1MXLC

Structure of cardiac troponin c-troponin i complex
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
89
structure length
89
Chain Sequence
MDDIYKAAVEQLTEEQKNEFKAAFDIFVLGAEDGCISTKELGKVMRMLGQNPTPEELQEMIDEVDEDGSGTVDFDEFLVMMVRCMKDDS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Calcium-binding protein
molecule keywords PROTEIN (TROPONIN C)
publication title Binding of cardiac troponin-I147-163 induces a structural opening in human cardiac troponin-C.
pubmed doi rcsb
source organism Homo sapiens
total genus 20
structure length 89
sequence length 89
ec nomenclature
pdb deposition date 1999-04-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF13833 EF-hand_8 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1mxlC00
1R2UA 2JZIA 2PRUA 5HLVA 3SIAA 1CTRA 1M63B 2ZFDA 5DKNA 1YVLA 1PSRA 2KFFA 1SL9A 2KAYA 2D8NA 1MHOA 2KI4B 3I5FC 1YX8A 2ZKMX 4CPVA 3ZWHA 3PN7C 2K7OA 1Y6WA 3SG5A 2NZ0A 2BCBA 3KF9A 4DRWA 1G33A 3KO0A 2ZRTA 4MVFA 3NSOA 4WQ3A 1TNPA 2F3YA 2L4HA 3O6BA 1QS7A 1N0YA 2FCDA 1YURA 2LV7A 2BE4A 3SG2A 3O78A 2MJWB 3DVEA 1WDCB 2QACA 3LL8B 2GGZA 5BPJA 1BJFA 2DOQA 4P2YB 2P6BB 1PSBA 2EC6B 1DJHA 3VRPA 3LK1A 1B8RA 4C0LA 4MSPA 4YGAA 3PALA 3JTDC 2PMYA 4QJ4B 4D1EA 4I5NB 2F3ZA 1A29A 1B47A 2BCXA 1F4QA 4E68A 2LLTA 2KI6D 1BU3A 1XFWO 2HETA 3PFVA 2KAXA 2LANA 3I5GB 5HKZA 5J3XA 2FCEA 1B1GA 1MUXA 2SASA 3EK4A 1JUOA 2KFHA 1G4YR 3VRQA 1NX2A 1DT7B 2WCFA 2M7LA 1C7VA 1JFJA 1KQMB 2ZNDA 4NDDA 1YUSA 1AJ4A 1F55A 1FBVA 5HKYA 1CM1A 1SYMA 1SR6C 3EVRA 1DGUA 1KFXL 1QV0A 1SK6D 3TZ1A 2H2KA 2JULA 2MLFC 3K21A 2OPOA 1M31A 3VRNA 1MWNA 1S5GZ 3CR2A 4Q04A 1TCFA 2LVKA 3IF7A 3NSIA 1RFJA 1SKTA 1UUSA 1NPQA 2KBIA 1TNWA 3DF0A 1U5IA 2BECA 2KFGA 3NSLA 5D7FA 1G8IA 1F71A 2E30A 1RK9A 4USLA 2LHIA 3HCMA 1Y0VH 2OTGC 3I5HB 3LCPC 2HQ8A 1KK7Y 2IS9A 1HT9A 4ORBB 1BF5A 1DJWA 1BR4B 1SL7A 1YUUA 2CTNA 2LLSA 4YGBB 2JU0A 3AKAA 1ZMZA 1K2HA 1HQVA 1K9PA 4NQGA 3KEVA 1TOPA 1J1EA 2BE6A 3OX6A 5I2QA 3CS1A 4ETOA 1BR1B 1XFYO 1LA0A 1ZFSA 3O4YA 2CXJA 4FTGA 4YGEB 5AEQA 5HYDA 3CLNA 1NX0A 1CMFA 1OMVA 3BQ3A 1CFPA 1OE9B 1KK8C 2JNFA 1CLMA 2JTTA 2LUCA 3I5IC 2I94A 1MXEA 1JSAA 1IGVA 2LVJA 2PSRA 2R2IA 3CGAA 1FI6A 1SCMC 2Q91A 2KI4C 1MR8A 4JPZB 1DJZA 4PDZA 3SG7A 2BBNA 2M1UA 1ZACA 3HX4A 1DTLA 2AMIA 1SPYA 3LK0A 1N65A 2JT3A 3FIAA 3PLFB 5K89A 1JC2A 4MRXA 1B7TZ 1C7WA 1U5IB 2KQ6A 4HRGA 1XVJA 2H61C 4CIDA 4GGFA 2BL0B 5AFPA 3ZNIA 3RM1A 3WHUB 1H8BA 4C0JA 1DJXA 4GNKB 2K61A 1OZSA 2KSPA 3TDZA 1WDCC 5HKWA 3SJSA 2BBMA 1TCOB 4IL1A 1IG5A 1K90D 1MF8B 1WLMA 2GV5A 2EC6C 4QJ5B 1MQ1A 2BCAA 4GUKA 1SRAA 1S26D 4YRUA 2LVVA 2M8UA 3E3RA 3CR5X 3TUYB 1NX3A 5CSIA 1WRLA 2K0JA 4DS7A 1DJGA 2TN4A 3D0YB 4ZCUA 2M0RA 1NWDA 1IJ5A 1CDPA 1S6IA 1UHHA 2OS8B 2M3WA 2KAVA 1CMGA 1BT6A 1PULA 5JJGA 1CKKA 2M1KB 3WNXB 1IRJA 2B1UA 2Y4QA 1L7ZA 4NDCA 1GGWA 2LAPA 4M2PA 3H4SE 1KWOB 1UHNA 2FOTA 1SNLA 3NSKA 2WNDA 1YUTA 2SCPA 1NCYA 2RGIA 2KGRA 1TIZA 2JTZA 1NYAA 3EK7A 3BUXB 2G2BA 1ALWA 2JNXA 2KGBC 4N5XA 2F2PA 1W7JB 1ZUZA 2LE9B 1OMRA 1W7IB 1UURA 1NP8A 1X02A 2JT0A 3BYAA 2I2RE 3SIBA 1DGVA 2EHBA 4N1GA 1IQ3A 4DIRA 1PK0D 3GK1A 2BKIB 1EH2A 4PHMA 2KYCA 4BY4A 4OVNF 3PN7B 2KI6C 3CWGA 1VRKA 3I5HC 5ER5A 2NLNA 1S1EA 4ORAB 5TNCA 1SL8A 1CLLA 2L2EA 2K8MB 2I18A 1GJYA 1TRFA 3GOFA 3OP0A 2LUXA 4MZLA 2KDHA 1RROA 1SMGA 1RECA 3WXAA 2L98A 2K7CA 1NIWA 3EVUA 1YX7A 1Y1AA 3VROA 5AERA 2L4IA 1UWOA 1JF0A 2JT8A 3IQOA 2JWWA 1GGZA 1L2OC 1S36A 4MBEA 1WLZA 4BY5A 2NXQA 1DJIA 4MZJA 1QLKA 4GBAA 4YBHB 1WRKA 1OQPA 1KK7Z 5AXIA 4CFRA 1V1FA 1JBAA 4MRYA 5CSJA 1XO5A 2AUCA 3AAJA 2JPTA 2KOTA 1K9KA 1RJVA 1QX5B 1S5GY 1JFKA 2HF5A 2LP2A 4M2OA 1NSHA 2WCBA 5PALA 3DVJA 1M39A 5I8NA 1UP5A 2MBXA 2KQYA 1JF2A 2NCPA 4PE1A 5B8IB 5G08A 1DF0A 2BKHB 1J7OA 2Y1NA 1BLQA 2L50A 1ALVA 4PE4A 4GAOA 2F2OA 3TS5C 5AANA 4ICBA 2O5GA 1QX2A 2CCMA 3VRRA 3CR4X 1K96A 4PHKA 1QTXA 2ISDA 3SG4A 1F70A 1DMOA 1M46A 1NCZA 4L9MA 1AUIB 2LMVA 4OKHA 1F54A 2ZN8A 2GGMA 2M9GA 1AP4A 1KSMA 2Y5IA 1XFUO 3KPXA 1F4OA 1NCXA 3BUWB 1N2DA 1V1GA 1XFXO 3DF0B 1WY9A 3JVTB 2H61A 4DUQA 5DKQA 1KCYA 1JWDA 1S6CA 4MEWA 4GGNA 2KHNA 1BOCA 2WCEA 3PATA 1RTP1 2MA2A 1IKUA 4OV2A 4WRIA 2KBMA 1J55A 3QRXA 4XJKA 4ZCVA 4M2QA 1XFZO 5IBWA 2JOJA 1A03A 2A4JA 3KHEA 3M0WA 4HREE 5HLOA 1BG1A 1YRUB 1QIVA 2M29A 2MAZA 5KTYA 2JRFA 4AOMA 3BOWA 1D1OA 3DVMA 4MLWA 1K9UA 1K95A 1PRWA 5KSZA 1KSOA 2MHHA 2PALA 2LVIA 1QVIY 1J7RA 2NCOA 2LP3A 3DVKA 2E6WA 1EJ3A 2I7AA 1EL4A 1CB1A 1DF0B 1PVBA 1SCVA 4TNCA 1ZOTB 4U8DA 1UHKA 1XK4C 1J7PA 4GGFC 1CDMA 2ZN9A 1K8UA 1EG4A 1OOJA 3I5GC 4OCIA 1LVCD 1QX7A 1SY9A 1NX1A 2M7NA 1J1DA 1Y1UA 2O60A 1SCMB 2Y1MA 4A4BA 1YVHA 1DVIA 1CNPA 1IJ6A 2CNPA 1F8HA 1KQMC 4I5KA 1B9AA 2LC5A 2M97A 2ZRSA 3I5IB 1A75A 1LA3A 4PCWA 3SG6A 1CLBA 1UHJA 3A4UB 3F45A 1IQ5A 1TN4A 2EGDA 1QASA 3AKBA 3OHMB 2VRGA 2CBLA 2HQWA 4F0ZB 1K94A 4ORCB 1OMDA 1PALA 4N1FA 2L5XB 1FPWA 4GFTA 1CDLA 2CT9A 2AAOA 1MXLC 2LCPA 4XJKB 3WHTB 1CFFA 1KQVA 1Y1XA 5KU1A 3A8RA 4NDBA 2K2FA 4JWQA 3I5FB 2F8PA 1J7QA 1KFXS 3BOWB 3TDUA 2MRDA 3NXAA 1B4CA 4PE0A 3OB2B 4HRHA 1B8LA 1E8AA 1BODA 3ICBA 3C1VA 5I2LA 3EVVA 1LINA 1C07A 1LKJA 1ODBA 1EXRA 2JQ6A 2K7BA 2L51A 3D10A 2LMTA 4AQJA 1R6PA 1CFDA 1OSAA 1QXPA 3O2PA 5I2OA 4CLNA 1B8CA 4A4CA 4PALA 4OR9B 1FW4A 1IH0A 1AVSA 1IWQA 1S6JA 1TNXA 3GK2A 4MZKA 2MLEC 1WRZA 5GQQC 3RLZA 2LLUA 3FS7A 4C0KA 1CFCA 1FF1A 2FJUB 1XFVO 4DCKA 5ER4X 2PASA 1A75B 1SBJA 1H4BA 2HPSA 3JTDB 1S3PA 4MN0A 3IQQA 4WQ2A 3BUNB 5CPVA 3VGOA 4HSZA 1AHRA 2V53A 1CDNA 5JOLA 3PM8A 4AQIA 4R1EA 3PSRA 4I5JA 2L0PA 1AJ5A 5D69A 4UPGA 4YI9A 2K7DA 3GK4X 1UHIA 3JVTC 4JQ0D 4P5OE 2COLB 4QJ3B 1AK8A 1XA5A 3FWCA 1PVAA 3BXKA 1QJTA 2PVBA 1YTZC 2BL0C 4YI8A 1SR6B 1QATA 2QPTA 2K2AA 3TDIA 1TTXA 3LLEA 2LNKA 5FYXA 3OX5A 4PHNA 2WORA 1KFUS 3BUOB 4I5LB 3AAKA 1OZOA 3SG3A 2JC2A 3TUYC 1L2OB 2M49B 3D0YA 4XYNA 1M45A 1BMOA 1LXFC 3DD4A 2WOSA 3BUMB 2OS8C 2OTGB 4YGCB 1TNQA 1RWYA 3EK8A 2LM5A 3EKHA 2F33A 2LHLA 1K93D 5F6TA 4YGDB 3EKJA 2WC8A 1FI5A 1A2XA 2LMUA 2JXLA 3OB1B 1SW8A 1A4PA 1QIWA 1QLSA 1KWOC 1QVIZ 2ZNEA 3FWBA 4GPLB 3CZTX 1GQMA 1YR5A 2KYFA 4PE7A 3CTNA 4FQOA 1Q80A 1YRTB 1XYDA 4PHJA 1NUBA 1QV1A 5CSNA 1DJYA 1KFUL 3MSEB 1B7TY 5CSFA 2Q4UA 1XK4A 5DKRA 2KNEA 2G9BA 4CFQA 1KK8B 1EG3A 3TS5B 1CM4A 2JXCA
