1EJ3A

Crystal structure of aequorin
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
187
structure length
187
Chain Sequence
LTSDFDNPRWIGRHKHMFNFLDVNHNGKISLDEMVYKASDIVINNLGATPEQAKRHKDAVEAFFGGAGMKYGVETDWPAYIEGWKKLATDELEKYAKNEPTLIRIWGDALFDIVDKDQNGAITLDEWKAYTKAAGIIQSSEDCEETFRVCDIDESGQLDVDEMTRQHLGFWYTMDPACEKLYGGAVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords AEQUORIN
publication title The crystal structure of the photoprotein aequorin at 2.3 A resolution.
pubmed doi rcsb
source organism Aequorea aequorea
molecule tags Oxidoreductase
total genus 72
structure length 187
sequence length 187
chains with identical sequence B
ec nomenclature
pdb deposition date 2000-02-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13202 EF-hand_5 EF hand
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1ej3A00
1Y1AA 2L50A 3CS1A 2LLSA 1K9PA 1K95A 3EK7A 3I5FB 3FS7A 5KU1A 2B1UA 3DVEA 4M2OA 1QLSA 5AXIA 2BKHB 2EHBA 4PCWA 1YURA 4C0LA 5HKYA 2PASA 2KI6C 1NP8A 3QRXA 1SBJA 1E8AA 1EJ3A 1QATA 2VRGA 1KSMA 1GJYA 1M46A 1UHKA 2LE9B 2I18A 1YUSA 4FQOA 5J3XA 1F71A 2M7LA 2CTNA 3KO0A 1QV1A 3JTDC 2K8MB 1K9KA 1FPWA 2JT8A 1B9AA 1NUBA 1ZACA 2IS9A 4N1FA 2MHHA 3RM1A 4MRYA 3VRQA 1RJVA 2ZN9A 3CLNA 2WCFA 2KGRA 2NCPA 1CLBA 1OOJA 3E3RA 2PVBA 1KQVA 1K90D 3KF9A 4NQGA 3TZ1A 4QJ5B 4YBHB 2HF5A 2L4HA 2LMTA 1CB1A 2BCXA 2CNPA 2F3YA 4MRXA 1YTZC 5AANA 2WCBA 1ALVA 2CCMA 2JXLA 3GK4X 4GGFA 1YVLA 1LINA 2JNFA 4HREE 2F2PA 2F8PA 3KHEA 2MRDA 1AJ4A 1KK8C 1J7OA 2I94A 4F0ZB 1EXRA 2Y1MA 4P2YB 3DF0A 2PMYA 4QJ3B 4JWQA 1CM4A 1IH0A 3OX6A 3BOWA 4ORBB 3D0YB 5HLOA 1XFZO 1TRFA 1BMOA 2SCPA 3A4UB 1RECA 2FJUB 3EK8A 3HX4A 2F2OA 1JC2A 1UHNA 1UURA 2JQ6A 2LVJA 1S26D 1Y6WA 3ZWHA 1CDNA 3GK2A 3OX5A 1RFJA 2E30A 5BPJA 3VROA 1S1EA 5DKNA 1ZUZA 4PE0A 1RTP1 5I8NA 3BUNB 1JF0A 5K89A 3TDZA 2E6WA 2KYFA 4DRWA 1SYMA 4OR9B 4YGEB 3AKBA 2JRFA 2LANA 4MBEA 4MEWA 2LP3A 4GFTA 1QASA 1M45A 1B7TY 2L4IA 2LNKA 3SG7A 1U5IA 2K7CA 3TS5C 4ORCB 1MR8A 3ZNIA 2PALA 2M9GA 2MAZA 2MJWB 3SG2A 2KOTA 1XK4A 1FI6A 1NCYA 2OTGB 4MN0A 2M0RA 4YI9A 2KFFA 3I5HC 2D8NA 5CSNA 4ORAB 1SCMB 1L2OB 1OQPA 5I2OA 4ETOA 3IQOA 3FWBA 5PALA 2JNXA 2KBIA 3CWGA 4I5NB 4OKHA 3I5GB 4PE7A 3OP0A 1KFXS 1SMGA 1B47A 3DVKA 2OTGC 2ZRTA 4YI8A 4I5JA 1CDPA 1XA5A 3WHTB 4I5LB 1PSRA 3KEVA 1UWOA 1MUXA 1A75B 1G8IA 1SNLA 2M3WA 2QPTA 3PM8A 4MLWA 4R1EA 5D7FA 1BR1B 1YRTB 2M1KB 1CNPA 3PATA 1DJHA 2NLNA 2ZNEA 1PULA 3SJSA 3AAJA 2G2BA 2OS8C 3A8RA 2LCPA 4GAOA 3TUYC 3SG4A 4WQ2A 1F8HA 2WNDA 1IKUA 1C7WA 2L5XB 1BODA 1EH2A 1YUUA 3JTDB 1IWQA 1JF2A 3TDIA 1RROA 3D10A 1QV0A 5B8IB 4DIRA 1AJ5A 1UUSA 3EKHA 1KK7Y 3NXAA 3O2PA 2MLFC 3GOFA 3SG3A 1M63B 1R6PA 4OVNF 3BYAA 4I5KA 2LLTA 1C7VA 4GUKA 1CLMA 2K7BA 4YGAA 5AFPA 1UHJA 2K7OA 3BUWB 1YVHA 1ODBA 1GQMA 1W7IB 2G9BA 4BY4A 1BOCA 1RK9A 2HETA 2O60A 1CKKA 1NPQA 5CSIA 2LHLA 1CM1A 1V1GA 1XYDA 5HLVA 3VRRA 1LKJA 2H61A 1MXEA 1NX3A 2JULA 1KK8B 3D0YA 4MZJA 2MLEC 1KCYA 1QX2A 1PSBA 1TCOB 4PHMA 3OHMB 1N65A 1A03A 1MWNA 4GGNA 4MSPA 2AMIA 3PN7C 1G33A 1WDCB 3BXKA 1L7ZA 1KFUS 2LLUA 2BL0C 3VRNA 1IQ5A 2GGMA 5FYXA 3EVUA 4AQJA 4D1EA 3GK1A 2KI4C 2R2IA 1J7QA 5AEQA 3CGAA 1TNPA 1YX8A 4FTGA 2L98A 1Q80A 1ZOTB 2GGZA 2KBMA 4HSZA 1CFCA 1LA3A 4YGCB 1WDCC 1QXPA 3EK4A 1QLKA 2M8UA 2LVKA 2NZ0A 1K96A 1IQ3A 2BCBA 1JUOA 3SIAA 1CFDA 2KFGA 2L2EA 1OZOA 2KI6D 1DGVA 2Q91A 3PSRA 1LVCD 3WXAA 1JFKA 1F54A 2JC2A 4USLA 4QJ4B 2KFHA 3TS5B 1QS7A 3CR5X 2LVIA 5CPVA 1S6JA 2EC6B 1FW4A 5CSFA 3RLZA 1BR4B 3MSEB 1PK0D 3I5HB 3KPXA 2M7NA 1PRWA 1J55A 1SCVA 1YX7A 1A4PA 1WY9A 3DVJA 1QIWA 2F33A 2RGIA 4CFRA 1F4OA 2KSPA 1D1OA 1A75A 2WCEA 4XJKB 2KHNA 5I2QA 4A4BA 2AAOA 2JXCA 2K0JA 1KQMB 2O5GA 2EC6C 1K93D 4GPLB 1H8BA 4PE4A 3IF7A 1Y0VH 3LCPC 1PALA 1SY9A 1QTXA 1CFFA 1QX7A 2MA2A 1NCXA 4N1GA 1G4YR 5AERA 1KFXL 5CSJA 1WLZA 3CR2A 1A2XA 2L51A 2KQYA 1AK8A 2SASA 2H2KA 1M31A 4YRUA 5HKWA 3LK1A 4GGFC 2OS8B 4MZLA 5D69A 4DUQA 2FCEA 4PE1A 4PDZA 1KQMC 2WC8A 1DTLA 4E68A 1JBAA 2CXJA 3TUYB 1DMOA 1MXLC 1SR6C 3LL8B 4NDBA 1BG1A 1IJ6A 2ISDA 2COLB 3M0WA 2FOTA 1A29A 3DD4A 1XFVO 1S36A 2ZFDA 2ZNDA 3AAKA 1DGUA 1S5GY 2EGDA 3OB1B 4AOMA 1CMGA 1FI5A 2M1UA 1GGZA 2K7DA 1NCZA 1XVJA 1B7TZ 1NX1A 5HYDA 3VGOA 1YRUB 1B8LA 1DJGA 3JVTC 2LHIA 2F3ZA 2LAPA 3I5IC 1WRZA 1PVAA 2A4JA 3WNXB 1DJYA 1YUTA 1SKTA 2FCDA 2L0PA 1DF0B 2NXQA 4IL1A 1M39A 1Y1UA 2ZKMX 5JJGA 1OMDA 1S6IA 5GQQC 3BQ3A 3NSIA 4MZKA 4CFQA 3FWCA 1NIWA 2JTZA 2PSRA 4U8DA 4OV2A 1OSAA 2BCAA 2Y5IA 4YGDB 1FF1A 4OCIA 2GV5A 3PFVA 2DOQA 3CR4X 1BLQA 5HKZA 1JFJA 3SG6A 1TNQA 5KSZA 1AHRA 1KWOC 4CPVA 4PHJA 1VRKA 3HCMA 5G08A 1S3PA 5JOLA 1DJZA 4DS7A 1BF5A 1TNWA 3VRPA 1R2UA 3PN7B 3O6BA 3PALA 1DT7B 4YGBB 1H4BA 1J1DA 1W7JB 1XK4C 1EG3A 2NCOA 2BL0B 2K61A 1GGWA 1S5GZ 4JQ0D 1J7RA 4C0JA 1DJXA 2KDHA 2BBNA 1SL9A 1WRLA 1Y1XA 2KI4B 2JWWA 3FIAA 3O4YA 2TN4A 4WQ3A 1PVBA 1UHIA 1J7PA 2JPTA 2I7AA 3EVRA 1KFUL 2WOSA 2JOJA 1UHHA 1NYAA 2KQ6A 2LP2A 3H4SE 3I5FC 2LUCA 4M2PA 1XO5A 2KYCA 1B8RA 1UP5A 1XFXO 1SL8A 1BT6A 3SIBA 4BY5A 2JT0A 1X02A 2LUXA 1IJ5A 1KK7Z 1TOPA 2KAVA 1CFPA 1XFUO 1YR5A 2LC5A 1B1GA 1TCFA 3F45A 2PRUA 1N2DA 1K8UA 1QJTA 1NWDA 3C1VA 1QX5B 5F6TA 1JWDA 1MQ1A 2LVVA 1ZFSA 4XJKA 1SRAA 2Y4QA 4XYNA 1CMFA 1F70A 3LLEA 3NSLA 2P6BB 1FBVA 1IRJA 1IG5A 1IGVA 1SK6D 2Y1NA 2KGBC 4PHKA 1F4QA 1KSOA 2HQ8A 3BUOB 3CTNA 1TNXA 2LMUA 1ALWA 4TNCA 1B4CA 1OE9B 1SW8A 4Q04A 5I2LA 4P5OE 1K94A 1QVIY 1BU3A 4NDCA 3NSKA 3ICBA 4CLNA 2M49B 4NDDA 3WHUB 2M29A 4C0KA 5ER4X 1DJWA 3BUMB 1OZSA 2Q4UA 2V53A 1QIVA 4UPGA 2JZIA 1MHOA 1RWYA 2HQWA 4CIDA 4A4CA 4PHNA 4DCKA 2K2FA 1NX0A 1CDLA 1K2HA 3EVVA 1EG4A 4GBAA 4ICBA 2BKIB 2KAXA 3BUXB 3DVMA 4WRIA 3TDUA 1DJIA 1DVIA 2JU0A 3PLFB 2H61C 2K2AA 1SR6B 2LMVA 5DKRA 4N5XA 1BJFA 2BECA 5DKQA 1S6CA 5TNCA 1TTXA 4JPZB 1NSHA 3IQQA 1AVSA 1ZMZA 3DF0B 2JT3A 1HT9A 1OMVA 1K9UA 3BOWB 1DF0A 2ZN8A 2JTTA 1F55A 2BE4A 2CBLA 1TIZA 3JVTB 1XFWO 3I5IB 1QVIZ 5IBWA 1TN4A 2MBXA 4PALA 1AP4A 1XFYO 1N0YA 1AUIB 2ZRSA 3OB2B 1WRKA 2QACA 1J1EA 1LXFC 5KTYA 4ZCVA 1WLMA 3EKJA 1V1FA 2I2RE 1SPYA 5ER5A 4AQIA 3CZTX 3AKAA 1CDMA 2BBMA 1OMRA 3LK0A 4GNKB 1NX2A 3SG5A 2KNEA 2LV7A 2OPOA 1KWOB 4M2QA 3O78A 1SL7A 2CT9A 1U5IB 1MF8B 1B8CA 1SCMC 1L2OC 1LA0A 1EL4A 2M97A 2AUCA 2KAYA 2LM5A 3K21A 4L9MA 1HQVA 4ZCUA 1C07A 2BE6A 4HRHA 3I5GC 1CTRA 2HPSA 2WORA 4HRGA 1CLLA 4MVFA 1JSAA 3NSOA
