3DYEA

Crystal structure of aed7-norepineprhine complex
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
302
structure length
302
Chain Sequence
MGPFDPEEMLFIFTRCMEDNLEDGANRLPMLAKWKEWINEPVDSPATQCFGKCVLVRTGLYDPVAQKFDASVIQEQFKAYPSLGEKSKVEAYANAVKQLPSTNNDCAAVFKAYDPVHKAHKDTSKNLFHGNKELTKGLYEKLGKDIRQKKQSYFEFCENKYYPAGSDKRQQLCQIRQYTVLDDALFKEHTDCVMKGIRYITKDNQLDVEEVKRDFKLVNKDTKALEEVLNDCKSKEPSNAKEKSWHYYKCLVESSVKDDFKEAFDYREVRSQIYAFNLPKNQAYSKPAVQSQVMEIDGKQCP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Odorant-binding protein
molecule keywords D7 protein
publication title Multifunctionality and mechanism of ligand binding in a mosquito antiinflammatory protein
pubmed doi rcsb
source organism Aedes aegypti
total genus 126
structure length 302
sequence length 302
ec nomenclature
pdb deposition date 2008-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01395 PBP_GOBP PBP/GOBP family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.20 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 Pheromone/general odorant binding protein domain 3dyeA01
1.10.238.20 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 Pheromone/general odorant binding protein domain 3dyeA02
1TWOA 3DYEA 3R1VA 2QEOA 4F7FA 1OOFA 1TUJA 1OOGA 2QEHA 3DXLA 2WC5A 3B7AA 3D77A 3NGVA 4FQTA 1C3ZA 3RZSA 3CZ0A 3BJHA 3D74A 3L4LA 4INWA 3VB1A 3S0FA 3QMEA 4OZDA 3Q8IA 1C3YA 3OGNA 3CDNA 1OW4A 1GM0A 1LS8A 1P28A 4INXA 3B6XA 5DICA 2L2CA 2QDIA 2GTEA 2KPHA 3S0GA 2WCMA 3CYZA 3B87A 3R72A 1ORGA 3CZ2A 1XFRA 4JD9A 3CZ1A 3PJIA 2PQLA 3V2LA 1T14A 3D76A 2QEBA 3FE9A 2P71A 2WCKA 3L4AA 4PT1A 3B86A 1DQEA 2H8VA 3BFAA 3FE8A 3S0AA 2WCLA 3B88A 2ERBA 3BFBA 3DY9A 3K1EA 3D75A 3CABA 3R1OA 3FE6A 2JPOA 2WCJA 3D73A 3L47A 2QEVA 3R1PA 3N7HA 1OOHA 3S0EA 1OOIX 3NHIA 2FJYA 3S0BA 2P70A 3NHTA 3BFHA 2WCHA 5EL2A 1QWVA 3D78A 3S0DA 2WC6A 3DZTA
chains in the Genus database with same CATH superfamily
1CNPA 1XYDA 1WRKA 2KI6C 3WHUB 3IQOA 1DF0A 3DYEA 5B8IB 1PK0D 1DJXA 1QIWA 3I5IB 4PHKA 3JVTB 1KSOA 2QEOA 1OOFA 4AOMA 1R6PA 2BKIB 1UHHA 3NSLA 2QEHA 1EL4A 3B7AA 1J55A 4PE4A 1KFXL 1EH2A 5J3XA 2MHHA 3NGVA 3CTNA 1MHOA 1AJ4A 1B8RA 2JOJA 2JQ6A 2KQ6A 4USLA 5PALA 2PRUA 1AUIB 3CZ0A 4HRGA 3VRPA 3BJHA 3HCMA 1ZACA 2KYCA 1WLZA 1L2OB 3SG6A 3D74A 3L4LA 4PHMA 1HT9A 2ZN8A 3I5HB 1WDCC 2Y1NA 2WCBA 4OZDA 4BY5A 1B4CA 1OSAA 3CS1A 1RJVA 4OKHA 3CDNA 1DGUA 1UHNA 1DJYA 1NUBA 2JWWA 1GM0A 1S3PA 1B9AA 3F45A 1K9PA 1QV0A 2G2BA 4PE7A 2LMTA 2LHIA 2KFHA 2KI4B 2GGZA 3BOWA 2BL0B 1TNPA 3CGAA 1JFKA 2CNPA 