3DYEA

Crystal structure of aed7-norepineprhine complex
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
302
structure length
302
Chain Sequence
MGPFDPEEMLFIFTRCMEDNLEDGANRLPMLAKWKEWINEPVDSPATQCFGKCVLVRTGLYDPVAQKFDASVIQEQFKAYPSLGEKSKVEAYANAVKQLPSTNNDCAAVFKAYDPVHKAHKDTSKNLFHGNKELTKGLYEKLGKDIRQKKQSYFEFCENKYYPAGSDKRQQLCQIRQYTVLDDALFKEHTDCVMKGIRYITKDNQLDVEEVKRDFKLVNKDTKALEEVLNDCKSKEPSNAKEKSWHYYKCLVESSVKDDFKEAFDYREVRSQIYAFNLPKNQAYSKPAVQSQVMEIDGKQCP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords D7 protein
publication title Multifunctionality and mechanism of ligand binding in a mosquito antiinflammatory protein
pubmed doi rcsb
source organism Aedes aegypti
molecule tags Odorant-binding protein
total genus 126
structure length 302
sequence length 302
ec nomenclature
pdb deposition date 2008-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01395 PBP_GOBP PBP/GOBP family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.20 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 Pheromone/general odorant binding protein domain 3dyeA01
1.10.238.20 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 Pheromone/general odorant binding protein domain 3dyeA02
2L2CA 3OGNA 2WCHA 3PJIA 3NHTA 3S0AA 1P28A 1TWOA 3R72A 3B6XA 3CZ1A 2P70A 1DQEA 4FQTA 3K1EA 5DICA 3S0GA 2GTEA 3CYZA 3S0BA 2QDIA 3S0DA 3BJHA 3RZSA 2KPHA 3NGVA 3BFBA 2WCLA 3BFAA 3L47A 3CZ0A 1LS8A 1ORGA 3BFHA 2P71A 3DYEA 2FJYA 3B87A 3S0FA 3CDNA 3D73A 4OZDA 1XFRA 3L4AA 3S0EA 5EL2A 1TUJA 3V2LA 3QMEA 2QEVA 2WCJA 2QEBA 2JPOA 1OOFA 3B7AA 3R1OA 1QWVA 4PT1A 3R1VA 2H8VA 3FE9A 3R1PA 3FE6A 2WC5A 1C3ZA 3N7HA 1OW4A 3DXLA 2WC6A 4JD9A 3CZ2A 2QEHA 3FE8A 3CABA 3D75A 2ERBA 4F7FA 3VB1A 3NHIA 2WCKA 1OOHA 3DY9A 4INXA 2PQLA 4INWA 1GM0A 2QEOA 3L4LA 1T14A 3B86A 3B88A 1OOGA 3DZTA 1OOIX 3D76A 3D78A 3Q8IA 3D77A 2WCMA 3D74A 1C3YA
chains in the Genus database with same CATH superfamily
4YGAA 2QPTA 1FPWA 3D0YA 2OTGC 4M2OA 3SIAA 1K93D 1TNWA 1MR8A 2H2KA 2DOQA 1IKUA 1OZOA 1XA5A 3S0AA 2K8MB 1SCMC 4GBAA 1B47A 2BCAA 3R72A 1EL4A 1K90D 3TDIA 3BUWB 2CBLA 1BMOA 1QLSA 4MEWA 2P70A 4MVFA 3OB1B 2BECA 2KFGA 1S6IA 2KI6C 2MAZA 4OCIA 2GTEA 2K0JA 3CTNA 1CMFA 2BBMA 1K96A 3S0BA 3BJHA 3RZSA 3DF0B 1K2HA 1RTP1 5I2QA 2JC2A 1QTXA 1KWOB 1NYAA 2NCPA 1B4CA 1UHNA 1LS8A 3I5FC 4AQIA 1IIOA 2M97A 1EXRA 4L9MA 1R2UA 3JTDC 1Z4HA 3IVTA 4MN0A 2COLB 2TN4A 4ICBA 2F2OA 1DVIA 1JFKA 1EG3A 1JSAA 2JTTA 3OHMB 2KLDA 1KFXL 1TRFA 2KSPA 2LVJA 3KHEA 1AK8A 1NPQA 2MRDA 1SCMB 2JT0A 1DMOA 3NXAA 4NDBA 