chains in the Genus database with same CATH superfamily
1Y1AA 2L50A 3CS1A 2LLSA 1C3ZA 1K9PA 1K95A 3EK7A 3I5FB 3FS7A 5I94A 5KU1A 2B1UA 3DVEA 4M2OA 1DC1A 1QLSA 5AXIA 2BKHB 2EHBA 4PCWA 1YURA 4C0LA 5HKYA 2PASA 2KI6C 1NP8A 3QRXA 1SBJA 1E8AA 1EJ3A 1QATA 2VRGA 1KSMA 1GJYA 1M46A 1UHKA 2LE9B 2I18A 1YUSA 4FQOA 5J3XA 1F71A 2M7LA 2CTNA 3KO0A 1QV1A 3JTDC 2K8MB 1K9KA 1FPWA 2JT8A 3B6XA 1B9AA 1NUBA 1ZACA 1TUJA 2IS9A 4N1FA 2MHHA 3RM1A 4MRYA 3VRQA 1RJVA 2ZN9A 3CLNA 3CZ1A 2WCFA 2KGRA 2NCPA 1CLBA 1OOJA 4OZDA 3E3RA 2PVBA 3EG5B 1K90D 3KF9A 4NQGA 3TZ1A 4QJ5B 4YBHB 1KQVA 2HF5A 2L4HA 2LMTA 2P70A 1CB1A 2BCXA 2CNPA 5FI2A 2F3YA 1W9ZA 4MRXA 1YTZC 5AANA 2L2CA 1ALVA 2CCMA 2JXLA 2WCBA 3GK4X 4GGFA 1YVLA 3D73A 1LINA 3BFAA 2JNFA 4HREE 2F2PA 2F8PA 3KHEA 2MRDA 1AJ4A 1KK8C 1J7OA 2I94A 4F0ZB 1EXRA 2Y1MA 2BNXA 4P2YB 3DF0A 2PMYA 4QJ3B 3L47A 4JWQA 1CM4A 1IH0A 3OX6A 3UO9A 3BOWA 4ORBB 3D0YB 5HLOA 1XFZO 1TRFA 1BMOA 2SCPA 3A4UB 1RECA 2FJUB 3EK8A 3HX4A 2F2OA 1JC2A 1UHNA 1UURA 2JQ6A 2LVJA 1S26D 1Y6WA 3ZWHA 1CDNA 1OOGA 3GK2A 3OX5A 3CYZA 1RFJA 2E30A 5BPJA 3VROA 1S1EA 3NHTA 5DKNA 1ZUZA 4PE0A 1RTP1 5I8NA 3BUNB 1JF0A 5K89A 3TDZA 2E6WA 2KYFA 4DRWA 1SYMA 4OR9B 4YGEB 3R1VA 3AKBA 2JRFA 2LANA 4MBEA 4MEWA 2LP3A 1C3YA 4GFTA 1QASA 1M45A 1B7TY 2L4IA 2LNKA 3SG7A 1U5IA 2K7CA 3TS5C 4ORCB 1MR8A 3ZNIA 2PALA 2M9GA 3S0EA 2MAZA 2MJWB 3D76A 3SG2A 2KOTA 1XK4A 1FI6A 1NCYA 2OTGB 4MN0A 2M0RA 4YI9A 2KFFA 3I5HC 2D8NA 3SS3A 3BFBA 5CSNA 4ORAB 1SCMB 1L2OB 1OQPA 2WC6A 4ETOA 3IQOA 3FWBA 5PALA 5I2OA 2JNXA 2KBIA 2WC5A 3CWGA 4I5NB 4OKHA 3I5GB 4PE7A 3OP0A 1KFXS 1SMGA 1B47A 3DVKA 2OTGC 2ZRTA 4YI8A 4I5JA 1CDPA 1XA5A 3WHTB 4I5LB 1PSRA 3KEVA 1UWOA 1MUXA 1A75B 1G8IA 1SNLA 2M3WA 2QPTA 3PM8A 3R1OA 4MLWA 4R1EA 5D7FA 1BR1B 1YRTB 2M1KB 3OBVA 1CNPA 1IIOA 3PATA 1DJHA 2NLNA 2ZNEA 1PULA 3SJSA 3AAJA 2G2BA 2OS8C 2QDIA 3A8RA 2LCPA 3DZTA 4GAOA 3TUYC 3SG4A 4WQ2A 1F8HA 2WNDA 1IKUA 1C7WA 2WCJA 2L5XB 4INWA 5FI7A 1BODA 5HL1A 1EH2A 1YUUA 3JTDB 4FQTA 1IWQA 1JF2A 3UNWA 3TDIA 3SS5A 1RROA 3D10A 1QV0A 5B8IB 3SS4A 4DIRA 1AJ5A 1UUSA 2P71A 1KK7Y 3EKHA 3NXAA 3O2PA 2MLFC 3GOFA 3L4AA 3SG3A 1M63B 1R6PA 4OVNF 3BYAA 4I5KA 2LLTA 1C7VA 4GUKA 1CLMA 2K7BA 4YGAA 5AFPA 1UHJA 2K7OA 3BUWB 1YVHA 3PM2A 1ODBA 1GQMA 1DEKA 1W7IB 2G9BA 4BY4A 1BOCA 1RK9A 2HETA 2O60A 4IJ7A 1CKKA 3Q8IA 1NPQA 2WCMA 5CSIA 2LHLA 1CM1A 1DQEA 1V1GA 1XYDA 3CDNA 5HLVA 3VRRA 1LKJA 2QEOA 2H61A 1MXEA 1NX3A 2JULA 1KK8B 3D0YA 4MZJA 2MLEC 3DY9A 1KCYA 1QX2A 4JKTA 1PSBA 1TCOB 4PHMA 2K60A 3OHMB 1N65A 1A03A 1MWNA 4GGNA 4MSPA 2WCKA 3QMEA 2AMIA 3PN7C 1G33A 1WDCB 2QEHA 2ERBA 3BXKA 1L7ZA 1LS8A 1KFUS 2LLUA 2BL0C 3VRNA 3NHIA 1IQ5A 2GGMA 5FYXA 3EVUA 4AQJA 4D1EA 3GK1A 2KI4C 2R2IA 1J7QA 5AEQA 3CGAA 1TNPA 1YX8A 4FTGA 3B86A 3BJHA 2L98A 1Q80A 1ZOTB 2GGZA 2KBMA 4HSZA 1CFCA 1LA3A 4YGCB 2PYQA 1WDCC 1QXPA 3EK4A 1QLKA 2M8UA 2LVKA 2NZ0A 1K96A 3DXLA 1IQ3A 2BCBA 1JUOA 5EL2A 3D75A 3SIAA 1CFDA 2KFGA 2L2EA 1OZOA 2KI6D 1DELA 1DGVA 2Q91A 3PSRA 1LVCD 3VB1A 3WXAA 1JFKA 1F54A 2JC2A 4USLA 4QJ4B 2KFHA 3TS5B 1QS7A 3CR5X 2LVIA 5CPVA 1S6JA 2EC6B 1FW4A 5CSFA 4INXA 3RLZA 3V2LA 1BR4B 3MSEB 1PK0D 3I5HB 3KPXA 2KLDA 1PRWA 2M7NA 5DICA 1J55A 1SCVA 1YX7A 1A4PA 1WY9A 3DVJA 1QIWA 2F33A 2RGIA 4CFRA 1F4OA 2KSPA 1D1OA 1A75A 2WCEA 4XJKB 2KHNA 5I2QA 4A4BA 2AAOA 1TUZA 2JXCA 2K0JA 1KQMB 2O5GA 2EC6C 1K93D 4GPLB 1H8BA 4PE4A 3IF7A 1Y0VH 3LCPC 4PT1A 1PALA 3K1EA 1SY9A 1QTXA 1CFFA 1QX7A 2MA2A 1NCXA 4N1GA 1G4YR 3B88A 5AERA 1KFXL 5CSJA 1WLZA 2WCLA 3CR2A 1A2XA 2L51A 2KQYA 1AK8A 2SASA 2H2KA 1M31A 4YRUA 5HKWA 3LK1A 4GGFC 2OS8B 4MZLA 5D3OA 5D69A 2BAPA 2FCEA 4PE1A 4PDZA 1KQMC 2WC8A 1DTLA 4DUQA 3IVTA 4E68A 1JBAA 2CXJA 3D78A 3TUYB 1DMOA 1MXLC 1SR6C 3LL8B 4NDBA 1BG1A 1IJ6A 2WCHA 2COLB 2ISDA 3M0WA 2FOTA 1A29A 3DD4A 1XFVO 2YGUA 1S36A 2ZFDA 2ZNDA 3AAKA 1DGUA 1S5GY 2EGDA 3OB1B 4AOMA 1CMGA 1FI5A 2M1UA 1GGZA 2K7DA 1NCZA 3L4LA 1XVJA 1B7TZ 1NX1A 5HYDA 3VGOA 1YRUB 1B8LA 1DJGA 3DYEA 2LHIA 2F3ZA 2L5YA 2LAPA 3I5IC 3JVTC 1WRZA 1PVAA 2A4JA 3WNXB 1DJYA 1YUTA 1SKTA 2FCDA 2L0PA 1DF0B 2KPHA 2NXQA 4IL1A 1M39A 1Y1UA 2ZKMX 5JJGA 1OMDA 1S6IA 5GQQC 3BQ3A 3NSIA 1ORGA 4MZKA 3FWCA 1NIWA 4CFQA 2JTZA 2PSRA 4U8DA 4OV2A 1OSAA 2BCAA 2Y5IA 4YGDB 1FF1A 3CZ0A 4OCIA 2GV5A 3PFVA 2DOQA 3CR4X 1BLQA 5HKZA 1JFJA 3SG6A 1TNQA 5KSZA 1AHRA 1KWOC 3D77A 4CPVA 4PHJA 1VRKA 3HCMA 5G08A 1S3PA 5JOLA 1DJZA 4DS7A 1BF5A 1TNWA 3VRPA 1R2UA 3PN7B 3O6BA 3PALA 1DT7B 4YGBB 1H4BA 1J1DA 1W7JB 1XK4C 1EG3A 2NCOA 2BL0B 2K61A 1GGWA 1S5GZ 3BFHA 2JPOA 4JQ0D 1J7RA 4C0JA 1DJXA 2KDHA 2BBNA 1SL9A 1WRLA 1Y1XA 2KI4B 2JWWA 3FE8A 3FIAA 1OW4A 2TN4A 3O4YA 1PVBA 1UHIA 4WQ3A 2JPTA 1J7PA 2I7AA 3EVRA 1T14A 1KFUL 2WOSA 2JOJA 1QWVA 1UHHA 1NYAA 2KQ6A 2LP2A 3H4SE 3I5FC 