chains in the Genus database with same CATH superfamily
1R2UA 2JZIA 2PRUA 5HLVA 3SIAA 1CTRA 1M63B 2ZFDA 5DKNA 1YVLA 1PSRA 2KFFA 1SL9A 2KAYA 2D8NA 1MHOA 2KI4B 4F7FA 3I5FC 1YX8A 2ZKMX 1DQEA 4CPVA 4INXA 3ZWHA 3PN7C 2K7OA 1Y6WA 2YGUA 3SG5A 2NZ0A 2BCBA 3KF9A 4DRWA 1G33A 3KO0A 2ZRTA 4MVFA 3NSOA 4WQ3A 1TNPA 2F3YA 2L4HA 3O6BA 3L47A 1QS7A 1N0YA 3S0FA 2FCDA 1YURA 2LV7A 3CZ0A 2BE4A 3SG2A 3O78A 2MJWB 2P71A 3DVEA 1WDCB 2QACA 2QEVA 3LL8B 2GGZA 5BPJA 1BJFA 2DOQA 4P2YB 2P6BB 3D78A 1PSBA 2EC6B 1DJHA 3NGVA 4F0ZB 3VRPA 3SS5A 3LK1A 1B8RA 4C0LA 4MSPA 4YGAA 3PALA 3JTDC 2PMYA 4QJ4B 4D1EA 4I5NB 2F3ZA 1A29A 2WCLA 1B47A 2BCXA 1C3ZA 1F4QA 4E68A 2LLTA 2KI6D 1BU3A 1XFWO 2HETA 3PFVA 2KAXA 2LANA 3I5GB 4INWA 5HKZA 5J3XA 4JD9A 2FCEA 1B1GA 1MUXA 2SASA 3CABA 1JUOA 2KFHA 1G4YR 3EK4A 1NX2A 3VRQA 1DT7B 2WCFA 2M7LA 1C7VA 1JFJA 3K1EA 1KQMB 3N7HA 2ZNDA 4NDDA 3S0BA 1YUSA 1AJ4A 1F55A 1FBVA 5HKYA 1CM1A 1SYMA 1SR6C 3EVRA 1TWOA 1DGUA 1KFXL 1QV0A 1SK6D 2KPHA 3TZ1A 2H2KA 2JULA 2MLFC 4PT1A 3K21A 2OPOA 1M31A 3VRNA 5I94A 1MWNA 1S5GZ 3CR2A 4Q04A 1TCFA 2LVKA 3IF7A 2KLEA 3NSIA 1RFJA 1SKTA 1UUSA 1NPQA 2KBIA 1TNWA 3DF0A 1OOIX 1C3YA 1U5IA 2BECA 3D75A 2KFGA 3NSLA 5D7FA 1G8IA 1F71A 2E30A 1RK9A 4USLA 2LHIA 3HCMA 1Y0VH 2OTGC 3I5HB 3LCPC 2HQ8A 1KK7Y 2IS9A 1DC1A 1HT9A 4ORBB 1BF5A 1DJWA 1BR4B 1SL7A 1YUUA 2CTNA 2LLSA 4YGBB 5FI7A 2JU0A 3AKAA 1ZMZA 1K2HA 1HQVA 1K9PA 4NQGA 3KEVA 1TOPA 1J1EA 2BE6A 3OX6A 5I2QA 2JPOA 3CS1A 1BR1B 4ETOA 1XFYO 1LA0A 1ZFSA 3O4YA 2CXJA 1GM0A 4FTGA 4YGEB 2QEHA 5AEQA 5HYDA 3CLNA 1NX0A 3D74A 1CMFA 1OMVA 3BQ3A 1CFPA 1OE9B 1KK8C 2JNFA 1CLMA 2L2CA 2JTTA 2LUCA 3I5IC 2I94A 1MXEA 1T14A 1JSAA 1IGVA 2LVJA 3NHTA 2PSRA 2R2IA 3CGAA 1FI6A 1SCMC 2Q91A 2KI4C 1MR8A 4JPZB 1DJZA 4PDZA 5FI6A 3SG7A 2BBNA 1DELA 1ZACA 2M1UA 3HX4A 1DTLA 2AMIA 4IJ7A 1SPYA 3B7AA 3LK0A 1N65A 2JT3A 3FIAA 3PLFB 5K89A 1JC2A 4MRXA 1B7TZ 4JKTA 1C7WA 1U5IB 5HL1A 2KQ6A 1SSEB 4HRGA 1XVJA 2H61C 4CIDA 4GGFA 2BL0B 5AFPA 3ZNIA 3RM1A 3WHUB 1H8BA 4C0JA 1DJXA 4GNKB 2K61A 1OZSA 2KSPA 3TDZA 1WDCC 2FJYA 5HKWA 2BAPA 3SJSA 2BBMA 1TCOB 4IL1A 1IG5A 1K90D 1MF8B 1WLMA 2GV5A 3B6XA 2EC6C 3CYZA 4QJ5B 1MQ1A 5EL2A 2BCAA 4GUKA 1SRAA 1S26D 4YRUA 2LVVA 2M8UA 3E3RA 3CR5X 3TUYB 1NX3A 5CSIA 1WRLA 2K0JA 3PJIA 4DS7A 3S0EA 1DJGA 2TN4A 3D0YB 4ZCUA 2M0RA 1NWDA 1IJ5A 1CDPA 1S6IA 1UHHA 2OS8B 2M3WA 5DICA 3D76A 3S0AA 2KAVA 1CMGA 1BT6A 1PULA 5JJGA 2PYQA 1CKKA 2M1KB 3WNXB 1IRJA 2B1UA 2Y4QA 1L7ZA 3OBVA 4NDCA 3BJHA 1GGWA 2LAPA 4M2PA 3H4SE 1KWOB 1UHNA 2FOTA 1SNLA 3NSKA 2WNDA 3EG5B 1YUTA 2SCPA 1NCYA 2RGIA 3R1OA 2KGRA 1TIZA 2JTZA 1NYAA 3EK7A 3BUXB 2G2BA 1ALWA 2JNXA 2KGBC 4N5XA 2F2PA 1W7JB 1ZUZA 2LE9B 1W7IB 1OMRA 1UURA 1NP8A 1X02A 2JT0A 3BYAA 2I2RE 3SIBA 4OZDA 1DGVA 2EHBA 3B88A 4N1GA 1IQ3A 2WCKA 4DIRA 1PK0D 2WC6A 2BKIB 3GK1A 1Z4HA 1EH2A 4PHMA 2KYCA 4BY4A 4OVNF 3PN7B 2KI6C 3CWGA 1VRKA 3I5HC 5ER5A 2NLNA 1S1EA 4ORAB 5TNCA 1SL8A 1CLLA 2L2EA 1OW4A 2K8MB 2I18A 1GJYA 1TRFA 3GOFA 3OP0A 2LUXA 2QDIA 4MZLA 2KDHA 1RROA 3DYEA 1SMGA 1Z2CB 1RECA 3WXAA 2L98A 2K7CA 1NIWA 3EVUA 1YX7A 1Y1AA 3L4LA 3O4XA 3VROA 2L4IA 5AERA 3BFHA 1UWOA 1JF0A 2JT8A 3IQOA 2JWWA 1GGZA 1L2OC 1S36A 4MBEA 1WLZA 4BY5A 2NXQA 1DJIA 4MZJA 1QLKA 3L4AA 4GBAA 4YBHB 1WRKA 1OQPA 1KK7Z 3BFBA 5AXIA 2BNXA 4CFRA 3UNWA 1V1FA 1JBAA 4MRYA 5CSJA 1ORGA 1XO5A 2AUCA 3AAJA 2JPTA 2KOTA 1K9KA 1RJVA 1QX5B 3CZ2A 1S5GY 1JFKA 2HF5A 2LP2A 4M2OA 1NSHA 2WCBA 5PALA 3DVJA 1M39A 5I8NA 1UP5A 2MBXA 2KQYA 1JF2A 2NCPA 4PE1A 5B8IB 5G08A 1DF0A 3DXLA 2BKHB 1J7OA 2QEBA 2Y1NA 1BLQA 2L50A 1ALVA 4PE4A 4GAOA 2F2OA 3TS5C 5AANA 4ICBA 2O5GA 1QX2A 2CCMA 3VRRA 3CR4X 1K96A 4PHKA 1QTXA 2ISDA 3SG4A 1F70A 1W9ZA 3PM2A 1DMOA 1M46A 1NCZA 4L9MA 1AUIB 2LMVA 4OKHA 1F54A 2ZN8A 2GGMA 2M9GA 1AP4A 1KSMA 2Y5IA 1XFUO 3KPXA 1F4OA 3NHIA 2GTEA 1NCXA 3BUWB 1N2DA 1V1GA 1XFXO 3DF0B 1WY9A 3JVTB 2H61A 4DUQA 5DKQA 1KCYA 1JWDA 1S6CA 4MEWA 4GGNA 2KHNA 1BOCA 2WCEA 3DZTA 3PATA 3Q8IA 1RTP1 3CDNA 2MA2A 1IKUA 4OV2A 4WRIA 3R72A 2KBMA 1J55A 3FE6A 3QRXA 4XJKA 4ZCVA 4M2QA 1XFZO 5IBWA 2JOJA 2WC5A 1A03A 2A4JA 3KHEA 3M0WA 4HREE 3CZ1A 5HLOA 1BG1A 1YRUB 3S0GA 1QIVA 2M29A 2MAZA 5KTYA 2JRFA 4AOMA 3BOWA 3SS4A 3DVMA 4MLWA 1D1OA 1K9UA 1K95A 1PRWA 5KSZA 1KSOA 2MHHA 2PALA 2LVIA 5D3OA 1QVIY 1J7RA 2NCOA 2QEOA 2LP3A 3DVKA 2E6WA 1EJ3A 2I7AA 1EL4A 1CB1A 1DF0B 1PVBA 1SCVA 4TNCA 1ZOTB 4U8DA 1UHKA 1XK4C 1J7PA 1P28A 4GGFC 1CDMA 2ZN9A 1K8UA 1EG4A 1OOJA 3FE8A 3I5GC 4OCIA 1LVCD 1QX7A 3BFAA 1SY9A 1NX1A 2M7NA 1J1DA 1Y1UA 2O60A 1SCMB 2Y1MA 4A4BA 1YVHA 1DVIA 1CNPA 1IJ6A 2L5YA 2CNPA 1F8HA 1KQMC 4I5KA 1B9AA 2LC5A 2M97A 2ZRSA 3I5IB 1A75A 1LA3A 4PCWA 3SG6A 1CLBA 1UHJA 3D73A 3A4UB 3F45A 1IQ5A 1TN4A 2EGDA 1QASA 3AKBA 5FI2A 3OHMB 1LS8A 2CBLA 2HQWA 2VRGA 1K94A 4ORCB 1OMDA 1PALA 4N1FA 2L5XB 3SS3A 1FPWA 4GFTA 1CDLA 