1K9UA 4I5NB 2ZN8A 3WXAA 4F0ZB 1MQ1A 3M0WA 2L50A 3IQQA 3PLFB 3FWBA 1RJVA 2FCDA 4MZKA 2EGDA 1F70A 1CLMA 3EKJA 1TUJA 5B8IB 2M9GA 1GQMA 1NSHA 2HF5A 1DF0B 2M49B 1TIZA 1SCVA 2LP2A 5BPJA 3CWGA 4PHMA 1M39A 1OZSA 4XYNA 2AMIA 3I5FB 3O4XA 3SG6A 4CPVA 2FJUB 3BOWB 1OMRA 1QV1A 3EK4A 2HPSA 3SG2A 3OBVA 2H8VA 3FE9A 1NX3A 3R1PA 1ZFSA 3FE6A 1JC2A 2WC5A 4IJ7A 1C3ZA 4CLNA 2I18A 1GGZA 2KAYA 4I5JA 5CSIA 1W9ZA 3CZ2A 1KFUL 1MF8B 2ZFDA 1AUIB 2KBMA 3D75A 1S5GY 2GV5A 3FS7A 1DJYA 3CGAA 1WRKA 3RLZA 1H8BA 1OMVA 3DY9A 4PHKA 2LVKA 3SS5A 1UP5A 1S36A 2K7DA 1Y0VH 2ZKMX 3EK8A 2I7AA 3EG5B 1LKJA 1SW8A 2EC6C 1RWYA 1IQ3A 2F33A 1ALVA 2LV7A 2JOJA 1NCZA 1BF5A 3B88A 1EG4A 2ZNEA 1CB1A 2WCEA 3E3RA 1J55A 1DGVA 1XFXO 1G33A 1UHJA 1K8UA 2K2AA 4DRWA 1OOIX 5DKNA 2WOSA 3D77A 1PK0D 5I2LA 1DGUA 1AP4A 5FI7A 5G08A 1NX1A 1Y1UA 2BL0B 1CM4A 1LA3A 1PALA 1QX7A 4FTGA 3OGNA 1L2OC 1SR6B 2PASA 4AOMA 4ETOA 2PVBA 2WCHA 3A8RA 3CS1A 3PJIA 1SL7A 4M2QA 4ORCB 4P5OE 3UO9A 1A4PA 4C0LA 3AKAA 3B6XA 3I5IC 2O5GA 4P2YB 3F45A 2EC6B 2KQ6A 3CZ1A 1ZACA 1M31A 2KAVA 2JTZA 2MA2A 1BLQA 2PYQA 1DF0A 2KBIA 3LCPC 1K9PA 4N5XA 2NXQA 2QDIA 4ZCUA 3DD4A 1AJ4A 1CLLA 1N65A 2D8NA 1XFYO 3CR4X 4U8DA 1CFDA 3BFAA 3L47A 2HQ8A 2KLEA 3BOWA 4JKTA 4ORBB 4YI8A 1S6CA 3CZTX 4NDCA 2KFHA 1UHHA 2BNXA 2FCEA 2LLUA 2I2RE 1BR1B 1DEKA 1IGVA 2P71A 1EH2A 5AERA 1S6JA 1PSBA 3BUXB 3SS3A 1KK8B 1OMDA 4QJ4B 3NSOA 2LE9B 4DS7A 3B87A 1L2OB 3GK2A 3CDNA 2JNXA 1F55A 5DKQA 1DJWA 3DVKA 1XVJA 4GUKA 2JT8A 3A4UB 3AKBA 1YR5A 3BXKA 3I5IB 3CR2A 1D1OA 1PULA 1J7RA 3S0EA 1MXLC 3PN7C 2K7CA 1CMGA 5EL2A 2JNFA 4WQ3A 1YURA 2BKHB 4C0KA 1YRTB 4Q04A 2L4IA 3V2LA 1NIWA 4MLWA 5HKWA 5D3OA 1XFWO 2WCJA 3LK1A 2L51A 3NSIA 2MLFC 2KQYA 1SMGA 2F3YA 3B7AA 2ZNDA 1N2DA 1QWVA 3OX6A 1KK7Y 2LAPA 3R1VA 3ZWHA 1PSRA 2B1UA 4MZLA 2WORA 4BY4A 3N7HA 1XK4C 1XFZO 2K7OA 1A29A 4PE7A 4JD9A 3O4YA 5HKZA 2QEHA 3FE8A 3LL8B 3CABA 4HRHA 4MBEA 1WRLA 1YVLA 1J7OA 1TN4A 2JQ6A 2M1UA 1JFJA 1V1GA 4NQGA 1YVHA 3VB1A 1NUBA 3NHIA 2ZRSA 4PHNA 1U5IA 1BJFA 2M3WA 3PN7B 2KNEA 2CNPA 4I5KA 1H4BA 1YUTA 1Z2CB 2KFFA 2G9BA 1ZMZA 4XJKB 2PQLA 1NWDA 1ODBA 2LHIA 2M0RA 2MBXA 1B8LA 3VRPA 1GM0A 1LA0A 4FQOA 3EVRA 1KQMC 1PRWA 2JXLA 1JF0A 3D10A 4HSZA 4PALA 4M2PA 3VROA 4QJ3B 1UURA 4DUQA 2CXJA 2Y4QA 1AHRA 1OOGA 3VRQA 3HCMA 1W7IB 1BOCA 3D78A 3DVEA 3MSEB 2BL0C 4C0JA 3NSKA 2M7LA 1EJ3A 2VRGA 1SR6C 3BYAA 3I5GC 3O2PA 3FWCA 3TS5C 2CCMA 4YGCB 2LVVA 2O60A 1S1EA 1CDPA 1W7JB 1NX0A 5K89A 1K9KA 4UPGA 1B7TY 1M45A 1QIWA 3CLNA 5D7FA 3NHTA 1TWOA 4USLA 1OQPA 1QS7A 3PM2A 1CKKA 1HQVA 4YGEB 2JZIA 1KFUS 1MHOA 