2LUCA 4M2PA 1XO5A 3S0GA 2KYCA 1B8RA 1UP5A 1XFXO 3OGNA 1SL8A 1BT6A 3SIBA 4BY5A 2JT0A 1X02A 2LUXA 1IJ5A 1SSEB 1KK7Z 1TOPA 2KAVA 1CFPA 1XFUO 1YR5A 2LC5A 1B1GA 1TCFA 3F45A 2PRUA 3S0BA 1N2DA 1K8UA 1QJTA 1NWDA 3C1VA 3B87A 1QX5B 5F6TA 1JWDA 1MQ1A 2LVVA 1ZFSA 4XJKA 3RZSA 3FE6A 1SRAA 2Y4QA 4XYNA 1CMFA 5FI6A 3FE9A 1F70A 3LLEA 3NSLA 2P6BB 1FBVA 1IRJA 1IG5A 1IGVA 1SK6D 2Y1NA 2KGBC 4PHKA 2H8VA 1F4QA 1KSOA 2HQ8A 3BUOB 3CTNA 1TNXA 2LMUA 1ALWA 4TNCA 3S0AA 1B4CA 1OE9B 1SW8A 2FJYA 4Q04A 5I2LA 4P5OE 1K94A 1QVIY 1BU3A 4NDCA 3NSKA 3ICBA 4CLNA 2M49B 4NDDA 3WHUB 2M29A 4C0KA 3R72A 5ER4X 1DJWA 2GTEA 3BUMB 1OZSA 2Q4UA 2V53A 1QIVA 4UPGA 2JZIA 1MHOA 1RWYA 2HQWA 4CIDA 4A4CA 3CZ2A 4PHNA 4DCKA 3S0DA 2K2FA 1NX0A 1CDLA 1K2HA 3EVVA 1EG4A 4GBAA 4ICBA 2BKIB 2KAXA 3BUXB 3DVMA 4WRIA 1OOIX 3TDUA 1DJIA 1DVIA 2PQLA 2JU0A 3PLFB 2H61C 2K2AA 1SR6B 2LMVA 5DKRA 4N5XA 1BJFA 2KLEA 2BECA 5DKQA 1S6CA 2QEBA 3B7AA 5TNCA 1TTXA 4JPZB 1NSHA 3IQQA 1AVSA 1ZMZA 3DF0B 2JT3A 1HT9A 1OMVA 3CABA 1K9UA 3BOWB 1DF0A 2ZN8A 2JTTA 4F7FA 1F55A 2BE4A 2CBLA 1TIZA 3JVTB 1P28A 1XFWO 3I5IB 1QVIZ 5IBWA 1TN4A 3D74A 2MBXA 1Z4HA 4PALA 1AP4A 1XFYO 1N0YA 1AUIB 2ZRSA 3OB2B 1WRKA 2QACA 1J1EA 1LXFC 5KTYA 4ZCVA 1TWOA 1WLMA 3EKJA 1V1FA 2I2RE 1SPYA 3O4XA 5ER5A 4AQIA 3CZTX 3R1PA 3AKAA 1CDMA 1GM0A 2QEVA 2BBMA 1OMRA 3LK0A 3PJIA 3N7HA 4GNKB 1NX2A 3SG5A 2KNEA 2LV7A 2OPOA 1KWOB 4JD9A 4M2QA 3O78A 1OOFA 1SL7A 2CT9A 3NGVA 1U5IB 1MF8B 1B8CA 1SCMC 1L2OC 1LA0A 1EL4A 2M97A 2AUCA 1XFRA 2KAYA 2LM5A 3K21A 1HQVA 4L9MA 4ZCUA 1C07A 2BE6A 4HRHA 3I5GC 1OOHA 1CTRA 1Z2CB 2HPSA 2WORA 4HRGA 4KYNA 1CLLA 3S0FA 4MVFA 1JSAA 3NSOA
chains in the Genus database with same CATH topology
1Y1AA 2L50A 3CS1A 2LLSA 1K9PA 1K95A 3EK7A 3I5FB 3FS7A 5KU1A 2B1UA 3DVEA 4M2OA 1QLSA 5AXIA 2BKHB 2EHBA 4PCWA 1YURA 4C0LA 5HKYA 2PASA 2KI6C 1NP8A 3QRXA 1SBJA 1E8AA 1EJ3A 1QATA 2VRGA 1KSMA 1GJYA 1M46A 1UHKA 2LE9B 2I18A 1YUSA 4FQOA 5J3XA 1F71A 2M7LA 2CTNA 3KO0A 1QV1A 3JTDC 2K8MB 1K9KA 1FPWA 2JT8A 1B9AA 1NUBA 1ZACA 2IS9A 4N1FA 2MHHA 3RM1A 4MRYA 3VRQA 1RJVA 2ZN9A 3CLNA 2WCFA 2KGRA 2NCPA 1CLBA 1OOJA 3E3RA 2PVBA 1KQVA 1K90D 3KF9A 4NQGA 3TZ1A 4QJ5B 4YBHB 2HF5A 2L4HA 2LMTA 1CB1A 2BCXA 2CNPA 2F3YA 4MRXA 1YTZC 5AANA 2WCBA 1ALVA 2CCMA 2JXLA 3GK4X 4GGFA 1YVLA 1LINA 2JNFA 4HREE 2F2PA 2F8PA 3KHEA 2MRDA 1AJ4A 1KK8C 1J7OA 2I94A 4F0ZB 1EXRA 2Y1MA 4P2YB 3DF0A 2PMYA 4QJ3B 4JWQA 1CM4A 1IH0A 3OX6A 3BOWA 4ORBB 3D0YB 5HLOA 1XFZO 1TRFA 1BMOA 2SCPA 3A4UB 1RECA 2FJUB 3EK8A 3HX4A 2F2OA 1JC2A 1UHNA 1UURA 2JQ6A 2LVJA 1S26D 1Y6WA 3ZWHA 1CDNA 3GK2A 3OX5A 1RFJA 2E30A 5BPJA 3VROA 1S1EA 5DKNA 1ZUZA 4PE0A 1RTP1 5I8NA 3BUNB 1JF0A 5K89A 3TDZA 2E6WA 2KYFA 4DRWA 1SYMA 4OR9B 4YGEB 3AKBA 2JRFA 2LANA 4MBEA 4MEWA 2LP3A 4GFTA 1QASA 1M45A 1B7TY 2L4IA 2LNKA 3SG7A 1U5IA 2K7CA 3TS5C 4ORCB 1MR8A 3ZNIA 2PALA 2M9GA 2MAZA 2MJWB 3SG2A 2KOTA 1XK4A 1FI6A 1NCYA 2OTGB 4MN0A 2M0RA 4YI9A 2KFFA 3I5HC 2D8NA 5CSNA 4ORAB 1SCMB 1L2OB 1OQPA 5I2OA 4ETOA 3IQOA 3FWBA 5PALA 2JNXA 2KBIA 3CWGA 4I5NB 4OKHA 3I5GB 4PE7A 3OP0A 1KFXS 1SMGA 1B47A 3DVKA 2OTGC 2ZRTA 4YI8A 4I5JA 1CDPA 1XA5A 3WHTB 4I5LB 1PSRA 3KEVA 1UWOA 1MUXA 1A75B 1G8IA 1SNLA 2M3WA 2QPTA 3PM8A 4MLWA 4R1EA 5D7FA 1BR1B 1YRTB 2M1KB 1CNPA 3PATA 1DJHA 2NLNA 2ZNEA 1PULA 3SJSA 3AAJA 2G2BA 2OS8C 3A8RA 2LCPA 4GAOA 3TUYC 3SG4A 4WQ2A 1F8HA 2WNDA 1IKUA 1C7WA 2L5XB 1BODA 1EH2A 1YUUA 3JTDB 1IWQA 1JF2A 3TDIA 1RROA 3D10A 1QV0A 5B8IB 4DIRA 1AJ5A 1UUSA 3EKHA 1KK7Y 3NXAA 3O2PA 2MLFC 3GOFA 3SG3A 1M63B 1R6PA 4OVNF 3BYAA 4I5KA 2LLTA 1C7VA 4GUKA 1CLMA 2K7BA 4YGAA 5AFPA 1UHJA 2K7OA 3BUWB 1YVHA 1ODBA 1GQMA 1W7IB 2G9BA 4BY4A 1BOCA 1RK9A 2HETA 2O60A 1CKKA 1NPQA 5CSIA 2LHLA 1CM1A 1V1GA 1XYDA 5HLVA 3VRRA 1LKJA 2H61A 1MXEA 1NX3A 2JULA 1KK8B 3D0YA 4MZJA 2MLEC 1KCYA 1QX2A 1PSBA 1TCOB 4PHMA 3OHMB 1N65A 1A03A 1MWNA 4GGNA 4MSPA 2AMIA 3PN7C 1G33A 1WDCB 3BXKA 1L7ZA 1KFUS 2LLUA 2BL0C 3VRNA 1IQ5A 2GGMA 5FYXA 3EVUA 4AQJA 4D1EA 3GK1A 2KI4C 2R2IA 1J7QA 5AEQA 3CGAA 1TNPA 1YX8A 4FTGA 2L98A 1Q80A 1ZOTB 2GGZA 2KBMA 4HSZA 1CFCA 1LA3A 4YGCB 1WDCC 1QXPA 3EK4A 1QLKA 2M8UA 2LVKA 2NZ0A 1K96A 1IQ3A 2BCBA 1JUOA 3SIAA 1CFDA 2KFGA 2L2EA 1OZOA 2KI6D 1DGVA 2Q91A 3PSRA 1LVCD 3WXAA 1JFKA 1F54A 2JC2A 4USLA 4QJ4B 2KFHA 3TS5B 1QS7A 3CR5X 2LVIA 5CPVA 1S6JA 2EC6B 1FW4A 5CSFA 3RLZA 1BR4B 3MSEB 1PK0D 3I5HB 3KPXA 2M7NA 1PRWA 1J55A 1SCVA 1YX7A 1A4PA 1WY9A 3DVJA 1QIWA 2F33A 2RGIA 4CFRA 1F4OA 2KSPA 1D1OA 1A75A 2WCEA 4XJKB 2KHNA 5I2QA 4A4BA 2AAOA 2JXCA 2K0JA 1KQMB 2O5GA 2EC6C 1K93D 4GPLB 1H8BA 4PE4A 3IF7A 1Y0VH 3LCPC 1PALA 1SY9A 1QTXA 1CFFA 1QX7A 2MA2A 1NCXA 4N1GA 1G4YR 5AERA 1KFXL 5CSJA 1WLZA 3CR2A 1A2XA 2L51A 2KQYA 1AK8A 2SASA 2H2KA 1M31A 4YRUA 5HKWA 3LK1A 4GGFC 2OS8B 4MZLA 5D69A 4DUQA 2FCEA 4PE1A 4PDZA 1KQMC 2WC8A 1DTLA 4E68A 1JBAA 2CXJA 3TUYB 1DMOA 1MXLC 1SR6C 3LL8B 4NDBA 1BG1A 1IJ6A 2ISDA 2COLB 3M0WA 2FOTA 1A29A 3DD4A 1XFVO 1S36A 2ZFDA 2ZNDA 3AAKA 1DGUA 1S5GY 2EGDA 3OB1B 4AOMA 1CMGA 1FI5A 2M1UA 1GGZA 2K7DA 1NCZA 1XVJA 1B7TZ 1NX1A 5HYDA 3VGOA 1YRUB 1B8LA 1DJGA 3JVTC 2LHIA 2F3ZA 2LAPA 3I5IC 1WRZA 1PVAA 2A4JA 3WNXB 1DJYA 1YUTA 1SKTA 2FCDA 2L0PA 1DF0B 2NXQA 4IL1A 1M39A 1Y1UA 2ZKMX 5JJGA 1OMDA 1S6IA 5GQQC 3BQ3A 3NSIA 4MZKA 4CFQA 3FWCA 1NIWA 2JTZA 2PSRA 4U8DA 4OV2A 1OSAA 2BCAA 2Y5IA 4YGDB 1FF1A 4OCIA 2GV5A 3PFVA 2DOQA 3CR4X 1BLQA 5HKZA 1JFJA 3SG6A 1TNQA 5KSZA 1AHRA 1KWOC 4CPVA 4PHJA 1VRKA 3HCMA 5G08A 1S3PA 5JOLA 1DJZA 4DS7A 1BF5A 1TNWA 3VRPA 1R2UA 3PN7B 3O6BA 3PALA 1DT7B 4YGBB 1H4BA 1J1DA 1W7JB 1XK4C 