1MXLC

Structure of cardiac troponin c-troponin i complex
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
89
structure length
89
Chain Sequence
MDDIYKAAVEQLTEEQKNEFKAAFDIFVLGAEDGCISTKELGKVMRMLGQNPTPEELQEMIDEVDEDGSGTVDFDEFLVMMVRCMKDDS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Binding of cardiac troponin-I147-163 induces a structural opening in human cardiac troponin-C.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Calcium-binding protein
molecule keywords PROTEIN (TROPONIN C)
total genus 20
structure length 89
sequence length 89
ec nomenclature
pdb deposition date 1999-04-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF13833 EF-hand_8 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1mxlC00
3RM1A 1CDLA 1XO5A 4OKHA 2K2FA 1DF0A 1WLMA 3BUMB 3BUWB 1XYDA 1B7TY 1QJTA 1GQMA 3JTDC 2JNFA 2PMYA 1XFXO 1ODBA 2O60A 1DVIA 2G2BA 1H4BA 1CKKA 1KWOC 2LVVA 3AKBA 1F4OA 3DD4A 2JPTA 2K7CA 2JT8A 2MRDA 3RLZA 2HQ8A 2PSRA 3DVEA 5KTYA 1YUUA 4GNKB 4YGAA 2KI6C 2PALA 2CBLA 2KSPA 2QACA 4USLA 3D10A 1CLMA 4HREE 2EC6B 1JFKA 2ZNEA 4DRWA 2K8MB 1JFJA 1PVAA 5AFPA 3I5FC 2QPTA 1QASA 2ZRSA 1EH2A 4GFTA 1CTRA 2I18A 1CDNA 3WNXB 4WQ3A 1XFWO 1IG5A 3CTNA 3E3RA 1ZOTB 1OZOA 1SCVA 2KFHA 2L0PA 3CLNA 4I5JA 4PE0A 4MLWA 4CFRA 3PN7B 1QV0A 3AAKA 1J7QA 1D1OA 4OCIA 2M49B 4PHKA 1KQMC 1B8RA 1NSHA 1KK7Y 2LV7A 2AAOA 2MLEC 4XYNA 1XK4A 1OMDA 2BECA 3DVKA 4F0ZB 1NCXA 3AAJA 3SG6A 1NIWA 1KWOB 2L98A 1QLKA 4C0KA 1BU3A 4ZCUA 3CGAA 1C07A 1BODA 1K93D 1QLSA 2M29A 3F45A 2JQ6A 1KQMB 3LK0A 3KPXA 1UURA 1R6PA 2EGDA 4MVFA 3EK8A 4MZJA 2M8UA 1OE9B 1DJHA 2AMIA 2LC5A 3IQQA 1B7TZ 1WDCB 2FOTA 2KGBC 1AP4A 3MSEB 1TNXA 1EJ3A 2DOQA 1L2OB 5AXIA 2Y4QA 2MBXA 1A03A 1CFCA 2LMUA 3DF0A 1VRKA 1TNQA 1MR8A 2LMVA 3A8RA 2Y1NA 1K95A 5AEQA 1J55A 2M0RA 5D69A 1CLLA 1NX3A 4GBAA 4CPVA 1NP8A 3I5GB 1Y0VH 4ZCVA 3LCPC 4YGBB 3LL8B 4ORAB 4ICBA 2KNEA 1UWOA 2LVKA 1N2DA 2JTTA 1CFDA 2LLTA 1B8CA 1OMVA 2JZIA 3NSOA 1K9PA 3DF0B 2KFFA 1YVHA 4ORBB 5AANA 1A75B 4L9MA 2P6BB 1J7OA 4P2YB 4MEWA 1CM4A 3HX4A 4D1EA 2K7BA 1MHOA 1IWQA 3I5IB 1IQ3A 1JF2A 4BY4A 2PVBA 3EVVA 3PLFB 1HT9A 2KI6D 2M1UA 4HSZA 4AQJA 1QX7A 1DMOA 2GGZA 2AUCA 1U5IA 1PULA 1S3PA 2BL0C 3NXAA 3EVRA 4U8DA 4DIRA 1PK0D 1TN4A 1K90D 1JWDA 1C7WA 4I5KA 1AHRA 3HCMA 2JTZA 4XJKB 5KSZA 1S1EA 4M2OA 4QJ4B 3PM8A 5KU1A 1GGWA 1TNWA 1YUTA 4AOMA 3TDZA 4C0JA 1B4CA 3EVUA 2EHBA 1KK7Z 1M63B 2NCPA 2NXQA 5BPJA 2E30A 2HQWA 2OTGC 1NYAA 2HPSA 4AQIA 1RJVA 1J1EA 5DKRA 4PDZA 2F2PA 1EG3A 4HRHA 5I2QA 1M46A 1UHJA 3PN7C 2CCMA 1U5IB 4FTGA 2KDHA 4GUKA 1TTXA 1KSOA 1M45A 3BOWA 1SK6D 2M97A 1N0YA 1LXFC 1FW4A 1S6IA 3NSIA 1NX0A 3VRRA 2JXCA 2FCEA 2I94A 3PALA 1QATA 2MJWB 4MRXA 4PCWA 1B47A 2LP3A 1BLQA 3TUYC 2F3ZA 1CMGA 4BY5A 1S5GY 1A75A 3DVJA 4PE1A 1OMRA 3GK2A 1SY9A 2ZKMX 1RWYA 2LHIA 3H4SE 4OR9B 2M7NA 1RTP1 1GJYA 5CSJA 1QTXA 2LE9B 3NSKA 4JPZB 1RK9A 2A4JA 1CNPA 4NDBA 1OSAA 2I2RE 1S5GZ 1LKJA 4JWQA 2L51A 5F6TA 1PRWA 1SR6B 3SG4A 1PSBA 2V53A 4PHMA 1YX7A 1QV1A 1L2OC 2SASA 3TS5C 4GPLB 2B1UA 2OS8C 1UP5A 2BBMA 2ZN9A 1MQ1A 5HLOA 2F33A 1K94A 3O4YA 2K2AA 1IKUA 1DJWA 1J7RA 2JXLA 2G9BA 4QJ5B 1QVIZ 2M9GA 2L4HA 4FQOA 3I5IC 1SL9A 1B9AA 1OOJA 3OX6A 1DJXA 2JT0A 1OZSA 2BBNA 2LLSA 1DT7B 4TNCA 1DJZA 1AVSA 3BUNB 1HQVA 2EC6C 3BYAA 1W7JB 2SCPA 2KHNA 1BT6A 2BE4A 4C0LA 4OV2A 1KSMA 2KQ6A 1SMGA 1MUXA 5GQQC 5I2LA 2HETA 1NX2A 1YTZC 1H8BA 1G33A 1K8UA 3KHEA 1WRKA 1WRZA 1G8IA 2WCFA 1SCMB 1AUIB 1ALVA 1BG1A 2F8PA 1J1DA 2E6WA 5I2OA 2LMTA 4A4BA 1IH0A 1LINA 2I7AA 1TNPA 3EKJA 3WHTB 4N1GA 2MAZA 4I5LB 5IBWA 3I5FB 2Y5IA 3OB2B 1QVIY 2F3YA 2JOJA 4R1EA 5DKNA 2MHHA 4NDDA 1F54A 1SCMC 1YX8A 4P5OE 3CR5X 5CSNA 1Y6WA 2K7OA 2Y1MA 1DJIA 3OB1B 1KFXL 1QX2A 1QS7A 2Q4UA 1S6CA 1Y1AA 3SG2A 4MRYA 1IQ5A 4MSPA 1E8AA 1R2UA 2LUCA 3IQOA 4ETOA 1WLZA 4CFQA 1XK4C 2WC8A 4OVNF 2JRFA 5I8NA 3FS7A 1LVCD 1TRFA 1A29A 5FYXA 3IF7A 2FJUB 1CFFA 1IJ5A 2H2KA 2H61C 1G4YR 2KAXA 1IJ6A 1SYMA 1UHKA 3M0WA 1XVJA 2KOTA 5CPVA 1JBAA 1KCYA 4MBEA 3TUYB 1PSRA 1M31A 3C1VA 4A4CA 3LK1A 1BR4B 1SKTA 2K0JA 4MZKA 3D0YB 1XFZO 2JC2A 3DVMA 4M2PA 1S36A 4XJKA 1DGUA 2MLFC 3VROA 1FPWA 2L4IA 1ALWA 1EXRA 5HKWA 1UHNA 2F2OA 2BCAA 3K21A 3EK4A 1L7ZA 1PVBA 2WCEA 1CDMA 3BXKA 3QRXA 3KO0A 2CNPA 2M1KB 3VRPA 3I5GC 5HLVA 2R2IA 1PALA 2GV5A 1CLBA 3SJSA 1UUSA 2KI4C 1DF0B 1SR6C 2JNXA 2WCBA 2BCXA 3JVTC 1V1FA 5ER5A 1SNLA 2KYCA 1JF0A 4GGFA 3SIAA 2BL0B 1XFUO 4YGEB 3GOFA 3VRQA 1TIZA 2L50A 4IL1A 2GGMA 1UHIA 3O2PA 4N5XA 1BR1B 1K2HA 1FF1A 2LNKA 1JUOA 4NDCA 1GGZA 1TCFA 2TN4A 3TDUA 3NSLA 1NCYA 3GK4X 1Y1UA 1DTLA 1EL4A 4NQGA 5D7FA 3LLEA 1NUBA 3SIBA 3ICBA 1LA3A 4WRIA 2OS8B 1EG4A 1RFJA 2LM5A 5G08A 1F70A 3PFVA 5PALA 2RGIA 2KYFA 2JULA 3CWGA 2LAPA 1SPYA 2ZFDA 3SG7A 1UHHA 3EKHA 1NPQA 1W7IB 1SL7A 3CR2A 2WNDA 2PRUA 1N65A 2ZNDA 1FBVA 2HF5A 2KGRA 4YI8A 1JSAA 2D8NA 1TCOB 2CXJA 1ZUZA 4JQ0D 1A4PA 2NZ0A 3JTDB 4ORCB 1YVLA 5ER4X 5J3XA 3PSRA 1CB1A 5JOLA 2OTGB 1A2XA 2KFGA 2JWWA 3A4UB 2MA2A 3D0YA 3CR4X 4MZLA 2WOSA 1CMFA 2COLB 4YBHB 1S26D 1JC2A 4WQ2A 1FI5A 4Q04A 3FWCA 2PASA 1MF8B 1F4QA 1CFPA 4DCKA 3KF9A 1DJYA 5TNCA 1MWNA 2LLUA 2Q91A 1FI6A 4GGNA 1NWDA 1KFUS 2O5GA 1MXEA 1Y1XA 4GAOA 2KQYA 3WXAA 2BKIB 3OHMB 4PE4A 1S6JA 3BOWB 3BQ3A 3BUOB 4N1FA 2M7LA 2L2EA 1ZFSA 1YRTB 3WHUB 3OX5A 5HKZA 4MN0A 1KQVA 3SG5A 1RECA 4PHJA 2CT9A 5CSFA 3AKAA 1CM1A 2K61A 4YI9A 5HKYA 3O78A 2H61A 1OQPA 2ZRTA 4PHNA 4DUQA 4QJ3B 1QX5B 3FWBA 1KK8C 1XFVO 1F71A 1SBJA 1YRUB 1B8LA 1RROA 1ZMZA 1WY9A 3CS1A 3FIAA 4PALA 3I5HC 1YR5A 1AJ4A 1M39A 1TOPA 2KI4B 1LA0A 1QIWA 4YRUA 2BCBA 2LP2A 4M2QA 1SW8A 1BF5A 3JVTB 2LCPA 2KAYA 4CIDA 1ZACA 4UPGA 5DKQA 1BOCA 2LHLA 2ZN8A 2LVIA 1KFXS 5AERA 1CDPA 5CSIA 4PE7A 1AK8A 3CZTX 1NX1A 1SRAA 3PATA 1IGVA 1X02A 4I5NB 1F55A 2KAVA 2FCDA 1WDCC 1BJFA 4YGDB 3BUXB 1QXPA 1KK8B 1XA5A 2L5XB 4CLNA 4GGFC 2VRGA 1B1GA 2M3WA 1IRJA 2CTNA 1K9UA 2KBMA 1Q80A 3TZ1A 3I5HB 3EK7A 3OP0A 1YUSA 3O6BA 1KFUL 1C7VA 1K9KA 5JJGA 2ISDA 2JT3A 1QIVA 2LUXA 1MXLC 3KEVA 5B8IB 3TS5B 1F8HA 1AJ5A 4E68A 1NCZA 1SL8A 2BE6A 2OPOA 1V1GA 1DJGA 1XFYO 2JU0A 3TDIA 3VGOA 3VRNA 1WRLA 3SG3A 1J7PA 2K7DA 2NLNA 2NCOA 2LVJA 1K96A 4DS7A 3GK1A 2KBIA 1DGVA 1YURA 4HRGA 5K89A 4YGCB 5HYDA 3ZWHA 2BKHB 2WORA 2IS9A 1BMOA 3ZNIA 2LANA
