1MXLC

Structure of cardiac troponin c-troponin i complex
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
89
structure length
89
Chain Sequence
MDDIYKAAVEQLTEEQKNEFKAAFDIFVLGAEDGCISTKELGKVMRMLGQNPTPEELQEMIDEVDEDGSGTVDFDEFLVMMVRCMKDDS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (TROPONIN C)
publication title Binding of cardiac troponin-I147-163 induces a structural opening in human cardiac troponin-C.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Calcium-binding protein
total genus 20
structure length 89
sequence length 89
ec nomenclature
pdb deposition date 1999-04-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF13833 EF-hand_8 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1mxlC00
1BR4B 4DRWA 1S36A 1UHNA 2LP3A 1BOCA 3D10A 2KNEA 3FIAA 1FI6A 3GOFA 1IQ5A 1BR1B 4PHKA 3IF7A 4MVFA 1RK9A 2OS8B 1NWDA 2JNXA 3I5FB 4MRXA 1XFXO 1SW8A 5PALA 2MA2A 3EVRA 4I5JA 2GV5A 1PALA 1W7JB 1OOJA 1QIVA 1S6CA 2AAOA 3ZNIA 1KSOA 1K94A 2GGMA 1J55A 1KFUL 4CFQA 2K0JA 5F6TA 2KYCA 2HQWA 1UHKA 2I94A 1E8AA 4IL1A 2CTNA 4PALA 3DF0A 4MEWA 2B1UA 1IJ5A 2LHLA 1B4CA 1B8LA 3E3RA 3EKJA 3SG2A 2M7NA 1SBJA 3BXKA 3VROA 3D0YB 1J7OA 2LC5A 4N5XA 4C0LA 1NCYA 3PATA 3NSKA 1A03A 1J1EA 4P2YB 4CLNA 4QJ3B 2KAYA 2LVVA 1K96A 2K8MB 1CM1A 3AAJA 1SNLA 3GK4X 1MR8A 1JSAA 1OSAA 1QLKA 3SIBA 1QV1A 2O60A 1S1EA 2BBNA 5AERA 3BOWB 5G08A 2V53A 1TCOB 1L2OC 2PRUA 5J3XA 1OMRA 1SR6B 3BUOB 1CFPA 1ZOTB 2JU0A 3CTNA 2KAXA 1K9PA 1XFZO 1DGUA 1TNPA 1JFJA 3NSLA 1LXFC 1L2OB 3OB1B 1ZACA 3BOWA 2GGZA 1SK6D 3VRRA 4CFRA 1F4OA 2LUCA 4JPZB 2HETA 1NCXA 1RECA 2KI4C 1OZOA 1UUSA 4XJKB 2F33A 4HRGA 2BKIB 4P5OE 3SG3A 3OP0A 2LMTA 1XK4A 1KFXS 4YGBB 1BODA 4NDDA 4UPGA 2QPTA 2NZ0A 1SMGA 4DIRA 1EL4A 5KSZA 1BLQA 1YUTA 3I5GC 3PFVA 1Y1XA 5DKQA 3BUXB 1QTXA 1CDMA 3DVEA 4M2QA 1H8BA 2O5GA 2JOJA 1S3PA 2ZNEA 3PSRA 1XYDA 3RM1A 2PMYA 1YTZC 1JWDA 1SY9A 2ZN8A 2E30A 2JPTA 4GNKB 1LINA 4NDCA 2KGBC 1F70A 1RFJA 1K90D 1K93D 2KFHA 1NUBA 4I5KA 1XFYO 3SG5A 1XVJA 4M2PA 1EH2A 1N0YA 1LKJA 1QVIZ 1NCZA 3JTDC 3NSOA 4GUKA 1TNWA 1LA3A 2L5XB 4MZLA 2LUXA 3SG4A 1Q80A 1SYMA 1GGZA 5TNCA 3AKAA 1SL9A 3TUYB 1JF2A 1ZMZA 2PVBA 2JZIA 1DVIA 1KK7Y 1NX2A 2BCAA 3BUWB 1XFUO 3O2PA 4N1GA 1SRAA 2CXJA 1ALVA 1UP5A 1WRKA 2M97A 2BE4A 2Y5IA 3TDZA 1DJHA 2HPSA 1KCYA 4PHJA 1LVCD 1WLMA 4GGFC 4WQ2A 2NCOA 5DKNA 1MXLC 4L9MA 1SCMB 1K9KA 1KQMC 1BG1A 1IWQA 3FWCA 5CSNA 2WCEA 1B8RA 2KQ6A 1NP8A 1JC2A 3HCMA 4GFTA 2ZFDA 2CCMA 1JFKA 2LLUA 2ZRTA 3OX6A 5CSJA 1J1DA 2L4HA 1KQMB 1KK7Z 3GK1A 3NXAA 2FCDA 3I5HB 2L4IA 1CM4A 2LP2A 3VRNA 3M0WA 2JQ6A 1K95A 1VRKA 1TTXA 3BYAA 1CFDA 4GGFA 4NDBA 4MZJA 2Y1MA 5K89A 1NIWA 1OQPA 2I18A 2R2IA 3DF0B 3O6BA 1KK8C 4PHMA 1F55A 2COLB 2M29A 3DVJA 2LLSA 1R2UA 2FCEA 2NCPA 1TOPA 2OPOA 5HLVA 2Q91A 2F2OA 1KWOC 1IG5A 1CFFA 4GGNA 2ZN9A 1KK8B 1N65A 4GBAA 1SL8A 1DMOA 4YGAA 2LVJA 2LM5A 3HX4A 5B8IB 1G33A 4HREE 5HYDA 2NLNA 1PSRA 1MUXA 2SCPA 1QASA 5ER4X 1HQVA 4I5LB 2M1KB 2CNPA 3AKBA 2BCBA 1AJ5A 1LA0A 1B8CA 1QV0A 2JT8A 2KDHA 2BL0C 4DUQA 3OB2B 1GGWA 2KAVA 1OE9B 4PHNA 1Y1AA 1QATA 3BUNB 3VRQA 4ZCVA 3CR2A 1MHOA 3JVTC 2BL0B 2L0PA 1XK4C 2LANA 1UHJA 1CB1A 2K7CA 1TNXA 2BE6A 1TNQA 2LAPA 1XA5A 2KI6D 3DVKA 4OV2A 2JRFA 1QXPA 1C7VA 3A4UB 1ZFSA 2P6BB 3ICBA 5AANA 1H4BA 1DTLA 1YX7A 1AVSA 4DS7A 1QLSA 3O78A 1FF1A 1DF0A 2WORA 4PE1A 3DVMA 1PSBA 1DGVA 2F8PA 4M2OA 1UURA 3F45A 4D1EA 1YURA 4ORCB 2ZKMX 3ZWHA 1M46A 5HLOA 2KI4B 4ETOA 1F8HA 5CSFA 2WNDA 3LK1A 1RROA 2WOSA 1DJWA 1DJYA 3WXAA 3EKHA 3SJSA 2PSRA 1IQ3A 3QRXA 2LMVA 2KGRA 2MLFC 5AFPA 1Y6WA 2KFFA 1CFCA 3EK7A 3I5GB 3CR5X 3FWBA 1PVAA 1BMOA 3CLNA 2M8UA 4PE7A 2K2FA 3PN7C 3LK0A 2EC6C 2L51A 2Y4QA 5KU1A 1M31A 1NX3A 1SCVA 2KSPA 3KEVA 3LL8B 2KHNA 2MRDA 3TZ1A 2G9BA 4WRIA 2LVKA 1A29A 2JNFA 1CKKA 2LNKA 4YGCB 3PN7B 1DJXA 2EC6B 1A2XA 1CDPA 1CMGA 2QACA 2JT0A 2DOQA 2ZNDA 3JTDB 1WDCC 2EHBA 2L50A 4MN0A 5AXIA 2JXLA 1QX2A 1AHRA 4QJ4B 1KQVA 4BY4A 2BCXA 4E68A 1KFUS 2BKHB 4QJ5B 4NQGA 1YVLA 3O4YA 4ZCUA 3RLZA 2M0RA 2FJUB 1WDCB 1G8IA 3AAKA 1A75B 1F54A 3PM8A 1UWOA 1BJFA 5JJGA 1YUSA 2BBMA 1XO5A 1AP4A 3IQQA 3C1VA 1WRLA 1B9AA 4YGDB 2K7OA 1QIWA 2MHHA 2MJWB 4TNCA 3VGOA 1QS7A 1YX8A 1MQ1A 1Y0VH 2F3ZA 5DKRA 2FOTA 1JUOA 1KFXL 1MWNA 2AUCA 1S5GY 2JTZA 2M49B 1A75A 1BF5A 3OHMB 3CWGA 4PE0A 1GJYA 2Q4UA 1NX0A 1D1OA 3WHTB 3EVVA 2MAZA 2TN4A 1PK0D 1V1GA 2L2EA 1NYAA 4GAOA 1ZUZA 1W7IB 1WRZA 2MLEC 4ICBA 3WNXB 2JXCA 3CS1A 3PLFB 2M1UA 1EG3A 1QX7A 1SKTA 2M7LA 4F0ZB 2ZRSA 1CNPA 1YVHA 3TS5C 5AEQA 1AJ4A 1S5GZ 1JBAA 1CLMA 4YRUA 3EVUA 1PRWA 4WQ3A 