1EG3A 2NCOA 2BL0B 2K61A 1GGWA 1S5GZ 4JQ0D 1J7RA 4C0JA 1DJXA 2KDHA 2BBNA 1SL9A 1WRLA 1Y1XA 2KI4B 2JWWA 3FIAA 3O4YA 2TN4A 4WQ3A 1PVBA 1UHIA 1J7PA 2JPTA 2I7AA 3EVRA 1KFUL 2WOSA 2JOJA 1UHHA 1NYAA 2KQ6A 2LP2A 3H4SE 3I5FC 2LUCA 4M2PA 1XO5A 2KYCA 1B8RA 1UP5A 1XFXO 1SL8A 1BT6A 3SIBA 4BY5A 2JT0A 1X02A 2LUXA 1IJ5A 1KK7Z 1TOPA 2KAVA 1CFPA 1XFUO 1YR5A 2LC5A 1B1GA 1TCFA 3F45A 2PRUA 1N2DA 1K8UA 1QJTA 1NWDA 3C1VA 1QX5B 5F6TA 1JWDA 1MQ1A 2LVVA 1ZFSA 4XJKA 1SRAA 2Y4QA 4XYNA 1CMFA 1F70A 3LLEA 3NSLA 2P6BB 1FBVA 1IRJA 1IG5A 1IGVA 1SK6D 2Y1NA 2KGBC 4PHKA 1F4QA 1KSOA 2HQ8A 3BUOB 3CTNA 1TNXA 2LMUA 1ALWA 4TNCA 1B4CA 1OE9B 1SW8A 4Q04A 5I2LA 4P5OE 1K94A 1QVIY 1BU3A 4NDCA 3NSKA 3ICBA 4CLNA 2M49B 4NDDA 3WHUB 2M29A 4C0KA 5ER4X 1DJWA 3BUMB 1OZSA 2Q4UA 2V53A 1QIVA 4UPGA 2JZIA 1MHOA 1RWYA 2HQWA 4CIDA 4A4CA 4PHNA 4DCKA 2K2FA 1NX0A 1CDLA 1K2HA 3EVVA 1EG4A 4GBAA 4ICBA 2BKIB 2KAXA 3BUXB 3DVMA 4WRIA 3TDUA 1DJIA 1DVIA 2JU0A 3PLFB 2H61C 2K2AA 1SR6B 2LMVA 5DKRA 4N5XA 1BJFA 2BECA 5DKQA 1S6CA 5TNCA 1TTXA 4JPZB 1NSHA 3IQQA 1AVSA 1ZMZA 3DF0B 2JT3A 1HT9A 1OMVA 1K9UA 3BOWB 1DF0A 2ZN8A 2JTTA 1F55A 2BE4A 2CBLA 1TIZA 3JVTB 1XFWO 3I5IB 1QVIZ 5IBWA 1TN4A 2MBXA 4PALA 1AP4A 1XFYO 1N0YA 1AUIB 2ZRSA 3OB2B 1WRKA 2QACA 1J1EA 1LXFC 5KTYA 4ZCVA 1WLMA 3EKJA 1V1FA 2I2RE 1SPYA 5ER5A 4AQIA 3CZTX 3AKAA 1CDMA 2BBMA 1OMRA 3LK0A 4GNKB 1NX2A 3SG5A 2KNEA 2LV7A 2OPOA 1KWOB 4M2QA 3O78A 1SL7A 2CT9A 1U5IB 1MF8B 1B8CA 1SCMC 1L2OC 1LA0A 1EL4A 2M97A 2AUCA 2KAYA 2LM5A 3K21A 4L9MA 1HQVA 4ZCUA 1C07A 2BE6A 4HRHA 3I5GC 1CTRA 2HPSA 2WORA 4HRGA 1CLLA 4MVFA 1JSAA 3NSOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Y1A A;  2L50 A;  3CS1 A;  2LLS A;  1K9P A;  1K95 A;  3EK7 A;  3I5F B;  3FS7 A;  5KU1 A;  2B1U A;  3DVE A;  4M2O A;  1QLS A;  5AXI A;  2BKH B;  2EHB A;  4PCW A;  1YUR A;  4C0L A;  5HKY A;  2PAS A;  2KI6 C;  1NP8 A;  3QRX A;  1SBJ A;  1E8A A;  1EJ3 A;  1QAT A;  2VRG A;  1KSM A;  1GJY A;  1M46 A;  1UHK A;  2LE9 B;  2I18 A;  1YUS A;  4FQO A;  5J3X A;  1F71 A;  2M7L A;  2CTN A;  3KO0 A;  1QV1 A;  3JTD C;  2K8M B;  1K9K A;  1FPW A;  2JT8 A;  1B9A A;  1NUB A;  1ZAC A;  2IS9 A;  4N1F A;  2MHH A;  3RM1 A;  4MRY A;  3VRQ A;  1RJV A;  2ZN9 A;  3CLN A;  2WCF A;  2KGR A;  2NCP A;  1CLB A;  1OOJ A;  3E3R A;  2PVB A;  1KQV A;  1K90 D;  3KF9 A;  4NQG A;  3TZ1 A;  4QJ5 B;  4YBH B;  2HF5 A;  2L4H A;  2LMT A;  1CB1 A;  2BCX A;  2CNP A;  2F3Y A;  4MRX A;  1YTZ C;  5AAN A;  2WCB A;  1ALV A;  2CCM A;  2JXL A;  3GK4 X;  4GGF A;  1YVL A;  1LIN A;  2JNF A;  4HRE E;  2F2P A;  2F8P A;  3KHE A;  2MRD A;  1AJ4 A;  1KK8 C;  1J7O A;  2I94 A;  4F0Z B;  1EXR A;  2Y1M A;  4P2Y B;  3DF0 A;  2PMY A;  4QJ3 B;  4JWQ A;  1CM4 A;  1IH0 A;  3OX6 A;  3BOW A;  4ORB B;  3D0Y B;  5HLO A;  1XFZ O;  1TRF A;  1BMO A;  2SCP A;  3A4U B;  1REC A;  2FJU B;  3EK8 A;  3HX4 A;  2F2O A;  1JC2 A;  1UHN A;  1UUR A;  2JQ6 A;  2LVJ A;  1S26 D;  1Y6W A;  3ZWH A;  1CDN A;  3GK2 A;  3OX5 A;  1RFJ A;  2E30 A;  5BPJ A;  3VRO A;  1S1E A;  5DKN A;  1ZUZ A;  4PE0 A;  1RTP 1;  5I8N A;  3BUN B;  1JF0 A;  5K89 A;  3TDZ A;  2E6W A;  2KYF A;  4DRW A;  1SYM A;  4OR9 B;  4YGE B;  3AKB A;  2JRF A;  2LAN A;  4MBE A;  4MEW A;  2LP3 A;  4GFT A;  1QAS A;  1M45 A;  1B7T Y;  2L4I A;  2LNK A;  3SG7 A;  1U5I A;  2K7C A;  3TS5 C;  4ORC B;  1MR8 A;  3ZNI A;  2PAL A;  2M9G A;  2MAZ A;  2MJW B;  3SG2 A;  2KOT A;  1XK4 A;  1FI6 A;  1NCY A;  2OTG B;  4MN0 A;  2M0R A;  4YI9 A;  2KFF A;  3I5H C;  2D8N A;  5CSN A;  4ORA B;  1SCM B;  1L2O B;  1OQP A;  5I2O A;  4ETO A;  3IQO A;  3FWB A;  5PAL A;  2JNX A;  2KBI A;  3CWG A;  4I5N B;  4OKH A;  3I5G B;  4PE7 A;  3OP0 A;  1KFX S;  1SMG A;  1B47 A;  3DVK A;  2OTG C;  2ZRT A;  4YI8 A;  4I5J A;  1CDP A;  1XA5 A;  3WHT B;  4I5L B;  1PSR A;  3KEV A;  1UWO A;  1MUX A;  1A75 B;  1G8I A;  1SNL A;  2M3W A;  2QPT A;  3PM8 A;  4MLW A;  4R1E A;  5D7F A;  1BR1 B;  1YRT B;  2M1K B;  1CNP A;  3PAT A;  1DJH A;  2NLN A;  2ZNE A;  1PUL A;  3SJS A;  3AAJ A;  2G2B A;  2OS8 C;  3A8R A;  2LCP A;  4GAO A;  3TUY C;  3SG4 A;  4WQ2 A;  1F8H A;  2WND A;  1IKU A;  1C7W A;  2L5X B;  1BOD A;  1EH2 A;  1YUU A;  3JTD B;  1IWQ A;  1JF2 A;  3TDI A;  1RRO A;  3D10 A;  1QV0 A;  5B8I B;  4DIR A;  1AJ5 A;  1UUS A;  3EKH A;  1KK7 Y;  3NXA A;  3O2P A;  2MLF C;  3GOF A;  3SG3 A;  1M63 B;  1R6P A;  4OVN F;  3BYA A;  4I5K A;  2LLT A;  1C7V A;  4GUK A;  1CLM A;  2K7B A;  4YGA A;  5AFP A;  1UHJ A;  2K7O A;  3BUW B;  1YVH A;  1ODB A;  1GQM A;  1W7I B;  2G9B A;  4BY4 A;  1BOC A;  1RK9 A;  2HET A;  2O60 A;  1CKK A;  1NPQ A;  5CSI A;  2LHL A;  1CM1 A;  1V1G A;  1XYD A;  5HLV A;  3VRR A;  1LKJ A;  2H61 A;  1MXE A;  1NX3 A;  2JUL A;  1KK8 B;  3D0Y A;  4MZJ A;  2MLE C;  1KCY A;  1QX2 A;  1PSB A;  1TCO B;  4PHM A;  3OHM B;  1N65 A;  1A03 A;  1MWN A;  4GGN A;  4MSP A;  2AMI A;  3PN7 C;  1G33 A;  1WDC B;  3BXK A;  1L7Z A;  1KFU S;  2LLU A;  2BL0 C;  3VRN A;  1IQ5 A;  2GGM A;  5FYX A;  3EVU A;  4AQJ A;  4D1E A;  3GK1 A;  2KI4 C;  2R2I A;  1J7Q A;  5AEQ A;  3CGA A;  1TNP A;  1YX8 A;  4FTG A;  2L98 A;  1Q80 A;  1ZOT B;  2GGZ A;  2KBM A;  4HSZ A;  1CFC A;  1LA3 A;  4YGC B;  1WDC C;  1QXP A;  3EK4 A;  1QLK A;  2M8U A;  2LVK A;  2NZ0 A;  1K96 A;  1IQ3 A;  2BCB A;  1JUO A;  3SIA A;  1CFD A;  2KFG A;  2L2E A;  1OZO A;  2KI6 D;  1DGV A;  2Q91 A;  3PSR A;  1LVC D;  3WXA A;  1JFK A;  1F54 A;  2JC2 A;  4USL A;  4QJ4 B;  2KFH A;  3TS5 B;  1QS7 A;  3CR5 X;  2LVI