2CT9A 2AAOA 2KLDA 2H8VA 1OOFA 1MXLC 2LCPA 4XJKB 3WHTB 1CFFA 1KQVA 1Y1XA 5KU1A 3A8RA 4NDBA 2K2FA 4JWQA 3I5FB 2F8PA 4FQTA 3V2LA 1J7QA 3DY9A 1KFXS 3BOWB 3TDUA 2MRDA 3NXAA 1QWVA 3RZSA 1B4CA 4PE0A 3OB2B 4HRHA 1B8LA 1E8AA 1OOGA 2PQLA 3ICBA 1BODA 3C1VA 5I2LA 3EVVA 1LINA 1C07A 1LKJA 1ODBA 1EXRA 2JQ6A 2K7BA 2L51A 3D10A 2LMTA 3D77A 1R6PA 1CFDA 1OSAA 1QXPA 4AQJA 3O2PA 5I2OA 4CLNA 3QMEA 1B8CA 1OOHA 4A4CA 4PALA 4OR9B 1FW4A 2WCMA 1IH0A 1TUJA 1AVSA 1IWQA 1S6JA 1TNXA 3GK2A 4MZKA 2MLEC 1WRZA 3B87A 5GQQC 3RLZA 2LLUA 3FS7A 4C0KA 1CFCA 1FF1A 2FJUB 1XFVO 2WCJA 5ER4X 2PASA 4DCKA 1A75B 1XFRA 1SBJA 1H4BA 2HPSA 3JTDB 1S3PA 4MN0A 3IQQA 4WQ2A 3BUNB 5CPVA 3VGOA 4HSZA 1AHRA 2V53A 1CDNA 3R1PA 5JOLA 3PM8A 4AQIA 1IIOA 4R1EA 3PSRA 4I5JA 2L0PA 1AJ5A 3FE9A 5D69A 4UPGA 4KYNA 4YI9A 2K7DA 3GK4X 1UHIA 3JVTC 4JQ0D 4P5OE 2COLB 4QJ3B 1AK8A 1XA5A 2P70A 3FWCA 1PVAA 3BXKA 3OGNA 1QJTA 1DEKA 3S0DA 2PVBA 1YTZC 2BL0C 4YI8A 1SR6B 1QATA 2QPTA 2K2AA 3TDIA 3UO9A 1TTXA 3IVTA 3LLEA 2LNKA 5FYXA 3OX5A 4PHNA 2WORA 1KFUS 3BUOB 2WCHA 3AAKA 4I5LB 1OZOA 3SG3A 2JC2A 3TUYC 1TUZA 1L2OB 2M49B 3D0YA 4XYNA 1M45A 1BMOA 1LXFC 3DD4A 2WOSA 3BUMB 2OS8C 2OTGB 3B86A 1TNQA 4YGCB 1RWYA 3EK8A 2LM5A 3EKHA 2F33A 2LHLA 1K93D 5F6TA 4YGDB 3EKJA 2WC8A 1FI5A 2K60A 1A2XA 2ERBA 2JXLA 2LMUA 3OB1B 1SW8A 1A4PA 1QIWA 1QLSA 1KWOC 1QVIZ 2ZNEA 3FWBA 4GPLB 3CZTX 1GQMA 1YR5A 2KYFA 4PE7A 3CTNA 4FQOA 1Q80A 1YRTB 1XYDA 4PHJA 1NUBA 1QV1A 5CSNA 1DJYA 1KFUL 3MSEB 1B7TY 5CSFA 2Q4UA 3R1VA 1XK4A 3VB1A 5DKRA 2KNEA 2G9BA 4CFQA 1KK8B 1EG3A 3TS5B 1CM4A 2JXCA
chains in the Genus database with same CATH topology
1R2UA 2JZIA 2PRUA 5HLVA 3SIAA 1CTRA 1M63B 2ZFDA 5DKNA 1YVLA 1PSRA 2KFFA 1SL9A 2KAYA 2D8NA 1MHOA 2KI4B 3I5FC 1YX8A 2ZKMX 4CPVA 3ZWHA 3PN7C 2K7OA 1Y6WA 3SG5A 2NZ0A 2BCBA 3KF9A 4DRWA 1G33A 3KO0A 2ZRTA 4MVFA 3NSOA 4WQ3A 1TNPA 2F3YA 2L4HA 3O6BA 1QS7A 1N0YA 2FCDA 1YURA 2LV7A 2BE4A 3SG2A 3O78A 2MJWB 3DVEA 1WDCB 2QACA 3LL8B 2GGZA 5BPJA 1BJFA 2DOQA 4P2YB 2P6BB 1PSBA 2EC6B 1DJHA 3VRPA 3LK1A 1B8RA 4C0LA 4MSPA 4YGAA 3PALA 3JTDC 2PMYA 4QJ4B 4D1EA 4I5NB 2F3ZA 1A29A 1B47A 2BCXA 1F4QA 4E68A 2LLTA 2KI6D 1BU3A 1XFWO 2HETA 3PFVA 2KAXA 2LANA 3I5GB 5HKZA 5J3XA 2FCEA 1B1GA 1MUXA 2SASA 3EK4A 1JUOA 2KFHA 1G4YR 3VRQA 1NX2A 1DT7B 2WCFA 2M7LA 1C7VA 1JFJA 1KQMB 2ZNDA 4NDDA 1YUSA 1AJ4A 1F55A 1FBVA 5HKYA 1CM1A 1SYMA 1SR6C 3EVRA 1DGUA 1KFXL 1QV0A 1SK6D 3TZ1A 2H2KA 2JULA 2MLFC 3K21A 2OPOA 1M31A 3VRNA 1MWNA 1S5GZ 3CR2A 4Q04A 1TCFA 2LVKA 3IF7A 3NSIA 1RFJA 1SKTA 1UUSA 1NPQA 2KBIA 1TNWA 3DF0A 1U5IA 2BECA 2KFGA 3NSLA 5D7FA 1G8IA 1F71A 2E30A 1RK9A 4USLA 2LHIA 3HCMA 1Y0VH 2OTGC 3I5HB 3LCPC 2HQ8A 1KK7Y 2IS9A 1HT9A 4ORBB 1BF5A 1DJWA 1BR4B 1SL7A 1YUUA 2CTNA 2LLSA 4YGBB 2JU0A 3AKAA 1ZMZA 1K2HA 1HQVA 1K9PA 4NQGA 3KEVA 1TOPA 1J1EA 2BE6A 3OX6A 5I2QA 3CS1A 4ETOA 1BR1B 1XFYO 1LA0A 1ZFSA 3O4YA 2CXJA 4FTGA 4YGEB 5AEQA 5HYDA 3CLNA 1NX0A 1CMFA 1OMVA 3BQ3A 1CFPA 1OE9B 1KK8C 2JNFA 1CLMA 2JTTA 2LUCA 3I5IC 2I94A 1MXEA 1JSAA 1IGVA 2LVJA 2PSRA 2R2IA 3CGAA 1FI6A 1SCMC 2Q91A 2KI4C 1MR8A 4JPZB 1DJZA 4PDZA 3SG7A 2BBNA 2M1UA 1ZACA 3HX4A 1DTLA 2AMIA 1SPYA 3LK0A 1N65A 2JT3A 3FIAA 3PLFB 5K89A 1JC2A 4MRXA 1B7TZ 1C7WA 1U5IB 2KQ6A 4HRGA 1XVJA 2H61C 4CIDA 4GGFA 2BL0B 5AFPA 3ZNIA 3RM1A 3WHUB 1H8BA 4C0JA 1DJXA 4GNKB 2K61A 1OZSA 2KSPA 3TDZA 1WDCC 5HKWA 3SJSA 2BBMA 1TCOB 4IL1A 1IG5A 1K90D 1MF8B 1WLMA 2GV5A 2EC6C 4QJ5B 1MQ1A 2BCAA 4GUKA 1SRAA 1S26D 4YRUA 2LVVA 2M8UA 3E3RA 3CR5X 3TUYB 1NX3A 5CSIA 1WRLA 2K0JA 4DS7A 1DJGA 2TN4A 3D0YB 4ZCUA 2M0RA 1NWDA 1IJ5A 1CDPA 1S6IA 1UHHA 2OS8B 2M3WA 2KAVA 1CMGA 1BT6A 1PULA 5JJGA 1CKKA 2M1KB 3WNXB 1IRJA 2B1UA 2Y4QA 1L7ZA 4NDCA 1GGWA 2LAPA 4M2PA 3H4SE 1KWOB 1UHNA 2FOTA 1SNLA 3NSKA 2WNDA 1YUTA 2SCPA 1NCYA 2RGIA 2KGRA 1TIZA 2JTZA 1NYAA 3EK7A 3BUXB 2G2BA 1ALWA 2JNXA 2KGBC 4N5XA 2F2PA 1W7JB 1ZUZA 2LE9B 1OMRA 1W7IB 1UURA 1NP8A 1X02A 2JT0A 3BYAA 2I2RE 3SIBA 1DGVA 2EHBA 4N1GA 1IQ3A 4DIRA 1PK0D 3GK1A 2BKIB 1EH2A 4PHMA 2KYCA 4BY4A 4OVNF 3PN7B 2KI6C 3CWGA 1VRKA 3I5HC 5ER5A 2NLNA 1S1EA 4ORAB 5TNCA 1SL8A 1CLLA 2L2EA 2K8MB 2I18A 1GJYA 1TRFA 3GOFA 3OP0A 2LUXA 4MZLA 2KDHA 1RROA 1SMGA 1RECA 3WXAA 2L98A 2K7CA 1NIWA 3EVUA 1YX7A 1Y1AA 3VROA 5AERA 2L4IA 1UWOA 1JF0A 2JT8A 3IQOA 2JWWA 1GGZA 1L2OC 1S36A 4MBEA 1WLZA 4BY5A 2NXQA 1DJIA 4MZJA 1QLKA 4GBAA 4YBHB 1WRKA 1OQPA 1KK7Z 5AXIA 4CFRA 1V1FA 1JBAA 4MRYA 5CSJA 1XO5A 2AUCA 3AAJA 2JPTA 2KOTA 1K9KA 1RJVA 1QX5B 1S5GY 1JFKA 2HF5A 2LP2A 4M2OA 1NSHA 2WCBA 5PALA 3DVJA 1M39A 5I8NA 1UP5A 2MBXA 2KQYA 1JF2A 2NCPA 4PE1A 5B8IB 5G08A 1DF0A 2BKHB 1J7OA 2Y1NA 1BLQA 2L50A 1ALVA 4PE4A 4GAOA 2F2OA 3TS5C 5AANA 4ICBA 2O5GA 1QX2A 2CCMA 3VRRA 3CR4X 1K96A 4PHKA 1QTXA 2ISDA 3SG4A 1F70A 1DMOA 1M46A 1NCZA 4L9MA 1AUIB 2LMVA 4OKHA 1F54A 2ZN8A 2GGMA 2M9GA 1AP4A 1KSMA 2Y5IA 1XFUO 3KPXA 1F4OA 1NCXA 3BUWB 1N2DA 1V1GA 1XFXO 3DF0B 1WY9A 3JVTB 2H61A 4DUQA 5DKQA 1KCYA 1JWDA 1S6CA 4MEWA 4GGNA 2KHNA 1BOCA 2WCEA 3PATA 1RTP1 2MA2A 1IKUA 4OV2A 4WRIA 2KBMA 1J55A 3QRXA 4XJKA 4ZCVA 4M2QA 1XFZO 5IBWA 2JOJA 1A03A 2A4JA 3KHEA 3M0WA 4HREE 5HLOA 1BG1A 1YRUB 1QIVA 2M29A 2MAZA 5KTYA 2JRFA 4AOMA 3BOWA 1D1OA 3DVMA 4MLWA 1K9UA 1K95A 1PRWA 5KSZA 1KSOA 2MHHA 2PALA 2LVIA 1QVIY 1J7RA 2NCOA 2LP3A 3DVKA 2E6WA 1EJ3A 2I7AA 1EL4A 1CB1A 1DF0B 1PVBA 1SCVA 4TNCA 1ZOTB 4U8DA 1UHKA 1XK4C 1J7PA 4GGFC 1CDMA 2ZN9A 1K8UA 1EG4A 1OOJA 3I5GC 4OCIA 1LVCD 1QX7A 1SY9A 1NX1A 2M7NA 1J1DA 1Y1UA 2O60A 1SCMB 2Y1MA 4A4BA 1YVHA 1DVIA 1CNPA 1IJ6A 2CNPA 1F8HA 1KQMC 4I5KA 