1NX1A 1CLLA 2JT3A 4U8DA 3TS5B 3LLEA 1KWOB 2L98A 3OX5A 4FTGA 1WY9A 5D7FA 3SIAA 2Y1NA 5ER5A 5HKZA 1DJIA 1K9UA 1ODBA 2F2PA 4YI9A 1IRJA 1FW4A 4HRHA 2KOTA 1J7PA 1HT9A 1MXEA 1CTRA 2WCBA 5I2LA 1CMFA 4MLWA 1PVBA 1YR5A 2M3WA 1M63B 1KSMA 2I2RE 1DF0B 1M45A 5D69A 1RJVA 1ALWA 1RWYA 2HQ8A 3WHUB 4PCWA 3JVTB 2MBXA 1YRTB 4OKHA 3CR4X 5BPJA 1XFVO 1MF8B 5I2QA 5IBWA 1IKUA 2E6WA 2PASA 5FYXA 1NSHA 2I7AA 2ISDA 1TN4A 5HKWA 3KF9A 1CDNA 4MSPA 1FBVA 1YUUA 3EK4A 3A8RA 3D0YA 1SR6C 1S6JA 4I5NB 5I8NA 3CGAA 4Q04A 4R1EA 1K8UA 4YBHB 2HF5A 2LMUA 3IQOA 1YRUB 5HKYA 3PALA 4AQJA 1AUIB 1X02A 1R6PA 2K61A 2AMIA 4MRYA 1U5IB 1CDLA 4OVNF 1IH0A 4FQOA 2A4JA 1EG4A 1OMVA 2K7DA 4ORBB 1Y1UA 5GQQC 2OTGC 1J7RA 3KHEA 4PDZA 5CPVA 1J7QA 1K2HA 3SG7A 1V1FA 2H2KA 3KPXA 3KO0A 4BY5A 2KQYA 2PALA 1TIZA 1C07A 1U5IA 4MZKA 1IGVA 5CSIA 2OTGB 2KBMA 4PE4A 1QVIY 1DJGA 2KBIA 1QJTA 2K7BA 4C0JA 4AOMA 1B1GA 4XJKA 4OR9B 1M39A 1BU3A 2F3YA 3TDUA 2H61C 2IS9A 2NXQA 2LHIA 2WCFA 3SG6A 1XFWO 4OCIA 2CBLA 4AQIA 2G2BA 1S6IA 1AK8A 2JULA 1B7TY 3K21A 4YGEB 2LLTA 1GQMA 2WC8A 4MBEA 2JTTA 2CT9A 2EGDA 1JF0A 4CIDA 2LCPA 3TDIA 4USLA 3TUYC 1OMDA 1PULA 1B47A 3CZTX 1FPWA 1EJ3A 1IJ6A 1A4PA 4JWQA 4XYNA 3EK8A 5I2OA 4HSZA 4ORAB 1OZSA 4JQ0D 1SPYA 1DJZA 4A4CA 3NSIA 2H61A 2M9GA 3FS7A 2VRGA 2D8NA 1EXRA 2JC2A 3BUMB 4A4BA 1NPQA 4CPVA 2LV7A 1N2DA 2BECA 1UHHA 5JOLA 1B7TZ 1UHIA 2JWWA 1SCMC 2LE9B 1RTP1 1QX5B 2KFGA 1CLBA 3DD4A 2RGIA 1S26D 1L7ZA 1TRFA 1F4QA 3VRPA 1G4YR 4C0KA 3MSEB 5KTYA 1WLZA 3I5IC 4YI8A 1C7WA 1DT7B 2SASA 4N1FA 2LVIA 3I5HC 4GPLB 4DCKA 3BQ3A 1SL7A 2KI6C 1F71A 3LCPC 1TCFA 1FI5A 2K2AA 3GK2A 3H4SE 1BT6A 3I5IB 2OS8C 3I5FC 2KYFA
chains in the Genus database with same CATH superfamily
1BR4B 4DRWA 1S36A 1UHNA 2LP3A 3Q8IA 1BOCA 3D10A 2KNEA 3FIAA 1FI6A 3GOFA 1OOIX 1QWVA 1IQ5A 1BR1B 4PHKA 3IF7A 4MVFA 1RK9A 2OS8B 1NWDA 2JNXA 3I5FB 4MRXA 3S0DA 3EG5B 1XFXO 1SW8A 5PALA 3OBVA 2MA2A 3EVRA 4I5JA 4IJ7A 2GV5A 1PALA 1W7JB 1OOJA 1QIVA 1S6CA 2AAOA 3UO9A 3ZNIA 1KSOA 1K94A 2GGMA 1J55A 1KFUL 4CFQA 2K0JA 5F6TA 2KYCA 2HQWA 1UHKA 2I94A 1E8AA 4IL1A 2CTNA 3L47A 3DF0A 4MEWA 4PALA 2B1UA 1IJ5A 2LHLA 1B4CA 1B8LA 3E3RA 3EKJA 3SG2A 2M7NA 1SBJA 3BXKA 3VROA 3D0YB 1J7OA 2LC5A 4N5XA 4C0LA 1NCYA 3PATA 3NSKA 1A03A 2WCJA 1J1EA 2WCMA 4P2YB 4CLNA 4QJ3B 2KAYA 2LVVA 1K96A 2K8MB 1CM1A 3AAJA 1SNLA 3GK4X 1MR8A 1JSAA 1OSAA 1QLKA 3SIBA 1QV1A 2O60A 1S1EA 2BBNA 5AERA 3BOWB 5G08A 3DYEA 2V53A 1TCOB 1L2OC 3O4XA 2PRUA 5J3XA 1OMRA 1SR6B 3BUOB 1CFPA 1ZOTB 2JU0A 3CTNA 3FE9A 2QEBA 2KAXA 1K9PA 1XFZO 1DGUA 1TNPA 1JFJA 3NSLA 1LXFC 1L2OB 3OB1B 1ZACA 1T14A 2GGZA 3BOWA 1SK6D 3VRRA 1Z2CB 4CFRA 1F4OA 2LUCA 4JPZB 2HETA 1NCXA 1RECA 2KI4C 1OZOA 3BFAA 1UUSA 4XJKB 2F33A 4HRGA 2BKIB 4P5OE 3SG3A 3OP0A 1TUZA 2LMTA 4JKTA 1XK4A 1KFXS 4YGBB 1BODA 4NDDA 4UPGA 3DXLA 2QPTA 2NZ0A 1SMGA 4DIRA 1EL4A 3N7HA 5KSZA 1BLQA 1YUTA 3NHIA 3B87A 3I5GC 3PFVA 1Y1XA 5DKQA 3OGNA 3BUXB 1QTXA 1CDMA 3DVEA 4M2QA 1H8BA 2O5GA 2JOJA 1S3PA 2ZNEA 3PSRA 1XYDA 3IVTA 2PMYA 3RM1A 1YTZC 1JWDA 1SY9A 2ZN8A 2E30A 2JPTA 4GNKB 1LINA 1XFRA 4NDCA 2KGBC 1F70A 1RFJA 1K90D 1K93D 2KFHA 5FI6A 1NUBA 4I5KA 1XFYO 3SG5A 1XVJA 4M2PA 1EH2A 1N0YA 1LKJA 1QVIZ 1NCZA 3JTDC 3NSOA 4GUKA 2JPOA 1TNWA 1LA3A 2L5XB 3D77A 2LUXA 4MZLA 1Q80A 3SG4A 1SYMA 1GGZA 5TNCA 3AKAA 1SL9A 3TUYB 1JF2A 1ZMZA 2PVBA 2WCLA 4PT1A 2JZIA 1DVIA 1KK7Y 1NX2A 2BCAA 3BUWB 1XFUO 3O2PA 4N1GA 1SRAA 2CXJA 1ALVA 1UP5A 1WRKA 2M97A 2BE4A 2Y5IA 3TDZA 1IIOA 1DJHA 2HPSA 1KCYA 4PHJA 1LVCD 1WLMA 4GGFC 4WQ2A 2NCOA 5DKNA 5FI7A 1MXLC 4L9MA 1SCMB 1OOHA 1K9KA 1KQMC 1BG1A 1IWQA 3FWCA 5CSNA 2WCEA 1B8RA 2KQ6A 1NP8A 1JC2A 3HCMA 1TUJA 4GFTA 2ZFDA 2CCMA 3PM2A 1JFKA 2LLUA 2ZRTA 3OX6A 2L5YA 5CSJA 1J1DA 2L4HA 1KQMB 1KK7Z 3GK1A 3NXAA 2FCDA 3I5HB 1W9ZA 1OOGA 2L4IA 1CM4A 2LP2A 3NGVA 3M0WA 3VRNA 5I94A 2JQ6A 1K95A 1VRKA 1TTXA 3BYAA 1CFDA 2P70A 4GGFA 2QEHA 3S0FA 4NDBA 4MZJA 5HL1A 2Y1MA 5K89A 1NIWA 1OQPA 2I18A 2R2IA 3DF0B 3O6BA 3BFBA 1KK8C 2ERBA 4PHMA 1F55A 2COLB 2M29A 3DVJA 2LLSA 1R2UA 2FCEA 2NCPA 1TOPA 1DC1A 2OPOA 5HLVA 2Q91A 2F2OA 1KWOC 1IG5A 3S0AA 1CFFA 4GGNA 2ZN9A 1KK8B 1N65A 4GBAA 1GM0A 1SL8A 3BJHA 1DMOA 4YGAA 2LVJA 2LM5A 3D75A 3UNWA 3HX4A 5B8IB 1G33A 4HREE 5HYDA 2NLNA 1PSRA 1MUXA 2SCPA 1QASA 5ER4X 1HQVA 4I5LB 2M1KB 2CNPA 3AKBA 2BCBA 1AJ5A 1LA0A 1B8CA 1QV0A 2JT8A 2KDHA 1P28A 2BL0C 4DUQA 3OB2B 3B7AA 1GGWA 2KAVA 1OE9B 3L4LA 4PHNA 1Y1AA 1QATA 3BUNB 3VRQA 4ZCVA 3CR2A 1MHOA 3L4AA 3JVTC 2BL0B 1OW4A 2L0PA 1XK4C 2LANA 1UHJA 1CB1A 2K7CA 1TNXA 2BE6A 1TNQA 2LAPA 3DZTA 1XA5A 2KI6D 3DVKA 4OV2A 