A;  5CPV A;  1S6J A;  2EC6 B;  1FW4 A;  5CSF A;  3RLZ A;  1BR4 B;  3MSE B;  1PK0 D;  3I5H B;  3KPX A;  2M7N A;  1PRW A;  1J55 A;  1SCV A;  1YX7 A;  1A4P A;  1WY9 A;  3DVJ A;  1QIW A;  2F33 A;  2RGI A;  4CFR A;  1F4O A;  2KSP A;  1D1O A;  1A75 A;  2WCE A;  4XJK B;  2KHN A;  5I2Q A;  4A4B A;  2AAO A;  2JXC A;  2K0J A;  1KQM B;  2O5G A;  2EC6 C;  1K93 D;  4GPL B;  1H8B A;  4PE4 A;  3IF7 A;  1Y0V H;  3LCP C;  1PAL A;  1SY9 A;  1QTX A;  1CFF A;  1QX7 A;  2MA2 A;  1NCX A;  4N1G A;  1G4Y R;  5AER A;  1KFX L;  5CSJ A;  1WLZ A;  3CR2 A;  1A2X A;  2L51 A;  2KQY A;  1AK8 A;  2SAS A;  2H2K A;  1M31 A;  4YRU A;  5HKW A;  3LK1 A;  4GGF C;  2OS8 B;  4MZL A;  5D69 A;  4DUQ A;  2FCE A;  4PE1 A;  4PDZ A;  1KQM C;  2WC8 A;  1DTL A;  4E68 A;  1JBA A;  2CXJ A;  3TUY B;  1DMO A;  1MXL C;  1SR6 C;  3LL8 B;  4NDB A;  1BG1 A;  1IJ6 A;  2ISD A;  2COL B;  3M0W A;  2FOT A;  1A29 A;  3DD4 A;  1XFV O;  1S36 A;  2ZFD A;  2ZND A;  3AAK A;  1DGU A;  1S5G Y;  2EGD A;  3OB1 B;  4AOM A;  1CMG A;  1FI5 A;  2M1U A;  1GGZ A;  2K7D A;  1NCZ A;  1XVJ A;  1B7T Z;  1NX1 A;  5HYD A;  3VGO A;  1YRU B;  1B8L A;  1DJG A;  3JVT C;  2LHI A;  2F3Z A;  2LAP A;  3I5I C;  1WRZ A;  1PVA A;  2A4J A;  3WNX B;  1DJY A;  1YUT A;  1SKT A;  2FCD A;  2L0P A;  1DF0 B;  2NXQ A;  4IL1 A;  1M39 A;  1Y1U A;  2ZKM X;  5JJG A;  1OMD A;  1S6I A;  5GQQ C;  3BQ3 A;  3NSI A;  4MZK A;  4CFQ A;  3FWC A;  1NIW A;  2JTZ A;  2PSR A;  4U8D A;  4OV2 A;  1OSA A;  2BCA A;  2Y5I A;  4YGD B;  1FF1 A;  4OCI A;  2GV5 A;  3PFV A;  2DOQ A;  3CR4 X;  1BLQ A;  5HKZ A;  1JFJ A;  3SG6 A;  1TNQ A;  5KSZ A;  1AHR A;  1KWO C;  4CPV A;  4PHJ A;  1VRK A;  3HCM A;  5G08 A;  1S3P A;  5JOL A;  1DJZ A;  4DS7 A;  1BF5 A;  1TNW A;  3VRP A;  1R2U A;  3PN7 B;  3O6B A;  3PAL A;  1DT7 B;  4YGB B;  1H4B A;  1J1D A;  1W7J B;  1XK4 C;  1EG3 A;  2NCO A;  2BL0 B;  2K61 A;  1GGW A;  1S5G Z;  4JQ0 D;  1J7R A;  4C0J A;  1DJX A;  2KDH A;  2BBN A;  1SL9 A;  1WRL A;  1Y1X A;  2KI4 B;  2JWW A;  3FIA A;  3O4Y A;  2TN4 A;  4WQ3 A;  1PVB A;  1UHI A;  1J7P A;  2JPT A;  2I7A A;  3EVR A;  1KFU L;  2WOS A;  2JOJ A;  1UHH A;  1NYA A;  2KQ6 A;  2LP2 A;  3H4S E;  3I5F C;  2LUC A;  4M2P A;  1XO5 A;  2KYC A;  1B8R A;  1UP5 A;  1XFX O;  1SL8 A;  1BT6 A;  3SIB A;  4BY5 A;  2JT0 A;  1X02 A;  2LUX A;  1IJ5 A;  1KK7 Z;  1TOP A;  2KAV A;  1CFP A;  1XFU O;  1YR5 A;  2LC5 A;  1B1G A;  1TCF A;  3F45 A;  2PRU A;  1N2D A;  1K8U A;  1QJT A;  1NWD A;  3C1V A;  1QX5 B;  5F6T A;  1JWD A;  1MQ1 A;  2LVV A;  1ZFS A;  4XJK A;  1SRA A;  2Y4Q A;  4XYN A;  1CMF A;  1F70 A;  3LLE A;  3NSL A;  2P6B B;  1FBV A;  1IRJ A;  1IG5 A;  1IGV A;  1SK6 D;  2Y1N A;  2KGB C;  4PHK A;  1F4Q A;  1KSO A;  2HQ8 A;  3BUO B;  3CTN A;  1TNX A;  2LMU A;  1ALW A;  4TNC A;  1B4C A;  1OE9 B;  1SW8 A;  4Q04 A;  5I2L A;  4P5O E;  1K94 A;  1QVI Y;  1BU3 A;  4NDC A;  3NSK A;  3ICB A;  4CLN A;  2M49 B;  4NDD A;  3WHU B;  2M29 A;  4C0K A;  5ER4 X;  1DJW A;  3BUM B;  1OZS A;  2Q4U A;  2V53 A;  1QIV A;  4UPG A;  2JZI A;  1MHO A;  1RWY A;  2HQW A;  4CID A;  4A4C A;  4PHN A;  4DCK A;  2K2F A;  1NX0 A;  1CDL A;  1K2H A;  3EVV A;  1EG4 A;  4GBA A;  4ICB A;  2BKI B;  2KAX A;  3BUX B;  3DVM A;  4WRI A;  3TDU A;  1DJI A;  1DVI A;  2JU0 A;  3PLF B;  2H61 C;  2K2A A;  1SR6 B;  2LMV A;  5DKR A;  4N5X A;  1BJF A;  2BEC A;  5DKQ A;  1S6C A;  5TNC A;  1TTX A;  4JPZ B;  1NSH A;  3IQQ A;  1AVS A;  1ZMZ A;  3DF0 B;  2JT3 A;  1HT9 A;  1OMV A;  1K9U A;  3BOW B;  1DF0 A;  2ZN8 A;  2JTT A;  1F55 A;  2BE4 A;  2CBL A;  1TIZ A;  3JVT B;  1XFW O;  3I5I B;  1QVI Z;  5IBW A;  1TN4 A;  2MBX A;  4PAL A;  1AP4 A;  1XFY O;  1N0Y A;  1AUI B;  2ZRS A;  3OB2 B;  1WRK A;  2QAC A;  1J1E A;  1LXF C;  5KTY A;  4ZCV A;  1WLM A;  3EKJ A;  1V1F A;  2I2R E;  1SPY A;  5ER5 A;  4AQI A;  3CZT X;  3AKA A;  1CDM A;  2BBM A;  1OMR A;  3LK0 A;  4GNK B;  1NX2 A;  3SG5 A;  2KNE A;  2LV7 A;  2OPO A;  1KWO B;  4M2Q A;  3O78 A;  1SL7 A;  2CT9 A;  1U5I B;  1MF8 B;  1B8C A;  1SCM C;  1L2O C;  1LA0 A;  1EL4 A;  2M97 A;  2AUC A;  2KAY A;  2LM5 A;  3K21 A;  4L9M A;  1HQV A;  4ZCU A;  1C07 A;  2BE6 A;  4HRH A;  3I5G C;  1CTR A;  2HPS A;  2WOR A;  4HRG A;  1CLL A;  4MVF A;  1JSA A;  3NSO A; 
#chains in the Genus database with same CATH topology
 1Y1A A;  2L50 A;  3CS1 A;  2LLS A;  1C3Z A;  1K9P A;  1K95 A;  3EK7 A;  3I5F B;  3FS7 A;  5I94 A;  5KU1 A;  2B1U A;  3DVE A;  4M2O A;  1DC1 A;  1QLS A;  5AXI A;  2BKH B;  2EHB A;  4PCW A;  1YUR A;  4C0L A;  5HKY A;  2PAS A;  2KI6 C;  1NP8 A;  3QRX A;  1SBJ A;  1E8A A;  1EJ3 A;  1QAT A;  2VRG A;  1KSM A;  1GJY A;  1M46 A;  1UHK A;  2LE9 B;  2I18 A;  1YUS A;  4FQO A;  5J3X A;  1F71 A;  2M7L A;  2CTN A;  3KO0 A;  1QV1 A;  3JTD C;  2K8M B;  1K9K A;  1FPW A;  2JT8 A;  3B6X A;  1B9A A;  1NUB A;  1ZAC A;  1TUJ A;  2IS9 A;  4N1F A;  2MHH A;  3RM1 A;  4MRY A;  3VRQ A;  1RJV A;  2ZN9 A;  3CLN A;  3CZ1 A;  2WCF A;  2KGR A;  2NCP A;  1CLB A;  1OOJ A;  4OZD A;  3E3R A;  2PVB A;  3EG5 B;  1K90 D;  3KF9 A;  4NQG A;  3TZ1 A;  4QJ5 B;  4YBH B;  1KQV A;  2HF5 A;  2L4H A;  2LMT A;  2P70 A;  1CB1 A;  2BCX A;  2CNP A;  5FI2 A;  2F3Y A;  1W9Z A;  4MRX A;  1YTZ C;  5AAN A;  2L2C A;  1ALV A;  2CCM A;  2JXL A;  2WCB A;  3GK4 X;  4GGF A;  1YVL A;  3D73 A;  1LIN A;  3BFA A;  2JNF A;  4HRE E;  2F2P A;  2F8P A;  3KHE A;  2MRD A;  1AJ4 A;  1KK8 C;  1J7O A;  2I94 A;  4F0Z B;  1EXR A;  2Y1M A;  2BNX A;  4P2Y