chains in the Genus database with same CATH superfamily
3RM1A 1CDLA 1XO5A 4OKHA 2K2FA 1DF0A 1WLMA 3BUMB 3BUWB 3RZSA 1XYDA 1B7TY 1QJTA 1GQMA 3JTDC 2JNFA 1GM0A 2PMYA 2PQLA 1XFXO 1TUJA 1ODBA 2O60A 1DVIA 2G2BA 1H4BA 1CKKA 1KWOC 2LVVA 3AKBA 1F4OA 3DD4A 2JPTA 2K7CA 2JT8A 5DICA 2QEBA 2MRDA 3RLZA 2HQ8A 2PSRA 3DVEA 5KTYA 1YUUA 4GNKB 4YGAA 2KI6C 2PALA 1TWOA 2CBLA 2KSPA 3D73A 2QACA 2WCHA 4USLA 3BFAA 1CLMA 3D10A 2EC6B 1JFKA 2ZNEA 4HREE 2K8MB 5FI6A 3S0GA 4DRWA 1PVAA 3PJIA 5AFPA 3I5FC 2QPTA 1QASA 2ZRSA 1EH2A 4GFTA 1CTRA 2I18A 1CDNA 3WNXB 4WQ3A 1OOFA 1IG5A 1XFWO 2WCMA 3CTNA 3E3RA 1ZOTB 3DY9A 3S0BA 1OZOA 1SCVA 2KFHA 2L0PA 1C3ZA 3CLNA 4I5JA 4PE0A 3NHIA 4MLWA 4CFRA 3PN7B 1QV0A 3AAKA 1J7QA 1D1OA 4OCIA 2M49B 4PHKA 1KQMC 1B8RA 1NSHA 1KK7Y 2LV7A 2AAOA 2MLEC 3CZ1A 3Q8IA 1XK4A 4XYNA 1OMDA 2BECA 3DVKA 3PM2A 4F0ZB 1NCXA 3AAJA 2GTEA 1Z2CB 3SG6A 1NIWA 1KWOB 2L98A 1QLKA 4C0KA 1BU3A 4ZCUA 3CGAA 1C07A 1BODA 1C3YA 1K93D 2WC6A 1QLSA 2M29A 3F45A 2JQ6A 1KQMB 3LK0A 3KPXA 1UURA 1R6PA 2EGDA 3R1VA 3EK8A 4MZJA 2M8UA 4MVFA 1OE9B 1DJHA 2AMIA 2KLEA 2LC5A 2PYQA 3IQQA 1B7TZ 1WDCB 2FOTA 2KGBC 1AP4A 3MSEB 1TNXA 1EJ3A 2DOQA 1L2OB 2WCKA 2Y4QA 5AXIA 2MBXA 1A03A 1CFCA 2LMUA 3DF0A 1VRKA 3DZTA 1TNQA 1MR8A 2LMVA 3A8RA 2Y1NA 1K95A 5AEQA 1J55A 2M0RA 5D69A 1CLLA 1NX3A 4GBAA 4CPVA 1NP8A 3I5GB 1Y0VH 4ZCVA 3LCPC 4YGBB 2BAPA 3LL8B 4ORAB 4ICBA 2KNEA 1UWOA 4OZDA 2LVKA 1N2DA 2JTTA 1CFDA 2LLTA 1B8CA 1OMVA 2JZIA 3NSOA 1K9PA 3DF0B 3V2LA 2KFFA 1YVHA 4ORBB 5AANA 1A75B 4L9MA 2P6BB 1J7OA 4P2YB 4INWA 4MEWA 1CM4A 2L5YA 3HX4A 5FI7A 2K7BA 4D1EA 1MHOA 1IWQA 3I5IB 1IQ3A 1JF2A 4BY4A 2PVBA 3EVVA 3PLFB 1HT9A 2KI6D 2M1UA 4HSZA 3L47A 4AQJA 1QX7A 1DMOA 2GGZA 2AUCA 1U5IA 1PULA 1S3PA 2BL0C 2JPOA 2L2CA 3EVRA 3NXAA 4U8DA 4DIRA 3CZ2A 1PK0D 1TN4A 1K90D 1JWDA 1C7WA 4I5KA 1AHRA 3HCMA 3CYZA 2JTZA 4XJKB 5KSZA 1S1EA 4M2OA 4QJ4B 3PM8A 5KU1A 3S0AA 1GGWA 1TNWA 1YUTA 4AOMA 3TDZA 4C0JA 1B4CA 3EVUA 2EHBA 1KK7Z 1M63B 2NCPA 2NXQA 5BPJA 2E30A 2HQWA 2OTGC 1NYAA 2HPSA 4AQIA 1RJVA 1J1EA 5DKRA 4PDZA 1TUZA 2F2PA 1EG3A 4HRHA 5I2QA 1M46A 1UHJA 3PN7C 2CCMA 1U5IB 4FTGA 2KDHA 4GUKA 1TTXA 4F7FA 5D3OA 1KSOA 1M45A 3BOWA 1SK6D 2M97A 1N0YA 1LXFC 1FW4A 1S6IA 3R72A 3NSIA 1NX0A 3VRRA 2JXCA 2FCEA 2I94A 3PALA 1QATA 2MJWB 4MRXA 4PCWA 1B47A 4IJ7A 2K60A 2LP3A 4KYNA 1BLQA 2QDIA 3R1PA 2F3ZA 3TUYC 4BY5A 1CMGA 1S5GY 1A75A 3DVJA 4PE1A 1OMRA 3D78A 3GK2A 1SY9A 2ZKMX 1RWYA 2LHIA 3H4SE 4OR9B 2M7NA 1RTP1 1GJYA 2QEVA 5CSJA 1QTXA 2LE9B 3NSKA 4JKTA 4JPZB 1RK9A 2A4JA 3S0DA 3QMEA 1CNPA 4NDBA 1DQEA 1OSAA 1S5GZ 2I2RE 1LKJA 3B7AA 4JWQA 1W9ZA 2L51A 2QEOA 3EG5B 5F6TA 1PRWA 1SR6B 3SG4A 1PSBA 2V53A 4PHMA 1YX7A 1QV1A 1L2OC 2SASA 3TS5C 4GPLB 2B1UA 2OS8C 1UP5A 2BBMA 2ZN9A 1MQ1A 5HLOA 2F33A 1K94A 4FQTA 3O4YA 2K2AA 1IKUA 1DJWA 1J7RA 2JXLA 2WC5A 2G9BA 4QJ5B 1QVIZ 2M9GA 2L4HA 4FQOA 2QEHA 3I5IC 1SL9A 1B9AA 1OOJA 3OX6A 1DJXA 2JT0A 1OZSA 2BBNA 2LLSA 1DT7B 4TNCA 1DJZA 1AVSA 3BUNB 1HQVA 2EC6C 3BYAA 1W7JB 2SCPA 2KHNA 1BT6A 2BE4A 4C0LA 4OV2A 1KSMA 2KQ6A 1SMGA 3D76A 1MUXA 5GQQC 5I2LA 2HETA 1NX2A 1YTZC 1H8BA 1G33A 1K8UA 3KHEA 1WRKA 1WRZA 1G8IA 2WCFA 1SCMB 3B6XA 1AUIB 1ALVA 1BG1A 1J1DA 2F8PA 1OW4A 2E6WA 5I2OA 2LMTA 3CZ0A 4A4BA 1IH0A 3VB1A 1LINA 2I7AA 1TNPA 3CDNA 3EKJA 4INXA 3WHTB 3FE8A 4N1GA 2MAZA 4I5LB 5IBWA 3I5FB 2Y5IA 3OB2B 1QVIY 2F3YA 2JOJA 4R1EA 5DKNA 2MHHA 4NDDA 1F54A 1SCMC 1YX8A 4P5OE 3CR5X 5CSNA 1Y6WA 2K7OA 2Y1MA 1DJIA 3OB1B 5HL1A 1KFXL 1QX2A 1QS7A 2Q4UA 1S6CA 1Y1AA 3SG2A 4MRYA 1IQ5A 4MSPA 1E8AA 1R2UA 2LUCA 3IQOA 4ETOA 2P70A 3BFHA 1WLZA 4CFQA 1XK4C 2WC8A 4OVNF 2JRFA 5I8NA 3FS7A 1DC1A 1LVCD 1TRFA 1A29A 5FYXA 3IF7A 3SS5A 2FJUB 1CFFA 1IJ5A 2H2KA 2H61C 1G4YR 2KAXA 1IJ6A 1P28A 1SYMA 1UHKA 3M0WA 1XVJA 2KOTA 2FJYA 5CPVA 1JBAA 1KCYA 4MBEA 3N7HA 3NHTA 3TUYB 1PSRA 1M31A 3C1VA 4A4CA 3LK1A 1BR4B 1SKTA 2K0JA 4MZKA 3D0YB 4JD9A 1XFZO 2JC2A 3D77A 3DVMA 1S36A 4M2PA 1DGUA 2MLFC 4XJKA 3VROA 2L4IA 1ALWA 1FPWA 1EXRA 5HKWA 1UHNA 2F2OA 2BCAA 3DXLA 3K21A 3EK4A 1L7ZA 1PVBA 2WCEA 1CDMA 3BXKA 3L4LA 3KO0A 2CNPA 3QRXA 1ORGA 2M1KB 3VRPA 3I5GC 5HLVA 2R2IA 1PALA 2GV5A 1CLBA 3SJSA 1UUSA 2KI4C 1DF0B 1SR6C 2JNXA 3B88A 2WCBA 2BCXA 3JVTC 1V1FA 1OOGA 5ER5A 1SNLA 5I94A 2KYCA 1JF0A 4GGFA 3SIAA 2BL0B 1XFUO 4YGEB 3S0EA 3GOFA 3UNWA 3VRQA 1TIZA 2L50A 4IL1A 2GGMA 1UHIA 3CABA 3O2PA 1BR1B 4N5XA 1FF1A 1K2HA 2LNKA 1JUOA 4NDCA 1GGZA 1TCFA 2TN4A 3TDUA 3NSLA 1T14A 1NCYA 3GK4X 1JFJA 1Y1UA 3DYEA 1DTLA 1EL4A 4NQGA 3S0FA 5D7FA 3LLEA 1NUBA 3OBVA 3SIBA 3ICBA 1LA3A 4WRIA 2OS8B 1EG4A 1RFJA 2LM5A 5G08A 1F70A 3B86A 3PFVA 5PALA 2RGIA 2KYFA 2JULA 3CWGA 2LAPA 1SPYA 2ZFDA 3SG7A 1UHHA 3EKHA 1NPQA 1W7IB 1SL7A 3CR2A 2WNDA 2PRUA 1N65A 2ZNDA 1DEKA 1FBVA 3D74A 2HF5A 2KGRA 4YI8A 1JSAA 2D8NA 3K1EA 1TCOB 2CXJA 1ZUZA 3BFBA 4JQ0D 1A4PA 2NZ0A 3B87A 