3PM8A 1KK8B 2WC8A 3PLFB 1YX8A 1M31A 1DGVA 1FPWA 1XO5A 2O5GA 2KGRA 2LCPA 4JWQA 2KAXA 4GGFC 2LLTA 2KPHA 1F4QA 1PVBA 2FCDA 4L9MA 4MBEA 2LP3A 2KHNA 2PASA 1CB1A 4DIRA 2ZFDA 1GJYA 4M2QA 5DKQA 1ORGA 1TIZA 2B1UA 4CFQA 1Y1UA 3FS7A 3RLZA 4JD9A 4MZJA 2PQLA 1TNWA 3AAJA 4R1EA 1IRJA 1M39A 4MLWA 1J7RA 1LA0A 1GGZA 2NZ0A 1IQ5A 2LM5A 2BECA 3BUWB 1NWDA 1N2DA 1TCFA 3ICBA 1KK7Y 1EG4A 5CSJA 3FWBA 3I5IC 3FE8A 3S0AA 1XFVO 1OZSA 1WLMA 2Q91A 3WNXB 4A4BA 1C7WA 1ZFSA 2TN4A 1WRLA 3TDUA 2P6BB 1QX7A 4MN0A 1XA5A 1CFDA 3DVEA 2JNXA 2PVBA 3TDIA 1QX5B 3SIAA 5JOLA 3EKJA 3QRXA 2BAPA 4MVFA 2I7AA 2WCJA 1A4PA 3SG7A 3CR4X 1S6IA 1IKUA 3RM1A 3R1PA 4YRUA 1F55A 3H4SE 3N7HA 1YUSA 1H4BA 1OOHA 5DKRA 3GK1A 1Y1AA 5KU1A 2E30A 2MBXA 2OS8C 2ZRSA 1KFXS 3LL8B 1E8AA 2K2FA 2P70A 4KYNA 1SR6C 5EL2A 1QWVA 2MLFC 2NCPA 1KK7Z 1L7ZA 1SK6D 4CFRA 1OZOA 1XFZO 2KI4C 1F4OA 1JC2A 1OMVA 3O4XA 2WOSA 4NDDA 1GGWA 1QJTA 3OX5A 1BOCA 4GGFA 2KBMA 1SL7A 4DS7A 4OCIA 4F7FA 3D10A 2H2KA 1ALVA 5DKNA 1H8BA 3DXLA 2JT8A 1DMOA 2EHBA 1V1GA 5F6TA 1BT6A 4XYNA 1TCOB 4GAOA 1FI6A 4FQOA 1UHJA 3I5GC 3WHTB 1QLSA 2L51A 4YGAA 4PHJA 1C3ZA 4M2OA 2OTGB 2LHLA 4ZCUA 3EG5B 1AVSA 4GBAA 1PSBA 2LC5A 1CDMA 2MA2A 2ZN9A 4IL1A 2LP2A 1KSMA 3VB1A 3S0FA 1JWDA 1OQPA 4OVNF 4DRWA 2AUCA 1UHKA 1AJ5A 3O4YA 2LLSA 3PFVA 1SRAA 2KGBC 1LS8A 1G4YR 1TNXA 2I18A 2BCXA 4NDCA 1S36A 3E3RA 1A75A 1OMRA 3PALA 3B6XA 4WQ2A 1QX2A 4MSPA 5ER5A 2F2PA 2GTEA 1QXPA 2E6WA 1DELA 2A4JA 4HSZA 1QS7A 2EC6B 3CYZA 5AFPA 1CTRA 2HETA 3VRRA 1K90D 3B87A 2FCEA 3CZ2A 1RWYA 1XFRA 3KEVA 5HLOA 1YUTA 3VROA 1A2XA 5JJGA 1QATA 2KAYA 3CZ1A 2F2OA 2R2IA 4N1GA 4CPVA 3V2LA 2M7LA 5AEQA 1XK4C 3BUNB 1F8HA 3OP0A 3FE9A 2F33A 5HKYA 1NSHA 1DVIA 3OHMB 1S5GZ 2KQYA 2BCBA 3EK7A 1SCMB 3AAKA 2JRFA 1J1DA 5FYXA 5GQQC 2KOTA 2HQ8A 1K94A 2LE9B 3B86A 3I5FB 4MRYA 2H8VA 3VGOA 1SKTA 4PCWA 3B88A 2YGUA 1QASA 3BFBA 1LA3A 1ALWA 3NSIA 4PE0A 2H61C 1CDLA 5HLVA 2KAVA 2Y4QA 4CLNA 2KBIA 2HPSA 1XVJA 3PN7B 3C1VA 1TUZA 2AMIA 2L0PA 4ICBA 5CSIA 4P2YB 3D73A 3DF0B 1K96A 1LVCD 3L47A 2KFFA 3AKBA 3PM2A 3CLNA 2QEVA 1CFFA 1A29A 1R2UA 1S26D 1W7JB 1F54A 1KWOB 2MJWB 1JFJA 1CLMA 1M63B 1UUSA 1XFYO 3LCPC 1FF1A 3DD4A 1BR4B 2Y1MA 4XJKA 1QIVA 2D8NA 3BOWB 2K60A 2M49B 3NSOA 2F8PA 1CLLA 2CTNA 1DJWA 1K8UA 3JVTC 3TS5B 1Y6WA 2NCOA 4MEWA 3D78A 3HX4A 3AKAA 3MSEB 1GQMA 5I94A 2WC6A 2I2RE 4YGBB 2BBMA 2M3WA 2GV5A 2O60A 1K2HA 1B8CA 3OBVA 5AXIA 1EG3A 4WQ3A 2CBLA 2L98A 2M29A 3CZTX 2M9GA 4GUKA 1PVAA 1SCVA 1ODBA 4HRHA 1M46A 1IJ6A 1DTLA 1SPYA 4A4CA 1CMGA 5ER4X 1FBVA 1L2OC 1Z2CB 1PALA 4YBHB 1SW8A 1RECA 1TTXA 