B;  3DF0 A;  2PMY A;  4QJ3 B;  3L47 A;  4JWQ A;  1CM4 A;  1IH0 A;  3OX6 A;  3UO9 A;  3BOW A;  4ORB B;  3D0Y B;  5HLO A;  1XFZ O;  1TRF A;  1BMO A;  2SCP A;  3A4U B;  1REC A;  2FJU B;  3EK8 A;  3HX4 A;  2F2O A;  1JC2 A;  1UHN A;  1UUR A;  2JQ6 A;  2LVJ A;  1S26 D;  1Y6W A;  3ZWH A;  1CDN A;  1OOG A;  3GK2 A;  3OX5 A;  3CYZ A;  1RFJ A;  2E30 A;  5BPJ A;  3VRO A;  1S1E A;  3NHT A;  5DKN A;  1ZUZ A;  4PE0 A;  1RTP 1;  5I8N A;  3BUN B;  1JF0 A;  5K89 A;  3TDZ A;  2E6W A;  2KYF A;  4DRW A;  1SYM A;  4OR9 B;  4YGE B;  3R1V A;  3AKB A;  2JRF A;  2LAN A;  4MBE A;  4MEW A;  2LP3 A;  1C3Y A;  4GFT A;  1QAS A;  1M45 A;  1B7T Y;  2L4I A;  2LNK A;  3SG7 A;  1U5I A;  2K7C A;  3TS5 C;  4ORC B;  1MR8 A;  3ZNI A;  2PAL A;  2M9G A;  3S0E A;  2MAZ A;  2MJW B;  3D76 A;  3SG2 A;  2KOT A;  1XK4 A;  1FI6 A;  1NCY A;  2OTG B;  4MN0 A;  2M0R A;  4YI9 A;  2KFF A;  3I5H C;  2D8N A;  3SS3 A;  3BFB A;  5CSN A;  4ORA B;  1SCM B;  1L2O B;  1OQP A;  2WC6 A;  4ETO A;  3IQO A;  3FWB A;  5PAL A;  5I2O A;  2JNX A;  2KBI A;  2WC5 A;  3CWG A;  4I5N B;  4OKH A;  3I5G B;  4PE7 A;  3OP0 A;  1KFX S;  1SMG A;  1B47 A;  3DVK A;  2OTG C;  2ZRT A;  4YI8 A;  4I5J A;  1CDP A;  1XA5 A;  3WHT B;  4I5L B;  1PSR A;  3KEV A;  1UWO A;  1MUX A;  1A75 B;  1G8I A;  1SNL A;  2M3W A;  2QPT A;  3PM8 A;  3R1O A;  4MLW A;  4R1E A;  5D7F A;  1BR1 B;  1YRT B;  2M1K B;  3OBV A;  1CNP A;  1IIO A;  3PAT A;  1DJH A;  2NLN A;  2ZNE A;  1PUL A;  3SJS A;  3AAJ A;  2G2B A;  2OS8 C;  2QDI A;  3A8R A;  2LCP A;  3DZT A;  4GAO A;  3TUY C;  3SG4 A;  4WQ2 A;  1F8H A;  2WND A;  1IKU A;  1C7W A;  2WCJ A;  2L5X B;  4INW A;  5FI7 A;  1BOD A;  5HL1 A;  1EH2 A;  1YUU A;  3JTD B;  4FQT A;  1IWQ A;  1JF2 A;  3UNW A;  3TDI A;  3SS5 A;  1RRO A;  3D10 A;  1QV0 A;  5B8I B;  3SS4 A;  4DIR A;  1AJ5 A;  1UUS A;  2P71 A;  1KK7 Y;  3EKH A;  3NXA A;  3O2P A;  2MLF C;  3GOF A;  3L4A A;  3SG3 A;  1M63 B;  1R6P A;  4OVN F;  3BYA A;  4I5K A;  2LLT A;  1C7V A;  4GUK A;  1CLM A;  2K7B A;  4YGA A;  5AFP A;  1UHJ A;  2K7O A;  3BUW B;  1YVH A;  3PM2 A;  1ODB A;  1GQM A;  1DEK A;  1W7I B;  2G9B A;  4BY4 A;  1BOC A;  1RK9 A;  2HET A;  2O60 A;  4IJ7 A;  1CKK A;  3Q8I A;  1NPQ A;  2WCM A;  5CSI A;  2LHL A;  1CM1 A;  1DQE A;  1V1G A;  1XYD A;  3CDN A;  5HLV A;  3VRR A;  1LKJ A;  2QEO A;  2H61 A;  1MXE A;  1NX3 A;  2JUL A;  1KK8 B;  3D0Y A;  4MZJ A;  2MLE C;  3DY9 A;  1KCY A;  1QX2 A;  4JKT A;  1PSB A;  1TCO B;  4PHM A;  2K60 A;  3OHM B;  1N65 A;  1A03 A;  1MWN A;  4GGN A;  4MSP A;  2WCK A;  3QME A;  2AMI A;  3PN7 C;  1G33 A;  1WDC B;  2QEH A;  2ERB A;  3BXK A;  1L7Z A;  1LS8 A;  1KFU S;  2LLU A;  2BL0 C;  3VRN A;  3NHI A;  1IQ5 A;  2GGM A;  5FYX A;  3EVU A;  4AQJ A;  4D1E A;  3GK1 A;  2KI4 C;  2R2I A;  1J7Q A;  5AEQ A;  3CGA A;  1TNP A;  1YX8 A;  4FTG A;  3B86 A;  3BJH A;  2L98 A;  1Q80 A;  1ZOT B;  2GGZ A;  2KBM A;  4HSZ A;  1CFC A;  1LA3 A;  4YGC B;  2PYQ A;  1WDC C;  1QXP A;  3EK4 A;  1QLK A;  2M8U A;  2LVK A;  2NZ0 A;  1K96 A;  3DXL A;  1IQ3 A;  2BCB A;  1JUO A;  5EL2 A;  3D75 A;  3SIA A;  1CFD A;  2KFG A;  2L2E A;  1OZO A;  2KI6 D;  1DEL A;  1DGV A;  2Q91 A;  3PSR A;  1LVC D;  3VB1 A;  3WXA A;  1JFK A;  1F54 A;  2JC2 A;  4USL A;  4QJ4 B;  2KFH A;  3TS5 B;  1QS7 A;  3CR5 X;  2LVI A;  5CPV A;  1S6J A;  2EC6 B;  1FW4 A;  5CSF A;  4INX A;  3RLZ A;  3V2L A;  1BR4 B;  3MSE B;  1PK0 D;  3I5H B;  3KPX A;  2KLD A;  1PRW A;  2M7N A;  5DIC A;  1J55 A;  1SCV A;  1YX7 A;  1A4P A;  1WY9 A;  3DVJ A;  1QIW A;  2F33 A;  2RGI A;  4CFR A;  1F4O A;  2KSP A;  1D1O A;  1A75 A;  2WCE A;  4XJK B;  2KHN A;  5I2Q A;  4A4B A;  2AAO A;  1TUZ A;  2JXC A;  2K0J A;  1KQM B;  2O5G A;  2EC6 C;  1K93 D;  4GPL B;  1H8B A;  4PE4 A;  3IF7 A;  1Y0V H;  3LCP C;  4PT1 A;  1PAL A;  3K1E A;  1SY9 A;  1QTX A;  1CFF A;  1QX7 A;  2MA2 A;  1NCX A;  4N1G A;  1G4Y R;  3B88 A;  5AER A;  1KFX L;  5CSJ A;  1WLZ A;  2WCL A;  3CR2 A;  1A2X A;  2L51 A;  2KQY A;  1AK8 A;  2SAS A;  2H2K A;  1M31 A;  4YRU A;  5HKW A;  3LK1 A;  4GGF C;  2OS8 B;  4MZL A;  5D3O A;  5D69 A;  2BAP A;  2FCE A;  4PE1 A;  4PDZ A;  1KQM C;  2WC8 A;  1DTL A;  4DUQ A;  3IVT A;  4E68 A;  1JBA A;  2CXJ A;  3D78 A;  3TUY B;  1DMO A;  1MXL C;  1SR6 C;  3LL8 B;  4NDB A;  1BG1 A;  1IJ6 A;  2WCH A;  2COL B;  2ISD A;  3M0W A;  2FOT A;  1A29 A;  3DD4 A;  1XFV O;  2YGU A;  1S36 A;  2ZFD A;  2ZND A;  3AAK A;  1DGU A;  1S5G Y;  2EGD A;  3OB1 B;  4AOM A;  1CMG A;  1FI5 A;  2M1U A;  1GGZ A;  2K7D A;  1NCZ A;  3L4L A;  1XVJ A;  1B7T Z;  1NX1 A;  5HYD A;  3VGO A;  1YRU B;  1B8L A;  1DJG A;  3DYE A;  2LHI A;  2F3Z A;  2L5Y A;  2LAP A;  3I5I C;  3JVT C;  1WRZ A;  1PVA A;  2A4J A;  3WNX B;  1DJY A;  1YUT A;  1SKT A;  2FCD A;  2L0P A;  1DF0 B;  2KPH A;  2NXQ A;  4IL1 A;  1M39 A;  1Y1U A;  2ZKM X;  5JJG A;  1OMD A;  1S6I A;  5GQQ C;  3BQ3 A;  3NSI A;  1ORG A;  4MZK A;  3FWC A;  1NIW A;  4CFQ A;  2JTZ A;  2PSR A;  4U8D A;  4OV2 A;  1OSA A;  2BCA A;  2Y5I A;  4YGD B;  1FF1 A;  3CZ0 A;  4OCI A;  2GV5 A;  3PFV A;  2DOQ A;  3CR4 X;  1BLQ A;  5HKZ A;  1JFJ A;  3SG6 A;  1TNQ A;  5KSZ A;  1AHR A;  1KWO C;  3D77 A;  4CPV A;  4PHJ A;  1VRK A;  3HCM A;  5G08 A;  1S3P A;  5JOL A;  1DJZ A;  4DS7 A;  1BF5 A;  1TNW A;  3VRP A;  1R2U A;  3PN7 B;  3O6B A;  3PAL A;  1DT7 B;  4YGB B;  1H4B A;  1J1D A;  1W7J B;  1XK4 C;  1EG3 A;  2NCO A;  2BL0 B;  2K61 A;  1GGW A;  1S5G Z;  3BFH A;  2JPO A;  4JQ0 D;  1J7R