2KPHA 1YVLA 3JTDB 4ORCB 5ER4X 5J3XA 3PSRA 1CB1A 1DELA 5JOLA 2OTGB 1A2XA 2KFGA 2JWWA 3A4UB 3OGNA 1SSEB 2MA2A 3D0YA 3CR4X 4MZLA 2WOSA 1CMFA 2COLB 4YBHB 1S26D 1JC2A 1OOHA 4WQ2A 1FI5A 2BNXA 4Q04A 3FWCA 2PASA 3O4XA 5EL2A 1MF8B 1F4QA 1CFPA 4DCKA 3KF9A 1DJYA 5TNCA 1MWNA 2LLUA 2Q91A 3IVTA 4GGNA 1NWDA 1FI6A 1KFUS 2O5GA 1MXEA 1Y1XA 4GAOA 2KQYA 3WXAA 2BKIB 3OHMB 4PE4A 1S6JA 3BOWB 3BQ3A 3BUOB 2H8VA 4N1FA 1QWVA 2M7LA 2L2EA 1ZFSA 1YRTB 3WHUB 3OX5A 5HKZA 4MN0A 1KQVA 3SG5A 1RECA 1Z4HA 4PHJA 2CT9A 4PT1A 5CSFA 2YGUA 3AKAA 1CM1A 2K61A 4YI9A 3SS3A 3O78A 5HKYA 2H61A 1OQPA 2ZRTA 4PHNA 4DUQA 4QJ3B 1QX5B 3FWBA 1KK8C 1XFVO 1F71A 1SBJA 1YRUB 3FE6A 3SS4A 2WCLA 1B8LA 1RROA 1ZMZA 1WY9A 3CS1A 3FIAA 2P71A 4PALA 3R1OA 3I5HC 1YR5A 3BJHA 1AJ4A 1M39A 1TOPA 2KI4B 1LA0A 1QIWA 4YRUA 2BCBA 2LP2A 4M2QA 1SW8A 1BF5A 3JVTB 2LCPA 2KAYA 4CIDA 1ZACA 4UPGA 5DKQA 1BOCA 2LHLA 2ZN8A 2LVIA 1KFXS 5FI2A 5AERA 1CDPA 5CSIA 4PE7A 1AK8A 3CZTX 1NX1A 1SRAA 3PATA 1IGVA 1X02A 4I5NB 1F55A 1IIOA 2KAVA 2FCDA 1WDCC 2ERBA 1LS8A 1BJFA 3NGVA 4YGDB 3BUXB 1QXPA 1KK8B 1XA5A 2L5XB 4CLNA 4GGFC 2VRGA 1B1GA 1XFRA 2M3WA 1IRJA 2CTNA 1K9UA 2KBMA 1Q80A 3TZ1A 3I5HB 3EK7A 3OP0A 1YUSA 3O6BA 1KFUL 1C7VA 1K9KA 5JJGA 2ISDA 2JT3A 2KLDA 1QIVA 2LUXA 1MXLC 3KEVA 5B8IB 3TS5B 3FE9A 1F8HA 1AJ5A 4E68A 1NCZA 1SL8A 2BE6A 2OPOA 1V1GA 1DJGA 1XFYO 2JU0A 3TDIA 3VGOA 1OOIX 3VRNA 3L4AA 1WRLA 3SG3A 1J7PA 2K7DA 2NLNA 2NCOA 2LVJA 1K96A 4DS7A 3UO9A 3GK1A 2KBIA 1DGVA 1YURA 2WCJA 4HRGA 5K89A 3D75A 4YGCB 5HYDA 3ZWHA 2BKHB 2WORA 2IS9A 1BMOA 3ZNIA 2LANA
chains in the Genus database with same CATH topology
3RM1A 1CDLA 1XO5A 4OKHA 2K2FA 1DF0A 1WLMA 3BUMB 3BUWB 1XYDA 1B7TY 1QJTA 1GQMA 3JTDC 2JNFA 2PMYA 1XFXO 1ODBA 2O60A 1DVIA 2G2BA 1H4BA 1CKKA 1KWOC 2LVVA 3AKBA 1F4OA 3DD4A 2JPTA 2K7CA 2JT8A 2MRDA 3RLZA 2HQ8A 2PSRA 3DVEA 5KTYA 1YUUA 4GNKB 4YGAA 2KI6C 2PALA 2CBLA 2KSPA 2QACA 4USLA 3D10A 1CLMA 4HREE 2EC6B 1JFKA 2ZNEA 4DRWA 2K8MB 1JFJA 1PVAA 5AFPA 3I5FC 2QPTA 1QASA 2ZRSA 1EH2A 4GFTA 1CTRA 2I18A 1CDNA 3WNXB 4WQ3A 1XFWO 1IG5A 3CTNA 3E3RA 1ZOTB 1OZOA 1SCVA 2KFHA 2L0PA 3CLNA 4I5JA 4PE0A 4MLWA 4CFRA 3PN7B 1QV0A 3AAKA 1J7QA 1D1OA 4OCIA 2M49B 4PHKA 1KQMC 1B8RA 1NSHA 1KK7Y 2LV7A 2AAOA 2MLEC 4XYNA 1XK4A 1OMDA 2BECA 3DVKA 4F0ZB 1NCXA 3AAJA 3SG6A 1NIWA 1KWOB 2L98A 1QLKA 4C0KA 1BU3A 4ZCUA 3CGAA 1C07A 1BODA 1K93D 1QLSA 2M29A 3F45A 2JQ6A 1KQMB 3LK0A 3KPXA 1UURA 1R6PA 2EGDA 4MVFA 3EK8A 4MZJA 2M8UA 1OE9B 1DJHA 2AMIA 2LC5A 3IQQA 1B7TZ 1WDCB 2FOTA 2KGBC 1AP4A 3MSEB 1TNXA 1EJ3A 2DOQA 1L2OB 5AXIA 2Y4QA 2MBXA 1A03A 1CFCA 2LMUA 3DF0A 1VRKA 1TNQA 1MR8A 2LMVA 3A8RA 2Y1NA 1K95A 5AEQA 1J55A 2M0RA 5D69A 1CLLA 1NX3A 4GBAA 4CPVA 1NP8A 3I5GB 1Y0VH 4ZCVA 3LCPC 4YGBB 3LL8B 4ORAB 4ICBA 2KNEA 1UWOA 2LVKA 1N2DA 2JTTA 1CFDA 2LLTA 1B8CA 1OMVA 2JZIA 3NSOA 1K9PA 3DF0B 2KFFA 1YVHA 4ORBB 5AANA 1A75B 4L9MA 2P6BB 1J7OA 4P2YB 4MEWA 1CM4A 3HX4A 4D1EA 2K7BA 1MHOA 1IWQA 3I5IB 1IQ3A 1JF2A 4BY4A 2PVBA 3EVVA 3PLFB 1HT9A 2KI6D 2M1UA 4HSZA 4AQJA 1QX7A 1DMOA 2GGZA 2AUCA 1U5IA 1PULA 1S3PA 2BL0C 3NXAA 3EVRA 4U8DA 4DIRA 1PK0D 1TN4A 1K90D 1JWDA 1C7WA 4I5KA 1AHRA 3HCMA 2JTZA 4XJKB 5KSZA 1S1EA 4M2OA 4QJ4B 3PM8A 5KU1A 1GGWA 1TNWA 1YUTA 4AOMA 3TDZA 4C0JA 1B4CA 3EVUA 2EHBA 1KK7Z 1M63B 2NCPA 2NXQA 5BPJA 2E30A 2HQWA 2OTGC 1NYAA 2HPSA 4AQIA 1RJVA 1J1EA 5DKRA 4PDZA 2F2PA 1EG3A 4HRHA 5I2QA 1M46A 1UHJA 3PN7C 2CCMA 1U5IB 4FTGA 2KDHA 4GUKA 1TTXA 1KSOA 1M45A 3BOWA 1SK6D 2M97A 1N0YA 1LXFC 1FW4A 1S6IA 3NSIA 1NX0A 3VRRA 2JXCA 2FCEA 2I94A 3PALA 1QATA 2MJWB 4MRXA 4PCWA 1B47A 2LP3A 1BLQA 3TUYC 2F3ZA 1CMGA 4BY5A 1S5GY 1A75A 3DVJA 4PE1A 1OMRA 3GK2A 1SY9A 2ZKMX 1RWYA 2LHIA 3H4SE 4OR9B 2M7NA 1RTP1 1GJYA 5CSJA 1QTXA 2LE9B 3NSKA 4JPZB 1RK9A 2A4JA 1CNPA 4NDBA 1OSAA 2I2RE 1S5GZ 1LKJA 4JWQA 2L51A 5F6TA 1PRWA 1SR6B 3SG4A 1PSBA 2V53A 4PHMA 1YX7A 1QV1A 1L2OC 2SASA 3TS5C 4GPLB 2B1UA 2OS8C 1UP5A 2BBMA 2ZN9A 1MQ1A 5HLOA 2F33A 1K94A 3O4YA 2K2AA 1IKUA 1DJWA 1J7RA 2JXLA 2G9BA 4QJ5B 1QVIZ 2M9GA 2L4HA 4FQOA 3I5IC 1SL9A 1B9AA 1OOJA 3OX6A 1DJXA 2JT0A 1OZSA 2BBNA 2LLSA 1DT7B 4TNCA 1DJZA 1AVSA 3BUNB 1HQVA 2EC6C 3BYAA 1W7JB 2SCPA 2KHNA 1BT6A 2BE4A 4C0LA 4OV2A 1KSMA 2KQ6A 1SMGA 1MUXA 5GQQC 5I2LA 2HETA 1NX2A 1YTZC 1H8BA 1G33A 1K8UA 3KHEA 1WRKA 1WRZA 1G8IA 2WCFA 1SCMB 1AUIB 1ALVA 1BG1A 2F8PA 1J1DA 2E6WA 5I2OA 2LMTA 4A4BA 1IH0A 1LINA 2I7AA 1TNPA 3EKJA 3WHTB 4N1GA 2MAZA 4I5LB 5IBWA 3I5FB 2Y5IA 3OB2B 1QVIY 2F3YA 2JOJA 4R1EA 5DKNA 2MHHA 4NDDA 1F54A 1SCMC 1YX8A 4P5OE 3CR5X 5CSNA 1Y6WA 2K7OA 2Y1MA 1DJIA 3OB1B 1KFXL 1QX2A 1QS7A 2Q4UA 1S6CA 1Y1AA 3SG2A 4MRYA 1IQ5A 4MSPA 1E8AA 1R2UA 2LUCA 3IQOA 4ETOA 1WLZA 4CFQA 1XK4C 2WC8A 4OVNF 2JRFA 5I8NA 3FS7A 1LVCD 1TRFA 1A29A 5FYXA 3IF7A 2FJUB 1CFFA 1IJ5A 2H2KA 2H61C 1G4YR 2KAXA 1IJ6A 1SYMA 1UHKA 3M0WA 1XVJA 2KOTA 5CPVA 1JBAA 1KCYA 4MBEA 3TUYB 1PSRA 1M31A 3C1VA 4A4CA 3LK1A 1BR4B 1SKTA 2K0JA 4MZKA 3D0YB 1XFZO 2JC2A 3DVMA 4M2PA 1S36A 4XJKA 1DGUA 2MLFC 3VROA 1FPWA 2L4IA 1ALWA 1EXRA 5HKWA 1UHNA 2F2OA 2BCAA 3K21A 3EK4A 1L7ZA 1PVBA 2WCEA 1CDMA 3BXKA 3QRXA 3KO0A 2CNPA 2M1KB 3VRPA 3I5GC 5HLVA 2R2IA 1PALA 2GV5A 1CLBA 3SJSA 1UUSA 2KI4C 1DF0B 1SR6C 2JNXA 2WCBA 2BCXA 3JVTC 1V1FA 5ER5A 1SNLA 2KYCA 1JF0A 4GGFA 3SIAA 2BL0B 1XFUO 4YGEB 3GOFA 3VRQA 1TIZA 2L50A 4IL1A 2GGMA 1UHIA 3O2PA 4N5XA 1BR1B 1K2HA 1FF1A 2LNKA 1JUOA 4NDCA 1GGZA 1TCFA 2TN4A 3TDUA 3NSLA 1NCYA 3GK4X 1Y1UA 1DTLA 1EL4A 4NQGA 5D7FA 3LLEA 1NUBA 3SIBA 3ICBA 1LA3A 4WRIA 2OS8B 1EG4A 1RFJA 2LM5A 5G08A 1F70A 3PFVA 