1B9AA 2LC5A 2M97A 2ZRSA 3I5IB 1A75A 1LA3A 4PCWA 3SG6A 1CLBA 1UHJA 3A4UB 3F45A 1IQ5A 1TN4A 2EGDA 1QASA 3AKBA 3OHMB 2VRGA 2CBLA 2HQWA 4F0ZB 1K94A 4ORCB 1OMDA 1PALA 4N1FA 2L5XB 1FPWA 4GFTA 1CDLA 2CT9A 2AAOA 1MXLC 2LCPA 4XJKB 3WHTB 1CFFA 1KQVA 1Y1XA 5KU1A 3A8RA 4NDBA 2K2FA 4JWQA 3I5FB 2F8PA 1J7QA 1KFXS 3BOWB 3TDUA 2MRDA 3NXAA 1B4CA 4PE0A 3OB2B 4HRHA 1B8LA 1E8AA 1BODA 3ICBA 3C1VA 5I2LA 3EVVA 1LINA 1C07A 1LKJA 1ODBA 1EXRA 2JQ6A 2K7BA 2L51A 3D10A 2LMTA 4AQJA 1R6PA 1CFDA 1OSAA 1QXPA 3O2PA 5I2OA 4CLNA 1B8CA 4A4CA 4PALA 4OR9B 1FW4A 1IH0A 1AVSA 1IWQA 1S6JA 1TNXA 3GK2A 4MZKA 2MLEC 1WRZA 5GQQC 3RLZA 2LLUA 3FS7A 4C0KA 1CFCA 1FF1A 2FJUB 1XFVO 4DCKA 5ER4X 2PASA 1A75B 1SBJA 1H4BA 2HPSA 3JTDB 1S3PA 4MN0A 3IQQA 4WQ2A 3BUNB 5CPVA 3VGOA 4HSZA 1AHRA 2V53A 1CDNA 5JOLA 3PM8A 4AQIA 4R1EA 3PSRA 4I5JA 2L0PA 1AJ5A 5D69A 4UPGA 4YI9A 2K7DA 3GK4X 1UHIA 3JVTC 4JQ0D 4P5OE 2COLB 4QJ3B 1AK8A 1XA5A 3FWCA 1PVAA 3BXKA 1QJTA 2PVBA 1YTZC 2BL0C 4YI8A 1SR6B 1QATA 2QPTA 2K2AA 3TDIA 1TTXA 3LLEA 2LNKA 5FYXA 3OX5A 4PHNA 2WORA 1KFUS 3BUOB 4I5LB 3AAKA 1OZOA 3SG3A 2JC2A 3TUYC 1L2OB 2M49B 3D0YA 4XYNA 1M45A 1BMOA 1LXFC 3DD4A 2WOSA 3BUMB 2OS8C 2OTGB 4YGCB 1TNQA 1RWYA 3EK8A 2LM5A 3EKHA 2F33A 2LHLA 1K93D 5F6TA 4YGDB 3EKJA 2WC8A 1FI5A 1A2XA 2LMUA 2JXLA 3OB1B 1SW8A 1A4PA 1QIWA 1QLSA 1KWOC 1QVIZ 2ZNEA 3FWBA 4GPLB 3CZTX 1GQMA 1YR5A 2KYFA 4PE7A 3CTNA 4FQOA 1Q80A 1YRTB 1XYDA 4PHJA 1NUBA 1QV1A 5CSNA 1DJYA 1KFUL 3MSEB 1B7TY 5CSFA 2Q4UA 1XK4A 5DKRA 2KNEA 2G9BA 4CFQA 1KK8B 1EG3A 3TS5B 1CM4A 2JXCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1R2U A;  2JZI A;  2PRU A;  5HLV A;  3SIA A;  1CTR A;  1M63 B;  2ZFD A;  5DKN A;  1YVL A;  1PSR A;  2KFF A;  1SL9 A;  2KAY A;  2D8N A;  1MHO A;  2KI4 B;  3I5F C;  1YX8 A;  2ZKM X;  4CPV A;  3ZWH A;  3PN7 C;  2K7O A;  1Y6W A;  3SG5 A;  2NZ0 A;  2BCB A;  3KF9 A;  4DRW A;  1G33 A;  3KO0 A;  2ZRT A;  4MVF A;  3NSO A;  4WQ3 A;  1TNP A;  2F3Y A;  2L4H A;  3O6B A;  1QS7 A;  1N0Y A;  2FCD A;  1YUR A;  2LV7 A;  2BE4 A;  3SG2 A;  3O78 A;  2MJW B;  3DVE A;  1WDC B;  2QAC A;  3LL8 B;  2GGZ A;  5BPJ A;  1BJF A;  2DOQ A;  4P2Y B;  2P6B B;  1PSB A;  2EC6 B;  1DJH A;  3VRP A;  3LK1 A;  1B8R A;  4C0L A;  4MSP A;  4YGA A;  3PAL A;  3JTD C;  2PMY A;  4QJ4 B;  4D1E A;  4I5N B;  2F3Z A;  1A29 A;  1B47 A;  2BCX A;  1F4Q A;  4E68 A;  2LLT A;  2KI6 D;  1BU3 A;  1XFW O;  2HET A;  3PFV A;  2KAX A;  2LAN A;  3I5G B;  5HKZ A;  5J3X A;  2FCE A;  1B1G A;  1MUX A;  2SAS A;  3EK4 A;  1JUO A;  2KFH A;  1G4Y R;  3VRQ A;  1NX2 A;  1DT7 B;  2WCF A;  2M7L A;  1C7V A;  1JFJ A;  1KQM B;  2ZND A;  4NDD A;  1YUS A;  1AJ4 A;  1F55 A;  1FBV A;  5HKY A;  1CM1 A;  1SYM A;  1SR6 C;  3EVR A;  1DGU A;  1KFX L;  1QV0 A;  1SK6 D;  3TZ1 A;  2H2K A;  2JUL A;  2MLF C;  3K21 A;  2OPO A;  1M31 A;  3VRN A;  1MWN A;  1S5G Z;  3CR2 A;  4Q04 A;  1TCF A;  2LVK A;  3IF7 A;  3NSI A;  1RFJ A;  1SKT A;  1UUS A;  1NPQ A;  2KBI A;  1TNW A;  3DF0 A;  1U5I A;  2BEC A;  2KFG A;  3NSL A;  5D7F A;  1G8I A;  1F71 A;  2E30 A;  1RK9 A;  4USL A;  2LHI A;  3HCM A;  1Y0V H;  2OTG C;  3I5H B;  3LCP C;  2HQ8 A;  1KK7 Y;  2IS9 A;  1HT9 A;  4ORB B;  1BF5 A;  1DJW A;  1BR4 B;  1SL7 A;  1YUU A;  2CTN A;  2LLS A;  4YGB B;  2JU0 A;  3AKA A;  1ZMZ A;  1K2H A;  1HQV A;  1K9P A;  4NQG A;  3KEV A;  1TOP A;  1J1E A;  2BE6 A;  3OX6 A;  5I2Q A;  3CS1 A;  4ETO A;  1BR1 B;  1XFY O;  1LA0 A;  1ZFS A;  3O4Y A;  2CXJ A;  4FTG A;  4YGE B;  5AEQ A;  5HYD A;  3CLN A;  1NX0 A;  1CMF A;  1OMV A;  3BQ3 A;  1CFP A;  1OE9 B;  1KK8 C;  2JNF A;  1CLM A;  2JTT A;  2LUC A;  3I5I C;  2I94 A;  1MXE A;  1JSA A;  1IGV A;  2LVJ A;  2PSR A;  2R2I A;  3CGA A;  1FI6 A;  1SCM C;  2Q91 A;  2KI4 C;  1MR8 A;  4JPZ B;  1DJZ A;  4PDZ A;  3SG7 A;  2BBN A;  2M1U A;  1ZAC A;  3HX4 A;  1DTL A;  2AMI A;  1SPY A;  3LK0 A;  1N65 A;  2JT3 A;  3FIA A;  3PLF B;  5K89 A;  1JC2 A;  4MRX A;  1B7T Z;  1C7W A;  1U5I B;  2KQ6 A;  4HRG A;  1XVJ A;  2H61 C;  4CID A;  4GGF A;  2BL0 B;  5AFP A;  3ZNI A;  3RM1 A;  3WHU B;  1H8B A;  4C0J A;  1DJX A;  4GNK B;  2K61 A;  1OZS A;  2KSP A;  3TDZ A;  1WDC C;  5HKW A;  3SJS A;  2BBM A;  1TCO B;  4IL1 A;  1IG5 A;  1K90 D;  1MF8 B;  1WLM A;  2GV5 A;  2EC6 C;  4QJ5 B;  1MQ1 A;  2BCA A;  4GUK A;  1SRA A;  1S26 D;  4YRU A;  2LVV A;  2M8U A;  3E3R A;  3CR5 X;  3TUY B;  1NX3 A;  5CSI A;  1WRL A;  2K0J A;  4DS7 A;  1DJG A;  2TN4 A;  3D0Y B;  4ZCU A;  2M0R A;  1NWD A;  1IJ5 A;  1CDP A;  1S6I A;  1UHH A;  2OS8 B;  2M3W A;  2KAV A;  1CMG A;  1BT6 A;  1PUL A;  5JJG A;  1CKK A;  2M1K B;  3WNX B;  1IRJ A;  2B1U A;  2Y4Q A;  1L7Z A;  4NDC A;  1GGW A;  2LAP A;  4M2P A;  3H4S E;  1KWO B;  1UHN A;  2FOT A;  1SNL A;  3NSK A;  2WND A;  1YUT A;  2SCP A;  1NCY A;  2RGI A;  2KGR A;  1TIZ A;  2JTZ A;  1NYA A;  3EK7 A;  3BUX B;  2G2B A;  1ALW A;  2JNX A;  2KGB C;  4N5X A;  2F2P A;  1W7J B;  1ZUZ A;  2LE9 B;  1OMR A;  1W7I B;  1UUR A;  1NP8 A;  1X02 A;  2JT0 A;  3BYA A;  2I2R E;  3SIB A;  1DGV A;  2EHB A;  4N1G A;  1IQ3 A;  4DIR A;  1PK0 D;  3GK1 A;  2BKI B;  1EH2 A;  4PHM A;  2KYC A;  4BY4 A;  4OVN F;  3PN7 B;  2KI6 C;  3CWG A;  1VRK A;  3I5H C;  5ER5 A;  2NLN A;  1S1E A;  4ORA B;  5TNC A;  1SL8 A;  1CLL A;  2L2E A;  2K8M B;  2I18 A;  1GJY A;  1TRF A;  3GOF A;  3OP0 A;  2LUX A;  4MZL A;  2KDH A;  1RRO A;  1SMG A;  1REC A;  3WXA A;  2L98 A;  2K7C A;  1NIW A;  3EVU A;  1YX7 A;  1Y1A A;  3VRO A;  5AER A;  2L4I A;  