A;  4C0J A;  1DJX A;  2KDH A;  2BBN A;  1SL9 A;  1WRL A;  1Y1X A;  2KI4 B;  2JWW A;  3FE8 A;  3FIA A;  1OW4 A;  2TN4 A;  3O4Y A;  1PVB A;  1UHI A;  4WQ3 A;  2JPT A;  1J7P A;  2I7A A;  3EVR A;  1T14 A;  1KFU L;  2WOS A;  2JOJ A;  1QWV A;  1UHH A;  1NYA A;  2KQ6 A;  2LP2 A;  3H4S E;  3I5F C;  2LUC A;  4M2P A;  1XO5 A;  3S0G A;  2KYC A;  1B8R A;  1UP5 A;  1XFX O;  3OGN A;  1SL8 A;  1BT6 A;  3SIB A;  4BY5 A;  2JT0 A;  1X02 A;  2LUX A;  1IJ5 A;  1SSE B;  1KK7 Z;  1TOP A;  2KAV A;  1CFP A;  1XFU O;  1YR5 A;  2LC5 A;  1B1G A;  1TCF A;  3F45 A;  2PRU A;  3S0B A;  1N2D A;  1K8U A;  1QJT A;  1NWD A;  3C1V A;  3B87 A;  1QX5 B;  5F6T A;  1JWD A;  1MQ1 A;  2LVV A;  1ZFS A;  4XJK A;  3RZS A;  3FE6 A;  1SRA A;  2Y4Q A;  4XYN A;  1CMF A;  5FI6 A;  3FE9 A;  1F70 A;  3LLE A;  3NSL A;  2P6B B;  1FBV A;  1IRJ A;  1IG5 A;  1IGV A;  1SK6 D;  2Y1N A;  2KGB C;  4PHK A;  2H8V A;  1F4Q A;  1KSO A;  2HQ8 A;  3BUO B;  3CTN A;  1TNX A;  2LMU A;  1ALW A;  4TNC A;  3S0A A;  1B4C A;  1OE9 B;  1SW8 A;  2FJY A;  4Q04 A;  5I2L A;  4P5O E;  1K94 A;  1QVI Y;  1BU3 A;  4NDC A;  3NSK A;  3ICB A;  4CLN A;  2M49 B;  4NDD A;  3WHU B;  2M29 A;  4C0K A;  3R72 A;  5ER4 X;  1DJW A;  2GTE A;  3BUM B;  1OZS A;  2Q4U A;  2V53 A;  1QIV A;  4UPG A;  2JZI A;  1MHO A;  1RWY A;  2HQW A;  4CID A;  4A4C A;  3CZ2 A;  4PHN A;  4DCK A;  3S0D A;  2K2F A;  1NX0 A;  1CDL A;  1K2H A;  3EVV A;  1EG4 A;  4GBA A;  4ICB A;  2BKI B;  2KAX A;  3BUX B;  3DVM A;  4WRI A;  1OOI X;  3TDU A;  1DJI A;  1DVI A;  2PQL A;  2JU0 A;  3PLF B;  2H61 C;  2K2A A;  1SR6 B;  2LMV A;  5DKR A;  4N5X A;  1BJF A;  2KLE A;  2BEC A;  5DKQ A;  1S6C A;  2QEB A;  3B7A A;  5TNC A;  1TTX A;  4JPZ B;  1NSH A;  3IQQ A;  1AVS A;  1ZMZ A;  3DF0 B;  2JT3 A;  1HT9 A;  1OMV A;  3CAB A;  1K9U A;  3BOW B;  1DF0 A;  2ZN8 A;  2JTT A;  4F7F A;  1F55 A;  2BE4 A;  2CBL A;  1TIZ A;  3JVT B;  1P28 A;  1XFW O;  3I5I B;  1QVI Z;  5IBW A;  1TN4 A;  3D74 A;  2MBX A;  1Z4H A;  4PAL A;  1AP4 A;  1XFY O;  1N0Y A;  1AUI B;  2ZRS A;  3OB2 B;  1WRK A;  2QAC A;  1J1E A;  1LXF C;  5KTY A;  4ZCV A;  1TWO A;  1WLM A;  3EKJ A;  1V1F A;  2I2R E;  1SPY A;  3O4X A;  5ER5 A;  4AQI A;  3CZT X;  3R1P A;  3AKA A;  1CDM A;  1GM0 A;  2QEV A;  2BBM A;  1OMR A;  3LK0 A;  3PJI A;  3N7H A;  4GNK B;  1NX2 A;  3SG5 A;  2KNE A;  2LV7 A;  2OPO A;  1KWO B;  4JD9 A;  4M2Q A;  3O78 A;  1OOF A;  1SL7 A;  2CT9 A;  3NGV A;  1U5I B;  1MF8 B;  1B8C A;  1SCM C;  1L2O C;  1LA0 A;  1EL4 A;  2M97 A;  2AUC A;  1XFR A;  2KAY A;  2LM5 A;  3K21 A;  1HQV A;  4L9M A;  4ZCU A;  1C07 A;  2BE6 A;  4HRH A;  3I5G C;  1OOH A;  1CTR A;  1Z2C B;  2HPS A;  2WOR A;  4HRG A;  4KYN A;  1CLL A;  3S0F A;  4MVF A;  1JSA A;  3NSO A; 
#chains in the Genus database with same CATH homology
 1Y1A A;  2L50 A;  3CS1 A;  2LLS A;  1K9P A;  1K95 A;  3EK7 A;  3I5F B;  3FS7 A;  5KU1 A;  2B1U A;  3DVE A;  4M2O A;  1QLS A;  5AXI A;  2BKH B;  2EHB A;  4PCW A;  1YUR A;  4C0L A;  5HKY A;  2PAS A;  2KI6 C;  1NP8 A;  3QRX A;  1SBJ A;  1E8A A;  1EJ3 A;  1QAT A;  2VRG A;  1KSM A;  1GJY A;  1M46 A;  1UHK A;  2LE9 B;  2I18 A;  1YUS A;  4FQO A;  5J3X A;  1F71 A;  2M7L A;  2CTN A;  3KO0 A;  1QV1 A;  3JTD C;  2K8M B;  1K9K A;  1FPW A;  2JT8 A;  1B9A A;  1NUB A;  1ZAC A;  2IS9 A;  4N1F A;  2MHH A;  3RM1 A;  4MRY A;  3VRQ A;  1RJV A;  2ZN9 A;  3CLN A;  2WCF A;  2KGR A;  2NCP A;  1CLB A;  1OOJ A;  3E3R A;  2PVB A;  1KQV A;  1K90 D;  3KF9 A;  4NQG A;  3TZ1 A;  4QJ5 B;  4YBH B;  2HF5 A;  2L4H A;  2LMT A;  1CB1 A;  2BCX A;  2CNP A;  2F3Y A;  4MRX A;  1YTZ C;  5AAN A;  2WCB A;  1ALV A;  2CCM A;  2JXL A;  3GK4 X;  4GGF A;  1YVL A;  1LIN A;  2JNF A;  4HRE E;  2F2P A;  2F8P A;  3KHE A;  2MRD A;  1AJ4 A;  1KK8 C;  1J7O A;  2I94 A;  4F0Z B;  1EXR A;  2Y1M A;  4P2Y B;  3DF0 A;  2PMY A;  4QJ3 B;  4JWQ A;  1CM4 A;  1IH0 A;  3OX6 A;  3BOW A;  4ORB B;  3D0Y B;  5HLO A;  1XFZ O;  1TRF A;  1BMO A;  2SCP A;  3A4U B;  1REC A;  2FJU B;  3EK8 A;  3HX4 A;  2F2O A;  1JC2 A;  1UHN A;  1UUR A;  2JQ6 A;  2LVJ A;  1S26 D;  1Y6W A;  3ZWH A;  1CDN A;  3GK2 A;  3OX5 A;  1RFJ A;  2E30 A;  5BPJ A;  3VRO A;  1S1E A;  5DKN A;  1ZUZ A;  4PE0 A;  1RTP 1;  5I8N A;  3BUN B;  1JF0 A;  5K89 A;  3TDZ A;  2E6W A;  2KYF A;  4DRW A;  1SYM A;  4OR9 B;  4YGE B;  3AKB A;  2JRF A;  2LAN A;  4MBE A;  4MEW A;  2LP3 A;  4GFT A;  1QAS A;  1M45 A;  1B7T Y;  2L4I A;  2LNK A;  3SG7 A;  1U5I A;  2K7C A;  3TS5 C;  4ORC B;  1MR8 A;  3ZNI A;  2PAL A;  2M9G A;  2MAZ A;  2MJW B;  3SG2 A;  2KOT A;  1XK4 A;  1FI6 A;  1NCY A;  2OTG B;  4MN0 A;  2M0R A;  4YI9 A;  2KFF A;  3I5H C;  2D8N A;  5CSN A;  4ORA B;  1SCM B;  1L2O B;  1OQP A;  5I2O A;  4ETO A;  3IQO A;  3FWB A;  5PAL A;  2JNX A;  2KBI A;  3CWG A;  4I5N B;  4OKH A;  3I5G B;  4PE7 A;  3OP0 A;  1KFX S;  1SMG A;  1B47 A;  3DVK A;  2OTG C;  2ZRT A;  4YI8 A;  4I5J A;  1CDP A;  1XA5 A;  3WHT B;  4I5L B;  1PSR A;  3KEV A;  1UWO A;  1MUX A;  1A75 B;  1G8I A;  1SNL A;  2M3W A;  2QPT A;  3PM8 A;  4MLW A;  4R1E A;  5D7F A;  1BR1 B;  1YRT B;  2M1K B;  1CNP A;  3PAT A;  1DJH A;  2NLN A;  2ZNE A;  1PUL A;  3SJS A;  3AAJ A;  2G2B A;  2OS8 C;  3A8R A;  2LCP A;  4GAO A;  3TUY C;  3SG4 A;  4WQ2 A;  1F8H A;  2WND A;  1IKU A;  1C7W A;  2L5X B;  1BOD A;  1EH2 A;  1YUU A;  3JTD B;  1IWQ A;  1JF2 A;  3TDI A;  1RRO A;  3D10 A;  1QV0 A;  5B8I B;  4DIR A;  1AJ5 A;  1UUS A;  3EKH A;  1KK7 Y;  3NXA A;  3O2P A;  2MLF