1TUJA 1CLBA 1OOGA 3UNWA 3I5HC 1B7TY 4PHNA 1B47A 3SG5A 4I5NB 4ORAB 4C0JA 2KLEA 4E68A 2K7BA 2G9BA 1RFJA 2CT9A 3KPXA 5CPVA 4YGEB 1XK4A 3WXAA 2CCMA 1ZMZA 2BL0C 1WY9A 2M1KB 4YGCB 2JC2A 1KK8C 3LLEA 4CIDA 4INWA 1AK8A 1CM1A 1KFUL 2K0JA 4WRIA 2OPOA 1S1EA 2K2AA 1PSRA 3JTDB 3DVKA 1QVIY 3QMEA 1SBJA 3TZ1A 2LV7A 1FI5A 3Q8IA 1MWNA 1JSAA 1DEKA 1AHRA 1PULA 2KYFA 3OGNA 2LMUA 4NDBA 2H61A 2L50A 3M0WA 1XFUO 1IIOA 4DCKA 5D3OA 1J7OA 2BKHB 4INXA 3CR2A 1YR5A 1K9KA 3EKHA 4QJ3B 1U5IA 3UO9A 1W7IB 3IQQA 2WORA 4FTGA 5DICA 1WDCB 2SASA 1Y0VH 2KNEA 2L2CA 2KI6D 2K61A 1SMGA 1TOPA 1B7TZ 1DC1A 2QACA 3S0GA 1JBAA 2WCMA 3D0YA 3EVVA 2HQWA 1DJIA 3FWCA 3EVUA 4IJ7A 1LINA 4GFTA 2JNFA 2HF5A 5HL1A 5KTYA 4YGDB 1EXRA 1RTP1 2K7DA 2LUXA 1DJZA 3A4UB 4MZKA 4AQIA 3BUOB 3PJIA 3SG4A 1FW4A 1TRFA 2KSPA 1B8LA 1S5GY 2FOTA 2FJUB 1NCZA 1D1OA 1HQVA 4GGNA 1IWQA 3ZWHA 2BE4A 1WRZA 2QEBA 1QVIZ 3OX6A 2P71A 1NX1A 1J7QA 2WCKA 3L4AA 1YURA 1V1FA 5FI7A 2BE6A 3IF7A 1ZOTB 3BUMB 2JXLA 1B1GA 4ETOA 4U8DA 2K7OA 1XFXO 1BMOA 4BY4A 1MF8B 1NIWA 5G08A 1NCYA 3K1EA 3O78A 2WCFA 1RROA 1X02A 3D75A 4C0LA 3FIAA 5I2QA 1RK9A 1IGVA 1ZUZA 2JT3A 4I5LB 3FE6A 1NX2A 5FI2A 5AERA 1MXEA 1SY9A 5FI6A 2JTTA 2COLB 4PE1A 2Y5IA 2QPTA 1DF0B 2ZKMX 1KQVA 2WNDA 1BJFA 1MXLC 1S6CA 1OE9B 1K9UA 1UURA 4HREE 4F0ZB 5I2LA 3O2PA 3JTDC 1QV1A 2LMVA 4TNCA 2GGMA 2LUCA 5CSFA 3S0BA 1KQMB 1A75B 2LANA 2F3YA 3PATA 2JTZA 1Y1XA 2WCHA 1N65A 3S0DA 1DT7B 1J1EA 2JZIA 2L5XB 3BXKA 1SYMA 1NP8A 3CWGA 3CR5X 4JPZB 3DZTA 1CMFA 1NX3A 3DF0A 2M8UA 3PSRA 4P5OE 5I2OA 1OMDA 1AP4A 5TNCA 1TWOA 1KFUS 2K8MB 3LK1A 2ZNEA 2CXJA 2M97A 2OTGC 5K89A 2OS8B 1YTZC 3R1VA 1JF2A 1SR6B 1BLQA 1CKKA 2PALA 3NSKA 1A03A 1J7PA 1CFPA 3TDZA 3LK0A 2WC5A 1IG5A 2KDHA 1YVLA 4PDZA 3D77A 3TUYB 2MRDA 2ZNDA 4GNKB 1G33A 1VRKA 3IVTA 5HKWA 4FQTA 1SNLA 3EK8A 1CFCA 2BCAA 3RZSA 3SG2A 5D7FA 3GOFA 3BYAA 3EVRA 1CDPA 3SJSA 2LNKA 1SL8A 2DOQA 1CDNA 1F71A 4M2PA 2IS9A 3VRNA 1PRWA 1KCYA 1N0YA 1JF0A 2MLEC 2L2EA 2ISDA 3BUXB 2L4HA 3I5GB 2M7NA 1C3YA 3SS5A 2EC6C 2LVJA 2VRGA 2JULA 1OW4A 2LAPA 2LVVA 1SSEB 2L5YA 2NLNA 4MZLA 4OR9B 4UPGA 1F70A 1P28A 5AANA 1JUOA 3A8RA 3O6BA 5KSZA 2LVKA 4XJKB 1LKJA 1S6JA 2JU0A 3KHEA 2JT0A 4I5KA 2JPTA 3OB1B 2PMYA 2KFGA 1IH0A 4Q04A 2SCPA 1C7VA 2ZRTA 2QDIA 3SG3A 1YRTB 4N1FA 4YI8A 1DJGA 2KLDA 4PALA 3ZNIA 2M1UA 1SCMC 1SL9A 1IJ5A 2EGDA 4AQJA 3R72A 1IQ3A 3I5FC 2K7CA 4C0KA 1KQMC 5BPJA 4ORCB 1NYAA 1Q80A 2V53A 1YX7A 5IBWA 1MR8A 2LVIA 1NPQA 1T14A 3D76A 4JQ0D 1BR1B 3PN7C 1W9ZA 1QTXA 3K21A 2I94A 1YUUA 1M45A 4N5XA 4PT1A 2MAZA 2BBNA 1DQEA 1QLKA 1UHIA 3BFAA 3GK4X 