2JRFA 1QXPA 1C7VA 3A4UB 1ZFSA 2P6BB 3ICBA 4INWA 5AANA 1H4BA 1DTLA 1YX7A 1AVSA 4DS7A 1QLSA 2H8VA 3O78A 1FF1A 1DF0A 2WORA 4PE1A 3FE8A 3DVMA 2BAPA 2PYQA 1PSBA 2QEVA 1DGVA 2F8PA 4M2OA 1UURA 3F45A 4D1EA 1YURA 4ORCB 2ZKMX 3ZWHA 1M46A 5HLOA 2QDIA 2KI4B 3SS3A 4ETOA 1F8HA 5CSFA 2WNDA 3LK1A 1RROA 2WOSA 1DJWA 1DJYA 3WXAA 3EKHA 3SJSA 2PSRA 3CZ1A 3QRXA 1IQ3A 2LMVA 2KGRA 2MLFC 5AFPA 1Y6WA 3R72A 2KFFA 1CFCA 5EL2A 3SS5A 2L2CA 3EK7A 3I5GB 3CR5X 3FWBA 1PVAA 1BMOA 3CLNA 2M8UA 4PE7A 2K2FA 3PN7C 3LK0A 2PQLA 2EC6C 2L51A 2Y4QA 5KU1A 1M31A 1NX3A 5D3OA 1SCVA 2KSPA 3KEVA 2WCKA 2KHNA 2MRDA 3LL8B 3TZ1A 2G9BA 4WRIA 2LVKA 1A29A 2JNFA 1CKKA 2P71A 2LNKA 4YGCB 3PN7B 1DJXA 2EC6B 1A2XA 1CDPA 1CMGA 2QACA 2JT0A 2DOQA 2ZNDA 3JTDB 1WDCC 2EHBA 2L50A 4MN0A 5AXIA 2JXLA 1QX2A 1AHRA 4QJ4B 2BNXA 2WC6A 3R1PA 1KQVA 4BY4A 2BCXA 4E68A 1KFUS 2BKHB 4QJ5B 4NQGA 1YVLA 3O4YA 4ZCUA 3B88A 3RLZA 2M0RA 1SSEB 2FJUB 1WDCB 1G8IA 3AAKA 1A75B 4OZDA 1F54A 3PM8A 1UWOA 1BJFA 2WCHA 5JJGA 1YUSA 2BBMA 1XO5A 1Z4HA 3IQQA 3C1VA 1AP4A 1WRLA 1B9AA 4YGDB 2K60A 2K7OA 1QIWA 2MHHA 2MJWB 4TNCA 3VGOA 1QS7A 1YX8A 1MQ1A 1Y0VH 2F3ZA 5DKRA 2FOTA 1JUOA 1KFXL 1MWNA 2AUCA 1S5GY 2JTZA 2M49B 1A75A 1BF5A 3OHMB 3CWGA 4PE0A 1GJYA 2Q4UA 1NX0A 1D1OA 3WHTB 3CABA 3EVVA 2MAZA 2TN4A 1PK0D 1V1GA 2L2EA 1NYAA 4GAOA 1ZUZA 4JD9A 1W7IB 1WRZA 2MLEC 4ICBA 3WNXB 2JXCA 3CS1A 3PLFB 3CZ0A 2M1UA 3D78A 1EG3A 1QX7A 1SKTA 2M7LA 3V2LA 4F0ZB 2ZRSA 1CNPA 1YVHA 2FJYA 3TS5C 5AEQA 1AJ4A 1S5GZ 3SS4A 1JBAA 1DEKA 1CLMA 4KYNA 4YRUA 3EVUA 1PRWA 3R1OA 5DICA 4WQ3A 1NX1A 1CLLA 2JT3A 4U8DA 3TS5B 3LLEA 2WC5A 5FI2A 1KWOB 2L98A 3OX5A 4FTGA 1WY9A 5D7FA 3SIAA 2Y1NA 5ER5A 5HKZA 1DJIA 1K9UA 1ODBA 2F2PA 4YI9A 1IRJA 1FW4A 4HRHA 2KOTA 1C3ZA 1HT9A 1MXEA 1J7PA 1CTRA 2WCBA 5I2LA 1CMFA 1TWOA 3B6XA 4MLWA 1PVBA 1YR5A 2M3WA 1LS8A 1M63B 1KSMA 2I2RE 1DF0B 1M45A 5D69A 1ORGA 1RJVA 2GTEA 1ALWA 1RWYA 2HQ8A 3WHUB 4PCWA 3FE6A 3JVTB 2MBXA 1OOFA 1YRTB 4OKHA 3CR4X 5BPJA 1XFVO 1MF8B 5I2QA 5IBWA 1IKUA 2E6WA 2PASA 5FYXA 1NSHA 2I7AA 2ISDA 2KLDA 1TN4A 5HKWA 3KF9A 1CDNA 3PJIA 1FBVA 1YUUA 3EK4A 4MSPA 3A8RA 3D0YA 1SR6C 1S6JA 4I5NB 5I8NA 3CGAA 4Q04A 4R1EA 1K8UA 4YBHB 2HF5A 1C3YA 3CDNA 2LMUA 3IQOA 1YRUB 2YGUA 3NHTA 5HKYA 3PALA 3S0BA 4AQJA 1AUIB 1X02A 1R6PA 2K61A 2AMIA 4MRYA 1U5IB 3S0EA 1CDLA 4OVNF 1IH0A 4FQOA 2A4JA 1EG4A 1OMVA 2K7DA 3B86A 4ORBB 1Y1UA 5GQQC 2OTGC 1J7RA 3KHEA 4PDZA 5CPVA 1J7QA 1K2HA 3SG7A 1V1FA 2H2KA 3KPXA 3DY9A 3KO0A 4BY5A 2KQYA 2PALA 1TIZA 1C07A 4INXA 1U5IA 4MZKA 1IGVA 3D76A 3QMEA 3R1VA 5CSIA 2OTGB 2KBMA 3BFHA 4PE4A 1QVIY 1DJGA 2KBIA 1QJTA 2K7BA 3K1EA 4C0JA 4AOMA 1B1GA 4XJKA 4OR9B 1M39A 1BU3A 2F3YA 3TDUA 2H61C 2IS9A 2NXQA 2LHIA 2QEOA 2WCFA 3SG6A 1XFWO 4OCIA 2CBLA 4AQIA 2G2BA 1S6IA 3CYZA 1AK8A 2JULA 1B7TY 3D74A 3K21A 4F7FA 4YGEB 2LLTA 1GQMA 2WC8A 3CZ2A 4MBEA 2JTTA 2CT9A 2EGDA 1JF0A 4CIDA 2LCPA 3TDIA 3RZSA 4USLA 3TUYC 1OMDA 1PULA 1B47A 3CZTX 1FPWA 1EJ3A 1IJ6A 1A4PA 4JWQA 4XYNA 3EK8A 5I2OA 4HSZA 4ORAB 1OZSA 1DELA 4JQ0D 1SPYA 1DJZA 4A4CA 3NSIA 2H61A 2KLEA 2M9GA 3FS7A 2VRGA 2D8NA 1EXRA 2JC2A 4FQTA 3BUMB 4A4BA 1NPQA 2KPHA 4CPVA 3D73A 2LV7A 1N2DA 2BECA 1UHHA 5JOLA 1B7TZ 1UHIA 2JWWA 1SCMC 2LE9B 1RTP1 1QX5B 2KFGA 1CLBA 3DD4A 2RGIA 1S26D 1L7ZA 1TRFA 3VB1A 1F4QA 3VRPA 1G4YR 4C0KA 3MSEB 3S0GA 1WLZA 5KTYA 3I5IC 4YI8A 1C7WA 1DT7B 2SASA 4N1FA 2LVIA 3I5HC 4GPLB 4DCKA 3BQ3A 1DQEA 1SL7A 2KI6C 1F71A 3LCPC 1TCFA 1FI5A 2K2AA 3GK2A 3H4SE 1BT6A 3I5IB 2OS8C 3I5FC 2KYFA
chains in the Genus database with same CATH topology
1BR4B 4DRWA 1S36A 1UHNA 2LP3A 1BOCA 3D10A 2KNEA 3FIAA 1FI6A 3GOFA 1IQ5A 1BR1B 4PHKA 3IF7A 4MVFA 1RK9A 2OS8B 1NWDA 2JNXA 3I5FB 4MRXA 1XFXO 1SW8A 5PALA 2MA2A 3EVRA 4I5JA 2GV5A 1PALA 1W7JB 1OOJA 1QIVA 1S6CA 2AAOA 3ZNIA 1KSOA 1K94A 2GGMA 1J55A 1KFUL 4CFQA 2K0JA 5F6TA 2KYCA 2HQWA 1UHKA 2I94A 1E8AA 4IL1A 2CTNA 4PALA 3DF0A 4MEWA 2B1UA 1IJ5A 2LHLA 1B4CA 1B8LA 3E3RA 3EKJA 3SG2A 2M7NA 1SBJA 3BXKA 3VROA 3D0YB 1J7OA 2LC5A 4N5XA 4C0LA 1NCYA 3PATA 3NSKA 1A03A 1J1EA 4P2YB 4CLNA 4QJ3B 2KAYA 2LVVA 1K96A 2K8MB 1CM1A 3AAJA 1SNLA 3GK4X 1MR8A 1JSAA 1OSAA 1QLKA 3SIBA 1QV1A 2O60A 1S1EA 2BBNA 5AERA 3BOWB 5G08A 2V53A 1TCOB 1L2OC 2PRUA 5J3XA 1OMRA 1SR6B 3BUOB 1CFPA 1ZOTB 2JU0A 3CTNA 2KAXA 1K9PA 1XFZO 1DGUA 1TNPA 1JFJA 3NSLA 1LXFC 1L2OB 3OB1B 1ZACA 3BOWA 2GGZA 1SK6D 3VRRA 4CFRA 1F4OA 2LUCA 4JPZB 2HETA 1NCXA 1RECA 2KI4C 1OZOA 1UUSA 4XJKB 2F33A 4HRGA 2BKIB 4P5OE 3SG3A 3OP0A 2LMTA 1XK4A 1KFXS 4YGBB 1BODA 4NDDA 4UPGA 2QPTA 2NZ0A 1SMGA 4DIRA 1EL4A 5KSZA 1BLQA 1YUTA 3I5GC 