1HT9 A;  1OW4 A;  3VRR A;  4ZCU A;  4PHJ A;  1OOJ A;  1IQ3 A;  3NSL A;  5HKZ A;  2MJW B;  1YUS A;  4IL1 A;  3B87 A;  1MUX A;  2CT9 A;  3SS4 A;  5AEQ A;  1CMG A;  2JZI A;  1B8C A;  5FYX A;  1EH2 A;  1DJI A;  4MZJ A;  1A4P A;  2LLS A;  1YRT B;  1TRF A;  1IJ6 A;  3EK8 A;  3DD4 A;  3IVT A;  4NDD A;  5HLV A;  3D73 A;  3PSR A;  4M2P A;  1M63 B;  2CCM A;  1S6C A;  3EK7 A;  1IGV A;  2KI6 D;  1SK6 D;  2KNE A;  4GUK A;  1BOD A;  5CSI A;  2ZND A;  3A8R A;  2JTZ A;  3OX6 A;  1UHK A;  1QX7 A;  2LAP A;  3CS1 A;  2AUC A;  1J1E A;  1S26 D;  4JPZ B;  3N7H A;  2BE4 A;  5D7F A;  5HKW A;  2R2I A;  1XA5 A;  5JJG A;  1SCM C;  1NX1 A;  2KSP A;  2KAX A;  1UWO A;  3SS3 A;  2COL B;  3I5I B;  4NQG A;  1YVH A;  1B47 A;  3LK0 A;  1S6J A;  1Y1A A;  3BQ3 A;  3QME A;  1JUO A;  1IKU A;  1J1D A;  3SG6 A;  2JT8 A;  2O60 A;  1NIW A;  1CM1 A;  1LS8 A;  1ZAC A;  2QEO A;  3LLE A;  3O78 A;  3SS5 A;  1KQV A;  3OGN A;  1BR4 B;  4GPL B;  5ER5 A;  1QLK A;  2PAS A;  1BJF A;  4GBA A;  2L5X B;  3RZS A;  4NDC A;  2JU0 A;  1K9K A;  1REC A;  3NHI A;  2KHN A;  2LAN A;  1NPQ A;  2MA2 A;  1KK7 Y;  2JNX A;  3O4Y A;  1YUU A;  1CNP A;  3BUO B;  4N1F A;  1BLQ A;  2ZFD A;  2WOS A;  2WCF A;  3D74 A;  3FS7 A;  4ORA B;  1CB1 A;  2BNX A;  4P5O E;  3CDN A;  2KBI A;  4AQI A;  2KI4 C;  1SRA A;  2OPO A;  5HYD A;  1ZFS A;  2BL0 B;  1A29 A;  1A75 A;  2Y1M A;  1IRJ A;  2KLE A;  2KLD A;  3CR2 A;  3QRX A;  3EKH A;  5K89 A;  1DMO A;  2SAS A;  1XFU O;  1YRU B;  4BY5 A;  1CDN A;  1QAT A;  2EGD A;  4D1E A;  3HCM A;  1CKK A;  2NLN A;  1H4B A;  5I94 A;  4GAO A;  1DJZ A;  3NGV A;  3DY9 A;  5G08 A;  1K93 D;  4IJ7 A;  4JKT A;  2HQ8 A;  2I2R E;  3KO0 A;  4PHN A;  2LCP A;  1XFR A;  4F7F A;  2JUL A;  1JBA A;  1K2H A;  1TCF A;  1SR6 B;  5AFP A;  1SL8 A;  4N5X A;  1JFJ A;  1CM4 A;  2KFH A;  1J55 A;  2BAP A;  4FQT A;  2MBX A;  1QAS A;  2M49 B;  3B7A A;  4MSP A;  4XJK B;  2ISD A;  1A03 A;  1B8L A;  4I5K A;  2L2E A;  1NCX A;  4GGF A;  1EG4 A;  1MHO A;  1IG5 A;  4PCW A;  3BFA A;  3CYZ A;  2P70 A;  1C7V A;  2LNK A;  2KI4 B;  3BOW A;  1RK9 A;  1A2X A;  3Q8I A;  2KBM A;  2Q91 A;  2LVK A;  1S5G Y;  2JNF A;  1YTZ C;  2KGR A;  2ZRT A;  4ETO A;  1IJ5 A;  1OOG A;  3AAJ A;  1WRK A;  1OOF A;  1WY9 A;  2Q4U A;  3OB2 B;  4PE1 A;  4MVF A;  2L4I A;  4INX A;  3PAT A;  3H4S E;  2NCP A;  1EL4 A;  1OSA A;  4M2Q A;  3UO9 A;  5FI2 A;  2V53 A;  2K7D A;  3F45 A;  3WHT B;  1J7Q A;  2LVI A;  3DZT A;  2KPH A;  4YI8 A;  3EVV A;  1TOP A;  2PYQ A;  3RM1 A;  2M7L A;  1KQM C;  3LL8 B;  1QVI Z;  4I5J A;  4OKH A;  1IQ5 A;  3EVU A;  3PLF B;  4PE7 A;  2F2O A;  2HQW A;  1GGZ A;  1OMV A;  2BCB A;  1CFD A;  2ZRS A;  4GNK B;  1DEK A;  1QX2 A;  5DIC A;  1TNX A;  2KDH A;  2WCM A;  1DGV A;  2YGU A;  1WRL A;  2ZNE A;  3FWB A;  2LMV A;  4ZCV A; 
#chains in the Genus database with same CATH homology
 1NWD A;  4U8D A;  2G9B A;  3D0Y B;  2ZN8 A;  4PDZ A;  1K9P A;  4USL A;  1ALW A;  5PAL A;  4YBH B;  2FOT A;  2GV5 A;  1TNW A;  2BBM A;  5I8N A;  1ZMZ A;  2JT3 A;  2LM5 A;  3I5H B;  3EVR A;  4YRU A;  2H61 A;  1PRW A;  1W7J B;  2B1U A;  1F4Q A;  2MAZ A;  2KAV A;  4JWQ A;  2KQY A;  4MBE A;  5DKR A;  1MQ1 A;  4HRE E;  2FCE A;  4MRX A;  2ZKM X;  4NDB A;  1DT7 B;  4CFQ A;  1BF5 A;  2GGM A;  3I5G B;  2JTT A;  1FPW A;  3PN7 C;  1KQM B;  4MZK A;  1YUT A;  1AK8 A;  1B9A A;  1R2U A;  4HRG A;  2BBN A;  2DOQ A;  1UHJ A;  1KSM A;  2G2B A;  2K8M B;  2IS9 A;  2BKH B;  2QAC A;  1MXE A;  4QJ3 B;  1L2O C;  3OX5 A;  1FI5 A;  1SPY A;  1WDC B;  1WLZ A;  1NSH A;  4WQ3 A;  2F3Z A;  2JT0 A;  5D69 A;  1QV0 A;  1BT6 A;  1QS7 A;  5KTY A;  3TUY C;  1QXP A;  4XYN A;  5I2Q A;  1YUR A;  1KWO C;  4AQJ A;  1KFX S;  1D1O A;  4DS7 A;  1SNL A;  1W7I B;  4L9M A;  4PHM A;  4F0Z B;  1NUB A;  2LUC A;  1TCO B;  3EK4 A;  1BMO A;  1SW8 A;  1JF2 A;  2LMU A;  2K2F A;  2PMY A;  3CR5 X;  3DF0 B;  3DVE A;  2LHI A;  2KFG A;  2LLT A;  5KSZ A;  1XK4 A;  2EHB A;  1UUS A;  2LUX A;  2P6B B;  2L50 A;  4MLW A;  2KI6 C;  4CLN A;  1NYA A;  4FQO A;  3GOF A;  1UHN A;  4HRH A;  3DVK A;  5DKN A;  1FI6 A;  3LK1 A;  1SYM A;  1DJY A;  3WXA A;  1DGU A;  1TNQ A;  1S36 A;  1YX8 A;  1H8B A;  4DRW A;  1Y6W A;  1DJG A;  2E30 A;  3KHE A;  1K90 D;  2BE6 A;  2F2P A;  4PE4 A;  1FBV A;  1QV1 A;  1LA3 A;  2Y4Q A;  2D8N A;  1SCM B;  3LCP C;  5I2O A;  1PVB A;  1JFK A;  3DVM A;  3E3R A;  5AER A;  5ER4 