4OV2A 2WCLA 5HKZA 1BODA 1YVHA 1NX0A 1KWOC 1MQ1A 1XFWO 2ERBA 3DY9A 3EK4A 4QJ5B 1TNQA 2PYQA 1OOJA 4DUQA 3TUYC 2NXQA 4I5JA 2WCEA 3CABA 1K93D 3BQ3A 2LLUA 3R1OA 2Q4UA 5HYDA 2L4IA 2JPOA 3TS5C 1BF5A 2JXCA 3NXAA 1G8IA 3DVJA 2RGIA 4ZCVA 3OB2B 1C07A 4D1EA 1LXFC 1Z4HA 1MUXA 4NQGA 1BG1A 4QJ4B 1UP5A 2M0RA 4MRXA 3VRQA 3SIBA 4ORBB 5I8NA 2PSRA 2AAOA 3S0EA 1OOIX 5CSNA 3KF9A 3NHIA 1NCXA 4JKTA 1BU3A 1U5IB 2FJYA 3GK2A 3SS4A 2BNXA 3DVMA 4GPLB 3NHTA 4YI9A 1TN4A 1YRUB 3BFHA 2F3ZA 1DJHA 3SS3A 1EJ3A 1UWOA 5D69A 3KO0A 1CM4A 1K95A 3D0YB
chains in the Genus database with same CATH topology
1TWOA 3DYEA 3R1VA 2QEOA 4F7FA 1OOFA 1TUJA 1OOGA 2QEHA 3DXLA 2WC5A 3B7AA 3D77A 3NGVA 4FQTA 1C3ZA 3RZSA 3CZ0A 3BJHA 3D74A 3L4LA 4INWA 3VB1A 3S0FA 3QMEA 4OZDA 3Q8IA 1C3YA 3OGNA 3CDNA 1OW4A 1GM0A 1LS8A 1P28A 4INXA 3B6XA 5DICA 2L2CA 2QDIA 2GTEA 2KPHA 3S0GA 2WCMA 3CYZA 3B87A 3R72A 1ORGA 3CZ2A 1XFRA 4JD9A 3CZ1A 3PJIA 2PQLA 3V2LA 1T14A 3D76A 2QEBA 3FE9A 2P71A 2WCKA 3L4AA 4PT1A 3B86A 1DQEA 2H8VA 3BFAA 3FE8A 3S0AA 2WCLA 3B88A 2ERBA 3BFBA 3DY9A 3K1EA 3D75A 3CABA 3R1OA 3FE6A 2JPOA 2WCJA 3D73A 3L47A 2QEVA 3R1PA 3N7HA 1OOHA 3S0EA 1OOIX 3NHIA 2FJYA 3S0BA 2P70A 3NHTA 3BFHA 2WCHA 5EL2A 1QWVA 3D78A 3S0DA 2WC6A 3DZTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TWO A;  3DYE A;  3R1V A;  2QEO A;  4F7F A;  1OOF A;  1TUJ A;  1OOG A;  2QEH A;  3DXL A;  2WC5 A;  3B7A A;  3D77 A;  3NGV A;  4FQT A;  1C3Z A;  3RZS A;  3CZ0 A;  3BJH A;  3D74 A;  3L4L A;  4INW A;  3VB1 A;  3S0F A;  3QME A;  4OZD A;  3Q8I A;  1C3Y A;  3OGN A;  3CDN A;  1OW4 A;  1GM0 A;  1LS8 A;  1P28 A;  4INX A;  3B6X A;  5DIC A;  2L2C A;  2QDI A;  2GTE A;  2KPH A;  3S0G A;  2WCM A;  3CYZ A;  3B87 A;  3R72 A;  1ORG A;  3CZ2 A;  1XFR A;  4JD9 A;  3CZ1 A;  3PJI A;  2PQL A;  3V2L A;  1T14 A;  3D76 A;  2QEB A;  3FE9 A;  2P71 A;  2WCK A;  3L4A A;  4PT1 A;  3B86 A;  1DQE A;  2H8V A;  3BFA A;  3FE8 A;  3S0A A;  2WCL A;  3B88 A;  2ERB A;  3BFB A;  3DY9 A;  3K1E A;  3D75 A;  3CAB A;  3R1O A;  3FE6 A;  2JPO A;  2WCJ A;  3D73 A;  3L47 A;  2QEV A;  3R1P A;  3N7H A;  1OOH A;  3S0E A;  1OOI X;  3NHI A;  2FJY A;  3S0B A;  2P70 A;  3NHT A;  3BFH A;  2WCH A;  5EL2 A;  1QWV A;  3D78 A;  3S0D A;  2WC6 A;  3DZT A; 
#chains in the Genus database with same CATH topology