3PFVA 1Y1XA 5DKQA 3BUXB 1QTXA 1CDMA 3DVEA 4M2QA 1H8BA 2O5GA 2JOJA 1S3PA 2ZNEA 3PSRA 1XYDA 3RM1A 2PMYA 1YTZC 1JWDA 1SY9A 2ZN8A 2E30A 2JPTA 4GNKB 1LINA 4NDCA 2KGBC 1F70A 1RFJA 1K90D 1K93D 2KFHA 1NUBA 4I5KA 1XFYO 3SG5A 1XVJA 4M2PA 1EH2A 1N0YA 1LKJA 1QVIZ 1NCZA 3JTDC 3NSOA 4GUKA 1TNWA 1LA3A 2L5XB 4MZLA 2LUXA 3SG4A 1Q80A 1SYMA 1GGZA 5TNCA 3AKAA 1SL9A 3TUYB 1JF2A 1ZMZA 2PVBA 2JZIA 1DVIA 1KK7Y 1NX2A 2BCAA 3BUWB 1XFUO 3O2PA 4N1GA 1SRAA 2CXJA 1ALVA 1UP5A 1WRKA 2M97A 2BE4A 2Y5IA 3TDZA 1DJHA 2HPSA 1KCYA 4PHJA 1LVCD 1WLMA 4GGFC 4WQ2A 2NCOA 5DKNA 1MXLC 4L9MA 1SCMB 1K9KA 1KQMC 1BG1A 1IWQA 3FWCA 5CSNA 2WCEA 1B8RA 2KQ6A 1NP8A 1JC2A 3HCMA 4GFTA 2ZFDA 2CCMA 1JFKA 2LLUA 2ZRTA 3OX6A 5CSJA 1J1DA 2L4HA 1KQMB 1KK7Z 3GK1A 3NXAA 2FCDA 3I5HB 2L4IA 1CM4A 2LP2A 3VRNA 3M0WA 2JQ6A 1K95A 1VRKA 1TTXA 3BYAA 1CFDA 4GGFA 4NDBA 4MZJA 2Y1MA 5K89A 1NIWA 1OQPA 2I18A 2R2IA 3DF0B 3O6BA 1KK8C 4PHMA 1F55A 2COLB 2M29A 3DVJA 2LLSA 1R2UA 2FCEA 2NCPA 1TOPA 2OPOA 5HLVA 2Q91A 2F2OA 1KWOC 1IG5A 1CFFA 4GGNA 2ZN9A 1KK8B 1N65A 4GBAA 1SL8A 1DMOA 4YGAA 2LVJA 2LM5A 3HX4A 5B8IB 1G33A 4HREE 5HYDA 2NLNA 1PSRA 1MUXA 2SCPA 1QASA 5ER4X 1HQVA 4I5LB 2M1KB 2CNPA 3AKBA 2BCBA 1AJ5A 1LA0A 1B8CA 1QV0A 2JT8A 2KDHA 2BL0C 4DUQA 3OB2B 1GGWA 2KAVA 1OE9B 4PHNA 1Y1AA 1QATA 3BUNB 3VRQA 4ZCVA 3CR2A 1MHOA 3JVTC 2BL0B 2L0PA 1XK4C 2LANA 1UHJA 1CB1A 2K7CA 1TNXA 2BE6A 1TNQA 2LAPA 1XA5A 2KI6D 3DVKA 4OV2A 2JRFA 1QXPA 1C7VA 3A4UB 1ZFSA 2P6BB 3ICBA 5AANA 1H4BA 1DTLA 1YX7A 1AVSA 4DS7A 1QLSA 3O78A 1FF1A 1DF0A 2WORA 4PE1A 3DVMA 1PSBA 1DGVA 2F8PA 4M2OA 1UURA 3F45A 4D1EA 1YURA 4ORCB 2ZKMX 3ZWHA 1M46A 5HLOA 2KI4B 4ETOA 1F8HA 5CSFA 2WNDA 3LK1A 1RROA 2WOSA 1DJWA 1DJYA 3WXAA 3EKHA 3SJSA 2PSRA 1IQ3A 3QRXA 2LMVA 2KGRA 2MLFC 5AFPA 1Y6WA 2KFFA 1CFCA 3EK7A 3I5GB 3CR5X 3FWBA 1PVAA 1BMOA 3CLNA 2M8UA 4PE7A 2K2FA 3PN7C 3LK0A 2EC6C 2L51A 2Y4QA 5KU1A 1M31A 1NX3A 1SCVA 2KSPA 3KEVA 3LL8B 2KHNA 2MRDA 3TZ1A 2G9BA 4WRIA 2LVKA 1A29A 2JNFA 1CKKA 2LNKA 4YGCB 3PN7B 1DJXA 2EC6B 1A2XA 1CDPA 1CMGA 2QACA 2JT0A 2DOQA 2ZNDA 3JTDB 1WDCC 2EHBA 2L50A 4MN0A 5AXIA 2JXLA 1QX2A 1AHRA 4QJ4B 1KQVA 4BY4A 2BCXA 4E68A 1KFUS 2BKHB 4QJ5B 4NQGA 1YVLA 3O4YA 4ZCUA 3RLZA 2M0RA 2FJUB 1WDCB 1G8IA 3AAKA 1A75B 1F54A 3PM8A 1UWOA 1BJFA 5JJGA 1YUSA 2BBMA 1XO5A 1AP4A 3IQQA 3C1VA 1WRLA 1B9AA 4YGDB 2K7OA 1QIWA 2MHHA 2MJWB 4TNCA 3VGOA 1QS7A 1YX8A 1MQ1A 1Y0VH 2F3ZA 5DKRA 2FOTA 1JUOA 1KFXL 1MWNA 2AUCA 1S5GY 2JTZA 2M49B 1A75A 1BF5A 3OHMB 3CWGA 4PE0A 1GJYA 2Q4UA 1NX0A 1D1OA 3WHTB 3EVVA 2MAZA 2TN4A 1PK0D 1V1GA 2L2EA 1NYAA 4GAOA 1ZUZA 1W7IB 1WRZA 2MLEC 4ICBA 3WNXB 2JXCA 3CS1A 3PLFB 2M1UA 1EG3A 1QX7A 1SKTA 2M7LA 4F0ZB 2ZRSA 1CNPA 1YVHA 3TS5C 5AEQA 1AJ4A 1S5GZ 1JBAA 1CLMA 4YRUA 3EVUA 1PRWA 4WQ3A 1NX1A 1CLLA 2JT3A 4U8DA 3TS5B 3LLEA 1KWOB 2L98A 3OX5A 4FTGA 1WY9A 5D7FA 3SIAA 2Y1NA 5ER5A 5HKZA 1DJIA 1K9UA 1ODBA 2F2PA 4YI9A 1IRJA 1FW4A 4HRHA 2KOTA 1J7PA 1HT9A 1MXEA 1CTRA 2WCBA 5I2LA 1CMFA 4MLWA 1PVBA 1YR5A 2M3WA 1M63B 1KSMA 2I2RE 1DF0B 1M45A 5D69A 1RJVA 1ALWA 1RWYA 2HQ8A 3WHUB 4PCWA 3JVTB 2MBXA 1YRTB 4OKHA 3CR4X 5BPJA 1XFVO 1MF8B 5I2QA 5IBWA 1IKUA 2E6WA 2PASA 5FYXA 1NSHA 2I7AA 2ISDA 1TN4A 5HKWA 3KF9A 1CDNA 4MSPA 1FBVA 1YUUA 3EK4A 3A8RA 3D0YA 1SR6C 1S6JA 4I5NB 5I8NA 3CGAA 4Q04A 4R1EA 1K8UA 4YBHB 2HF5A 2LMUA 3IQOA 1YRUB 5HKYA 3PALA 4AQJA 1AUIB 1X02A 1R6PA 2K61A 2AMIA 4MRYA 1U5IB 1CDLA 4OVNF 1IH0A 4FQOA 2A4JA 1EG4A 1OMVA 2K7DA 4ORBB 1Y1UA 5GQQC 2OTGC 1J7RA 3KHEA 4PDZA 5CPVA 1J7QA 1K2HA 3SG7A 1V1FA 2H2KA 3KPXA 3KO0A 4BY5A 2KQYA 2PALA 1TIZA 1C07A 1U5IA 4MZKA 1IGVA 5CSIA 2OTGB 2KBMA 4PE4A 1QVIY 1DJGA 2KBIA 1QJTA 2K7BA 4C0JA 4AOMA 1B1GA 4XJKA 4OR9B 1M39A 1BU3A 2F3YA 3TDUA 2H61C 2IS9A 2NXQA 2LHIA 2WCFA 3SG6A 1XFWO 4OCIA 2CBLA 4AQIA 2G2BA 1S6IA 1AK8A 2JULA 1B7TY 3K21A 4YGEB 2LLTA 1GQMA 2WC8A 4MBEA 2JTTA 2CT9A 2EGDA 1JF0A 4CIDA 2LCPA 3TDIA 4USLA 3TUYC 1OMDA 1PULA 1B47A 3CZTX 1FPWA 1EJ3A 1IJ6A 1A4PA 4JWQA 4XYNA 3EK8A 5I2OA 4HSZA 4ORAB 1OZSA 4JQ0D 1SPYA 1DJZA 4A4CA 3NSIA 2H61A 2M9GA 3FS7A 2VRGA 2D8NA 1EXRA 2JC2A 3BUMB 4A4BA 1NPQA 4CPVA 2LV7A 1N2DA 2BECA 1UHHA 5JOLA 1B7TZ 1UHIA 2JWWA 1SCMC 2LE9B 1RTP1 1QX5B 2KFGA 1CLBA 3DD4A 2RGIA 1S26D 1L7ZA 1TRFA 1F4QA 3VRPA 1G4YR 4C0KA 3MSEB 5KTYA 1WLZA 3I5IC 4YI8A 1C7WA 1DT7B 2SASA 4N1FA 2LVIA 3I5HC 4GPLB 4DCKA 3BQ3A 1SL7A 2KI6C 1F71A 3LCPC 1TCFA 1FI5A 2K2AA 3GK2A 3H4SE 1BT6A 3I5IB 2OS8C 3I5FC 2KYFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BR4 B;  4DRW A;  1S36 A;  1UHN A;  2LP3 A;  1BOC A;  3D10 A;  2KNE A;  3FIA