5PALA 2RGIA 2KYFA 2JULA 3CWGA 2LAPA 1SPYA 2ZFDA 3SG7A 1UHHA 3EKHA 1NPQA 1W7IB 1SL7A 3CR2A 2WNDA 2PRUA 1N65A 2ZNDA 1FBVA 2HF5A 2KGRA 4YI8A 1JSAA 2D8NA 1TCOB 2CXJA 1ZUZA 4JQ0D 1A4PA 2NZ0A 3JTDB 4ORCB 1YVLA 5ER4X 5J3XA 3PSRA 1CB1A 5JOLA 2OTGB 1A2XA 2KFGA 2JWWA 3A4UB 2MA2A 3D0YA 3CR4X 4MZLA 2WOSA 1CMFA 2COLB 4YBHB 1S26D 1JC2A 4WQ2A 1FI5A 4Q04A 3FWCA 2PASA 1MF8B 1F4QA 1CFPA 4DCKA 3KF9A 1DJYA 5TNCA 1MWNA 2LLUA 2Q91A 1FI6A 4GGNA 1NWDA 1KFUS 2O5GA 1MXEA 1Y1XA 4GAOA 2KQYA 3WXAA 2BKIB 3OHMB 4PE4A 1S6JA 3BOWB 3BQ3A 3BUOB 4N1FA 2M7LA 2L2EA 1ZFSA 1YRTB 3WHUB 3OX5A 5HKZA 4MN0A 1KQVA 3SG5A 1RECA 4PHJA 2CT9A 5CSFA 3AKAA 1CM1A 2K61A 4YI9A 5HKYA 3O78A 2H61A 1OQPA 2ZRTA 4PHNA 4DUQA 4QJ3B 1QX5B 3FWBA 1KK8C 1XFVO 1F71A 1SBJA 1YRUB 1B8LA 1RROA 1ZMZA 1WY9A 3CS1A 3FIAA 4PALA 3I5HC 1YR5A 1AJ4A 1M39A 1TOPA 2KI4B 1LA0A 1QIWA 4YRUA 2BCBA 2LP2A 4M2QA 1SW8A 1BF5A 3JVTB 2LCPA 2KAYA 4CIDA 1ZACA 4UPGA 5DKQA 1BOCA 2LHLA 2ZN8A 2LVIA 1KFXS 5AERA 1CDPA 5CSIA 4PE7A 1AK8A 3CZTX 1NX1A 1SRAA 3PATA 1IGVA 1X02A 4I5NB 1F55A 2KAVA 2FCDA 1WDCC 1BJFA 4YGDB 3BUXB 1QXPA 1KK8B 1XA5A 2L5XB 4CLNA 4GGFC 2VRGA 1B1GA 2M3WA 1IRJA 2CTNA 1K9UA 2KBMA 1Q80A 3TZ1A 3I5HB 3EK7A 3OP0A 1YUSA 3O6BA 1KFUL 1C7VA 1K9KA 5JJGA 2ISDA 2JT3A 1QIVA 2LUXA 1MXLC 3KEVA 5B8IB 3TS5B 1F8HA 1AJ5A 4E68A 1NCZA 1SL8A 2BE6A 2OPOA 1V1GA 1DJGA 1XFYO 2JU0A 3TDIA 3VGOA 3VRNA 1WRLA 3SG3A 1J7PA 2K7DA 2NLNA 2NCOA 2LVJA 1K96A 4DS7A 3GK1A 2KBIA 1DGVA 1YURA 4HRGA 5K89A 4YGCB 5HYDA 3ZWHA 2BKHB 2WORA 2IS9A 1BMOA 3ZNIA 2LANA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RM1 A;  1CDL A;  1XO5 A;  4OKH A;  2K2F A;  1DF0 A;  1WLM A;  3BUM B;  3BUW B;  1XYD A;  1B7T Y;  1QJT A;  1GQM A;  3JTD C;  2JNF A;  2PMY A;  1XFX O;  1ODB A;  2O60 A;  1DVI A;  2G2B A;  1H4B A;  1CKK A;  1KWO C;  2LVV A;  3AKB A;  1F4O A;  3DD4 A;  2JPT A;  2K7C A;  2JT8 A;  2MRD A;  3RLZ A;  2HQ8 A;  2PSR A;  3DVE A;  5KTY A;  1YUU A;  4GNK B;  4YGA A;  2KI6 C;  2PAL A;  2CBL A;  2KSP A;  2QAC A;  4USL A;  3D10 A;  1CLM A;  4HRE E;  2EC6 B;  1JFK A;  2ZNE A;  4DRW A;  2K8M B;  1JFJ A;  1PVA A;  5AFP A;  3I5F C;  2QPT A;  1QAS A;  2ZRS A;  1EH2 A;  4GFT A;  1CTR A;  2I18 A;  1CDN A;  3WNX B;  4WQ3 A;  1XFW O;  1IG5 A;  3CTN A;  3E3R A;  1ZOT B;  1OZO A;  1SCV A;  2KFH A;  2L0P A;  3CLN A;  4I5J A;  4PE0 A;  4MLW A;  4CFR A;  3PN7 B;  1QV0 A;  3AAK A;  1J7Q A;  1D1O A;  4OCI A;  2M49 B;  4PHK A;  1KQM C;  1B8R A;  1NSH A;  1KK7 Y;  2LV7 A;  2AAO A;  2MLE C;  4XYN A;  1XK4 A;  1OMD A;  2BEC A;  3DVK A;  4F0Z B;  1NCX A;  3AAJ A;  3SG6 A;  1NIW A;  1KWO B;  2L98 A;  1QLK A;  4C0K A;  1BU3 A;  4ZCU A;  3CGA A;  1C07 A;  1BOD A;  1K93 D;  1QLS A;  2M29 A;  3F45 A;  2JQ6 A;  1KQM B;  3LK0 A;  3KPX A;  1UUR A;  1R6P A;  2EGD A;  4MVF A;  3EK8 A;  4MZJ A;  2M8U A;  1OE9 B;  1DJH A;  2AMI A;  2LC5 A;  3IQQ A;  1B7T Z;  1WDC B;  2FOT A;  2KGB C;  1AP4 A;  3MSE B;  1TNX A;  1EJ3 A;  2DOQ A;  1L2O B;  5AXI A;  2Y4Q A;  2MBX A;  1A03 A;  1CFC A;  2LMU A;  3DF0 A;  1VRK A;  1TNQ A;  1MR8 A;  2LMV A;  3A8R A;  2Y1N A;  1K95 A;  5AEQ A;  1J55 A;  2M0R A;  5D69 A;  1CLL A;  1NX3 A;  4GBA A;  4CPV A;  1NP8 A;  3I5G B;  1Y0V H;  4ZCV A;  3LCP C;  4YGB B;  3LL8 B;  4ORA B;  4ICB A;  2KNE A;  1UWO A;  2LVK A;  1N2D A;  2JTT A;  1CFD A;  2LLT A;  1B8C A;  1OMV A;  2JZI A;  3NSO A;  1K9P A;  3DF0 B;  2KFF A;  1YVH A;  4ORB B;  5AAN A;  1A75 B;  4L9M A;  2P6B B;  1J7O A;  4P2Y B;  4MEW A;  1CM4 A;  3HX4 A;  4D1E A;  2K7B A;  1MHO A;  1IWQ A;  3I5I B;  1IQ3 A;  1JF2 A;  4BY4 A;  2PVB A;  3EVV A;  3PLF B;  1HT9 A;  2KI6 D;  2M1U A;  4HSZ A;  4AQJ A;  1QX7 A;  1DMO A;  2GGZ A;  2AUC A;  1U5I A;  1PUL A;  1S3P A;  2BL0 C;  3NXA A;  3EVR A;  4U8D A;  4DIR A;  1PK0 D;  1TN4 A;  1K90 D;  1JWD A;  1C7W A;  4I5K A;  1AHR A;  3HCM A;  2JTZ A;  4XJK B;  5KSZ A;  1S1E A;  4M2O A;  4QJ4 B;  3PM8 A;  5KU1 A;  1GGW A;  1TNW A;  1YUT A;  4AOM A;  3TDZ A;  4C0J A;  1B4C A;  3EVU A;  2EHB A;  1KK7 Z;  1M63 B;  2NCP A;  2NXQ A;  5BPJ A;  2E30 A;  2HQW A;  2OTG C;  1NYA A;  2HPS A;  4AQI A;  1RJV A;  1J1E A;  5DKR A;  4PDZ A;  2F2P A;  1EG3 A;  4HRH A;  5I2Q A;  1M46 A;  1UHJ A;  3PN7 C;  2CCM A;  1U5I B;  4FTG A;  2KDH A;  4GUK A;  1TTX A;  1KSO A;  1M45 A;  3BOW A;  1SK6 D;  2M97 A;  1N0Y A;  1LXF C;  1FW4 A;  1S6I A;  3NSI A;  1NX0 A;  3VRR A;  2JXC A;  2FCE A;  2I94 A;  3PAL A;  1QAT A;  2MJW B;  4MRX A;  4PCW A;  1B47 A;  2LP3 A;  1BLQ A;  3TUY C;  2F3Z A;  1CMG A;  4BY5 A;  1S5G Y;  1A75 A;  3DVJ A;  4PE1 A;  1OMR A;  3GK2 A;  1SY9 A;  2ZKM X;  1RWY A;  2LHI A;  3H4S E;  4OR9 B;  2M7N A;  1RTP 1;  1GJY A;  5CSJ A;  1QTX A;  2LE9 B;  3NSK A;  4JPZ B;  1RK9 A;  2A4J A;  1CNP A;  4NDB A;  1OSA A;  2I2R E;  1S5G Z;  1LKJ A;  4JWQ A;  2L51 A;  5F6T A;  1PRW A;  1SR6 B;  3SG4 A;  1PSB A;  2V53 A;  4PHM A;  1YX7 A;  1QV1 A;  1L2O C;  2SAS A;  3TS5 C;  4GPL B;  2B1U A;  2OS8 C;  1UP5 A;  2BBM A;  2ZN9 A;  1MQ1 A;  5HLO A;  2F33 A;  1K94 A;  3O4Y A;  2K2A A;  1IKU A;  1DJW A;  1J7R A;  2JXL A;  2G9B A;  4QJ5 B;  1QVI Z;  2M9G A;  2L4H A;  4FQO A;  3I5I C;  1SL9 A;  1B9A A;  1OOJ A;  3OX6 A;  1DJX A;  2JT0 A;  1OZS A;  2BBN A;  2LLS A;  1DT7 B;  4TNC A;  1DJZ A;  1AVS A;  3BUN B;  1HQV A;  2EC6 C;  3BYA A;  1W7J B;  2SCP A;  2KHN A;  1BT6 A;  2BE4 A;  4C0L A;  4OV2 A;  1KSM A;  2KQ6 A;  1SMG A;  1MUX A;  5GQQ C;  5I2L A;  2HET A;  1NX2 