X;  1B7T Z;  1N2D A;  1QX5 B;  1KWO B;  2MLE C;  1OMR A;  3SIB A;  3SG2 A;  2QPT A;  2JOJ A;  3PM8 A;  3CTN A;  1A75 B;  3DVJ A;  1GQM A;  2OS8 C;  2M0R A;  3GK1 A;  3NSI A;  2M1U A;  3BUM B;  1F55 A;  2KQ6 A;  1QIV A;  2Y1N A;  3TDU A;  3SIA A;  1Y1X A;  1YR5 A;  4DIR A;  4A4C A;  1ZUZ A;  1XO5 A;  2CNP A;  4R1E A;  1CDM A;  4AOM A;  1K95 A;  2I18 A;  1IH0 A;  2ZN9 A;  1SBJ A;  2CXJ A;  1SL7 A;  1RRO A;  4A4B A;  1EJ3 A;  4GFT A;  2MRD A;  1U5I A;  1DJX A;  1PK0 D;  1OQP A;  2K7C A;  4ORB B;  3C1V A;  3IF7 A;  1QTX A;  1MR8 A;  2KYC A;  2LVV A;  1MF8 B;  3BXK A;  3BUN B;  4YGD B;  3OB1 B;  1YVL A;  2PSR A;  2L4H A;  1WRZ A;  2RGI A;  4MEW A;  4XJK A;  3PAL A;  3VRP A;  3VRN A;  1ALV A;  5KU1 A;  1AVS A;  1BR1 B;  1DF0 B;  3EKJ A;  3BYA A;  1SKT A;  1UHH A;  1KK8 C;  1CDP A;  1MWN A;  2OS8 B;  2LP3 A;  4OCI A;  1XFZ O;  5AXI A;  3NSO A;  2BKI B;  2H61 C;  2F8P A;  4OVN F;  1Y1U A;  1DJH A;  1AHR A;  5CSN A;  1N0Y A;  1MXL C;  1NX0 A;  3TDZ A;  4C0K A;  5CSF A;  1G33 A;  1WLM A;  2H2K A;  1QLS A;  1KFU S;  1S3P A;  1C7W A;  2FJU B;  1KK7 Z;  1LKJ A;  3NXA A;  3SJS A;  1PUL A;  3ICB A;  1JC2 A;  3MSE B;  1AJ4 A;  1K8U A;  2NXQ A;  2WND A;  2K61 A;  3JTD C;  2JPT A;  2M3W A;  2M97 A;  1K96 A;  1V1F A;  3TDI A;  1KSO A;  2M1K B;  2K0J A;  2K7O A;  1XVJ A;  2FCD A;  3D0Y A;  4WRI A;  4BY4 A;  1YX7 A;  5HKY A;  2JWW A;  1F71 A;  1F54 A;  2PRU A;  1AUI B;  1N65 A;  1XFY O;  3HX4 A;  4YGB B;  1R6P A;  1XYD A;  5JOL A;  1SL9 A;  2L98 A;  1XK4 C;  1VRK A;  3AKA A;  3TS5 C;  5CPV A;  1XFX O;  1LVC D;  3I5I C;  4QJ5 B;  2BEC A;  1JSA A;  1M45 A;  2NCO A;  4JQ0 D;  1GJY A;  2LV7 A;  1JF0 A;  1J7P A;  4GGN A;  4HSZ A;  3NSK A;  1B4C A;  3CZT X;  1Y0V H;  2I7A A;  5BPJ A;  2KYF A;  4E68 A;  3JTD B;  2AMI A;  2HF5 A;  2JXC A;  3GK2 A;  2NZ0 A;  1SY9 A;  2A4J A;  1S5G Z;  2HPS A;  2K7B A;  2Y5I A;  4OR9 B;  1J7O A;  1LA0 A;  1BG1 A;  3I5F C;  5HLO A;  4C0J A;  2HET A;  3K21 A;  1OMD A;  2EC6 C;  4MN0 A;  1QIW A;  2PVB A;  1BU3 A;  3CWG A;  1QJT A;  1NCY A;  3OP0 A;  3PN7 B;  2M29 A;  1B8R A;  4MZL A;  2BL0 C;  2WOR A;  5F6T A;  3TS5 B;  1F4O A;  2M8U A;  3SG7 A;  