A;  1FI6 A;  3GOF A;  1IQ5 A;  1BR1 B;  4PHK A;  3IF7 A;  4MVF A;  1RK9 A;  2OS8 B;  1NWD A;  2JNX A;  3I5F B;  4MRX A;  1XFX O;  1SW8 A;  5PAL A;  2MA2 A;  3EVR A;  4I5J A;  2GV5 A;  1PAL A;  1W7J B;  1OOJ A;  1QIV A;  1S6C A;  2AAO A;  3ZNI A;  1KSO A;  1K94 A;  2GGM A;  1J55 A;  1KFU L;  4CFQ A;  2K0J A;  5F6T A;  2KYC A;  2HQW A;  1UHK A;  2I94 A;  1E8A A;  4IL1 A;  2CTN A;  4PAL A;  3DF0 A;  4MEW A;  2B1U A;  1IJ5 A;  2LHL A;  1B4C A;  1B8L A;  3E3R A;  3EKJ A;  3SG2 A;  2M7N A;  1SBJ A;  3BXK A;  3VRO A;  3D0Y B;  1J7O A;  2LC5 A;  4N5X A;  4C0L A;  1NCY A;  3PAT A;  3NSK A;  1A03 A;  1J1E A;  4P2Y B;  4CLN A;  4QJ3 B;  2KAY A;  2LVV A;  1K96 A;  2K8M B;  1CM1 A;  3AAJ A;  1SNL A;  3GK4 X;  1MR8 A;  1JSA A;  1OSA A;  1QLK A;  3SIB A;  1QV1 A;  2O60 A;  1S1E A;  2BBN A;  5AER A;  3BOW B;  5G08 A;  2V53 A;  1TCO B;  1L2O C;  2PRU A;  5J3X A;  1OMR A;  1SR6 B;  3BUO B;  1CFP A;  1ZOT B;  2JU0 A;  3CTN A;  2KAX A;  1K9P A;  1XFZ O;  1DGU A;  1TNP A;  1JFJ A;  3NSL A;  1LXF C;  1L2O B;  3OB1 B;  1ZAC A;  3BOW A;  2GGZ A;  1SK6 D;  3VRR A;  4CFR A;  1F4O A;  2LUC A;  4JPZ B;  2HET A;  1NCX A;  1REC A;  2KI4 C;  1OZO A;  1UUS A;  4XJK B;  2F33 A;  4HRG A;  2BKI B;  4P5O E;  3SG3 A;  3OP0 A;  2LMT A;  1XK4 A;  1KFX S;  4YGB B;  1BOD A;  4NDD A;  4UPG A;  2QPT A;  2NZ0 A;  1SMG A;  4DIR A;  1EL4 A;  5KSZ A;  1BLQ A;  1YUT A;  3I5G C;  3PFV A;  1Y1X A;  5DKQ A;  3BUX B;  1QTX A;  1CDM A;  3DVE A;  4M2Q A;  1H8B A;  2O5G A;  2JOJ A;  1S3P A;  2ZNE A;  3PSR A;  1XYD A;  3RM1 A;  2PMY A;  1YTZ C;  1JWD A;  1SY9 A;  2ZN8 A;  2E30 A;  2JPT A;  4GNK B;  1LIN A;  4NDC A;  2KGB C;  1F70 A;  1RFJ A;  1K90 D;  1K93 D;  2KFH A;  1NUB A;  4I5K A;  1XFY O;  3SG5 A;  1XVJ A;  4M2P A;  1EH2 A;  1N0Y A;  1LKJ A;  1QVI Z;  1NCZ A;  3JTD C;  3NSO A;  4GUK A;  1TNW A;  1LA3 A;  2L5X B;  4MZL A;  2LUX A;  3SG4 A;  1Q80 A;  1SYM A;  1GGZ A;  5TNC A;  3AKA A;  1SL9 A;  3TUY B;  1JF2 A;  1ZMZ A;  2PVB A;  2JZI A;  1DVI A;  1KK7 Y;  1NX2 A;  2BCA A;  3BUW B;  1XFU O;  3O2P A;  4N1G A;  1SRA A;  2CXJ A;  1ALV A;  1UP5 A;  1WRK A;  2M97 A;  2BE4 A;  2Y5I A;  3TDZ A;  1DJH A;  2HPS A;  1KCY A;  4PHJ A;  1LVC D;  1WLM A;  4GGF C;  4WQ2 A;  2NCO A;  5DKN A;  1MXL C;  4L9M A;  1SCM B;  1K9K A;  1KQM C;  1BG1 A;  1IWQ A;  3FWC A;  5CSN A;  2WCE A;  1B8R A;  2KQ6 A;  1NP8 A;  1JC2 A;  3HCM A;  4GFT A;  2ZFD A;  2CCM A;  1JFK A;  2LLU A;  2ZRT A;  3OX6 A;  5CSJ A;  1J1D A;  2L4H A;  1KQM B;  1KK7 Z;  3GK1 A;  3NXA A;  2FCD A;  3I5H B;  2L4I A;  1CM4 A;  2LP2 A;  3VRN A;  3M0W A;  2JQ6 A;  1K95 A;  1VRK A;  1TTX A;  3BYA A;  1CFD A;  4GGF A;  4NDB A;  4MZJ A;  2Y1M A;  5K89 A;  1NIW A;  1OQP A;  2I18 A;  2R2I A;  3DF0 B;  3O6B A;  1KK8 C;  4PHM A;  1F55 A;  2COL B;  2M29 A;  3DVJ A;  2LLS A;  1R2U A;  2FCE A;  2NCP A;  1TOP A;  2OPO A;  5HLV A;  2Q91 A;  2F2O A;  1KWO C;  1IG5 A;  1CFF A;  4GGN A;  2ZN9 A;  1KK8 B;  1N65 A;  4GBA A;  1SL8 A;  1DMO A;  4YGA A;  2LVJ A;  2LM5 A;  3HX4 A;  5B8I B;  1G33 A;  4HRE E;  5HYD A;  2NLN A;  1PSR A;  1MUX A;  2SCP A;  1QAS A;  5ER4 X;  1HQV A;  4I5L B;  2M1K B;  2CNP A;  3AKB A;  2BCB A;  1AJ5 A;  1LA0 A;  1B8C A;  1QV0 A;  2JT8 A;  2KDH A;  2BL0 C;  4DUQ A;  3OB2 B;  1GGW A;  2KAV A;  1OE9 B;  4PHN A;  1Y1A A;  1QAT A;  3BUN B;  3VRQ A;  4ZCV A;  3CR2 A;  1MHO A;  3JVT C;  2BL0 B;  2L0P A;  1XK4 C;  2LAN A;  1UHJ A;  1CB1 A;  2K7C A;  1TNX A;  2BE6 A;  1TNQ A;  2LAP A;  1XA5 A;  2KI6 D;  3DVK A;  4OV2 A;  2JRF A;  1QXP A;  1C7V A;  3A4U B;  1ZFS A;  2P6B B;  3ICB A;  5AAN A;  1H4B A;  1DTL A;  1YX7 A;  1AVS A;  4DS7 A;  1QLS A;  3O78 A;  1FF1 A;  1DF0 A;  2WOR A;  4PE1 A;  3DVM A;  1PSB A;  1DGV A;  2F8P A;  4M2O A;  1UUR A;  3F45 A;  4D1E A;  1YUR A;  4ORC B;  2ZKM X;  3ZWH A;  1M46 A;  5HLO A;  2KI4 B;  4ETO A;  1F8H A;  5CSF A;  2WND A;  3LK1 A;  1RRO A;  2WOS A;  1DJW A;  1DJY A;  3WXA A;  3EKH A;  3SJS A;  2PSR A;  1IQ3 A;  3QRX A;  2LMV A;  2KGR A;  2MLF C;  5AFP A;  1Y6W A;  2KFF A;  1CFC A;  3EK7 A;  3I5G B;  3CR5 X;  3FWB A;  1PVA A;  1BMO A;  3CLN A;  2M8U A;  4PE7 A;  2K2F A;  3PN7 C;  3LK0 A;  2EC6 C;  2L51 A;  2Y4Q A;  5KU1 A;  1M31 A;  1NX3 A;  1SCV A;  2KSP A;  3KEV A;  3LL8 B;  2KHN A;  2MRD A;  3TZ1 A;  2G9B A;  4WRI A;  2LVK A;  1A29 A;  2JNF A;  1CKK A;  2LNK A;  4YGC B;  3PN7 B;  1DJX A;  2EC6 B;  1A2X A;  1CDP A;  1CMG A;  2QAC A;  2JT0 A;  2DOQ A;  2ZND A;  