A;  1YTZ C;  1H8B A;  1G33 A;  1K8U A;  3KHE A;  1WRK A;  1WRZ A;  1G8I A;  2WCF A;  1SCM B;  1AUI B;  1ALV A;  1BG1 A;  2F8P A;  1J1D A;  2E6W A;  5I2O A;  2LMT A;  4A4B A;  1IH0 A;  1LIN A;  2I7A A;  1TNP A;  3EKJ A;  3WHT B;  4N1G A;  2MAZ A;  4I5L B;  5IBW A;  3I5F B;  2Y5I A;  3OB2 B;  1QVI Y;  2F3Y A;  2JOJ A;  4R1E A;  5DKN A;  2MHH A;  4NDD A;  1F54 A;  1SCM C;  1YX8 A;  4P5O E;  3CR5 X;  5CSN A;  1Y6W A;  2K7O A;  2Y1M A;  1DJI A;  3OB1 B;  1KFX L;  1QX2 A;  1QS7 A;  2Q4U A;  1S6C A;  1Y1A A;  3SG2 A;  4MRY A;  1IQ5 A;  4MSP A;  1E8A A;  1R2U A;  2LUC A;  3IQO A;  4ETO A;  1WLZ A;  4CFQ A;  1XK4 C;  2WC8 A;  4OVN F;  2JRF A;  5I8N A;  3FS7 A;  1LVC D;  1TRF A;  1A29 A;  5FYX A;  3IF7 A;  2FJU B;  1CFF A;  1IJ5 A;  2H2K A;  2H61 C;  1G4Y R;  2KAX A;  1IJ6 A;  1SYM A;  1UHK A;  3M0W A;  1XVJ A;  2KOT A;  5CPV A;  1JBA A;  1KCY A;  4MBE A;  3TUY B;  1PSR A;  1M31 A;  3C1V A;  4A4C A;  3LK1 A;  1BR4 B;  1SKT A;  2K0J A;  4MZK A;  3D0Y B;  1XFZ O;  2JC2 A;  3DVM A;  4M2P A;  1S36 A;  4XJK A;  1DGU A;  2MLF C;  3VRO A;  1FPW A;  2L4I A;  1ALW A;  1EXR A;  5HKW A;  1UHN A;  2F2O A;  2BCA A;  3K21 A;  3EK4 A;  1L7Z A;  1PVB A;  2WCE A;  1CDM A;  3BXK A;  3QRX A;  3KO0 A;  2CNP A;  2M1K B;  3VRP A;  3I5G C;  5HLV A;  2R2I A;  1PAL A;  2GV5 A;  1CLB A;  3SJS A;  1UUS A;  2KI4 C;  1DF0 B;  1SR6 C;  2JNX A;  2WCB A;  2BCX A;  3JVT C;  1V1F A;  5ER5 A;  1SNL A;  2KYC A;  1JF0 A;  4GGF A;  3SIA A;  2BL0 B;  1XFU O;  4YGE B;  3GOF A;  3VRQ A;  1TIZ A;  2L50 A;  4IL1 A;  2GGM A;  1UHI A;  3O2P A;  4N5X A;  1BR1 B;  1K2H A;  1FF1 A;  2LNK A;  1JUO A;  4NDC A;  1GGZ A;  1TCF A;  2TN4 A;  3TDU A;  3NSL A;  1NCY A;  3GK4 X;  1Y1U A;  1DTL A;  1EL4 A;  4NQG A;  5D7F A;  3LLE A;  1NUB A;  3SIB A;  3ICB A;  1LA3 A;  4WRI A;  2OS8 B;  1EG4 A;  1RFJ A;  2LM5 A;  5G08 A;  1F70 A;  3PFV A;  5PAL A;  2RGI A;  2KYF A;  2JUL A;  3CWG A;  2LAP A;  1SPY A;  2ZFD A;  3SG7 A;  1UHH A;  3EKH A;  1NPQ A;  1W7I B;  1SL7 A;  3CR2 A;  2WND A;  2PRU A;  1N65 A;  2ZND A;  1FBV A;  2HF5 A;  2KGR A;  4YI8 A;  1JSA A;  2D8N A;  1TCO B;  2CXJ A;  1ZUZ A;  4JQ0 D;  1A4P A;  2NZ0 A;  3JTD B;  4ORC B;  1YVL A;  5ER4 X;  5J3X A;  3PSR A;  1CB1 A;  5JOL A;  2OTG B;  1A2X A;  2KFG A;  2JWW A;  3A4U B;  2MA2 A;  3D0Y A;  3CR4 X;  4MZL A;  2WOS A;  1CMF A;  2COL B;  4YBH B;  1S26 D;  1JC2 A;  4WQ2 A;  1FI5 A;  4Q04 A;  3FWC A;  2PAS A;  1MF8 B;  1F4Q A;  1CFP A;  4DCK A;  3KF9 A;  1DJY A;  5TNC A;  1MWN A;  2LLU A;  2Q91 A;  1FI6 A;  4GGN A;  1NWD A;  1KFU S;  2O5G A;  1MXE A;  1Y1X A;  4GAO A;  2KQY A;  3WXA A;  2BKI B;  3OHM B;  4PE4 A;  1S6J A;  3BOW B;  3BQ3 A;  3BUO B;  4N1F A;  2M7L A;  2L2E A;  1ZFS A;  1YRT B;  3WHU B;  3OX5 A;  5HKZ A;  4MN0 A;  1KQV A;  3SG5 A;  1REC A;  4PHJ A;  2CT9 A;  5CSF A;  3AKA A;  1CM1 A;  2K61 A;  4YI9 A;  5HKY A;  3O78 A;  2H61 A;  1OQP A;  2ZRT A;  4PHN A;  4DUQ A;  4QJ3 B;  1QX5 B;  3FWB A;  1KK8 C;  1XFV O;  1F71 A;  1SBJ A;  1YRU B;  1B8L A;  1RRO A;  1ZMZ A;  1WY9 A;  3CS1 A;  3FIA A;  4PAL A;  3I5H C;  1YR5 A;  1AJ4 A;  1M39 A;  1TOP A;  2KI4 B;  1LA0 A;  1QIW A;  4YRU A;  2BCB A;  2LP2 A;  4M2Q A;  1SW8 A;  1BF5 A;  3JVT B;  2LCP A;  2KAY A;  4CID A;  1ZAC A;  4UPG A;  5DKQ A;  1BOC A;  2LHL A;  2ZN8 A;  2LVI A;  1KFX S;  5AER A;  1CDP A;  5CSI A;  4PE7 A;  1AK8 A;  3CZT X;  1NX1 A;  1SRA A;  3PAT A;  1IGV A;  1X02 A;  4I5N B;  1F55 A;  2KAV A;  2FCD A;  1WDC C;  1BJF A;  4YGD B;  3BUX B;  1QXP A;  1KK8 B;  1XA5 A;  2L5X B;  4CLN A;  4GGF C;  2VRG A;  1B1G A;  2M3W A;  1IRJ A;  2CTN A;  1K9U A;  2KBM A;  1Q80 A;  3TZ1 A;  3I5H B;  3EK7 A;  3OP0 A;  1YUS A;  3O6B A;  1KFU L;  1C7V A;  1K9K A;  5JJG A;  2ISD A;  2JT3 A;  1QIV A;  2LUX A;  1MXL C;  3KEV A;  5B8I B;  3TS5 B;  1F8H A;  1AJ5 A;  4E68 A;  1NCZ A;  1SL8 A;  2BE6 A;  2OPO A;  1V1G A;  1DJG A;  1XFY O;  2JU0 A;  3TDI A;  3VGO A;  3VRN A;  1WRL A;  3SG3 A;  1J7P A;  2K7D A;  2NLN A;  2NCO A;  2LVJ A;  1K96 A;  4DS7 A;  3GK1 A;  2KBI A;  1DGV A;  1YUR A;  4HRG A;  5K89 A;  4YGC B;  5HYD A;  3ZWH A;  2BKH B;  2WOR A;  2IS9 A;  1BMO A;  3ZNI A;  2LAN A; 
#chains in the Genus database with same CATH topology
 3RM1 A;  1CDL A;  1XO5 A;  4OKH A;  2K2F A;  1DF0 A;  1WLM A;  3BUM B;  3BUW B;  3RZS A;  1XYD A;  1B7T Y;  1QJT A;  1GQM A;  3JTD C;  2JNF A;  1GM0 A;  2PMY A;  2PQL A;  1XFX O;  1TUJ A;  1ODB A;  2O60 A;  1DVI A;  2G2B A;  1H4B A;  1CKK A;  1KWO C;  2LVV A;  3AKB A;  1F4O A;  3DD4 A;  2JPT A;  2K7C A;  2JT8 A;  5DIC A;  2QEB A;  2MRD A;  3RLZ A;  2HQ8 A;  2PSR A;  3DVE A;  5KTY A;  1YUU A;  4GNK B;  4YGA A;  2KI6 C;  2PAL A;  1TWO A;  2CBL A;  2KSP A;  3D73 A;  2QAC A;  2WCH A;  4USL A;  3BFA A;  1CLM A;  3D10 A;  2EC6 B;  1JFK A;  2ZNE A;  4HRE E;  2K8M B;  5FI6 A;  3S0G A;  4DRW A;  1PVA A;  3PJI A;  5AFP A;  3I5F C;  2QPT A;  1QAS A;  2ZRS A;  1EH2 A;  4GFT A;  1CTR A;  2I18 A;  1CDN A;  3WNX B;  4WQ3 A;  1OOF A;  1IG5 A;  1XFW O;  2WCM A;  3CTN A;  3E3R A;  1ZOT B;  3DY9 A;  3S0B A;  1OZO A;  1SCV A;  2KFH A;  2L0P A;  1C3Z A;  3CLN A;  4I5J A;  4PE0 A;  3NHI A;  4MLW A;  4CFR A;  3PN7 B;  1QV0 A;  3AAK A;  1J7Q A;  1D1O A;  4OCI A;  2M49 B;  4PHK A;  1KQM C;  1B8R A;  1NSH A;  1KK7 Y;  2LV7 A;  2AAO A;  2MLE C;  3CZ1 A;  3Q8I A;  1XK4 A;  4XYN A;  1OMD A;  2BEC A;  3DVK A;  3PM2 A;  4F0Z B;  1NCX A;  3AAJ A;  2GTE A;  1Z2C B;  3SG6 A;  1NIW A;  1KWO B;  2L98 A;  1QLK A;  4C0K A;  1BU3 A;  4ZCU A;  3CGA A;  1C07 A;  1BOD A;  1C3Y A;  1K93 D;  2WC6 A;  1QLS A;  2M29 A;  3F45 A;  2JQ6 A;  1KQM B;  3LK0 A;  3KPX A;  1UUR A;  1R6P A;  2EGD A;  3R1V A;  3EK8 A;  4MZJ A;  2M8U A;  4MVF A;  1OE9 B;  1DJH A;  2AMI A;  2KLE A;  2LC5 A;  2PYQ A;  3IQQ A;  1B7T Z;  1WDC B;  2FOT A;  2KGB C;  1AP4 A;  3MSE B;  1TNX A;  1EJ3 A;  2DOQ A;  1L2O B;  2WCK A;  2Y4Q A;  5AXI A;  2MBX A;  1A03 A;  1CFC A;  2LMU A;  3DF0 A;  1VRK A;  3DZT A;  1TNQ A;  1MR8 A;  2LMV A;  3A8R A;  2Y1N A;  1K95 A;  5AEQ A;  1J55 A;  2M0R A;  5D69 A;  1CLL A;  1NX3 A;  4GBA A;  4CPV A;  1NP8 A;  3I5G B;  1Y0V H;  4ZCV A;  3LCP C;  4YGB B;  2BAP A;  3LL8 B;  4ORA B;  4ICB A;  2KNE A;  1UWO A;  4OZD A;  2LVK A;  1N2D A;  2JTT A;  1CFD A;  2LLT A;  1B8C A;  1OMV A;  2JZI A;  3NSO A;  1K9P A;  3DF0 B;  3V2L A;  2KFF A;  1YVH A;  4ORB B;  5AAN A;  1A75 B;  4L9M A;  2P6B B;  1J7O A;  4P2Y B;  4INW A;  4MEW A;  1CM4 A;  2L5Y A;  3HX4 A;  5FI7 A;  2K7B A;  4D1E A;  1MHO A;  1IWQ A;  3I5I B;  1IQ3 A;  1JF2 A;  4BY4 A;  2PVB A;  3EVV A;  3PLF B;  1HT9 A;  2KI6 D;  2M1U A;  4HSZ A;  3L47 A;  4AQJ A;  1QX7 A;  1DMO A;  2GGZ A;  2AUC A;  1U5I A;  1PUL A;  1S3P A;  2BL0 C;  2JPO A;  2L2C A;  3EVR A;  3NXA A;  4U8D A;  4DIR A;  3CZ2 A;  1PK0 D;  1TN4 A;  1K90 D;  1JWD A;  1C7W A;  4I5K A;  1AHR A;  3HCM A;  3CYZ A;  2JTZ A;  4XJK B;  5KSZ A;  1S1E A;  4M2O A;  4QJ4 B;  3PM8 A;  5KU1 A;  3S0A A;  1GGW A;  1TNW A;  1YUT A;  4AOM A;  3TDZ A;  4C0J A;  1B4C A;  3EVU A;  2EHB A;  1KK7 Z;  1M63 B;  2NCP A;  2NXQ A;  5BPJ A;  2E30 A;  2HQW A;  2OTG C;  1NYA A;  2HPS A;  4AQI A;  1RJV A;  1J1E A;  5DKR A;  4PDZ A;  1TUZ A;  2F2P A;  1EG3 A;  4HRH A;  5I2Q A;  1M46 A;  1UHJ A;  3PN7 C;  2CCM A;  1U5I B;  4FTG A;  2KDH A;  4GUK A;  1TTX A;  4F7F A;  5D3O A;  1KSO A;  1M45 A;  3BOW A;  1SK6 D;  2M97 A;  1N0Y A;  1LXF C;  1FW4 A;  1S6I A;  3R72 A;  3NSI A;  1NX0 A;  3VRR A;  2JXC A;  2FCE A;  2I94 A;  3PAL A;  1QAT A;  2MJW B;  4MRX A;  4PCW A;  1B47 A;  4IJ7 A;  2K60 A;  2LP3 A;  4KYN A;  1BLQ A;  2QDI A;  3R1P A;  2F3Z A;  3TUY C;  4BY5 A;  1CMG A;  1S5G Y;  1A75 A;  3DVJ A;  4PE1 A;  1OMR A;  3D78 A;  3GK2 A;  1SY9 A;  2ZKM X;  1RWY A;  2LHI A;  3H4S E;  4OR9 B;  2M7N A;  1RTP 1;  1GJY A;  2QEV A;  5CSJ A;  1QTX A;  2LE9 B;  3NSK A;  4JKT A;  4JPZ B;  1RK9 A;  2A4J A;  3S0D A;  3QME A;  1CNP A;  4NDB A;  1DQE A;  1OSA A;  1S5G Z;  2I2R E;  1LKJ A;  3B7A A;  4JWQ A;  1W9Z A;  2L51 A;  2QEO A;  3EG5 B;  5F6T A;  1PRW A;  1SR6 B;  3SG4 A;  1PSB A;  2V53 A;  4PHM A;  1YX7 A;  1QV1 A;  1L2O C;  2SAS A;  3TS5 C;  4GPL B;  2B1U A;  2OS8 C;  1UP5 A;  2BBM A;  2ZN9 A;  1MQ1 A;  5HLO A;  2F33 A;  1K94 A;  4FQT A;  3O4Y A;  2K2A A;  1IKU A;  1DJW A;  1J7R A;  2JXL A;  2WC5 A;  2G9B A;  4QJ5 B;  1QVI Z;  2M9G A;  2L4H A;  4FQO A;  2QEH A;  3I5I C;  1SL9 A;  1B9A A;  1OOJ A;  3OX6 A;  1DJX A;  2JT0 A;  1OZS A;  2BBN A;  2LLS A;  1DT7 B;  4TNC A;  1DJZ A;  1AVS A;  3BUN B;  1HQV A;  2EC6 C;  3BYA A;  1W7J B;  2SCP A;  2KHN A;  1BT6 A;  2BE4 A;  4C0L A;  4OV2 A;  1KSM A;  2KQ6 A;  1SMG A;  3D76 A;  1MUX A;  5GQQ C;  5I2L A;  2HET A;  1NX2 A;  1YTZ C;  1H8B A;  1G33 A;  1K8U A;  3KHE A;  1WRK A;  1WRZ A;  1G8I A;  2WCF A;  1SCM B;  3B6X A;  1AUI B;  1ALV A;  1BG1 A;  1J1D A;  2F8P A;  1OW4 A;  2E6W A;  5I2O A;  2LMT A;  3CZ0 A;  4A4B A;  1IH0 A;  3VB1 A;  1LIN A;  2I7A A;  1TNP A;  3CDN A;  3EKJ A;  4INX A;  3WHT B;  3FE8 A;  4N1G A;  2MAZ A;  4I5L B;  5IBW A;  3I5F B;  2Y5I A;  3OB2 B;  1QVI Y;  2F3Y A;  2JOJ A;  4R1E A;  5DKN A;  2MHH A;  4NDD A;  1F54 A;  1SCM C;  1YX8 A;  4P5O E;  3CR5 X;  5CSN A;  1Y6W A;  2K7O A;  2Y1M A;  1DJI A;  3OB1 B;  5HL1 A;  1KFX L;  1QX2 A;  1QS7 A;  2Q4U A;  1S6C A;  1Y1A A;  3SG2 A;  4MRY A;  1IQ5 A;  4MSP A;  1E8A A;  1R2U A;  2LUC A;  3IQO A;  4ETO A;  2P70 A;  3BFH A;  1WLZ A;  4CFQ A;  1XK4 C;  2WC8 A;  4OVN F;  2JRF A;  5I8N A;  3FS7 A;  1DC1 A;  1LVC D;  1TRF A;  1A29 A;  5FYX A;  3IF7 A;  3SS5 A;  2FJU B;  1CFF A;  1IJ5 A;  2H2K A;  2H61 C;  1G4Y R;  2KAX A;  1IJ6 A;  1P28 A;  1SYM A;  1UHK A;  3M0W A;  1XVJ A;  2KOT A;  2FJY A;  5CPV A;  1JBA A;  1KCY A;  4MBE A;  3N7H A;  3NHT A;  3TUY B;  1PSR A;  1M31 A;  3C1V A;  4A4C A;  3LK1 A;  1BR4 B;  1SKT A;  2K0J A;  4MZK A;  3D0Y B;  4JD9 A;  1XFZ O;  2JC2 A;  3D77 A;  3DVM A;  1S36 A;  4M2P A;  1DGU A;  2MLF C;  4XJK A;  3VRO A;  2L4I A;  1ALW A;  1FPW A;  1EXR A;  5HKW A;  1UHN A;  2F2O A;  2BCA A;  3DXL A;  3K21 A;  3EK4 A;  1L7Z A;  1PVB A;  2WCE A;  1CDM A;  3BXK A;  3L4L A;  3KO0 A;  2CNP A;  3QRX A;  1ORG A;  2M1K B;  3VRP A;  3I5G C;  5HLV A;  2R2I A;  1PAL A;  2GV5 A;  1CLB A;  3SJS A;  1UUS A;  2KI4 C;  1DF0 B;  1SR6 C;  2JNX A;  3B88 A;  2WCB A;  2BCX A;  3JVT C;  1V1F A;  1OOG A;  5ER5 A;  1SNL A;  5I94 A;  2KYC A;  1JF0 A;  4GGF A;  3SIA A;  2BL0 B;  1XFU O;  4YGE B;  3S0E A;  3GOF A;  3UNW A;  3VRQ A;  1TIZ A;  2L50 A;  4IL1 A;  2GGM A;  1UHI A;  3CAB A;  3O2P A;  1BR1 B;  4N5X A;  1FF1 A;  1K2H A;  2LNK A;  1JUO A;  4NDC A;  1GGZ A;  1TCF A;  2TN4 A;  3TDU A;  3NSL A;  1T14 A;  1NCY A;  3GK4 X;  1JFJ A;  1Y1U A;  3DYE A;  1DTL A;  1EL4 A;  4NQG A;  3S0F A;  5D7F A;  3LLE A;  1NUB A;  3OBV A;  3SIB A;  3ICB A;  1LA3 A;  4WRI A;  2OS8 B;  1EG4 A;  