4JPZB 5DICA 3K1EA 3SIBA 1KQMB 1NCYA 1YTZC 4MSPA 3CYZA 1M63B 2R2IA 1CFFA 1B9AA 1QASA 1FF1A 1C7WA 5KTYA 1S5GZ 3OX5A 3NGVA 3BFBA 3NSLA 4YGDB 1Q80A 4JWQA 3PFVA 1CDNA 1CDMA 1ORGA 2V53A 1SY9A 1E8AA 1KK8C 3SG3A 1FW4A 2Q4UA 3I5GB 3TS5B 5AFPA 2WCFA 1BT6A 2BAPA 5KU1A 1XFVO 4CIDA 2K7BA 5PALA 3S0FA 3SS4A 1IRJA 3D73A 1WLZA 1QLKA 1U5IB 1SRAA 1DT7B 5ER4X 1XFRA 2MHHA 2HETA 1CFPA 2LMUA 1BR4B 1SL9A 3L4AA 2A4JA 1OSAA 3TDUA 3FIAA 3WHUB 1QVIZ 2F3ZA 5F6TA 3EVVA 3LLEA 4XJKA 4BY5A 1TNQA 1XO5A 1PVAA 4GGNA 4MRXA 2LUCA 2L0PA 2KAXA 1M46A 2QEBA 1ZUZA 2LMVA 4N1FA 3SG4A 1F8HA 1DTLA 5IBWA 3SJSA 2F2PA 1OOFA 2JPOA 3R1OA 1FBVA 4R1EA 2BE4A 1CLBA 3PALA 4OKHA 1LVCD 2P6BB 2CT9A 2KGBC 4MRYA 2OS8B 3AAKA 1IH0A 1XK4A 3O6BA 5FYXA 2M29A 2BE6A 3GK4X 1IWQA 2JRFA 1KSMA 2I94A 2Y1MA 5FI6A 1DJIA 5KSZA 3ICBA 1F71A 2LUXA 3BUMB 1CM1A 3C1VA 4GPLB 5FI2A 3GOFA 1UWOA 2WCKA 4TNCA 5J3XA 1WRZA 2LNKA 1SYMA 2JULA 5HL1A 1KQVA 1TNPA 2K2FA 1AJ5A 3AAJA 2L2EA 3PSRA 4INWA 1QATA 5CPVA 4E68A 1F54A 5HLOA 2QEOA 1GGWA 1A75B 1JUOA 2YGUA 1T14A 1MXEA 3TDZA 1RK9A 1UHIA 2G2BA 1PVBA 1DELA 1DJXA 1QX5B 1SKTA 4GFTA 1AVSA 2KI6D 1TTXA 2BKIB 3DVMA 3ZNIA 1IJ5A 3WNXB 2E6WA 2LLTA 2LP3A 3D76A 4GGFC 4JQ0D 5CSJA 3Q8IA 5GQQC 2WCMA 4GNKB 2ISDA 4A4BA 3D74A 2H61C 3PM8A 2JWWA 1NP8A 1C3YA 1SK6D 1WDCC 3O78A 5D69A 2L2CA 4HREE 1FI6A 4YGBB 1NX2A 1J1DA 1JF2A 1K95A 1Y1AA 1G4YR 1WY9A 1YUUA 1B8CA 2KYCA 3JVTC 2PMYA 4OVNF 3UNWA 4PE4A 1IJ6A 1S3PA 3VRNA 2KDHA 1TUZA 1F4QA 2OTGB 1C7VA 1P28A 1KFXS 4WRIA 1IQ5A 1KK7Z 4QJ5B 5AANA 2PRUA 2F8PA 1V1FA 4OR9B 5CSFA 1DQEA 1TCFA 1FI5A 2Y5IA 4FQTA 3S0GA 1SL8A 1Y6WA 2L5YA 2JPTA 2RGIA 1BG1A 2MJWB 3S0DA 1DJHA 4CFRA 2KPHA 1QJTA 2WNDA 5HKYA 2WCLA 1OOJA 4WQ2A 3QRXA 1QX2A 1YUSA 3CZ0A 2KI4C 1ALWA 2FOTA 1JWDA 3BFHA 1B1GA 1SSEB 2L98A 2L5XB 1J1EA 1RFJA 1RECA 3BUNB 2Y1NA 1MUXA 1SNLA 3IQOA 1TOPA 2GGMA 3DVJA 4A4CA 1BODA 1WDCB 2QACA 3DYEA 5I8NA 2SASA 4GAOA 3JTDB 2KYFA 4N1GA 2FJYA 4PHJA 1N0YA 3HX4A 3JVTB 1OE9B 1C07A 4KYNA 4YI9A 4OZDA 2BCXA 3LK0A 3D0YB 4DIRA 5I94A 1BU3A 1KSOA 3I5HC 1LXFC 3EK7A 4D1EA 2LM5A 3OP0A 1HT9A 2AAOA 2LLSA 5HLVA 2IS9A 5HYDA 3WHTB 2BCBA 2L4HA 2KGRA 2JU0A 4DCKA 3KF9A 2K60A 3TUYC 2M8UA 3H4SE 1TCOB 3GK1A 1DC1A 1F4OA 1A2XA 1A75A 1A03A 3QMEA 2QEVA 2LVIA 4MZJA 2M7NA 3BUOB 4IL1A 1SPYA 2OS8C 1B7TZ 2KI4B 2MLEC 2ZN9A 3TZ1A 5I2OA 3EVUA 1XFUO 1CTRA 1TNXA 2OPOA 2KOTA 4PT1A 1G8IA 1RROA 3DF0A 4HRGA 4YRUA 2KHNA 1SBJA 1B8RA 3RM1A 4AQJA 1JBAA 2SCPA 5DKRA 3BQ3A 2K61A 2PALA 1OW4A 3DXLA 1X02A 4NDDA 3K21A 2WC6A 5JJGA 1S26D 2HQWA 2JT3A 3KPXA 2E30A 1LINA 1DJGA 1QVIY 