3JTD B;  1WDC C;  2EHB A;  2L50 A;  4MN0 A;  5AXI A;  2JXL A;  1QX2 A;  1AHR A;  4QJ4 B;  1KQV A;  4BY4 A;  2BCX A;  4E68 A;  1KFU S;  2BKH B;  4QJ5 B;  4NQG A;  1YVL A;  3O4Y A;  4ZCU A;  3RLZ A;  2M0R A;  2FJU B;  1WDC B;  1G8I A;  3AAK A;  1A75 B;  1F54 A;  3PM8 A;  1UWO A;  1BJF A;  5JJG A;  1YUS A;  2BBM A;  1XO5 A;  1AP4 A;  3IQQ A;  3C1V A;  1WRL A;  1B9A A;  4YGD B;  2K7O A;  1QIW A;  2MHH A;  2MJW B;  4TNC A;  3VGO A;  1QS7 A;  1YX8 A;  1MQ1 A;  1Y0V H;  2F3Z A;  5DKR A;  2FOT A;  1JUO A;  1KFX L;  1MWN A;  2AUC A;  1S5G Y;  2JTZ A;  2M49 B;  1A75 A;  1BF5 A;  3OHM B;  3CWG A;  4PE0 A;  1GJY A;  2Q4U A;  1NX0 A;  1D1O A;  3WHT B;  3EVV A;  2MAZ A;  2TN4 A;  1PK0 D;  1V1G A;  2L2E A;  1NYA A;  4GAO A;  1ZUZ A;  1W7I B;  1WRZ A;  2MLE C;  4ICB A;  3WNX B;  2JXC A;  3CS1 A;  3PLF B;  2M1U A;  1EG3 A;  1QX7 A;  1SKT A;  2M7L A;  4F0Z B;  2ZRS A;  1CNP A;  1YVH A;  3TS5 C;  5AEQ A;  1AJ4 A;  1S5G Z;  1JBA A;  1CLM A;  4YRU A;  3EVU A;  1PRW A;  4WQ3 A;  1NX1 A;  1CLL A;  2JT3 A;  4U8D A;  3TS5 B;  3LLE A;  1KWO B;  2L98 A;  3OX5 A;  4FTG A;  1WY9 A;  5D7F A;  3SIA A;  2Y1N A;  5ER5 A;  5HKZ A;  1DJI A;  1K9U A;  1ODB A;  2F2P A;  4YI9 A;  1IRJ A;  1FW4 A;  4HRH A;  2KOT A;  1J7P A;  1HT9 A;  1MXE A;  1CTR A;  2WCB A;  5I2L A;  1CMF A;  4MLW A;  1PVB A;  1YR5 A;  2M3W A;  1M63 B;  1KSM A;  2I2R E;  1DF0 B;  1M45 A;  5D69 A;  1RJV A;  1ALW A;  1RWY A;  2HQ8 A;  3WHU B;  4PCW A;  3JVT B;  2MBX A;  1YRT B;  4OKH A;  3CR4 X;  5BPJ A;  1XFV O;  1MF8 B;  5I2Q A;  5IBW A;  1IKU A;  2E6W A;  2PAS A;  5FYX A;  1NSH A;  2I7A A;  2ISD A;  1TN4 A;  5HKW A;  3KF9 A;  1CDN A;  4MSP A;  1FBV A;  1YUU A;  3EK4 A;  3A8R A;  3D0Y A;  1SR6 C;  1S6J A;  4I5N B;  5I8N A;  3CGA A;  4Q04 A;  4R1E A;  1K8U A;  4YBH B;  2HF5 A;  2LMU A;  3IQO A;  1YRU B;  5HKY A;  3PAL A;  4AQJ A;  1AUI B;  1X02 A;  1R6P A;  2K61 A;  2AMI A;  4MRY A;  1U5I B;  1CDL A;  4OVN F;  1IH0 A;  4FQO A;  2A4J A;  1EG4 A;  1OMV A;  2K7D A;  4ORB B;  1Y1U A;  5GQQ C;  2OTG C;  1J7R A;  3KHE A;  4PDZ A;  5CPV A;  1J7Q A;  1K2H A;  3SG7 A;  1V1F A;  2H2K A;  3KPX A;  3KO0 A;  4BY5 A;  2KQY A;  2PAL A;  1TIZ A;  1C07 A;  1U5I A;  4MZK A;  1IGV A;  5CSI A;  2OTG B;  2KBM A;  4PE4 A;  1QVI Y;  1DJG A;  2KBI A;  1QJT A;  2K7B A;  4C0J A;  4AOM A;  1B1G A;  4XJK A;  4OR9 B;  1M39 A;  1BU3 A;  2F3Y A;  3TDU A;  2H61 C;  2IS9 A;  2NXQ A;  2LHI A;  2WCF A;  3SG6 A;  1XFW O;  4OCI A;  2CBL A;  4AQI A;  2G2B A;  1S6I A;  1AK8 A;  2JUL A;  1B7T Y;  3K21 A;  4YGE B;  2LLT A;  1GQM A;  2WC8 A;  4MBE A;  2JTT A;  2CT9 A;  2EGD A;  1JF0 A;  4CID A;  2LCP A;  3TDI A;  4USL A;  3TUY C;  1OMD A;  1PUL A;  1B47 A;  3CZT X;  1FPW A;  1EJ3 A;  1IJ6 A;  1A4P A;  4JWQ A;  4XYN A;  3EK8 A;  5I2O A;  4HSZ A;  4ORA B;  1OZS A;  4JQ0 D;  1SPY A;  1DJZ A;  4A4C A;  3NSI A;  2H61 A;  2M9G A;  3FS7 A;  2VRG A;  2D8N A;  1EXR A;  2JC2 A;  3BUM B;  4A4B A;  1NPQ A;  4CPV A;  2LV7 A;  1N2D A;  2BEC A;  1UHH A;  5JOL A;  1B7T Z;  1UHI A;  2JWW A;  1SCM C;  2LE9 B;  1RTP 1;  1QX5 B;  2KFG A;  1CLB A;  3DD4 A;  2RGI A;  1S26 D;  1L7Z A;  1TRF A;  1F4Q A;  3VRP A;  1G4Y R;  4C0K A;  3MSE B;  5KTY A;  1WLZ A;  3I5I C;  4YI8 A;  1C7W A;  1DT7 B;  2SAS A;  4N1F A;  2LVI A;  3I5H C;  4GPL B;  4DCK A;  3BQ3 A;  1SL7 A;  2KI6 C;  1F71 A;  3LCP C;  1TCF A;  1FI5 A;  2K2A A;  3GK2 A;  3H4S E;  1BT6 A;  3I5I B;  2OS8 C;  3I5F C;  2KYF A; 
#chains in the Genus database with same CATH topology
 1BR4 B;  4DRW A;  1S36 A;  1UHN A;  2LP3 A;  3Q8I A;  1BOC A;  3D10 A;  2KNE A;  3FIA A;  1FI6 A;  3GOF A;  1OOI X;  1QWV A;  1IQ5 A;  1BR1 B;  4PHK A;  3IF7 A;  4MVF A;  1RK9 A;  2OS8 B;  1NWD A;  2JNX A;  3I5F B;  4MRX A;  3S0D A;  3EG5 B;  1XFX O;  1SW8 A;  5PAL A;  3OBV A;  2MA2 A;  3EVR A;  4I5J A;  4IJ7 A;  2GV5 A;  1PAL A;  1W7J B;  1OOJ A;  1QIV A;  1S6C A;  2AAO A;  3UO9 A;  3ZNI A;  1KSO A;  1K94 A;  2GGM A;  1J55 A;  1KFU L;  4CFQ A;  2K0J A;  5F6T A;  2KYC A;  2HQW A;  1UHK A;  2I94 A;  1E8A A;  4IL1 A;  2CTN A;  3L47 A;  3DF0 A;  4MEW A;  4PAL A;  2B1U A;  1IJ5 A;  2LHL A;  1B4C A;  1B8L A;  3E3R A;  3EKJ A;  3SG2 A;  2M7N A;  1SBJ A;  3BXK A;  3VRO A;  3D0Y B;  1J7O A;  2LC5 A;  4N5X A;  4C0L A;  1NCY A;  3PAT A;  3NSK A;  1A03 A;  2WCJ A;  1J1E A;  2WCM A;  4P2Y B;  4CLN A;  4QJ3 B;  2KAY A;  2LVV A;  1K96 A;  2K8M B;  1CM1 A;  3AAJ A;  1SNL A;  3GK4 X;  1MR8 A;  1JSA A;  1OSA A;  