 1CNP A;  1XYD A;  1WRK A;  2KI6 C;  3WHU B;  3IQO A;  1DF0 A;  3DYE A;  5B8I B;  1PK0 D;  1DJX A;  1QIW A;  3I5I B;  4PHK A;  3JVT B;  1KSO A;  2QEO A;  1OOF A;  4AOM A;  1R6P A;  2BKI B;  1UHH A;  3NSL A;  2QEH A;  1EL4 A;  3B7A A;  1J55 A;  4PE4 A;  1KFX L;  1EH2 A;  5J3X A;  2MHH A;  3NGV A;  3CTN A;  1MHO A;  1AJ4 A;  1B8R A;  2JOJ A;  2JQ6 A;  2KQ6 A;  4USL A;  5PAL A;  2PRU A;  1AUI B;  3CZ0 A;  4HRG A;  3VRP A;  3BJH A;  3HCM A;  1ZAC A;  2KYC A;  1WLZ A;  1L2O B;  3SG6 A;  3D74 A;  3L4L A;  4PHM A;  1HT9 A;  2ZN8 A;  3I5H B;  1WDC C;  2Y1N A;  2WCB A;  4OZD A;  4BY5 A;  1B4C A;  1OSA A;  3CS1 A;  1RJV A;  4OKH A;  3CDN A;  1DGU A;  1UHN A;  1DJY A;  1NUB A;  2JWW A;  1GM0 A;  1S3P A;  1B9A A;  3F45 A;  1K9P A;  1QV0 A;  2G2B A;  4PE7 A;  2LMT A;  2LHI A;  2KFH A;  2KI4 B;  2GGZ A;  3BOW A;  2BL0 B;  1TNP A;  3CGA A;  1JFK A;  2CNP A;  3PM8 A;  1KK8 B;  2WC8 A;  3PLF B;  1YX8 A;  1M31 A;  1DGV A;  1FPW A;  1XO5 A;  2O5G A;  2KGR A;  2LCP A;  4JWQ A;  2KAX A;  4GGF C;  2LLT A;  2KPH A;  1F4Q A;  1PVB A;  2FCD A;  4L9M A;  4MBE A;  2LP3 A;  2KHN A;  2PAS A;  1CB1 A;  4DIR A;  2ZFD A;  1GJY A;  4M2Q A;  5DKQ A;  1ORG A;  1TIZ A;  2B1U A;  4CFQ A;  1Y1U A;  3FS7 A;  3RLZ A;  4JD9 A;  4MZJ A;  2PQL A;  1TNW A;  3AAJ A;  4R1E A;  1IRJ A;  1M39 A;  4MLW A;  1J7R A;  1LA0 A;  1GGZ A;  2NZ0 A;  1IQ5 A;  2LM5 A;  2BEC A;  3BUW B;  1NWD A;  1N2D A;  1TCF A;  3ICB A;  1KK7 Y;  1EG4 A;  5CSJ A;  3FWB A;  3I5I C;  3FE8 A;  3S0A A;  1XFV O;  1OZS A;  1WLM A;  2Q91 A;  3WNX B;  4A4B A;  1C7W A;  1ZFS A;  2TN4 A;  1WRL A;  3TDU A;  2P6B B;  1QX7 A;  4MN0 A;  1XA5 A;  1CFD A;  3DVE A;  2JNX A;  2PVB A;  3TDI A;  1QX5 B;  3SIA A;  5JOL A;  3EKJ A;  3QRX A;  2BAP A;  4MVF A;  2I7A A;  2WCJ A;  1A4P A;  3SG7 A;  3CR4 X;  1S6I A;  1IKU A;  3RM1 A;  3R1P A;  4YRU A;  1F55 A;  3H4S E;  3N7H A;  1YUS A;  1H4B A;  1OOH A;  5DKR A;  3GK1 A;  1Y1A A;  5KU1 A;  2E30 A;  2MBX A;  2OS8 C;  2ZRS A;  1KFX S;  3LL8 B;  1E8A A;  2K2F A;  2P70 A;  4KYN A;  1SR6 C;  5EL2 A;  1QWV A;  2MLF C;  2NCP A;  1KK7 Z;  1L7Z A;  1SK6 D;  4CFR A;  1OZO A;  1XFZ O;  2KI4 C;  1F4O A;  1JC2 A;  1OMV A;  3O4X A;  2WOS A;  4NDD A;  1GGW A;  1QJT A;  3OX5 A;  1BOC A;  4GGF A;  2KBM A;  1SL7 A;  4DS7 A;  4OCI A;  4F7F A;  3D10 A;  2H2K A;  1ALV A;  5DKN A;  1H8B A;  3DXL A;  2JT8 A;  1DMO A;  2EHB A;  1V1G A;  5F6T A;  1BT6 A;  4XYN A;  1TCO B;  4GAO A;  1FI6 A;  4FQO A;  1UHJ A;  3I5G C;  3WHT B;  1QLS A;  2L51 A;  4YGA A;  4PHJ A;  1C3Z A;  4M2O A;  2OTG B;  2LHL A;  4ZCU A;  3EG5 B;  1AVS A;  4GBA A;  1PSB A;  2LC5 A;  1CDM A;  2MA2 A;  2ZN9 A;  4IL1 A;  2LP2 A;  1KSM A;  3VB1 A;  3S0F A;  1JWD A;  1OQP A;  4OVN F;  4DRW A;  2AUC A;  1UHK