1UWO A;  1JF0 A;  2JT8 A;  3IQO A;  2JWW A;  1GGZ A;  1L2O C;  1S36 A;  4MBE A;  1WLZ A;  4BY5 A;  2NXQ A;  1DJI A;  4MZJ A;  1QLK A;  4GBA A;  4YBH B;  1WRK A;  1OQP A;  1KK7 Z;  5AXI A;  4CFR A;  1V1F A;  1JBA A;  4MRY A;  5CSJ A;  1XO5 A;  2AUC A;  3AAJ A;  2JPT A;  2KOT A;  1K9K A;  1RJV A;  1QX5 B;  1S5G Y;  1JFK A;  2HF5 A;  2LP2 A;  4M2O A;  1NSH A;  2WCB A;  5PAL A;  3DVJ A;  1M39 A;  5I8N A;  1UP5 A;  2MBX A;  2KQY A;  1JF2 A;  2NCP A;  4PE1 A;  5B8I B;  5G08 A;  1DF0 A;  2BKH B;  1J7O A;  2Y1N A;  1BLQ A;  2L50 A;  1ALV A;  4PE4 A;  4GAO A;  2F2O A;  3TS5 C;  5AAN A;  4ICB A;  2O5G A;  1QX2 A;  2CCM A;  3VRR A;  3CR4 X;  1K96 A;  4PHK A;  1QTX A;  2ISD A;  3SG4 A;  1F70 A;  1DMO A;  1M46 A;  1NCZ A;  4L9M A;  1AUI B;  2LMV A;  4OKH A;  1F54 A;  2ZN8 A;  2GGM A;  2M9G A;  1AP4 A;  1KSM A;  2Y5I A;  1XFU O;  3KPX A;  1F4O A;  1NCX A;  3BUW B;  1N2D A;  1V1G A;  1XFX O;  3DF0 B;  1WY9 A;  3JVT B;  2H61 A;  4DUQ A;  5DKQ A;  1KCY A;  1JWD A;  1S6C A;  4MEW A;  4GGN A;  2KHN A;  1BOC A;  2WCE A;  3PAT A;  1RTP 1;  2MA2 A;  1IKU A;  4OV2 A;  4WRI A;  2KBM A;  1J55 A;  3QRX A;  4XJK A;  4ZCV A;  4M2Q A;  1XFZ O;  5IBW A;  2JOJ A;  1A03 A;  2A4J A;  3KHE A;  3M0W A;  4HRE E;  5HLO A;  1BG1 A;  1YRU B;  1QIV A;  2M29 A;  2MAZ A;  5KTY A;  2JRF A;  4AOM A;  3BOW A;  1D1O A;  3DVM A;  4MLW A;  1K9U A;  1K95 A;  1PRW A;  5KSZ A;  1KSO A;  2MHH A;  2PAL A;  2LVI A;  1QVI Y;  1J7R A;  2NCO A;  2LP3 A;  3DVK A;  2E6W A;  1EJ3 A;  2I7A A;  1EL4 A;  1CB1 A;  1DF0 B;  1PVB A;  1SCV A;  4TNC A;  1ZOT B;  4U8D A;  1UHK A;  1XK4 C;  1J7P A;  4GGF C;  1CDM A;  2ZN9 A;  1K8U A;  1EG4 A;  1OOJ A;  3I5G C;  4OCI A;  1LVC D;  1QX7 A;  1SY9 A;  1NX1 A;  2M7N A;  1J1D A;  1Y1U A;  2O60 A;  1SCM B;  2Y1M A;  4A4B A;  1YVH A;  1DVI A;  1CNP A;  1IJ6 A;  2CNP A;  1F8H A;  1KQM C;  4I5K A;  1B9A A;  2LC5 A;  2M97 A;  2ZRS A;  3I5I B;  1A75 A;  1LA3 A;  4PCW A;  3SG6 A;  1CLB A;  1UHJ A;  3A4U B;  3F45 A;  1IQ5 A;  1TN4 A;  2EGD A;  1QAS A;  3AKB A;  3OHM B;  2VRG A;  2CBL A;  2HQW A;  4F0Z B;  1K94 A;  4ORC B;  1OMD A;  1PAL A;  4N1F A;  2L5X B;  1FPW A;  4GFT A;  1CDL A;  2CT9 A;  2AAO A;  1MXL C;  2LCP A;  4XJK B;  3WHT B;  1CFF A;  1KQV A;  1Y1X A;  5KU1 A;  3A8R A;  4NDB A;  2K2F A;  4JWQ A;  3I5F B;  2F8P A;  1J7Q A;  1KFX S;  3BOW B;  3TDU A;  2MRD A;  3NXA A;  1B4C A;  4PE0 A;  3OB2 B;  4HRH A;  1B8L A;  1E8A A;  1BOD A;  3ICB A;  3C1V A;  5I2L A;  3EVV A;  1LIN A;  1C07 A;  1LKJ A;  1ODB A;  1EXR A;  2JQ6 A;  2K7B A;  2L51 A;  3D10 A;  2LMT A;  4AQJ A;  1R6P A;  1CFD A;  1OSA A;  1QXP A;  3O2P A;  5I2O A;  4CLN A;  1B8C A;  4A4C A;  4PAL A;  4OR9 B;  1FW4 A;  1IH0 A;  1AVS A;  1IWQ A;  1S6J A;  1TNX A;  3GK2 A;  4MZK A;  2MLE C;  1WRZ A;  5GQQ C;  3RLZ A;  2LLU A;  3FS7 A;  4C0K A;  1CFC A;  1FF1 A;  2FJU B;  1XFV O;  4DCK A;  5ER4 X;  2PAS A;  1A75 B;  1SBJ A;  1H4B A;  2HPS A;  3JTD B;  1S3P A;  4MN0 A;  3IQQ A;  4WQ2 A;  3BUN B;  5CPV A;  3VGO A;  4HSZ A;  1AHR A;  2V53 A;  1CDN A;  5JOL A;  3PM8 A;  4AQI A;  4R1E A;  3PSR A;  4I5J A;  2L0P A;  1AJ5 A;  5D69 A;  4UPG A;  4YI9 A;  2K7D A;  3GK4 X;  1UHI A;  3JVT C;  4JQ0 D;  4P5O E;  2COL B;  4QJ3 B;  1AK8 A;  1XA5 A;  3FWC A;  1PVA A;  3BXK A;  1QJT A;  2PVB A;  1YTZ C;  2BL0 C;  4YI8 A;  1SR6 B;  1QAT A;  2QPT A;  2K2A A;  3TDI A;  1TTX A;  3LLE A;  2LNK A;  5FYX A;  3OX5 A;  4PHN A;  2WOR A;  1KFU S;  3BUO B;  4I5L B;  3AAK A;  1OZO A;  3SG3 A;  2JC2 A;  3TUY C;  1L2O B;  2M49 B;  3D0Y A;  4XYN A;  1M45 A;  1BMO A;  1LXF C;  3DD4 A;  2WOS A;  3BUM B;  2OS8 C;  2OTG B;  4YGC B;  1TNQ A;  1RWY A;  3EK8 A;  2LM5 A;  3EKH A;  2F33 A;  2LHL A;  1K93 D;  5F6T A;  4YGD B;  3EKJ A;  2WC8 A;  1FI5 A;  1A2X A;  2LMU A;  2JXL A;  3OB1 B;  1SW8 A;  1A4P A;  1QIW A;  1QLS A;  1KWO C;  1QVI Z;  2ZNE A;  3FWB A;  4GPL B;  3CZT X;  1GQM A;  1YR5 A;  2KYF A;  4PE7 A;  3CTN A;  4FQO A;  1Q80 A;  1YRT B;  1XYD A;  4PHJ A;  1NUB A;  1QV1 A;  5CSN A;  1DJY A;  1KFU L;  3MSE B;  1B7T Y;  5CSF A;  2Q4U A;  1XK4 A;  5DKR A;  2KNE A;  2G9B A;  4CFQ A;  1KK8 B;  1EG3 A;  3TS5 B;  1CM4 A;  2JXC A; 
#chains in the Genus database with same CATH topology
 1R2U A;  2JZI A;  2PRU A;  5HLV A;  3SIA A;  1CTR A;  1M63 B;  2ZFD A;  5DKN A;  1YVL A;  1PSR A;  2KFF A;  1SL9 A;  2KAY A;  2D8N A;  1MHO A;  2KI4 B;  4F7F A;  3I5F C;  1YX8 A;  2ZKM X;  1DQE A;  4CPV A;  4INX A;  3ZWH A;  3PN7 C;  2K7O A;  1Y6W A;  2YGU A;  3SG5 A;  2NZ0 A;  2BCB A;  3KF9 A;  4DRW A;  1G33 A;  3KO0 A;  2ZRT A;  4MVF A;  3NSO A;  4WQ3 A;  1TNP A;  2F3Y A;  2L4H A;  3O6B A;  3L47 A;  1QS7 A;  1N0Y A;  3S0F A;  2FCD A;  1YUR A;  2LV7 A;  3CZ0 A;  2BE4 A;  3SG2 A;  3O78 A;  2MJW B;  2P71 A;  3DVE A;  1WDC B;  2QAC A;  2QEV A;  3LL8 B;  2GGZ A;  5BPJ A;  1BJF A;  2DOQ A;  4P2Y B;  2P6B B;  3D78 A;  1PSB A;  2EC6 B;  1DJH A;  3NGV A;  4F0Z B;  3VRP A;  3SS5 A;  3LK1 A;  1B8R A;  4C0L A;  4MSP A;  4YGA A;  3PAL A;  3JTD C;  2PMY A;  4QJ4 B;  4D1E A;  4I5N B;  2F3Z A;  1A29 A;  2WCL A;  1B47 A;  2BCX A;  1C3Z A;  1F4Q A;  4E68 A;  2LLT A;  2KI6 D;  1BU3 A;  1XFW O;  2HET A;  3PFV A;  2KAX A;  2LAN A;  3I5G B;  4INW A;  5HKZ A;  5J3X A;  4JD9 A;  2FCE A;  1B1G A;  1MUX A;  2SAS A;  3CAB A;  1JUO A;  2KFH A;  1G4Y R;  3EK4 A;  1NX2 A;  3VRQ A;  1DT7 B;  2WCF A;  2M7L A;  1C7V A;  1JFJ A;  3K1E A;  