1YX7A 1YX8A 2GGZA 2PSRA 3I5HB 1GJYA 5AEQA 2LANA 2ERBA 2WC8A 2Q91A 1WLMA 4OV2A 4F7FA 2BBNA 3VGOA 2LHLA 1UHKA 3PATA 1CNPA 2JXCA 1CDLA 1OOHA 3KEVA 5ER5A 4CFQA 1ZOTB 2LMTA 3IF7A 4YBHB 2M1KB 2NCOA 4INXA 2WCBA 3SG5A 3TUYB 4PE1A 1QV0A 2CTNA 1VRKA 3VRRA 1QIVA 1DJZA 4ORAB 2LCPA 3OB2B 1J7QA 1UUSA 3L4LA 1K94A 3B86A 3KO0A 1NCXA 2EHBA 1Y1XA 1KCYA 1XYDA 2NZ0A 3DZTA 4GGFA 1YRUB 5TNCA 2AUCA 1J7PA 1L7ZA 1KWOC 2ZRTA 3SG7A 2NLNA 1R6PA 2H61A 3CR5X 4I5LB 4PE0A 1MWNA 5CSNA 2LC5A 5JOLA 3EKHA 5AXIA 4PDZA 1IG5A 1QXPA 4ZCVA 4PCWA 1CFCA
chains in the Genus database with same CATH topology
2L2CA 3OGNA 2WCHA 3PJIA 3NHTA 3S0AA 1P28A 1TWOA 3R72A 3B6XA 3CZ1A 2P70A 1DQEA 4FQTA 3K1EA 5DICA 3S0GA 2GTEA 3CYZA 3S0BA 2QDIA 3S0DA 3BJHA 3RZSA 2KPHA 3NGVA 3BFBA 2WCLA 3BFAA 3L47A 3CZ0A 1LS8A 1ORGA 3BFHA 2P71A 3DYEA 2FJYA 3B87A 3S0FA 3CDNA 3D73A 4OZDA 1XFRA 3L4AA 3S0EA 5EL2A 1TUJA 3V2LA 3QMEA 2QEVA 2WCJA 2QEBA 2JPOA 1OOFA 3B7AA 3R1OA 1QWVA 4PT1A 3R1VA 2H8VA 3FE9A 3R1PA 3FE6A 2WC5A 1C3ZA 3N7HA 1OW4A 3DXLA 2WC6A 4JD9A 3CZ2A 2QEHA 3FE8A 3CABA 3D75A 2ERBA 4F7FA 3VB1A 3NHIA 2WCKA 1OOHA 3DY9A 4INXA 2PQLA 4INWA 1GM0A 2QEOA 3L4LA 1T14A 3B86A 3B88A 1OOGA 3DZTA 1OOIX 3D76A 3D78A 3Q8IA 3D77A 2WCMA 3D74A 1C3YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2L2C A;  3OGN A;  2WCH A;  3PJI A;  3NHT A;  3S0A A;  1P28 A;  1TWO A;  3R72 A;  3B6X A;  3CZ1 A;  2P70 A;  1DQE A;  4FQT A;  3K1E A;  5DIC A;  3S0G A;  2GTE A;  3CYZ A;  3S0B A;  2QDI A;  3S0D A;  3BJH A;  3RZS A;  2KPH A;  3NGV A;  3BFB A;  2WCL A;  3BFA A;  3L47 A;  3CZ0 A;  1LS8 A;  1ORG A;  3BFH A;  2P71 A;  3DYE A;  2FJY A;  3B87 A;  3S0F A;  3CDN A;  3D73 A;  4OZD A;  1XFR A;  3L4A A;  3S0E A;  5EL2 A;  1TUJ A;  3V2L A;  3QME A;  2QEV A;  2WCJ A;  2QEB A;  2JPO A;  1OOF A;  3B7A A;  3R1O A;  1QWV A;  4PT1 A;  3R1V A;  2H8V A;  3FE9 A;  3R1P A;  3FE6 A;  2WC5 A;  1C3Z A;  3N7H A;  1OW4 A;  3DXL A;  2WC6 A;  4JD9 A;  3CZ2 A;  2QEH A;  3FE8 A;  3CAB A;  3D75 A;  2ERB A;  4F7F A;  3VB1 A;  3NHI A;  2WCK A;  1OOH A;  3DY9 A;  4INX A;  2PQL A;  4INW A;  1GM0 A;  2QEO A;  3L4L A;  1T14 A;  3B86 A;  3B88 A;  1OOG A;  3DZT A;  1OOI X;  3D76 A;  3D78 A;  3Q8I A;  3D77 A;  2WCM A;  3D74 A;  1C3Y A; 
#chains in the Genus database with same CATH topology