3WNX B;  2WCB A;  3DF0 A;  1BOC A;  1TNP A;  2WC8 A;  3JVT C;  3SG3 A;  3SG5 A;  3KEV A;  5B8I B;  1KFX L;  1L2O B;  3CLN A;  4WQ2 A;  3AKB A;  1SMG A;  4P2Y B;  1CLL A;  4GGF C;  3TUY B;  1QVI Y;  1OZS A;  1M39 A;  2F33 A;  3CGA A;  2LC5 A;  1ODB A;  1AJ5 A;  1JWD A;  4CID A;  2OTG C;  3FIA A;  4I5N B;  1NCZ A;  2BCA A;  1SR6 C;  2LVJ A;  4MRY A;  1EG3 A;  1TN4 A;  2SCP A;  3TZ1 A;  1CFF A;  2TN4 A;  4M2O A;  1S6I A;  1HQV A;  2LE9 B;  1OE9 B;  1PAL A;  1UUR A;  2M7N A;  2KOT A;  3I5F B;  4N1G A;  2WCE A;  4C0L A;  3KPX A;  1LIN A;  1RJV A;  1CFC A;  1NX2 A;  1KCY A;  1IWQ A;  2KAY A;  3IQQ A;  5AAN A;  3O2P A;  2EC6 B;  2L51 A;  2KGB C;  2VRG A;  1RFJ A;  1S1E A;  1G8I A;  5J3X A;  4YGC B;  4UPG A;  1XFV O;  1CDL A;  1RTP 1;  4YGA A;  1FF1 A;  4OV2 A;  3D10 A;  3JVT B;  1LXF C;  3IQO A;  1CFP A;  2JRF A;  4CPV A;  3RLZ A;  3WHU B;  3KF9 A;  1ZOT B;  1GGW A;  3PFV A;  1OZO A;  1DVI A;  1PVA A;  1U5I B;  2JQ6 A;  3AAK A;  5TNC A;  1L7Z A;  4PHK A;  1UP5 A;  1EXR A;  2AAO A;  4YI9 A;  1E8A A;  2OTG B;  1C07 A;  3BOW B;  1FW4 A;  3GK4 X;  1CTR A;  2GGZ A;  1CLB A;  1DTL A;  5DKQ A;  4TNC A;  2KFF A;  3M0W A;  4Q04 A;  2CTN A;  2JC2 A;  2BCX A;  4YGE B;  1M46 A;  2MHH A;  1TIZ A;  1PSR A;  1J7R A;  3A4U B;  3BUW B;  5GQQ C;  4DCK A;  4DUQ A;  2LMT A;  1DF0 A;  1PSB A;  1CLM A;  1Q80 A;  3ZWH A;  4ICB A;  1B1G A;  3I5H C;  1CMF A;  1G4Y R;  1DJW A;  1F70 A;  2I94 A;  4FTG A;  4PE0 A;  1V1G A;  3CR4 X;  3OHM B;  4ORC B;  1K9U A;  2M9G A;  2E6W A;  1TTX A;  5I2L A;  3FWC A;  1AP4 A;  2LLU A;  2CBL A;  1X02 A;  2JXL A;  2F3Y A;  3I5G C;  1NX3 A;  1UHI A;  3BUX B;  4QJ4 B;  1XFW O;  4CFR A;  1K94 A;  1NP8 A;  1RWY A;  3O6B A;  1KK8 B;  1M31 A;  4I5L B;  2L0P A;  2LHL A;  5CSJ A;  1KFU L;  1SCV A;  1WDC C;  3ZNI A;  2LP2 A;  3VRO A;  2O5G A;  4PAL A;  1F8H A;  1B7T Y;  3SG4 A;  2MLF C;  3VRQ A;  3VGO A;  5IBW A;  2PAL A;  2K2A A;  1HT9 A;  3VRR A;  4ZCU A;  4PHJ A;  1OOJ A;  1IQ3 A;  3NSL A;  5HKZ A;  2MJW B;  1YUS A;  4IL1 A;  1MUX A;  2CT9 A;  5AEQ A;  1CMG A;  2JZI A;  1B8C A;  5FYX A;  1EH2 A;  1DJI A;  4MZJ A;  1A4P A;  2LLS A;  1YRT B;  1TRF A;  1IJ6 