1QLK A;  3SIB A;  1QV1 A;  2O60 A;  1S1E A;  2BBN A;  5AER A;  3BOW B;  5G08 A;  3DYE A;  2V53 A;  1TCO B;  1L2O C;  3O4X A;  2PRU A;  5J3X A;  1OMR A;  1SR6 B;  3BUO B;  1CFP A;  1ZOT B;  2JU0 A;  3CTN A;  3FE9 A;  2QEB A;  2KAX A;  1K9P A;  1XFZ O;  1DGU A;  1TNP A;  1JFJ A;  3NSL A;  1LXF C;  1L2O B;  3OB1 B;  1ZAC A;  1T14 A;  2GGZ A;  3BOW A;  1SK6 D;  3VRR A;  1Z2C B;  4CFR A;  1F4O A;  2LUC A;  4JPZ B;  2HET A;  1NCX A;  1REC A;  2KI4 C;  1OZO A;  3BFA A;  1UUS A;  4XJK B;  2F33 A;  4HRG A;  2BKI B;  4P5O E;  3SG3 A;  3OP0 A;  1TUZ A;  2LMT A;  4JKT A;  1XK4 A;  1KFX S;  4YGB B;  1BOD A;  4NDD A;  4UPG A;  3DXL A;  2QPT A;  2NZ0 A;  1SMG A;  4DIR A;  1EL4 A;  3N7H A;  5KSZ A;  1BLQ A;  1YUT A;  3NHI A;  3B87 A;  3I5G C;  3PFV A;  1Y1X A;  5DKQ A;  3OGN A;  3BUX B;  1QTX A;  1CDM A;  3DVE A;  4M2Q A;  1H8B A;  2O5G A;  2JOJ A;  1S3P A;  2ZNE A;  3PSR A;  1XYD A;  3IVT A;  2PMY A;  3RM1 A;  1YTZ C;  1JWD A;  1SY9 A;  2ZN8 A;  2E30 A;  2JPT A;  4GNK B;  1LIN A;  1XFR A;  4NDC A;  2KGB C;  1F70 A;  1RFJ A;  1K90 D;  1K93 D;  2KFH A;  5FI6 A;  1NUB A;  4I5K A;  1XFY O;  3SG5 A;  1XVJ A;  4M2P A;  1EH2 A;  1N0Y A;  1LKJ A;  1QVI Z;  1NCZ A;  3JTD C;  3NSO A;  4GUK A;  2JPO A;  1TNW A;  1LA3 A;  2L5X B;  3D77 A;  2LUX A;  4MZL A;  1Q80 A;  3SG4 A;  1SYM A;  1GGZ A;  5TNC A;  3AKA A;  1SL9 A;  3TUY B;  1JF2 A;  1ZMZ A;  2PVB A;  2WCL A;  4PT1 A;  2JZI A;  1DVI A;  1KK7 Y;  1NX2 A;  2BCA A;  3BUW B;  1XFU O;  3O2P A;  4N1G A;  1SRA A;  2CXJ A;  1ALV A;  1UP5 A;  1WRK A;  2M97 A;  2BE4 A;  2Y5I A;  3TDZ A;  1IIO A;  1DJH A;  2HPS A;  1KCY A;  4PHJ A;  1LVC D;  1WLM A;  4GGF C;  4WQ2 A;  2NCO A;  5DKN A;  5FI7 A;  1MXL C;  4L9M A;  1SCM B;  1OOH A;  1K9K A;  1KQM C;  1BG1 A;  1IWQ A;  3FWC A;  5CSN A;  2WCE A;  1B8R A;  2KQ6 A;  1NP8 A;  1JC2 A;  3HCM A;  1TUJ A;  4GFT A;  2ZFD A;  2CCM A;  3PM2 A;  1JFK A;  2LLU A;  2ZRT A;  3OX6 A;  2L5Y A;  5CSJ A;  1J1D A;  2L4H A;  1KQM B;  1KK7 Z;  3GK1 A;  3NXA A;  2FCD A;  3I5H B;  1W9Z A;  1OOG A;  2L4I A;  1CM4 A;  2LP2 A;  3NGV A;  3M0W A;  3VRN A;  5I94 A;  2JQ6 A;  1K95 A;  1VRK A;  1TTX A;  3BYA A;  1CFD A;  2P70 A;  4GGF A;  2QEH A;  3S0F A;  4NDB A;  4MZJ A;  5HL1 A;  2Y1M A;  5K89 A;  1NIW A;  1OQP A;  2I18 A;  2R2I A;  3DF0 B;  3O6B A;  3BFB A;  1KK8 C;  2ERB A;  4PHM A;  1F55 A;  2COL B;  2M29 A;  3DVJ A;  2LLS A;  1R2U A;  2FCE A;  2NCP A;  1TOP A;  1DC1 A;  2OPO A;  5HLV A;  2Q91 A;  2F2O A;  1KWO C;  1IG5 A;  3S0A A;  1CFF A;  4GGN A;  2ZN9 A;  1KK8 B;  1N65 A;  4GBA A;  1GM0 A;  1SL8 A;  3BJH A;  1DMO A;  4YGA A;  2LVJ A;  2LM5 A;  3D75 A;  3UNW A;  3HX4 A;  5B8I B;  1G33 A;  4HRE E;  5HYD A;  2NLN A;  1PSR A;  1MUX A;  2SCP A;  1QAS A;  5ER4 X;  1HQV A;  4I5L B;  2M1K B;  2CNP A;  3AKB A;  2BCB A;  1AJ5 A;  1LA0 A;  1B8C A;  1QV0 A;  2JT8 A;  2KDH A;  1P28 A;  2BL0 C;  4DUQ A;  3OB2 B;  3B7A A;  1GGW A;  2KAV A;  1OE9 B;  3L4L A;  4PHN A;  1Y1A A;  1QAT A;  3BUN B;  3VRQ A;  4ZCV A;  3CR2 A;  1MHO A;  3L4A A;  3JVT C;  2BL0 B;  1OW4 A;  2L0P A;  1XK4 C;  2LAN A;  1UHJ A;  1CB1 A;  2K7C A;  1TNX A;  2BE6 A;  1TNQ A;  2LAP A;  3DZT A;  1XA5 A;  2KI6 D;  3DVK A;  4OV2 A;  2JRF A;  1QXP A;  1C7V A;  3A4U B;  1ZFS A;  2P6B B;  3ICB A;  4INW A;  5AAN A;  1H4B A;  1DTL A;  1YX7 A;  1AVS A;  4DS7 A;  1QLS A;  2H8V A;  3O78 A;  1FF1 A;  1DF0 A;  2WOR A;  4PE1 A;  3FE8 A;  3DVM A;  2BAP A;  2PYQ A;  1PSB A;  2QEV A;  1DGV A;  2F8P A;  4M2O A;  1UUR A;  3F45 A;  4D1E A;  1YUR A;  4ORC B;  2ZKM X;  3ZWH A;  1M46 A;  5HLO A;  2QDI A;  2KI4 B;  3SS3 A;  4ETO A;  1F8H A;  5CSF A;  2WND A;  3LK1 A;  1RRO A;  2WOS A;  1DJW A;  1DJY A;  3WXA A;  3EKH A;  3SJS A;  2PSR A;  3CZ1 A;  3QRX A;  1IQ3 A;  2LMV A;  2KGR A;  2MLF C;  5AFP A;  1Y6W A;  3R72 A;  2KFF A;  1CFC A;  5EL2 A;  3SS5 A;  2L2C A;  3EK7 A;  3I5G B;  3CR5 X;  3FWB A;  1PVA A;  1BMO A;  3CLN A;  2M8U A;  4PE7 A;  2K2F A;  3PN7 C;  3LK0 A;  2PQL A;  2EC6 C;  2L51 A;  2Y4Q A;  5KU1 A;  1M31 A;  1NX3 A;  5D3O A;  1SCV A;  2KSP A;  3KEV A;  2WCK A;  2KHN A;  2MRD A;  3LL8 B;  3TZ1 A;  2G9B A;  4WRI A;  2LVK A;  1A29 A;  2JNF A;  1CKK A;  2P71 A;  2LNK A;  4YGC B;  3PN7 B;  1DJX A;  2EC6 B;  1A2X A;  1CDP A;  1CMG A;  2QAC A;  2JT0 A;  2DOQ A;  2ZND A;  3JTD B;  1WDC C;  2EHB A;  2L50 A;  4MN0 A;  5AXI A;  2JXL A;  1QX2 A;  1AHR A;  4QJ4 B;  2BNX A;  2WC6 A;  3R1P A;  1KQV A;  4BY4 A;  2BCX A;  