A;  1AJ5 A;  3O4Y A;  2LLS A;  3PFV A;  1SRA A;  2KGB C;  1LS8 A;  1G4Y R;  1TNX A;  2I18 A;  2BCX A;  4NDC A;  1S36 A;  3E3R A;  1A75 A;  1OMR A;  3PAL A;  3B6X A;  4WQ2 A;  1QX2 A;  4MSP A;  5ER5 A;  2F2P A;  2GTE A;  1QXP A;  2E6W A;  1DEL A;  2A4J A;  4HSZ A;  1QS7 A;  2EC6 B;  3CYZ A;  5AFP A;  1CTR A;  2HET A;  3VRR A;  1K90 D;  3B87 A;  2FCE A;  3CZ2 A;  1RWY A;  1XFR A;  3KEV A;  5HLO A;  1YUT A;  3VRO A;  1A2X A;  5JJG A;  1QAT A;  2KAY A;  3CZ1 A;  2F2O A;  2R2I A;  4N1G A;  4CPV A;  3V2L A;  2M7L A;  5AEQ A;  1XK4 C;  3BUN B;  1F8H A;  3OP0 A;  3FE9 A;  2F33 A;  5HKY A;  1NSH A;  1DVI A;  3OHM B;  1S5G Z;  2KQY A;  2BCB A;  3EK7 A;  1SCM B;  3AAK A;  2JRF A;  1J1D A;  5FYX A;  5GQQ C;  2KOT A;  2HQ8 A;  1K94 A;  2LE9 B;  3B86 A;  3I5F B;  4MRY A;  2H8V A;  3VGO A;  1SKT A;  4PCW A;  3B88 A;  2YGU A;  1QAS A;  3BFB A;  1LA3 A;  1ALW A;  3NSI A;  4PE0 A;  2H61 C;  1CDL A;  5HLV A;  2KAV A;  2Y4Q A;  4CLN A;  2KBI A;  2HPS A;  1XVJ A;  3PN7 B;  3C1V A;  1TUZ A;  2AMI A;  2L0P A;  4ICB A;  5CSI A;  4P2Y B;  3D73 A;  3DF0 B;  1K96 A;  1LVC D;  3L47 A;  2KFF A;  3AKB A;  3PM2 A;  3CLN A;  2QEV A;  1CFF A;  1A29 A;  1R2U A;  1S26 D;  1W7J B;  1F54 A;  1KWO B;  2MJW B;  1JFJ A;  1CLM A;  1M63 B;  1UUS A;  1XFY O;  3LCP C;  1FF1 A;  3DD4 A;  1BR4 B;  2Y1M A;  4XJK A;  1QIV A;  2D8N A;  3BOW B;  2K60 A;  2M49 B;  3NSO A;  2F8P A;  1CLL A;  2CTN A;  1DJW A;  1K8U A;  3JVT C;  3TS5 B;  1Y6W A;  2NCO A;  4MEW A;  3D78 A;  3HX4 A;  3AKA A;  3MSE B;  1GQM A;  5I94 A;  2WC6 A;  2I2R E;  4YGB B;  2BBM A;  2M3W A;  2GV5 A;  2O60 A;  1K2H A;  1B8C A;  3OBV A;  5AXI A;  1EG3 A;  4WQ3 A;  2CBL A;  2L98 A;  2M29 A;  3CZT X;  2M9G A;  4GUK A;  1PVA A;  1SCV A;  1ODB A;  4HRH A;  1M46 A;  1IJ6 A;  1DTL A;  1SPY A;  4A4C A;  1CMG A;  5ER4 X;  1FBV A;  1L2O C;  1Z2C B;  1PAL A;  4YBH B;  1SW8 A;  1REC A;  1TTX A;  1TUJ A;  1CLB A;  1OOG A;  3UNW A;  3I5H C;  1B7T Y;  4PHN A;  1B47 A;  3SG5 A;  4I5N B;  4ORA B;  4C0J A;  2KLE A;  4E68 A;  2K7B A;  2G9B A;  1RFJ A;  2CT9 A;  3KPX A;  5CPV A;  4YGE B;  1XK4 A;  3WXA A;  2CCM A;  1ZMZ A;  2BL0 C;  1WY9 A;  2M1K B;  4YGC B;  2JC2 A;  1KK8 C;  3LLE A;  4CID A;  4INW A;  1AK8 A;  1CM1 A;  1KFU L;  2K0J A;  4WRI A;  2OPO A;  1S1E A;  2K2A A;  1PSR A;  3JTD B;  3DVK A;  1QVI Y;  3QME A;  1SBJ A;  3TZ1 A;  2LV7 A;  1FI5 A;  3Q8I A;  1MWN A;  1JSA A;  1DEK A;  1AHR A;  1PUL A;  2KYF A;  3OGN A;  2LMU A;  4NDB A;  2H61 A;  2L50 A;  3M0W A;  1XFU O;  