 4YGA A;  2QPT A;  1FPW A;  3D0Y A;  2OTG C;  4M2O A;  3SIA A;  1K93 D;  1TNW A;  1MR8 A;  2H2K A;  2DOQ A;  1IKU A;  1OZO A;  1XA5 A;  3S0A A;  2K8M B;  1SCM C;  4GBA A;  1B47 A;  2BCA A;  3R72 A;  1EL4 A;  1K90 D;  3TDI A;  3BUW B;  2CBL A;  1BMO A;  1QLS A;  4MEW A;  2P70 A;  4MVF A;  3OB1 B;  2BEC A;  2KFG A;  1S6I A;  2KI6 C;  2MAZ A;  4OCI A;  2GTE A;  2K0J A;  3CTN A;  1CMF A;  2BBM A;  1K96 A;  3S0B A;  3BJH A;  3RZS A;  3DF0 B;  1K2H A;  1RTP 1;  5I2Q A;  2JC2 A;  1QTX A;  1KWO B;  1NYA A;  2NCP A;  1B4C A;  1UHN A;  1LS8 A;  3I5F C;  4AQI A;  1IIO A;  2M97 A;  1EXR A;  4L9M A;  1R2U A;  3JTD C;  1Z4H A;  3IVT A;  4MN0 A;  2COL B;  2TN4 A;  4ICB A;  2F2O A;  1DVI A;  1JFK A;  1EG3 A;  1JSA A;  2JTT A;  3OHM B;  2KLD A;  1KFX L;  1TRF A;  2KSP A;  2LVJ A;  3KHE A;  1AK8 A;  1NPQ A;  2MRD A;  1SCM B;  2JT0 A;  1DMO A;  3NXA A;  4NDB A;  1K9U A;  4I5N B;  2ZN8 A;  3WXA A;  4F0Z B;  1MQ1 A;  3M0W A;  2L50 A;  3IQQ A;  3PLF B;  3FWB A;  1RJV A;  2FCD A;  4MZK A;  2EGD A;  1F70 A;  1CLM A;  3EKJ A;  1TUJ A;  5B8I B;  2M9G A;  1GQM A;  1NSH A;  2HF5 A;  1DF0 B;  2M49 B;  1TIZ A;  1SCV A;  2LP2 A;  5BPJ A;  3CWG A;  4PHM A;  1M39 A;  1OZS A;  4XYN A;  2AMI A;  3I5F B;  3O4X A;  3SG6 A;  4CPV A;  2FJU B;  3BOW B;  1OMR A;  1QV1 A;  3EK4 A;  2HPS A;  3SG2 A;  3OBV A;  2H8V A;  3FE9 A;  1NX3 A;  3R1P A;  1ZFS A;  3FE6 A;  1JC2 A;  2WC5 A;  4IJ7 A;  1C3Z A;  4CLN A;  2I18 A;  1GGZ A;  2KAY A;  4I5J A;  5CSI A;  1W9Z A;  3CZ2 A;  1KFU L;  1MF8 B;  2ZFD A;  1AUI B;  2KBM A;  3D75 A;  1S5G Y;  2GV5 A;  3FS7 A;  1DJY A;  3CGA A;  1WRK A;  3RLZ A;  1H8B A;  1OMV A;  3DY9 A;  4PHK A;  2LVK A;  3SS5 A;  1UP5 A;  1S36 A;  2K7D A;  1Y0V H;  2ZKM X;  3EK8 A;  2I7A A;  3EG5 B;  1LKJ A;  1SW8 A;  2EC6 C;  1RWY A;  1IQ3 A;  2F33 A;  1ALV A;  2LV7 A;  2JOJ A;  1NCZ A;  1BF5 A;  3B88 A;  1EG4 A;  2ZNE A;  1CB1 A;  2WCE A;  3E3R A;  1J55 A;  1DGV A;  1XFX O;  1G33 A;  1UHJ A;  1K8U A;  2K2A A;  4DRW A;  1OOI X;  5DKN A;  2WOS A;  3D77 A;  1PK0 D;  5I2L A;  1DGU A;  1AP4 A;  5FI7 A;  5G08 A;  1NX1 A;  1Y1U A;  2BL0 B;  1CM4 A;  1LA3 A;  1PAL A;  1QX7 A;  4FTG A;  3OGN A;  1L2O C;  1SR6 B;  2PAS A;  4AOM A;  4ETO A;  2PVB A;  2WCH A;  3A8R A;  3CS1 A;  3PJI A;  1SL7 A;  4M2Q A;  4ORC B;  4P5O E;  3UO9 A;  1A4P A;  4C0L A;  3AKA A;  3B6X A;  3I5I C;  2O5G A;  4P2Y B;  3F45 A;  2EC6 B;  2KQ6 A;  3CZ1 A;  1ZAC A;  1M31 A;  2KAV A;  2JTZ A;  2MA2 A;  1BLQ A;  2PYQ A;  1DF0 A;  2KBI A;  3LCP C;  1K9P A;  4N5X A;  2NXQ A;  2QDI A;  4ZCU A;  3DD4 A;  1AJ4 A;  1CLL A;  1N65 A;  2D8N A;  1XFY O;  3CR4 X;  4U8D A;  1CFD A;  3BFA A;  3L47 A;  2HQ8 A;  2KLE A;  3BOW A;  4JKT A;  4ORB B;  4YI8 A;  1S6C A;  3CZT X;  4NDC A;  2KFH