1RFJ A;  2LM5 A;  5G08 A;  1F70 A;  3B86 A;  3PFV A;  5PAL A;  2RGI A;  2KYF A;  2JUL A;  3CWG A;  2LAP A;  1SPY A;  2ZFD A;  3SG7 A;  1UHH A;  3EKH A;  1NPQ A;  1W7I B;  1SL7 A;  3CR2 A;  2WND A;  2PRU A;  1N65 A;  2ZND A;  1DEK A;  1FBV A;  3D74 A;  2HF5 A;  2KGR A;  4YI8 A;  1JSA A;  2D8N A;  3K1E A;  1TCO B;  2CXJ A;  1ZUZ A;  3BFB A;  4JQ0 D;  1A4P A;  2NZ0 A;  3B87 A;  2KPH A;  1YVL A;  3JTD B;  4ORC B;  5ER4 X;  5J3X A;  3PSR A;  1CB1 A;  1DEL A;  5JOL A;  2OTG B;  1A2X A;  2KFG A;  2JWW A;  3A4U B;  3OGN A;  1SSE B;  2MA2 A;  3D0Y A;  3CR4 X;  4MZL A;  2WOS A;  1CMF A;  2COL B;  4YBH B;  1S26 D;  1JC2 A;  1OOH A;  4WQ2 A;  1FI5 A;  2BNX A;  4Q04 A;  3FWC A;  2PAS A;  3O4X A;  5EL2 A;  1MF8 B;  1F4Q A;  1CFP A;  4DCK A;  3KF9 A;  1DJY A;  5TNC A;  1MWN A;  2LLU A;  2Q91 A;  3IVT A;  4GGN A;  1NWD A;  1FI6 A;  1KFU S;  2O5G A;  1MXE A;  1Y1X A;  4GAO A;  2KQY A;  3WXA A;  2BKI B;  3OHM B;  4PE4 A;  1S6J A;  3BOW B;  3BQ3 A;  3BUO B;  2H8V A;  4N1F A;  1QWV A;  2M7L A;  2L2E A;  1ZFS A;  1YRT B;  3WHU B;  3OX5 A;  5HKZ A;  4MN0 A;  1KQV A;  3SG5 A;  1REC A;  1Z4H A;  4PHJ A;  2CT9 A;  4PT1 A;  5CSF A;  2YGU A;  3AKA A;  1CM1 A;  2K61 A;  4YI9 A;  3SS3 A;  3O78 A;  5HKY A;  2H61 A;  1OQP A;  2ZRT A;  4PHN A;  4DUQ A;  4QJ3 B;  1QX5 B;  3FWB A;  1KK8 C;  1XFV O;  1F71 A;  1SBJ A;  1YRU B;  3FE6 A;  3SS4 A;  2WCL A;  1B8L A;  1RRO A;  1ZMZ A;  1WY9 A;  3CS1 A;  3FIA A;  2P71 A;  4PAL A;  3R1O A;  3I5H C;  1YR5 A;  3BJH A;  1AJ4 A;  1M39 A;  1TOP A;  2KI4 B;  1LA0 A;  1QIW A;  4YRU A;  2BCB A;  2LP2 A;  4M2Q A;  1SW8 A;  1BF5 A;  3JVT B;  2LCP A;  2KAY A;  4CID A;  1ZAC A;  4UPG A;  5DKQ A;  1BOC A;  2LHL A;  2ZN8 A;  2LVI A;  1KFX S;  5FI2 A;  5AER A;  1CDP A;  5CSI A;  4PE7 A;  1AK8 A;  3CZT X;  1NX1 A;  1SRA A;  3PAT A;  1IGV A;  1X02 A;  4I5N B;  1F55 A;  1IIO A;  2KAV A;  2FCD A;  1WDC C;  2ERB A;  1LS8 A;  1BJF A;  3NGV A;  4YGD B;  3BUX B;  1QXP A;  1KK8 B;  1XA5 A;  2L5X B;  4CLN A;  4GGF C;  2VRG A;  1B1G A;  1XFR A;  2M3W A;  1IRJ A;  2CTN A;  1K9U A;  2KBM A;  1Q80 A;  3TZ1 A;  3I5H B;  3EK7 A;  3OP0 A;  1YUS A;  3O6B A;  1KFU L;  1C7V A;  1K9K A;  5JJG A;  2ISD A;  2JT3 A;  2KLD A;  1QIV A;  2LUX A;  1MXL C;  3KEV A;  5B8I B;  3TS5 B;  3FE9 A;  1F8H A;  1AJ5 A;  4E68 A;  1NCZ A;  1SL8 A;  2BE6 A;  2OPO A;  1V1G A;  1DJG A;  1XFY O;  2JU0 A;  3TDI A;  3VGO A;  1OOI X;  3VRN A;  3L4A A;  1WRL A;  3SG3 A;  1J7P A;  2K7D A;  2NLN A;  2NCO A;  2LVJ A;  1K96 A;  4DS7 A;  3UO9 A;  3GK1 A;  2KBI A;  1DGV A;  1YUR A;  2WCJ A;  4HRG A;  5K89 A;  3D75 A;  4YGC B;  5HYD A;  3ZWH A;  2BKH B;  2WOR A;  2IS9 A;  1BMO A;  3ZNI A;  2LAN A; 
#chains in the Genus database with same CATH homology
 3RM1 A;  1CDL A;  1XO5 A;  4OKH A;  2K2F A;  1DF0 A;  1WLM A;  3BUM B;  3BUW B;  1XYD A;  1B7T Y;  1QJT A;  1GQM A;  3JTD C;  2JNF A;  2PMY A;  1XFX O;  1ODB A;  2O60 A;  1DVI A;  2G2B A;  1H4B A;  1CKK A;  1KWO C;  2LVV A;  3AKB A;  1F4O A;  3DD4 A;  2JPT A;  2K7C A;  2JT8 A;  2MRD A;  3RLZ A;  2HQ8 A;  2PSR A;  3DVE A;  5KTY A;  1YUU A;  4GNK B;  4YGA A;  2KI6 C;  2PAL A;  2CBL A;  2KSP A;  2QAC A;  4USL A;  3D10 A;  1CLM A;  4HRE E;  2EC6 B;  1JFK A;  2ZNE A;  4DRW A;  2K8M B;  1JFJ A;  1PVA A;  5AFP A;  3I5F C;  2QPT A;  1QAS A;  2ZRS A;  1EH2 A;  4GFT A;  1CTR A;  2I18 A;  1CDN A;  3WNX B;  4WQ3 A;  1XFW O;  1IG5 A;  3CTN A;  3E3R A;  1ZOT B;  1OZO A;  1SCV A;  2KFH A;  2L0P A;  3CLN A;  4I5J A;  4PE0 A;  4MLW A;  4CFR A;  3PN7 B;  1QV0 A;  3AAK A;  1J7Q A;  1D1O A;  4OCI A;  2M49 B;  4PHK A;  1KQM C;  1B8R A;  1NSH A;  1KK7 Y;  2LV7 A;  2AAO A;  2MLE C;  4XYN A;  1XK4 A;  1OMD A;  2BEC A;  3DVK A;  4F0Z B;  1NCX A;  3AAJ A;  3SG6 A;  1NIW A;  1KWO B;  2L98 A;  1QLK A;  4C0K A;  1BU3 A;  4ZCU A;  3CGA A;  1C07 A;  1BOD A;  1K93 D;  1QLS A;  2M29 A;  3F45 A;  2JQ6 A;  1KQM B;  3LK0 A;  3KPX A;  1UUR A;  1R6P A;  2EGD A;  4MVF A;  3EK8 A;  4MZJ A;  2M8U A;  1OE9 B;  1DJH A;  2AMI A;  2LC5 A;  3IQQ A;  1B7T Z;  1WDC B;  2FOT A;  2KGB C;  1AP4 A;  3MSE B;  1TNX A;  1EJ3 A;  2DOQ A;  1L2O B;  5AXI A;  2Y4Q A;  2MBX A;  1A03 A;  1CFC A;  2LMU A;  3DF0 A;  1VRK A;  1TNQ A;  1MR8 A;  2LMV A;  3A8R A;  2Y1N A;  1K95 A;  5AEQ A;  1J55 A;  2M0R A;  5D69 A;  1CLL A;  1NX3 A;  4GBA A;  4CPV A;  1NP8 A;  3I5G B;  1Y0V H;  4ZCV A;  3LCP C;  4YGB B;  3LL8 B;  4ORA B;  4ICB A;  2KNE A;  1UWO A;  2LVK A;  1N2D A;  2JTT A;  1CFD A;  2LLT A;  1B8C A;  1OMV A;  2JZI A;  3NSO A;  1K9P A;  3DF0 B;  2KFF A;  1YVH A;  4ORB B;  5AAN A;  1A75 B;  4L9M A;  2P6B B;  1J7O A;  4P2Y B;  4MEW A;  1CM4 A;  3HX4 A;  4D1E A;  2K7B A;  1MHO A;  1IWQ A;  3I5I B;  1IQ3 A;  1JF2 A;  4BY4 A;  2PVB A;  3EVV A;  3PLF B;  1HT9 A;  2KI6 D;  2M1U A;  4HSZ A;  4AQJ A;  1QX7 A;  1DMO A;  2GGZ A;  2AUC A;  1U5I A;  1PUL A;  1S3P A;  2BL0 C;  3NXA A;  3EVR A;  4U8D A;  4DIR A;  1PK0 D;  1TN4 A;  1K90 D;  1JWD A;  1C7W A;  4I5K A;  1AHR A;  3HCM A;  2JTZ A;  4XJK B;  5KSZ A;  1S1E A;  4M2O A;  4QJ4 B;  3PM8 A;  5KU1 A;  1GGW A;  1TNW A;  1YUT A;  4AOM A;  3TDZ A;  4C0J A;  1B4C A;  3EVU A;  2EHB A;  1KK7 Z;  1M63 B;  2NCP A;  2NXQ A;  5BPJ A;  2E30 A;  2HQW A;  2OTG C;  1NYA A;  2HPS A;  4AQI A;  1RJV A;  1J1E A;  5DKR A;  4PDZ A;  2F2P A;  1EG3 A;  4HRH A;  5I2Q A;  1M46 A;  1UHJ A;  3PN7 C;  2CCM A;  1U5I B;  4FTG A;  2KDH A;  