C;  3GOF A;  3SG3 A;  1M63 B;  1R6P A;  4OVN F;  3BYA A;  4I5K A;  2LLT A;  1C7V A;  4GUK A;  1CLM A;  2K7B A;  4YGA A;  5AFP A;  1UHJ A;  2K7O A;  3BUW B;  1YVH A;  1ODB A;  1GQM A;  1W7I B;  2G9B A;  4BY4 A;  1BOC A;  1RK9 A;  2HET A;  2O60 A;  1CKK A;  1NPQ A;  5CSI A;  2LHL A;  1CM1 A;  1V1G A;  1XYD A;  5HLV A;  3VRR A;  1LKJ A;  2H61 A;  1MXE A;  1NX3 A;  2JUL A;  1KK8 B;  3D0Y A;  4MZJ A;  2MLE C;  1KCY A;  1QX2 A;  1PSB A;  1TCO B;  4PHM A;  3OHM B;  1N65 A;  1A03 A;  1MWN A;  4GGN A;  4MSP A;  2AMI A;  3PN7 C;  1G33 A;  1WDC B;  3BXK A;  1L7Z A;  1KFU S;  2LLU A;  2BL0 C;  3VRN A;  1IQ5 A;  2GGM A;  5FYX A;  3EVU A;  4AQJ A;  4D1E A;  3GK1 A;  2KI4 C;  2R2I A;  1J7Q A;  5AEQ A;  3CGA A;  1TNP A;  1YX8 A;  4FTG A;  2L98 A;  1Q80 A;  1ZOT B;  2GGZ A;  2KBM A;  4HSZ A;  1CFC A;  1LA3 A;  4YGC B;  1WDC C;  1QXP A;  3EK4 A;  1QLK A;  2M8U A;  2LVK A;  2NZ0 A;  1K96 A;  1IQ3 A;  2BCB A;  1JUO A;  3SIA A;  1CFD A;  2KFG A;  2L2E A;  1OZO A;  2KI6 D;  1DGV A;  2Q91 A;  3PSR A;  1LVC D;  3WXA A;  1JFK A;  1F54 A;  2JC2 A;  4USL A;  4QJ4 B;  2KFH A;  3TS5 B;  1QS7 A;  3CR5 X;  2LVI A;  5CPV A;  1S6J A;  2EC6 B;  1FW4 A;  5CSF A;  3RLZ A;  1BR4 B;  3MSE B;  1PK0 D;  3I5H B;  3KPX A;  2M7N A;  1PRW A;  1J55 A;  1SCV A;  1YX7 A;  1A4P A;  1WY9 A;  3DVJ A;  1QIW A;  2F33 A;  2RGI A;  4CFR A;  1F4O A;  2KSP A;  1D1O A;  1A75 A;  2WCE A;  4XJK B;  2KHN A;  5I2Q A;  4A4B A;  2AAO A;  2JXC A;  2K0J A;  1KQM B;  2O5G A;  2EC6 C;  1K93 D;  4GPL B;  1H8B A;  4PE4 A;  3IF7 A;  1Y0V H;  3LCP C;  1PAL A;  1SY9 A;  1QTX A;  1CFF A;  1QX7 A;  2MA2 A;  1NCX A;  4N1G A;  1G4Y R;  5AER A;  1KFX L;  5CSJ A;  1WLZ A;  3CR2 A;  1A2X A;  2L51 A;  2KQY A;  1AK8 A;  2SAS A;  2H2K A;  1M31 A;  4YRU A;  5HKW A;  3LK1 A;  4GGF C;  2OS8 B;  4MZL A;  5D69 A;  4DUQ A;  2FCE A;  4PE1 A;  4PDZ A;  1KQM C;  2WC8 A;  1DTL A;  4E68 A;  1JBA A;  2CXJ A;  3TUY B;  1DMO A;  1MXL C;  1SR6 C;  3LL8 B;  4NDB A;  1BG1 A;  1IJ6 A;  2ISD A;  2COL B;  3M0W A;  2FOT A;  1A29 A;  3DD4 A;  1XFV O;  1S36 A;  2ZFD A;  2ZND A;  3AAK A;  1DGU A;  1S5G Y;  2EGD A;  3OB1 B;  4AOM A;  1CMG A;  1FI5 A;  2M1U A;  1GGZ A;  2K7D A;  1NCZ A;  1XVJ A;  1B7T Z;  1NX1 A;  5HYD A;  3VGO A;  1YRU B;  1B8L A;  1DJG A;  3JVT C;  2LHI A;  2F3Z A;  2LAP A;  3I5I C;  1WRZ A;  1PVA A;  2A4J A;  3WNX B;  1DJY A;  1YUT A;  1SKT A;  2FCD A;  2L0P A;  1DF0 B;  2NXQ A;  4IL1 A;  1M39 A;  1Y1U A;  2ZKM X;  5JJG A;  1OMD A;  1S6I A;  5GQQ C;  3BQ3 A;  3NSI A;  4MZK A;  4CFQ A;  3FWC A;  1NIW A;  2JTZ A;  2PSR A;  4U8D A;  4OV2 A;  1OSA A;  2BCA A;  2Y5I A;  4YGD B;  1FF1 A;  4OCI A;  2GV5 A;  3PFV A;  2DOQ A;  3CR4 X;  1BLQ A;  5HKZ A;  1JFJ A;  3SG6 A;  1TNQ A;  5KSZ A;  1AHR A;  1KWO C;  4CPV A;  4PHJ A;  1VRK A;  3HCM A;  5G08 A;  1S3P A;  5JOL A;  1DJZ A;  4DS7 A;  1BF5 A;  1TNW A;  3VRP A;  1R2U A;  3PN7 B;  3O6B A;  3PAL A;  1DT7 B;  4YGB B;  1H4B A;  1J1D A;  1W7J B;  1XK4 C;  1EG3 A;  2NCO A;  2BL0 B;  2K61 A;  1GGW A;  1S5G Z;  4JQ0 D;  1J7R A;  4C0J A;  1DJX A;  2KDH A;  2BBN A;  1SL9 A;  1WRL A;  1Y1X A;  2KI4 B;  2JWW A;  3FIA A;  3O4Y A;  2TN4 A;  4WQ3 A;  1PVB A;  1UHI A;  1J7P A;  2JPT A;  2I7A A;  3EVR A;  1KFU L;  2WOS A;  2JOJ A;  1UHH A;  1NYA A;  2KQ6 A;  2LP2 A;  3H4S E;  3I5F C;  2LUC A;  4M2P A;  1XO5 A;  2KYC A;  1B8R A;  1UP5 A;  1XFX O;  1SL8 A;  1BT6 A;  3SIB A;  4BY5 A;  2JT0 A;  1X02 A;  2LUX A;  1IJ5 A;  1KK7 Z;  1TOP A;  2KAV A;  1CFP A;  1XFU O;  1YR5 A;  2LC5 A;  1B1G A;  1TCF A;  3F45 A;  2PRU A;  1N2D A;  1K8U A;  1QJT A;  1NWD A;  3C1V A;  1QX5 B;  5F6T A;  1JWD A;  1MQ1 A;  2LVV A;  1ZFS A;  4XJK A;  1SRA A;  2Y4Q A;  4XYN A;  1CMF A;  1F70 A;  3LLE A;  3NSL A;  2P6B B;  1FBV A;  1IRJ A;  1IG5 A;  1IGV A;  1SK6 D;  2Y1N A;  2KGB C;  4PHK A;  1F4Q A;  1KSO A;  2HQ8 A;  3BUO B;  3CTN A;  1TNX A;  2LMU A;  1ALW A;  4TNC A;  1B4C A;  1OE9 B;  1SW8 A;  4Q04 A;  5I2L A;  4P5O E;  1K94 A;  1QVI Y;  1BU3 A;  4NDC A;  3NSK A;  3ICB A;  4CLN A;  2M49 B;  4NDD A;  3WHU B;  2M29 A;  4C0K A;  5ER4 X;  1DJW A;  3BUM B;  1OZS A;  2Q4U A;  2V53 A;  1QIV A;  4UPG A;  2JZI A;  1MHO A;  1RWY A;  2HQW A;  4CID A;  4A4C A;  4PHN A;  4DCK A;  2K2F A;  1NX0 A;  1CDL A;  1K2H A;  3EVV A;  1EG4 A;  4GBA A;  4ICB A;  2BKI B;  2KAX A;  3BUX B;  3DVM A;  4WRI A;  3TDU A;  1DJI A;  1DVI A;  2JU0 A;  3PLF B;  2H61 C;  2K2A A;  1SR6 B;  2LMV A;  5DKR A;  4N5X A;  1BJF A;  2BEC A;  5DKQ A;  1S6C A;  5TNC A;  1TTX A;  4JPZ B;  1NSH A;  3IQQ A;  1AVS A;  1ZMZ A;  3DF0 B;  2JT3 A;  1HT9 A;  1OMV A;  1K9U A;  3BOW B;  1DF0 A;  2ZN8 A;  2JTT A;  1F55 A;  2BE4 A;  2CBL A;  1TIZ A;  3JVT B;  1XFW O;  3I5I B;  1QVI Z;  5IBW A;  1TN4 A;  2MBX A;  4PAL A;  1AP4 A;  1XFY O;  1N0Y A;  1AUI B;  2ZRS A;  3OB2 B;  1WRK A;  2QAC A;  1J1E A;  1LXF C;  5KTY A;  4ZCV A;  1WLM A;  3EKJ A;  1V1F A;  2I2R E;  1SPY A;  5ER5 A;  4AQI A;  3CZT X;  3AKA A;  1CDM A;  2BBM A;  1OMR A;  3LK0 A;  4GNK B;  1NX2 A;  3SG5 A;  2KNE A;  2LV7 A;  2OPO A;  1KWO B;  4M2Q A;  3O78 A;  1SL7 A;  2CT9 A;  1U5I B;  1MF8 B;  1B8C A;  1SCM C;  1L2O C;  1LA0 A;  1EL4 A;  2M97 A;  2AUC A;  2KAY A;  2LM5 A;  3K21 A;  4L9M A;  1HQV A;  4ZCU A;  1C07 A;  2BE6 A;  4HRH A;  3I5G C;  1CTR A;  2HPS A;  2WOR A;  4HRG A;  1CLL A;  4MVF A;  1JSA A;  3NSO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...