A;  1UHH A;  2BNX A;  2FCE A;  2LLU A;  2I2R E;  1BR1 B;  1DEK A;  1IGV A;  2P71 A;  1EH2 A;  5AER A;  1S6J A;  1PSB A;  3BUX B;  3SS3 A;  1KK8 B;  1OMD A;  4QJ4 B;  3NSO A;  2LE9 B;  4DS7 A;  3B87 A;  1L2O B;  3GK2 A;  3CDN A;  2JNX A;  1F55 A;  5DKQ A;  1DJW A;  3DVK A;  1XVJ A;  4GUK A;  2JT8 A;  3A4U B;  3AKB A;  1YR5 A;  3BXK A;  3I5I B;  3CR2 A;  1D1O A;  1PUL A;  1J7R A;  3S0E A;  1MXL C;  3PN7 C;  2K7C A;  1CMG A;  5EL2 A;  2JNF A;  4WQ3 A;  1YUR A;  2BKH B;  4C0K A;  1YRT B;  4Q04 A;  2L4I A;  3V2L A;  1NIW A;  4MLW A;  5HKW A;  5D3O A;  1XFW O;  2WCJ A;  3LK1 A;  2L51 A;  3NSI A;  2MLF C;  2KQY A;  1SMG A;  2F3Y A;  3B7A A;  2ZND A;  1N2D A;  1QWV A;  3OX6 A;  1KK7 Y;  2LAP A;  3R1V A;  3ZWH A;  1PSR A;  2B1U A;  4MZL A;  2WOR A;  4BY4 A;  3N7H A;  1XK4 C;  1XFZ O;  2K7O A;  1A29 A;  4PE7 A;  4JD9 A;  3O4Y A;  5HKZ A;  2QEH A;  3FE8 A;  3LL8 B;  3CAB A;  4HRH A;  4MBE A;  1WRL A;  1YVL A;  1J7O A;  1TN4 A;  2JQ6 A;  2M1U A;  1JFJ A;  1V1G A;  4NQG A;  1YVH A;  3VB1 A;  1NUB A;  3NHI A;  2ZRS A;  4PHN A;  1U5I A;  1BJF A;  2M3W A;  3PN7 B;  2KNE A;  2CNP A;  4I5K A;  1H4B A;  1YUT A;  1Z2C B;  2KFF A;  2G9B A;  1ZMZ A;  4XJK B;  2PQL A;  1NWD A;  1ODB A;  2LHI A;  2M0R A;  2MBX A;  1B8L A;  3VRP A;  1GM0 A;  1LA0 A;  4FQO A;  3EVR A;  1KQM C;  1PRW A;  2JXL A;  1JF0 A;  3D10 A;  4HSZ A;  4PAL A;  4M2P A;  3VRO A;  4QJ3 B;  1UUR A;  4DUQ A;  2CXJ A;  2Y4Q A;  1AHR A;  1OOG A;  3VRQ A;  3HCM A;  1W7I B;  1BOC A;  3D78 A;  3DVE A;  3MSE B;  2BL0 C;  4C0J A;  3NSK A;  2M7L A;  1EJ3 A;  2VRG A;  1SR6 C;  3BYA A;  3I5G C;  3O2P A;  3FWC A;  3TS5 C;  2CCM A;  4YGC B;  2LVV A;  2O60 A;  1S1E A;  1CDP A;  1W7J B;  1NX0 A;  5K89 A;  1K9K A;  4UPG A;  1B7T Y;  1M45 A;  1QIW A;  3CLN A;  5D7F A;  3NHT A;  1TWO A;  4USL A;  1OQP A;  1QS7 A;  3PM2 A;  1CKK A;  1HQV A;  4YGE B;  2JZI A;  1KFU S;  1MHO A;  4JPZ B;  5DIC A;  3K1E A;  3SIB A;  1KQM B;  1NCY A;  1YTZ C;  4MSP A;  3CYZ A;  1M63 B;  2R2I A;  1CFF A;  1B9A A;  1QAS A;  1FF1 A;  1C7W A;  5KTY A;  1S5G Z;  3OX5 A;  3NGV A;  3BFB A;  3NSL A;  4YGD B;  1Q80 A;  4JWQ A;  3PFV A;  1CDN A;  1CDM A;  1ORG A;  2V53 A;  1SY9 A;  1E8A A;  1KK8 C;  3SG3 A;  1FW4 A;  2Q4U A;  3I5G B;  3TS5 B;  5AFP A;  2WCF A;  1BT6 A;  2BAP A;  5KU1 A;  1XFV O;  4CID A;  2K7B A;  5PAL A;  3S0F A;  3SS4 A;  1IRJ A;  3D73 A;  1WLZ A;  1QLK A;  1U5I B;  1SRA A;  1DT7 B;  5ER4 X;  1XFR A;  2MHH A;  2HET A;  1CFP A;  2LMU A;  1BR4 B;  1SL9 A;  3L4A A;  