4GUK A;  1TTX A;  1KSO A;  1M45 A;  3BOW A;  1SK6 D;  2M97 A;  1N0Y A;  1LXF C;  1FW4 A;  1S6I A;  3NSI A;  1NX0 A;  3VRR A;  2JXC A;  2FCE A;  2I94 A;  3PAL A;  1QAT A;  2MJW B;  4MRX A;  4PCW A;  1B47 A;  2LP3 A;  1BLQ A;  3TUY C;  2F3Z A;  1CMG A;  4BY5 A;  1S5G Y;  1A75 A;  3DVJ A;  4PE1 A;  1OMR A;  3GK2 A;  1SY9 A;  2ZKM X;  1RWY A;  2LHI A;  3H4S E;  4OR9 B;  2M7N A;  1RTP 1;  1GJY A;  5CSJ A;  1QTX A;  2LE9 B;  3NSK A;  4JPZ B;  1RK9 A;  2A4J A;  1CNP A;  4NDB A;  1OSA A;  2I2R E;  1S5G Z;  1LKJ A;  4JWQ A;  2L51 A;  5F6T A;  1PRW A;  1SR6 B;  3SG4 A;  1PSB A;  2V53 A;  4PHM A;  1YX7 A;  1QV1 A;  1L2O C;  2SAS A;  3TS5 C;  4GPL B;  2B1U A;  2OS8 C;  1UP5 A;  2BBM A;  2ZN9 A;  1MQ1 A;  5HLO A;  2F33 A;  1K94 A;  3O4Y A;  2K2A A;  1IKU A;  1DJW A;  1J7R A;  2JXL A;  2G9B A;  4QJ5 B;  1QVI Z;  2M9G A;  2L4H A;  4FQO A;  3I5I C;  1SL9 A;  1B9A A;  1OOJ A;  3OX6 A;  1DJX A;  2JT0 A;  1OZS A;  2BBN A;  2LLS A;  1DT7 B;  4TNC A;  1DJZ A;  1AVS A;  3BUN B;  1HQV A;  2EC6 C;  3BYA A;  1W7J B;  2SCP A;  2KHN A;  1BT6 A;  2BE4 A;  4C0L A;  4OV2 A;  1KSM A;  2KQ6 A;  1SMG A;  1MUX A;  5GQQ C;  5I2L A;  2HET A;  1NX2 A;  1YTZ C;  1H8B A;  1G33 A;  1K8U A;  3KHE A;  1WRK A;  1WRZ A;  1G8I A;  2WCF A;  1SCM B;  1AUI B;  1ALV A;  1BG1 A;  2F8P A;  1J1D A;  2E6W A;  5I2O A;  2LMT A;  4A4B A;  1IH0 A;  1LIN A;  2I7A A;  1TNP A;  3EKJ A;  3WHT B;  4N1G A;  2MAZ A;  4I5L B;  5IBW A;  3I5F B;  2Y5I A;  3OB2 B;  1QVI Y;  2F3Y A;  2JOJ A;  4R1E A;  5DKN A;  2MHH A;  4NDD A;  1F54 A;  1SCM C;  1YX8 A;  4P5O E;  3CR5 X;  5CSN A;  1Y6W A;  2K7O A;  2Y1M A;  1DJI A;  3OB1 B;  1KFX L;  1QX2 A;  1QS7 A;  2Q4U A;  1S6C A;  1Y1A A;  3SG2 A;  4MRY A;  1IQ5 A;  4MSP A;  1E8A A;  1R2U A;  2LUC A;  3IQO A;  4ETO A;  1WLZ A;  4CFQ A;  1XK4 C;  2WC8 A;  4OVN F;  2JRF A;  5I8N A;  3FS7 A;  1LVC D;  1TRF A;  1A29 A;  5FYX A;  3IF7 A;  2FJU B;  1CFF A;  1IJ5 A;  2H2K A;  2H61 C;  1G4Y R;  2KAX A;  1IJ6 A;  1SYM A;  1UHK A;  3M0W A;  1XVJ A;  2KOT A;  5CPV A;  1JBA A;  1KCY A;  4MBE A;  3TUY B;  1PSR A;  1M31 A;  3C1V A;  4A4C A;  3LK1 A;  1BR4 B;  1SKT A;  2K0J A;  4MZK A;  3D0Y B;  1XFZ O;  2JC2 A;  3DVM A;  4M2P A;  1S36 A;  4XJK A;  1DGU A;  2MLF C;  3VRO A;  1FPW A;  2L4I A;  1ALW A;  1EXR A;  5HKW A;  1UHN A;  2F2O A;  2BCA A;  3K21 A;  3EK4 A;  1L7Z A;  1PVB A;  2WCE A;  1CDM A;  3BXK A;  3QRX A;  3KO0 A;  2CNP A;  2M1K B;  3VRP A;  3I5G C;  5HLV A;  2R2I A;  1PAL A;  2GV5 A;  1CLB A;  3SJS A;  1UUS A;  2KI4 C;  1DF0 B;  1SR6 C;  2JNX A;  2WCB A;  2BCX A;  3JVT C;  1V1F A;  5ER5 A;  1SNL A;  2KYC A;  1JF0 A;  4GGF A;  3SIA A;  2BL0 B;  1XFU O;  4YGE B;  3GOF A;  3VRQ A;  1TIZ A;  2L50 A;  4IL1 A;  2GGM A;  1UHI A;  3O2P A;  4N5X A;  1BR1 B;  1K2H A;  1FF1 A;  2LNK A;  1JUO A;  4NDC A;  1GGZ A;  1TCF A;  2TN4 A;  3TDU A;  3NSL A;  1NCY A;  3GK4 X;  1Y1U A;  1DTL A;  1EL4 A;  4NQG A;  5D7F A;  3LLE A;  1NUB A;  3SIB A;  3ICB A;  1LA3 A;  4WRI A;  2OS8 B;  1EG4 A;  1RFJ A;  2LM5 A;  5G08 A;  1F70 A;  3PFV A;  5PAL A;  2RGI A;  2KYF A;  2JUL A;  3CWG A;  2LAP A;  1SPY A;  2ZFD A;  3SG7 A;  1UHH A;  3EKH A;  1NPQ A;  1W7I B;  1SL7 A;  3CR2 A;  2WND A;  2PRU A;  1N65 A;  2ZND A;  1FBV A;  2HF5 A;  2KGR A;  4YI8 A;  1JSA A;  2D8N A;  1TCO B;  2CXJ A;  1ZUZ A;  4JQ0 D;  1A4P A;  2NZ0 A;  3JTD B;  4ORC B;  1YVL A;  5ER4 X;  5J3X A;  3PSR A;  1CB1 A;  5JOL A;  2OTG B;  1A2X A;  2KFG A;  2JWW A;  3A4U B;  2MA2 A;  3D0Y A;  3CR4 X;  4MZL A;  2WOS A;  1CMF A;  2COL B;  4YBH B;  1S26 D;  1JC2 A;  4WQ2 A;  1FI5 A;  4Q04 A;  3FWC A;  2PAS A;  1MF8 B;  1F4Q A;  1CFP A;  4DCK A;  3KF9 A;  1DJY A;  5TNC A;  1MWN A;  2LLU A;  2Q91 A;  1FI6 A;  4GGN A;  1NWD A;  1KFU S;  2O5G A;  1MXE A;  1Y1X A;  4GAO A;  2KQY A;  3WXA A;  2BKI B;  3OHM B;  4PE4 A;  1S6J A;  3BOW B;  3BQ3 A;  3BUO B;  4N1F A;  2M7L A;  2L2E A;  1ZFS A;  1YRT B;  3WHU B;  3OX5 A;  5HKZ A;  4MN0 A;  1KQV A;  3SG5 A;  1REC A;  4PHJ A;  2CT9 A;  5CSF A;  3AKA A;  1CM1 A;  2K61 A;  4YI9 A;  5HKY A;  3O78 A;  2H61 A;  1OQP A;  2ZRT A;  4PHN A;  4DUQ A;  4QJ3 B;  1QX5 B;  3FWB A;  1KK8 C;  1XFV O;  1F71 A;  1SBJ A;  1YRU B;  1B8L A;  1RRO A;  1ZMZ A;  1WY9 A;  3CS1 A;  3FIA A;  4PAL A;  3I5H C;  1YR5 A;  1AJ4 A;  1M39 A;  1TOP A;  2KI4 B;  1LA0 A;  1QIW A;  4YRU A;  2BCB A;  2LP2 A;  4M2Q A;  1SW8 A;  1BF5 A;  3JVT B;  2LCP A;  2KAY A;  4CID A;  1ZAC A;  4UPG A;  5DKQ A;  1BOC A;  2LHL A;  2ZN8 A;  2LVI A;  1KFX S;  5AER A;  1CDP A;  5CSI A;  4PE7 A;  1AK8 A;  3CZT X;  1NX1 A;  1SRA A;  3PAT A;  1IGV A;  1X02 A;  4I5N B;  1F55 A;  2KAV A;  2FCD A;  1WDC C;  1BJF A;  4YGD B;  3BUX B;  1QXP A;  1KK8 B;  1XA5 A;  2L5X B;  4CLN A;  4GGF C;  2VRG A;  1B1G A;  2M3W A;  1IRJ A;  2CTN A;  1K9U A;  2KBM A;  1Q80 A;  3TZ1 A;  3I5H B;  3EK7 A;  3OP0 A;  1YUS A;  3O6B A;  1KFU L;  1C7V A;  1K9K A;  5JJG A;  2ISD A;  2JT3 A;  1QIV A;  2LUX A;  1MXL C;  3KEV A;  5B8I B;  3TS5 B;  1F8H A;  1AJ5 A;  4E68 A;  1NCZ A;  1SL8 A;  2BE6 A;  2OPO A;  1V1G A;  1DJG A;  1XFY O;  2JU0 A;  3TDI A;  3VGO A;  3VRN A;  1WRL A;  3SG3 A;  1J7P A;  2K7D A;  2NLN A;  2NCO A;  2LVJ A;  1K96 A;  4DS7 A;  3GK1 A;  2KBI A;  1DGV A;  1YUR A;  4HRG A;  5K89 A;  4YGC B;  5HYD A;  3ZWH A;  2BKH B;  2WOR A;  2IS9 A;  1BMO A;  3ZNI A;  2LAN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...