1KQM B;  3N7H A;  2ZND A;  4NDD A;  3S0B A;  1YUS A;  1AJ4 A;  1F55 A;  1FBV A;  5HKY A;  1CM1 A;  1SYM A;  1SR6 C;  3EVR A;  1TWO A;  1DGU A;  1KFX L;  1QV0 A;  1SK6 D;  2KPH A;  3TZ1 A;  2H2K A;  2JUL A;  2MLF C;  4PT1 A;  3K21 A;  2OPO A;  1M31 A;  3VRN A;  5I94 A;  1MWN A;  1S5G Z;  3CR2 A;  4Q04 A;  1TCF A;  2LVK A;  3IF7 A;  2KLE A;  3NSI A;  1RFJ A;  1SKT A;  1UUS A;  1NPQ A;  2KBI A;  1TNW A;  3DF0 A;  1OOI X;  1C3Y A;  1U5I A;  2BEC A;  3D75 A;  2KFG A;  3NSL A;  5D7F A;  1G8I A;  1F71 A;  2E30 A;  1RK9 A;  4USL A;  2LHI A;  3HCM A;  1Y0V H;  2OTG C;  3I5H B;  3LCP C;  2HQ8 A;  1KK7 Y;  2IS9 A;  1DC1 A;  1HT9 A;  4ORB B;  1BF5 A;  1DJW A;  1BR4 B;  1SL7 A;  1YUU A;  2CTN A;  2LLS A;  4YGB B;  5FI7 A;  2JU0 A;  3AKA A;  1ZMZ A;  1K2H A;  1HQV A;  1K9P A;  4NQG A;  3KEV A;  1TOP A;  1J1E A;  2BE6 A;  3OX6 A;  5I2Q A;  2JPO A;  3CS1 A;  1BR1 B;  4ETO A;  1XFY O;  1LA0 A;  1ZFS A;  3O4Y A;  2CXJ A;  1GM0 A;  4FTG A;  4YGE B;  2QEH A;  5AEQ A;  5HYD A;  3CLN A;  1NX0 A;  3D74 A;  1CMF A;  1OMV A;  3BQ3 A;  1CFP A;  1OE9 B;  1KK8 C;  2JNF A;  1CLM A;  2L2C A;  2JTT A;  2LUC A;  3I5I C;  2I94 A;  1MXE A;  1T14 A;  1JSA A;  1IGV A;  2LVJ A;  3NHT A;  2PSR A;  2R2I A;  3CGA A;  1FI6 A;  1SCM C;  2Q91 A;  2KI4 C;  1MR8 A;  4JPZ B;  1DJZ A;  4PDZ A;  5FI6 A;  3SG7 A;  2BBN A;  1DEL A;  1ZAC A;  2M1U A;  3HX4 A;  1DTL A;  2AMI A;  4IJ7 A;  1SPY A;  3B7A A;  3LK0 A;  1N65 A;  2JT3 A;  3FIA A;  3PLF B;  5K89 A;  1JC2 A;  4MRX A;  1B7T Z;  4JKT A;  1C7W A;  1U5I B;  5HL1 A;  2KQ6 A;  1SSE B;  4HRG A;  1XVJ A;  2H61 C;  4CID A;  4GGF A;  2BL0 B;  5AFP A;  3ZNI A;  3RM1 A;  3WHU B;  1H8B A;  4C0J A;  1DJX A;  4GNK B;  2K61 A;  1OZS A;  2KSP A;  3TDZ A;  1WDC C;  2FJY A;  5HKW A;  2BAP A;  3SJS A;  2BBM A;  1TCO B;  4IL1 A;  1IG5 A;  1K90 D;  1MF8 B;  1WLM A;  2GV5 A;  3B6X A;  2EC6 C;  3CYZ A;  4QJ5 B;  1MQ1 A;  5EL2 A;  2BCA A;  4GUK A;  1SRA A;  1S26 D;  4YRU A;  2LVV A;  2M8U A;  3E3R A;  3CR5 X;  3TUY B;  1NX3 A;  5CSI A;  1WRL A;  2K0J A;  3PJI A;  4DS7 A;  3S0E A;  1DJG A;  2TN4 A;  3D0Y B;  4ZCU A;  2M0R A;  1NWD A;  1IJ5 A;  1CDP A;  1S6I A;  1UHH A;  2OS8 B;  2M3W A;  5DIC A;  3D76 A;  3S0A A;  2KAV A;  1CMG A;  1BT6 A;  1PUL A;  5JJG A;  2PYQ A;  1CKK A;  2M1K B;  3WNX B;  1IRJ A;  2B1U A;  2Y4Q A;  1L7Z A;  3OBV A;  4NDC A;  3BJH A;  1GGW A;  2LAP A;  4M2P A;  3H4S E;  1KWO B;  1UHN A;  2FOT A;  1SNL A;  3NSK A;  2WND A;  3EG5 B;  1YUT A;  2SCP A;  1NCY A;  2RGI A;  3R1O A;  2KGR A;  1TIZ A;  2JTZ A;  1NYA A;  3EK7 A;  3BUX B;  2G2B A;  1ALW A;  2JNX A;  2KGB C;  4N5X A;  2F2P A;  1W7J B;  1ZUZ A;  2LE9 B;  1W7I B;  1OMR A;  1UUR A;  1NP8 A;  1X02 A;  2JT0 A;  3BYA A;  2I2R E;  3SIB A;  4OZD A;  1DGV A;  2EHB A;  3B88 A;  4N1G A;  1IQ3 A;  2WCK A;  4DIR A;  1PK0 D;  2WC6 A;  2BKI B;  3GK1 A;  1Z4H A;  1EH2 A;  4PHM A;  2KYC A;  4BY4 A;  4OVN F;  3PN7 B;  2KI6 C;  3CWG A;  1VRK A;  3I5H C;  5ER5 A;  2NLN A;  1S1E A;  4ORA B;  5TNC A;  1SL8 A;  1CLL A;  2L2E A;  1OW4 A;  2K8M B;  2I18 A;  1GJY A;  1TRF A;  3GOF A;  3OP0 A;  2LUX A;  2QDI A;  4MZL A;  2KDH A;  1RRO A;  3DYE A;  1SMG A;  1Z2C B;  1REC A;  3WXA A;  2L98 A;  2K7C A;  1NIW A;  3EVU A;  1YX7 A;  1Y1A A;  3L4L A;  3O4X A;  3VRO A;  2L4I A;  5AER A;  3BFH A;  1UWO A;  1JF0 A;  2JT8 A;  3IQO A;  2JWW A;  1GGZ A;  1L2O C;  1S36 A;  4MBE A;  1WLZ A;  4BY5 A;  2NXQ A;  1DJI A;  4MZJ A;  1QLK A;  3L4A A;  4GBA A;  4YBH B;  1WRK A;  1OQP A;  1KK7 Z;  3BFB A;  5AXI A;  2BNX A;  4CFR A;  3UNW A;  1V1F A;  1JBA A;  4MRY A;  5CSJ A;  1ORG A;  1XO5 A;  2AUC A;  3AAJ A;  2JPT A;  2KOT A;  1K9K A;  1RJV A;  1QX5 B;  3CZ2 A;  1S5G Y;  1JFK A;  2HF5 A;  2LP2 A;  4M2O A;  1NSH A;  2WCB A;  5PAL A;  3DVJ A;  1M39 A;  5I8N A;  1UP5 A;  2MBX A;  2KQY A;  1JF2 A;  2NCP A;  4PE1 A;  5B8I B;  5G08 A;  1DF0 A;  3DXL A;  2BKH B;  1J7O A;  2QEB A;  2Y1N A;  1BLQ A;  2L50 A;  1ALV A;  4PE4 A;  4GAO A;  2F2O A;  3TS5 C;  5AAN A;  4ICB A;  2O5G A;  1QX2 A;  2CCM A;  3VRR A;  3CR4 X;  1K96 A;  4PHK A;  1QTX A;  2ISD A;  3SG4 A;  1F70 A;  1W9Z A;  3PM2 A;  1DMO A;  1M46 A;  1NCZ A;  4L9M A;  1AUI B;  2LMV A;  4OKH A;  1F54 A;  2ZN8 A;  2GGM A;  2M9G A;  1AP4 A;  1KSM A;  2Y5I A;  1XFU O;  3KPX A;  1F4O A;  3NHI A;  2GTE A;  1NCX A;  3BUW B;  1N2D A;  1V1G A;  1XFX O;  3DF0 B;  1WY9 A;  3JVT B;  2H61 A;  4DUQ A;  5DKQ A;  1KCY A;  1JWD A;  1S6C A;  4MEW A;  4GGN A;  2KHN A;  1BOC A;  2WCE A;  3DZT A;  3PAT A;  3Q8I A;  1RTP 1;  3CDN A;  2MA2 A;  1IKU A;  4OV2 A;  4WRI A;  3R72 A;  2KBM A;  1J55 A;  3FE6 A;  3QRX A;  4XJK A;  4ZCV A;  4M2Q A;  1XFZ O;  5IBW A;  2JOJ A;  2WC5 A;  1A03 A;  2A4J A;  3KHE A;  3M0W A;  4HRE E;  3CZ1 A;  5HLO A;  1BG1 A;  1YRU B;  3S0G A;  1QIV A;  2M29 A;  2MAZ A;  5KTY A;  2JRF A;  4AOM A;  3BOW A;  3SS4 A;  3DVM A;  4MLW A;  1D1O A;  1K9U A;  1K95 A;  1PRW A;  5KSZ A;  1KSO A;  2MHH A;  2PAL A;  2LVI A;  5D3O A;  1QVI Y;  1J7R A;  2NCO A;  2QEO A;  2LP3 A;  3DVK A;  2E6W A;  1EJ3 A;  2I7A A;  1EL4 A;  1CB1 A;  1DF0 B;  1PVB A;  1SCV A;  4TNC A;  1ZOT B;  4U8D A;  1UHK A;  1XK4 C;  1J7P A;  1P28 A;  4GGF C;  1CDM A;  2ZN9 A;  1K8U A;  1EG4 A;  1OOJ A;  3FE8 A;  3I5G C;  4OCI A;  1LVC D;  1QX7 A;  3BFA A;  1SY9 A;  1NX1 A;  2M7N A;  1J1D A;  1Y1U A;  2O60 A;  1SCM B;  2Y1M A;  4A4B A;  1YVH A;  1DVI A;  1CNP A;  