2A4J A;  1OSA A;  3TDU A;  3FIA A;  3WHU B;  1QVI Z;  2F3Z A;  5F6T A;  3EVV A;  3LLE A;  4XJK A;  4BY5 A;  1TNQ A;  1XO5 A;  1PVA A;  4GGN A;  4MRX A;  2LUC A;  2L0P A;  2KAX A;  1M46 A;  2QEB A;  1ZUZ A;  2LMV A;  4N1F A;  3SG4 A;  1F8H A;  1DTL A;  5IBW A;  3SJS A;  2F2P A;  1OOF A;  2JPO A;  3R1O A;  1FBV A;  4R1E A;  2BE4 A;  1CLB A;  3PAL A;  4OKH A;  1LVC D;  2P6B B;  2CT9 A;  2KGB C;  4MRY A;  2OS8 B;  3AAK A;  1IH0 A;  1XK4 A;  3O6B A;  5FYX A;  2M29 A;  2BE6 A;  3GK4 X;  1IWQ A;  2JRF A;  1KSM A;  2I94 A;  2Y1M A;  5FI6 A;  1DJI A;  5KSZ A;  3ICB A;  1F71 A;  2LUX A;  3BUM B;  1CM1 A;  3C1V A;  4GPL B;  5FI2 A;  3GOF A;  1UWO A;  2WCK A;  4TNC A;  5J3X A;  1WRZ A;  2LNK A;  1SYM A;  2JUL A;  5HL1 A;  1KQV A;  1TNP A;  2K2F A;  1AJ5 A;  3AAJ A;  2L2E A;  3PSR A;  4INW A;  1QAT A;  5CPV A;  4E68 A;  1F54 A;  5HLO A;  2QEO A;  1GGW A;  1A75 B;  1JUO A;  2YGU A;  1T14 A;  1MXE A;  3TDZ A;  1RK9 A;  1UHI A;  2G2B A;  1PVB A;  1DEL A;  1DJX A;  1QX5 B;  1SKT A;  4GFT A;  1AVS A;  2KI6 D;  1TTX A;  2BKI B;  3DVM A;  3ZNI A;  1IJ5 A;  3WNX B;  2E6W A;  2LLT A;  2LP3 A;  3D76 A;  4GGF C;  4JQ0 D;  5CSJ A;  3Q8I A;  5GQQ C;  2WCM A;  4GNK B;  2ISD A;  4A4B A;  3D74 A;  2H61 C;  3PM8 A;  2JWW A;  1NP8 A;  1C3Y A;  1SK6 D;  1WDC C;  3O78 A;  5D69 A;  2L2C A;  4HRE E;  1FI6 A;  4YGB B;  1NX2 A;  1J1D A;  1JF2 A;  1K95 A;  1Y1A A;  1G4Y R;  1WY9 A;  1YUU A;  1B8C A;  2KYC A;  3JVT C;  2PMY A;  4OVN F;  3UNW A;  4PE4 A;  1IJ6 A;  1S3P A;  3VRN A;  2KDH A;  1TUZ A;  1F4Q A;  2OTG B;  1C7V A;  1P28 A;  1KFX S;  4WRI A;  1IQ5 A;  1KK7 Z;  4QJ5 B;  5AAN A;  2PRU A;  2F8P A;  1V1F A;  4OR9 B;  5CSF A;  1DQE A;  1TCF A;  1FI5 A;  2Y5I A;  4FQT A;  3S0G A;  1SL8 A;  1Y6W A;  2L5Y A;  2JPT A;  2RGI A;  1BG1 A;  2MJW B;  3S0D A;  1DJH A;  4CFR A;  2KPH A;  1QJT A;  2WND A;  5HKY A;  2WCL A;  1OOJ A;  4WQ2 A;  3QRX A;  1QX2 A;  1YUS A;  3CZ0 A;  2KI4 C;  1ALW A;  2FOT A;  1JWD A;  3BFH A;  1B1G A;  1SSE B;  2L98 A;  2L5X B;  1J1E A;  1RFJ A;  1REC A;  3BUN B;  2Y1N A;  1MUX A;  1SNL A;  3IQO A;  1TOP A;  2GGM A;  3DVJ A;  4A4C A;  1BOD A;  1WDC B;  2QAC A;  3DYE A;  5I8N A;  2SAS A;  4GAO A;  3JTD B;  2KYF A;  4N1G A;  2FJY A;  4PHJ A;  1N0Y A;  3HX4 A;  3JVT B;  1OE9 B;  1C07 A;  4KYN A;  4YI9 A;  4OZD A;  2BCX A;  3LK0 A;  3D0Y B;  4DIR A;  5I94 A;  1BU3 A;  1KSO A;  3I5H C;  1LXF C;  3EK7 A;  4D1E A;  2LM5 A;  3OP0 A;  1HT9 A;  2AAO A;  2LLS A;  5HLV A;  2IS9 A;  5HYD A;  3WHT B;  