1IIO A;  4DCK A;  5D3O A;  1J7O A;  2BKH B;  4INX A;  3CR2 A;  1YR5 A;  1K9K A;  3EKH A;  4QJ3 B;  1U5I A;  3UO9 A;  1W7I B;  3IQQ A;  2WOR A;  4FTG A;  5DIC A;  1WDC B;  2SAS A;  1Y0V H;  2KNE A;  2L2C A;  2KI6 D;  2K61 A;  1SMG A;  1TOP A;  1B7T Z;  1DC1 A;  2QAC A;  3S0G A;  1JBA A;  2WCM A;  3D0Y A;  3EVV A;  2HQW A;  1DJI A;  3FWC A;  3EVU A;  4IJ7 A;  1LIN A;  4GFT A;  2JNF A;  2HF5 A;  5HL1 A;  5KTY A;  4YGD B;  1EXR A;  1RTP 1;  2K7D A;  2LUX A;  1DJZ A;  3A4U B;  4MZK A;  4AQI A;  3BUO B;  3PJI A;  3SG4 A;  1FW4 A;  1TRF A;  2KSP A;  1B8L A;  1S5G Y;  2FOT A;  2FJU B;  1NCZ A;  1D1O A;  1HQV A;  4GGN A;  1IWQ A;  3ZWH A;  2BE4 A;  1WRZ A;  2QEB A;  1QVI Z;  3OX6 A;  2P71 A;  1NX1 A;  1J7Q A;  2WCK A;  3L4A A;  1YUR A;  1V1F A;  5FI7 A;  2BE6 A;  3IF7 A;  1ZOT B;  3BUM B;  2JXL A;  1B1G A;  4ETO A;  4U8D A;  2K7O A;  1XFX O;  1BMO A;  4BY4 A;  1MF8 B;  1NIW A;  5G08 A;  1NCY A;  3K1E A;  3O78 A;  2WCF A;  1RRO A;  1X02 A;  3D75 A;  4C0L A;  3FIA A;  5I2Q A;  1RK9 A;  1IGV A;  1ZUZ A;  2JT3 A;  4I5L B;  3FE6 A;  1NX2 A;  5FI2 A;  5AER A;  1MXE A;  1SY9 A;  5FI6 A;  2JTT A;  2COL B;  4PE1 A;  2Y5I A;  2QPT A;  1DF0 B;  2ZKM X;  1KQV A;  2WND A;  1BJF A;  1MXL C;  1S6C A;  1OE9 B;  1K9U A;  1UUR A;  4HRE E;  4F0Z B;  5I2L A;  3O2P A;  3JTD C;  1QV1 A;  2LMV A;  4TNC A;  2GGM A;  2LUC A;  5CSF A;  3S0B A;  1KQM B;  1A75 B;  2LAN A;  2F3Y A;  3PAT A;  2JTZ A;  1Y1X A;  2WCH A;  1N65 A;  3S0D A;  1DT7 B;  1J1E A;  2JZI A;  2L5X B;  3BXK A;  1SYM A;  1NP8 A;  3CWG A;  3CR5 X;  4JPZ B;  3DZT A;  1CMF A;  1NX3 A;  3DF0 A;  2M8U A;  3PSR A;  4P5O E;  5I2O A;  1OMD A;  1AP4 A;  5TNC A;  1TWO A;  1KFU S;  2K8M B;  3LK1 A;  2ZNE A;  2CXJ A;  2M97 A;  2OTG C;  5K89 A;  2OS8 B;  1YTZ C;  3R1V A;  1JF2 A;  1SR6 B;  1BLQ A;  1CKK A;  2PAL A;  3NSK A;  1A03 A;  1J7P A;  1CFP A;  3TDZ A;  3LK0 A;  2WC5 A;  1IG5 A;  2KDH A;  1YVL A;  4PDZ A;  3D77 A;  3TUY B;  2MRD A;  2ZND A;  4GNK B;  1G33 A;  1VRK A;  3IVT A;  5HKW A;  4FQT A;  1SNL A;  3EK8 A;  1CFC A;  2BCA A;  3RZS A;  3SG2 A;  5D7F A;  3GOF A;  3BYA A;  3EVR A;  1CDP A;  3SJS A;  2LNK A;  1SL8 A;  2DOQ A;  1CDN A;  1F71 A;  4M2P A;  2IS9 A;  3VRN A;  1PRW A;  1KCY A;  1N0Y A;  1JF0 A;  2MLE C;  2L2E A;  2ISD A;  3BUX B;  2L4H A;  3I5G B;  2M7N A;  1C3Y A;  3SS5 A;  2EC6 C;  2LVJ A;  2VRG A;  2JUL A;  1OW4 A;  2LAP A;  2LVV A;  1SSE B;  2L5Y A;  2NLN A;  4MZL A;  4OR9 B;  4UPG A;  1F70 A;  1P28 A;  5AAN A;  1JUO A;  3A8R A;  3O6B