1IJ6 A;  2L5Y A;  2CNP A;  1F8H A;  1KQM C;  4I5K A;  1B9A A;  2LC5 A;  2M97 A;  2ZRS A;  3I5I B;  1A75 A;  1LA3 A;  4PCW A;  3SG6 A;  1CLB A;  1UHJ A;  3D73 A;  3A4U B;  3F45 A;  1IQ5 A;  1TN4 A;  2EGD A;  1QAS A;  3AKB A;  5FI2 A;  3OHM B;  1LS8 A;  2CBL A;  2HQW A;  2VRG A;  1K94 A;  4ORC B;  1OMD A;  1PAL A;  4N1F A;  2L5X B;  3SS3 A;  1FPW A;  4GFT A;  1CDL A;  2CT9 A;  2AAO A;  2KLD A;  2H8V A;  1OOF A;  1MXL C;  2LCP A;  4XJK B;  3WHT B;  1CFF A;  1KQV A;  1Y1X A;  5KU1 A;  3A8R A;  4NDB A;  2K2F A;  4JWQ A;  3I5F B;  2F8P A;  4FQT A;  3V2L A;  1J7Q A;  3DY9 A;  1KFX S;  3BOW B;  3TDU A;  2MRD A;  3NXA A;  1QWV A;  3RZS A;  1B4C A;  4PE0 A;  3OB2 B;  4HRH A;  1B8L A;  1E8A A;  1OOG A;  2PQL A;  3ICB A;  1BOD A;  3C1V A;  5I2L A;  3EVV A;  1LIN A;  1C07 A;  1LKJ A;  1ODB A;  1EXR A;  2JQ6 A;  2K7B A;  2L51 A;  3D10 A;  2LMT A;  3D77 A;  1R6P A;  1CFD A;  1OSA A;  1QXP A;  4AQJ A;  3O2P A;  5I2O A;  4CLN A;  3QME A;  1B8C A;  1OOH A;  4A4C A;  4PAL A;  4OR9 B;  1FW4 A;  2WCM A;  1IH0 A;  1TUJ A;  1AVS A;  1IWQ A;  1S6J A;  1TNX A;  3GK2 A;  4MZK A;  2MLE C;  1WRZ A;  3B87 A;  5GQQ C;  3RLZ A;  2LLU A;  3FS7 A;  4C0K A;  1CFC A;  1FF1 A;  2FJU B;  1XFV O;  2WCJ A;  5ER4 X;  2PAS A;  4DCK A;  1A75 B;  1XFR A;  1SBJ A;  1H4B A;  2HPS A;  3JTD B;  1S3P A;  4MN0 A;  3IQQ A;  4WQ2 A;  3BUN B;  5CPV A;  3VGO A;  4HSZ A;  1AHR A;  2V53 A;  1CDN A;  3R1P A;  5JOL A;  3PM8 A;  4AQI A;  1IIO A;  4R1E A;  3PSR A;  4I5J A;  2L0P A;  1AJ5 A;  3FE9 A;  5D69 A;  4UPG A;  4KYN A;  4YI9 A;  2K7D A;  3GK4 X;  1UHI A;  3JVT C;  4JQ0 D;  4P5O E;  2COL B;  4QJ3 B;  1AK8 A;  1XA5 A;  2P70 A;  3FWC A;  1PVA A;  3BXK A;  3OGN A;  1QJT A;  1DEK A;  3S0D A;  2PVB A;  1YTZ C;  2BL0 C;  4YI8 A;  1SR6 B;  1QAT A;  2QPT A;  2K2A A;  3TDI A;  3UO9 A;  1TTX A;  3IVT A;  3LLE A;  2LNK A;  5FYX A;  3OX5 A;  4PHN A;  2WOR A;  1KFU S;  3BUO B;  2WCH A;  3AAK A;  4I5L B;  1OZO A;  3SG3 A;  2JC2 A;  3TUY C;  1TUZ A;  1L2O B;  2M49 B;  3D0Y A;  4XYN A;  1M45 A;  1BMO A;  1LXF C;  3DD4 A;  2WOS A;  3BUM B;  2OS8 C;  2OTG B;  3B86 A;  1TNQ A;  4YGC B;  1RWY A;  3EK8 A;  2LM5 A;  3EKH A;  2F33 A;  2LHL A;  1K93 D;  5F6T A;  4YGD B;  3EKJ A;  2WC8 A;  1FI5 A;  2K60 A;  1A2X A;  2ERB A;  2JXL A;  2LMU A;  3OB1 B;  1SW8 A;  1A4P A;  1QIW A;  1QLS A;  1KWO C;  1QVI Z;  2ZNE A;  3FWB A;  4GPL B;  3CZT X;  1GQM A;  1YR5 A;  2KYF A;  4PE7 A;  3CTN A;  4FQO A;  1Q80 A;  1YRT B;  1XYD A;  4PHJ A;  1NUB A;  1QV1 A;  5CSN A;  1DJY A;  1KFU L;  3MSE B;  1B7T Y;  5CSF A;  2Q4U A;  3R1V A;  1XK4 A;  3VB1 A;  5DKR A;  2KNE A;  2G9B A;  4CFQ A;  1KK8 B;  1EG3 A;  3TS5 B;  1CM4 A;  2JXC A; 
#chains in the Genus database with same CATH homology
 1R2U A;  2JZI A;  2PRU A;  5HLV A;  3SIA A;  1CTR A;  1M63 B;  2ZFD A;  5DKN A;  1YVL A;  1PSR A;  2KFF A;  1SL9 A;  2KAY A;  2D8N A;  1MHO A;  2KI4 B;  3I5F C;  1YX8 A;  2ZKM X;  4CPV A;  3ZWH A;  3PN7 C;  2K7O A;  1Y6W A;  3SG5 A;  2NZ0 A;  2BCB A;  3KF9 A;  4DRW A;  1G33 A;  3KO0 A;  2ZRT A;  4MVF A;  3NSO A;  4WQ3 A;  1TNP A;  2F3Y A;  2L4H A;  3O6B A;  1QS7 A;  1N0Y A;  2FCD A;  1YUR A;  2LV7 A;  2BE4 A;  3SG2 A;  3O78 A;  2MJW B;  3DVE A;  1WDC B;  2QAC A;  3LL8 B;  2GGZ A;  5BPJ A;  1BJF A;  2DOQ A;  4P2Y B;  2P6B B;  1PSB A;  2EC6 B;  1DJH A;  3VRP A;  3LK1 A;  1B8R A;  4C0L A;  4MSP A;  4YGA A;  3PAL A;  3JTD C;  2PMY A;  4QJ4 B;  4D1E A;  4I5N B;  2F3Z A;  1A29 A;  1B47 A;  2BCX A;  1F4Q A;  4E68 A;  2LLT A;  2KI6 D;  1BU3 A;  1XFW O;  2HET A;  3PFV A;  2KAX A;  2LAN A;  3I5G B;  5HKZ A;  5J3X A;  2FCE A;  1B1G A;  1MUX A;  2SAS A;  3EK4 A;  1JUO A;  2KFH A;  1G4Y R;  3VRQ A;  1NX2 A;  1DT7 B;  2WCF A;  2M7L A;  1C7V A;  1JFJ A;  1KQM B;  2ZND A;  4NDD A;  1YUS A;  1AJ4 A;  1F55 A;  1FBV A;  5HKY A;  1CM1 A;  1SYM A;  1SR6 C;  3EVR A;  1DGU A;  1KFX L;  1QV0 A;  1SK6 D;  3TZ1 A;  2H2K A;  2JUL A;  2MLF C;  3K21 A;  2OPO A;  1M31 A;  3VRN A;  1MWN A;  1S5G Z;  3CR2 A;  4Q04 A;  1TCF A;  2LVK A;  3IF7 A;  3NSI A;  1RFJ A;  1SKT A;  1UUS A;  1NPQ A;  2KBI A;  1TNW A;  3DF0 A;  1U5I A;  2BEC A;  2KFG A;  3NSL A;  5D7F A;  1G8I A;  1F71 A;  2E30 A;  1RK9 A;  4USL A;  2LHI A;  3HCM A;  1Y0V H;  2OTG C;  3I5H B;  3LCP C;  2HQ8 A;  1KK7 Y;  2IS9 A;  1HT9 A;  4ORB B;  1BF5 A;  1DJW A;  1BR4 B;  1SL7 A;  1YUU A;  2CTN A;  2LLS A;  4YGB B;  2JU0 A;  3AKA A;  1ZMZ A;  1K2H A;  1HQV A;  1K9P A;  4NQG A;  3KEV A;  1TOP A;  1J1E A;  2BE6 A;  3OX6 A;  5I2Q A;  3CS1 A;  4ETO A;  1BR1 B;  1XFY O;  1LA0 A;  1ZFS A;  3O4Y A;  2CXJ A;  4FTG A;  4YGE B;  5AEQ A;  5HYD A;  3CLN A;  1NX0 A;  1CMF A;  1OMV A;  3BQ3 A;  1CFP A;  1OE9 B;  1KK8 C;  2JNF A;  1CLM A;  2JTT A;  2LUC A;  3I5I C;  2I94 A;  1MXE A;  1JSA A;  1IGV A;  2LVJ A;  2PSR A;  2R2I A;  3CGA A;  1FI6 A;  1SCM C;  2Q91 A;  2KI4 C;  1MR8 A;  4JPZ B;  1DJZ A;  4PDZ A;  3SG7 A;  2BBN A;  2M1U A;  1ZAC A;  3HX4 A;  1DTL A;  2AMI A;  1SPY A;  3LK0 A;  1N65 A;  2JT3 A;  3FIA A;  3PLF B;  5K89 A;  1JC2 A;  4MRX A;  1B7T Z;  1C7W A;  1U5I B;  2KQ6 A;  4HRG A;  1XVJ A;  2H61 C;  4CID A;  4GGF A;  2BL0 B;  5AFP A;  3ZNI A;  3RM1 A;  3WHU B;  1H8B A;  4C0J A;  1DJX A;  4GNK B;  2K61 A;  1OZS A;  2KSP A;  3TDZ A;  1WDC C;  5HKW A;  3SJS A;  2BBM A;  1TCO B;  4IL1 A;  1IG5 A;  1K90 D;  1MF8 B;  1WLM A;  2GV5 A;  2EC6 C;  4QJ5 B;  1MQ1 A;  2BCA