2BCB A;  2L4H A;  2KGR A;  2JU0 A;  4DCK A;  3KF9 A;  2K60 A;  3TUY C;  2M8U A;  3H4S E;  1TCO B;  3GK1 A;  1DC1 A;  1F4O A;  1A2X A;  1A75 A;  1A03 A;  3QME A;  2QEV A;  2LVI A;  4MZJ A;  2M7N A;  3BUO B;  4IL1 A;  1SPY A;  2OS8 C;  1B7T Z;  2KI4 B;  2MLE C;  2ZN9 A;  3TZ1 A;  5I2O A;  3EVU A;  1XFU O;  1CTR A;  1TNX A;  2OPO A;  2KOT A;  4PT1 A;  1G8I A;  1RRO A;  3DF0 A;  4HRG A;  4YRU A;  2KHN A;  1SBJ A;  1B8R A;  3RM1 A;  4AQJ A;  1JBA A;  2SCP A;  5DKR A;  3BQ3 A;  2K61 A;  2PAL A;  1OW4 A;  3DXL A;  1X02 A;  4NDD A;  3K21 A;  2WC6 A;  5JJG A;  1S26 D;  2HQW A;  2JT3 A;  3KPX A;  2E30 A;  1LIN A;  1DJG A;  1QVI Y;  1YX7 A;  1YX8 A;  2GGZ A;  2PSR A;  3I5H B;  1GJY A;  5AEQ A;  2LAN A;  2ERB A;  2WC8 A;  2Q91 A;  1WLM A;  4OV2 A;  4F7F A;  2BBN A;  3VGO A;  2LHL A;  1UHK A;  3PAT A;  1CNP A;  2JXC A;  1CDL A;  1OOH A;  3KEV A;  5ER5 A;  4CFQ A;  1ZOT B;  2LMT A;  3IF7 A;  4YBH B;  2M1K B;  2NCO A;  4INX A;  2WCB A;  3SG5 A;  3TUY B;  4PE1 A;  1QV0 A;  2CTN A;  1VRK A;  3VRR A;  1QIV A;  1DJZ A;  4ORA B;  2LCP A;  3OB2 B;  1J7Q A;  1UUS A;  3L4L A;  1K94 A;  3B86 A;  3KO0 A;  1NCX A;  2EHB A;  1Y1X A;  1KCY A;  1XYD A;  2NZ0 A;  3DZT A;  4GGF A;  1YRU B;  5TNC A;  2AUC A;  1J7P A;  1L7Z A;  1KWO C;  2ZRT A;  3SG7 A;  2NLN A;  1R6P A;  2H61 A;  3CR5 X;  4I5L B;  4PE0 A;  1MWN A;  5CSN A;  2LC5 A;  5JOL A;  3EKH A;  5AXI A;  4PDZ A;  1IG5 A;  1QXP A;  4ZCV A;  4PCW A;  1CFC A; 
#chains in the Genus database with same CATH homology
 2L2C A;  3OGN A;  2WCH A;  3PJI A;  3NHT A;  3S0A A;  1P28 A;  1TWO A;  3R72 A;  3B6X A;  3CZ1 A;  2P70 A;  1DQE A;  4FQT A;  3K1E A;  5DIC A;  3S0G A;  2GTE A;  3CYZ A;  3S0B A;  2QDI A;  3S0D A;  3BJH A;  3RZS A;  2KPH A;  3NGV A;  3BFB A;  2WCL A;  3BFA A;  3L47 A;  3CZ0 A;  1LS8 A;  1ORG A;  3BFH A;  2P71 A;  3DYE A;  2FJY A;  3B87 A;  3S0F A;  3CDN A;  3D73 A;  4OZD A;  1XFR A;  3L4A A;  3S0E A;  5EL2 A;  1TUJ A;  3V2L A;  3QME A;  2QEV A;  2WCJ A;  2QEB A;  2JPO A;  1OOF A;  3B7A A;  3R1O A;  1QWV A;  4PT1 A;  3R1V A;  2H8V A;  3FE9 A;  3R1P A;  3FE6 A;  2WC5 A;  1C3Z A;  3N7H A;  1OW4 A;  3DXL A;  2WC6 A;  4JD9 A;  3CZ2 A;  2QEH A;  3FE8 A;  3CAB A;  3D75 A;  2ERB A;  4F7F A;  3VB1 A;  3NHI A;  2WCK A;  1OOH A;  3DY9 A;  4INX A;  2PQL A;  4INW A;  1GM0 A;  2QEO A;  3L4L A;  1T14 A;  3B86 A;  3B88 A;  1OOG A;  3DZT A;  1OOI X;  3D76 A;  3D78 A;  3Q8I A;  3D77 A;  2WCM A;  3D74 A;  1C3Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...