A;  5KSZ A;  2LVK A;  4XJK B;  1LKJ A;  1S6J A;  2JU0 A;  3KHE A;  2JT0 A;  4I5K A;  2JPT A;  3OB1 B;  2PMY A;  2KFG A;  1IH0 A;  4Q04 A;  2SCP A;  1C7V A;  2ZRT A;  2QDI A;  3SG3 A;  1YRT B;  4N1F A;  4YI8 A;  1DJG A;  2KLD A;  4PAL A;  3ZNI A;  2M1U A;  1SCM C;  1SL9 A;  1IJ5 A;  2EGD A;  4AQJ A;  3R72 A;  1IQ3 A;  3I5F C;  2K7C A;  4C0K A;  1KQM C;  5BPJ A;  4ORC B;  1NYA A;  1Q80 A;  2V53 A;  1YX7 A;  5IBW A;  1MR8 A;  2LVI A;  1NPQ A;  1T14 A;  3D76 A;  4JQ0 D;  1BR1 B;  3PN7 C;  1W9Z A;  1QTX A;  3K21 A;  2I94 A;  1YUU A;  1M45 A;  4N5X A;  4PT1 A;  2MAZ A;  2BBN A;  1DQE A;  1QLK A;  1UHI A;  3BFA A;  3GK4 X;  4OV2 A;  2WCL A;  5HKZ A;  1BOD A;  1YVH A;  1NX0 A;  1KWO C;  1MQ1 A;  1XFW O;  2ERB A;  3DY9 A;  3EK4 A;  4QJ5 B;  1TNQ A;  2PYQ A;  1OOJ A;  4DUQ A;  3TUY C;  2NXQ A;  4I5J A;  2WCE A;  3CAB A;  1K93 D;  3BQ3 A;  2LLU A;  3R1O A;  2Q4U A;  5HYD A;  2L4I A;  2JPO A;  3TS5 C;  1BF5 A;  2JXC A;  3NXA A;  1G8I A;  3DVJ A;  2RGI A;  4ZCV A;  3OB2 B;  1C07 A;  4D1E A;  1LXF C;  1Z4H A;  1MUX A;  4NQG A;  1BG1 A;  4QJ4 B;  1UP5 A;  2M0R A;  4MRX A;  3VRQ A;  3SIB A;  4ORB B;  5I8N A;  2PSR A;  2AAO A;  3S0E A;  1OOI X;  5CSN A;  3KF9 A;  3NHI A;  1NCX A;  4JKT A;  1BU3 A;  1U5I B;  2FJY A;  3GK2 A;  3SS4 A;  2BNX A;  3DVM A;  4GPL B;  3NHT A;  4YI9 A;  1TN4 A;  1YRU B;  3BFH A;  2F3Z A;  1DJH A;  3SS3 A;  1EJ3 A;  1UWO A;  5D69 A;  3KO0 A;  1CM4 A;  1K95 A;  3D0Y B; 
#chains in the Genus database with same CATH homology
 1TWO A;  3DYE A;  3R1V A;  2QEO A;  4F7F A;  1OOF A;  1TUJ A;  1OOG A;  2QEH A;  3DXL A;  2WC5 A;  3B7A A;  3D77 A;  3NGV A;  4FQT A;  1C3Z A;  3RZS A;  3CZ0 A;  3BJH A;  3D74 A;  3L4L A;  4INW A;  3VB1 A;  3S0F A;  3QME A;  4OZD A;  3Q8I A;  1C3Y A;  3OGN A;  3CDN A;  1OW4 A;  1GM0 A;  1LS8 A;  1P28 A;  4INX A;  3B6X A;  5DIC A;  2L2C A;  2QDI A;  2GTE A;  2KPH A;  3S0G A;  2WCM A;  3CYZ A;  3B87 A;  3R72 A;  1ORG A;  3CZ2 A;  1XFR A;  4JD9 A;  3CZ1 A;  3PJI A;  2PQL A;  3V2L A;  1T14 A;  3D76 A;  2QEB A;  3FE9 A;  2P71 A;  2WCK A;  3L4A A;  4PT1 A;  3B86 A;  1DQE A;  2H8V A;  3BFA A;  3FE8 A;  3S0A A;  2WCL A;  3B88 A;  2ERB A;  3BFB A;  3DY9 A;  3K1E A;  3D75 A;  3CAB A;  3R1O A;  3FE6 A;  2JPO A;  2WCJ A;  3D73 A;  3L47 A;  2QEV A;  3R1P A;  3N7H A;  1OOH A;  3S0E A;  1OOI X;  3NHI A;  2FJY A;  3S0B A;  2P70 A;  3NHT A;  3BFH A;  2WCH A;  5EL2 A;  1QWV A;  3D78 A;  3S0D A;  2WC6 A;  3DZT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...