A;  4GUK A;  1SRA A;  1S26 D;  4YRU A;  2LVV A;  2M8U A;  3E3R A;  3CR5 X;  3TUY B;  1NX3 A;  5CSI A;  1WRL A;  2K0J A;  4DS7 A;  1DJG A;  2TN4 A;  3D0Y B;  4ZCU A;  2M0R A;  1NWD A;  1IJ5 A;  1CDP A;  1S6I A;  1UHH A;  2OS8 B;  2M3W A;  2KAV A;  1CMG A;  1BT6 A;  1PUL A;  5JJG A;  1CKK A;  2M1K B;  3WNX B;  1IRJ A;  2B1U A;  2Y4Q A;  1L7Z A;  4NDC A;  1GGW A;  2LAP A;  4M2P A;  3H4S E;  1KWO B;  1UHN A;  2FOT A;  1SNL A;  3NSK A;  2WND A;  1YUT A;  2SCP A;  1NCY A;  2RGI A;  2KGR A;  1TIZ A;  2JTZ A;  1NYA A;  3EK7 A;  3BUX B;  2G2B A;  1ALW A;  2JNX A;  2KGB C;  4N5X A;  2F2P A;  1W7J B;  1ZUZ A;  2LE9 B;  1OMR A;  1W7I B;  1UUR A;  1NP8 A;  1X02 A;  2JT0 A;  3BYA A;  2I2R E;  3SIB A;  1DGV A;  2EHB A;  4N1G A;  1IQ3 A;  4DIR A;  1PK0 D;  3GK1 A;  2BKI B;  1EH2 A;  4PHM A;  2KYC A;  4BY4 A;  4OVN F;  3PN7 B;  2KI6 C;  3CWG A;  1VRK A;  3I5H C;  5ER5 A;  2NLN A;  1S1E A;  4ORA B;  5TNC A;  1SL8 A;  1CLL A;  2L2E A;  2K8M B;  2I18 A;  1GJY A;  1TRF A;  3GOF A;  3OP0 A;  2LUX A;  4MZL A;  2KDH A;  1RRO A;  1SMG A;  1REC A;  3WXA A;  2L98 A;  2K7C A;  1NIW A;  3EVU A;  1YX7 A;  1Y1A A;  3VRO A;  5AER A;  2L4I A;  1UWO A;  1JF0 A;  2JT8 A;  3IQO A;  2JWW A;  1GGZ A;  1L2O C;  1S36 A;  4MBE A;  1WLZ A;  4BY5 A;  2NXQ A;  1DJI A;  4MZJ A;  1QLK A;  4GBA A;  4YBH B;  1WRK A;  1OQP A;  1KK7 Z;  5AXI A;  4CFR A;  1V1F A;  1JBA A;  4MRY A;  5CSJ A;  1XO5 A;  2AUC A;  3AAJ A;  2JPT A;  2KOT A;  1K9K A;  1RJV A;  1QX5 B;  1S5G Y;  1JFK A;  2HF5 A;  2LP2 A;  4M2O A;  1NSH A;  2WCB A;  5PAL A;  3DVJ A;  1M39 A;  5I8N A;  1UP5 A;  2MBX A;  2KQY A;  1JF2 A;  2NCP A;  4PE1 A;  5B8I B;  5G08 A;  1DF0 A;  2BKH B;  1J7O A;  2Y1N A;  1BLQ A;  2L50 A;  1ALV A;  4PE4 A;  4GAO A;  2F2O A;  3TS5 C;  5AAN A;  4ICB A;  2O5G A;  1QX2 A;  2CCM A;  3VRR A;  3CR4 X;  1K96 A;  4PHK A;  1QTX A;  2ISD A;  3SG4 A;  1F70 A;  1DMO A;  1M46 A;  1NCZ A;  4L9M A;  1AUI B;  2LMV A;  4OKH A;  1F54 A;  2ZN8 A;  2GGM A;  2M9G A;  1AP4 A;  1KSM A;  2Y5I A;  1XFU O;  3KPX A;  1F4O A;  1NCX A;  3BUW B;  1N2D A;  1V1G A;  1XFX O;  3DF0 B;  1WY9 A;  3JVT B;  2H61 A;  4DUQ A;  5DKQ A;  1KCY A;  1JWD A;  1S6C A;  4MEW A;  4GGN A;  2KHN A;  1BOC A;  2WCE A;  3PAT A;  1RTP 1;  2MA2 A;  1IKU A;  4OV2 A;  4WRI A;  2KBM A;  1J55 A;  3QRX A;  4XJK A;  4ZCV A;  4M2Q A;  1XFZ O;  5IBW A;  2JOJ A;  1A03 A;  2A4J A;  3KHE A;  3M0W A;  4HRE E;  5HLO A;  1BG1 A;  1YRU B;  1QIV A;  2M29 A;  2MAZ A;  5KTY A;  2JRF A;  4AOM A;  3BOW A;  1D1O A;  3DVM A;  4MLW A;  1K9U A;  1K95 A;  1PRW A;  5KSZ A;  1KSO A;  2MHH A;  2PAL A;  2LVI A;  1QVI Y;  1J7R A;  2NCO A;  2LP3 A;  3DVK A;  2E6W A;  1EJ3 A;  2I7A A;  1EL4 A;  1CB1 A;  1DF0 B;  1PVB A;  1SCV A;  4TNC A;  1ZOT B;  4U8D A;  1UHK A;  1XK4 C;  1J7P A;  4GGF C;  1CDM A;  2ZN9 A;  1K8U A;  1EG4 A;  1OOJ A;  3I5G C;  4OCI A;  1LVC D;  1QX7 A;  1SY9 A;  1NX1 A;  2M7N A;  1J1D A;  1Y1U A;  2O60 A;  1SCM B;  2Y1M A;  4A4B A;  1YVH A;  1DVI A;  1CNP A;  1IJ6 A;  2CNP A;  1F8H A;  1KQM C;  4I5K A;  1B9A A;  2LC5 A;  2M97 A;  2ZRS A;  3I5I B;  1A75 A;  1LA3 A;  4PCW A;  3SG6 A;  1CLB A;  1UHJ A;  3A4U B;  3F45 A;  1IQ5 A;  1TN4 A;  2EGD A;  1QAS A;  3AKB A;  3OHM B;  2VRG A;  2CBL A;  2HQW A;  4F0Z B;  1K94 A;  4ORC B;  1OMD A;  1PAL A;  4N1F A;  2L5X B;  1FPW A;  4GFT A;  1CDL A;  2CT9 A;  2AAO A;  1MXL C;  2LCP A;  4XJK B;  3WHT B;  1CFF A;  1KQV A;  1Y1X A;  5KU1 A;  3A8R A;  4NDB A;  2K2F A;  4JWQ A;  3I5F B;  2F8P A;  1J7Q A;  1KFX S;  3BOW B;  3TDU A;  2MRD A;  3NXA A;  1B4C A;  4PE0 A;  3OB2 B;  4HRH A;  1B8L A;  1E8A A;  1BOD A;  3ICB A;  3C1V A;  5I2L A;  3EVV A;  1LIN A;  1C07 A;  1LKJ A;  1ODB A;  1EXR A;  2JQ6 A;  2K7B A;  2L51 A;  3D10 A;  2LMT A;  4AQJ A;  1R6P A;  1CFD A;  1OSA A;  1QXP A;  3O2P A;  5I2O A;  4CLN A;  1B8C A;  4A4C A;  4PAL A;  4OR9 B;  1FW4 A;  1IH0 A;  1AVS A;  1IWQ A;  1S6J A;  1TNX A;  3GK2 A;  4MZK A;  2MLE C;  1WRZ A;  5GQQ C;  3RLZ A;  2LLU A;  3FS7 A;  4C0K A;  1CFC A;  1FF1 A;  2FJU B;  1XFV O;  4DCK A;  5ER4 X;  2PAS A;  1A75 B;  1SBJ A;  1H4B A;  2HPS A;  3JTD B;  1S3P A;  4MN0 A;  3IQQ A;  4WQ2 A;  3BUN B;  5CPV A;  3VGO A;  4HSZ A;  1AHR A;  2V53 A;  1CDN A;  5JOL A;  3PM8 A;  4AQI A;  4R1E A;  3PSR A;  4I5J A;  2L0P A;  1AJ5 A;  5D69 A;  4UPG A;  4YI9 A;  2K7D A;  3GK4 X;  1UHI A;  3JVT C;  4JQ0 D;  4P5O E;  2COL B;  4QJ3 B;  1AK8 A;  1XA5 A;  3FWC A;  1PVA A;  3BXK A;  1QJT A;  2PVB A;  1YTZ C;  2BL0 C;  4YI8 A;  1SR6 B;  1QAT A;  2QPT A;  2K2A A;  3TDI A;  1TTX A;  3LLE A;  2LNK A;  5FYX A;  3OX5 A;  4PHN A;  2WOR A;  1KFU S;  3BUO B;  4I5L B;  3AAK A;  1OZO A;  3SG3 A;  2JC2 A;  3TUY C;  1L2O B;  2M49 B;  3D0Y A;  4XYN A;  1M45 A;  1BMO A;  1LXF C;  3DD4 A;  2WOS A;  3BUM B;  2OS8 C;  2OTG B;  4YGC B;  1TNQ A;  1RWY A;  3EK8 A;  2LM5 A;  3EKH A;  2F33 A;  2LHL A;  1K93 D;  5F6T A;  4YGD B;  3EKJ A;  2WC8 A;  1FI5 A;  1A2X A;  2LMU A;  2JXL A;  3OB1 B;  1SW8 A;  1A4P A;  1QIW A;  1QLS A;  1KWO C;  1QVI Z;  2ZNE A;  3FWB A;  4GPL B;  3CZT X;  1GQM A;  1YR5 A;  2KYF A;  4PE7 A;  3CTN A;  4FQO A;  1Q80 A;  1YRT B;  1XYD A;  4PHJ A;  1NUB A;  1QV1 A;  5CSN A;  1DJY A;  1KFU L;  3MSE B;  1B7T Y;  5CSF A;  2Q4U A;  1XK4 A;  5DKR A;  2KNE A;  2G9B A;  4CFQ A;  1KK8 B;  1EG3 A;  3TS5 B;  1CM4 A;  2JXC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...