A;  3EK8 A;  3DD4 A;  5HLV A;  4NDD A;  3PSR A;  4M2P A;  1M63 B;  2CCM A;  1S6C A;  3EK7 A;  1IGV A;  2KI6 D;  1SK6 D;  2KNE A;  4GUK A;  1BOD A;  5CSI A;  2ZND A;  3A8R A;  2JTZ A;  3OX6 A;  1UHK A;  1QX7 A;  2LAP A;  3CS1 A;  2AUC A;  1J1E A;  1S26 D;  4JPZ B;  2BE4 A;  5D7F A;  5HKW A;  2R2I A;  1XA5 A;  5JJG A;  1SCM C;  1NX1 A;  2KSP A;  2KAX A;  1UWO A;  2COL B;  3I5I B;  4NQG A;  1YVH A;  1B47 A;  3LK0 A;  1S6J A;  1Y1A A;  3BQ3 A;  1IKU A;  1JUO A;  1J1D A;  3SG6 A;  2JT8 A;  2O60 A;  1NIW A;  1CM1 A;  1ZAC A;  3O78 A;  3LLE A;  1KQV A;  5ER5 A;  1BR4 B;  4GPL B;  1QLK A;  2PAS A;  1BJF A;  4GBA A;  2L5X B;  4NDC A;  2JU0 A;  1K9K A;  1REC A;  2KHN A;  2LAN A;  1NPQ A;  2MA2 A;  1KK7 Y;  2JNX A;  3O4Y A;  1YUU A;  1CNP A;  3BUO B;  4N1F A;  1BLQ A;  2ZFD A;  2WOS A;  2WCF A;  3FS7 A;  4ORA B;  1CB1 A;  4P5O E;  2KBI A;  4AQI A;  2KI4 C;  1SRA A;  2OPO A;  5HYD A;  1ZFS A;  2BL0 B;  1A29 A;  1A75 A;  2Y1M A;  1IRJ A;  3CR2 A;  3QRX A;  3EKH A;  5K89 A;  1DMO A;  2SAS A;  1XFU O;  1YRU B;  4BY5 A;  1CDN A;  1QAT A;  2EGD A;  4D1E A;  3HCM A;  1CKK A;  2NLN A;  1H4B A;  4GAO A;  1DJZ A;  5G08 A;  1K93 D;  2HQ8 A;  2I2R E;  3KO0 A;  4PHN A;  2LCP A;  1JBA A;  2JUL A;  1K2H A;  1TCF A;  1SR6 B;  5AFP A;  1SL8 A;  4N5X A;  1JFJ A;  1CM4 A;  2KFH A;  1J55 A;  2ISD A;  2MBX A;  1QAS A;  2M49 B;  4XJK B;  4MSP A;  1A03 A;  1B8L A;  4I5K A;  2L2E A;  1NCX A;  4GGF A;  1EG4 A;  1MHO A;  1IG5 A;  4PCW A;  1C7V A;  2LNK A;  2KI4 B;  3BOW A;  1RK9 A;  1A2X A;  2KBM A;  2Q91 A;  2LVK A;  1S5G Y;  2JNF A;  1YTZ C;  2KGR A;  2ZRT A;  4ETO A;  1IJ5 A;  3OB2 B;  3AAJ A;  1WRK A;  1WY9 A;  4PE1 A;  2Q4U A;  4MVF A;  2L4I A;  3PAT A;  3H4S E;  2NCP A;  1EL4 A;  1OSA A;  4M2Q A;  1J7Q A;  3WHT B;  2V53 A;  2K7D A;  3F45 A;  2LVI A;  4YI8 A;  3EVV A;  1TOP A;  3RM1 A;  2M7L A;  1KQM C;  3LL8 B;  1QVI Z;  4I5J A;  4OKH A;  1IQ5 A;  3EVU A;  3PLF B;  4PE7 A;  2F2O A;  2HQW A;  1GGZ A;  1OMV A;  2BCB A;  1CFD A;  2ZRS A;  4GNK B;  1QX2 A;  1TNX A;  2KDH A;  1DGV A;  1WRL A;  2ZNE A;  3FWB A;  2LMV A;  4ZCV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...