4E68 A;  1KFU S;  2BKH B;  4QJ5 B;  4NQG A;  1YVL A;  3O4Y A;  4ZCU A;  3B88 A;  3RLZ A;  2M0R A;  1SSE B;  2FJU B;  1WDC B;  1G8I A;  3AAK A;  1A75 B;  4OZD A;  1F54 A;  3PM8 A;  1UWO A;  1BJF A;  2WCH A;  5JJG A;  1YUS A;  2BBM A;  1XO5 A;  1Z4H A;  3IQQ A;  3C1V A;  1AP4 A;  1WRL A;  1B9A A;  4YGD B;  2K60 A;  2K7O A;  1QIW A;  2MHH A;  2MJW B;  4TNC A;  3VGO A;  1QS7 A;  1YX8 A;  1MQ1 A;  1Y0V H;  2F3Z A;  5DKR A;  2FOT A;  1JUO A;  1KFX L;  1MWN A;  2AUC A;  1S5G Y;  2JTZ A;  2M49 B;  1A75 A;  1BF5 A;  3OHM B;  3CWG A;  4PE0 A;  1GJY A;  2Q4U A;  1NX0 A;  1D1O A;  3WHT B;  3CAB A;  3EVV A;  2MAZ A;  2TN4 A;  1PK0 D;  1V1G A;  2L2E A;  1NYA A;  4GAO A;  1ZUZ A;  4JD9 A;  1W7I B;  1WRZ A;  2MLE C;  4ICB A;  3WNX B;  2JXC A;  3CS1 A;  3PLF B;  3CZ0 A;  2M1U A;  3D78 A;  1EG3 A;  1QX7 A;  1SKT A;  2M7L A;  3V2L A;  4F0Z B;  2ZRS A;  1CNP A;  1YVH A;  2FJY A;  3TS5 C;  5AEQ A;  1AJ4 A;  1S5G Z;  3SS4 A;  1JBA A;  1DEK A;  1CLM A;  4KYN A;  4YRU A;  3EVU A;  1PRW A;  3R1O A;  5DIC A;  4WQ3 A;  1NX1 A;  1CLL A;  2JT3 A;  4U8D A;  3TS5 B;  3LLE A;  2WC5 A;  5FI2 A;  1KWO B;  2L98 A;  3OX5 A;  4FTG A;  1WY9 A;  5D7F A;  3SIA A;  2Y1N A;  5ER5 A;  5HKZ A;  1DJI A;  1K9U A;  1ODB A;  2F2P A;  4YI9 A;  1IRJ A;  1FW4 A;  4HRH A;  2KOT A;  1C3Z A;  1HT9 A;  1MXE A;  1J7P A;  1CTR A;  2WCB A;  5I2L A;  1CMF A;  1TWO A;  3B6X A;  4MLW A;  1PVB A;  1YR5 A;  2M3W A;  1LS8 A;  1M63 B;  1KSM A;  2I2R E;  1DF0 B;  1M45 A;  5D69 A;  1ORG A;  1RJV A;  2GTE A;  1ALW A;  1RWY A;  2HQ8 A;  3WHU B;  4PCW A;  3FE6 A;  3JVT B;  2MBX A;  1OOF A;  1YRT B;  4OKH A;  3CR4 X;  5BPJ A;  1XFV O;  1MF8 B;  5I2Q A;  5IBW A;  1IKU A;  2E6W A;  2PAS A;  5FYX A;  1NSH A;  2I7A A;  2ISD A;  2KLD A;  1TN4 A;  5HKW A;  3KF9 A;  1CDN A;  3PJI A;  1FBV A;  1YUU A;  3EK4 A;  4MSP A;  3A8R A;  3D0Y A;  1SR6 C;  1S6J A;  4I5N B;  5I8N A;  3CGA A;  4Q04 A;  4R1E A;  1K8U A;  4YBH B;  2HF5 A;  1C3Y A;  3CDN A;  2LMU A;  3IQO A;  1YRU B;  2YGU A;  3NHT A;  5HKY A;  3PAL A;  3S0B A;  4AQJ A;  1AUI B;  1X02 A;  1R6P A;  2K61 A;  2AMI A;  4MRY A;  1U5I B;  3S0E A;  1CDL A;  4OVN F;  1IH0 A;  4FQO A;  2A4J A;  1EG4 A;  1OMV A;  2K7D A;  3B86 A;  4ORB B;  1Y1U A;  5GQQ C;  2OTG C;  1J7R A;  3KHE A;  4PDZ A;  5CPV A;  1J7Q A;  1K2H A;  3SG7 A;  1V1F A;  2H2K A;  3KPX A;  3DY9 A;  3KO0 A;  4BY5 A;  2KQY A;  2PAL A;  1TIZ A;  1C07 A;  4INX A;  1U5I A;  4MZK A;  1IGV A;  3D76 A;  3QME A;  3R1V A;  5CSI A;  2OTG B;  2KBM A;  3BFH A;  4PE4 A;  1QVI Y;  1DJG A;  2KBI A;  1QJT A;  2K7B A;  3K1E A;  4C0J A;  4AOM A;  1B1G A;  4XJK A;  4OR9 B;  1M39 A;  1BU3 A;  2F3Y A;  3TDU A;  2H61 C;  2IS9 A;  2NXQ A;  2LHI A;  2QEO A;  2WCF A;  3SG6 A;  1XFW O;  4OCI A;  2CBL A;  4AQI A;  2G2B A;  1S6I A;  3CYZ A;  1AK8 A;  2JUL A;  1B7T Y;  3D74 A;  3K21 A;  4F7F A;  4YGE B;  2LLT A;  1GQM A;  2WC8 A;  3CZ2 A;  4MBE A;  2JTT A;  2CT9 A;  2EGD A;  1JF0 A;  4CID A;  2LCP A;  3TDI A;  3RZS A;  4USL A;  3TUY C;  1OMD A;  1PUL A;  1B47 A;  3CZT X;  1FPW A;  1EJ3 A;  1IJ6 A;  1A4P A;  4JWQ A;  4XYN A;  3EK8 A;  5I2O A;  4HSZ A;  4ORA B;  1OZS A;  1DEL A;  4JQ0 D;  1SPY A;  1DJZ A;  4A4C A;  3NSI A;  2H61 A;  2KLE A;  2M9G A;  3FS7 A;  2VRG A;  2D8N A;  1EXR A;  2JC2 A;  4FQT A;  3BUM B;  4A4B A;  1NPQ A;  2KPH A;  4CPV A;  3D73 A;  2LV7 A;  1N2D A;  2BEC A;  1UHH A;  5JOL A;  1B7T Z;  1UHI A;  2JWW A;  1SCM C;  2LE9 B;  1RTP 1;  1QX5 B;  2KFG A;  1CLB A;  3DD4 A;  2RGI A;  1S26 D;  1L7Z A;  1TRF A;  3VB1 A;  1F4Q A;  3VRP A;  1G4Y R;  4C0K A;  3MSE B;  3S0G A;  1WLZ A;  5KTY A;  3I5I C;  4YI8 A;  1C7W A;  1DT7 B;  2SAS A;  4N1F A;  2LVI A;  3I5H C;  4GPL B;  4DCK A;  3BQ3 A;  1DQE A;  1SL7 A;  2KI6 C;  1F71 A;  3LCP C;  1TCF A;  1FI5 A;  2K2A A;  3GK2 A;  3H4S E;  1BT6 A;  3I5I B;  2OS8 C;  3I5F C;  2KYF A; 
#chains in the Genus database with same CATH homology
 1BR4 B;  4DRW A;  1S36 A;  1UHN A;  2LP3 A;  1BOC A;  3D10 A;  2KNE A;  3FIA A;  1FI6 A;  3GOF A;  1IQ5 A;  1BR1 B;  4PHK A;  3IF7 A;  4MVF A;  1RK9 A;  2OS8 B;  1NWD A;  2JNX A;  3I5F B;  4MRX A;  1XFX O;  1SW8 A;  5PAL A;  2MA2 A;  3EVR A;  4I5J A;  2GV5 A;  1PAL A;  1W7J B;  1OOJ A;  1QIV A;  1S6C A;  2AAO A;  3ZNI A;  1KSO A;  1K94 A;  2GGM A;  1J55 A;  1KFU L;  4CFQ A;  2K0J A;  5F6T A;  2KYC A;  2HQW A;  1UHK A;  2I94 A;  1E8A A;  4IL1 A;  2CTN A;  4PAL A;  3DF0 A;  4MEW A;  2B1U A;  1IJ5 A;  2LHL A;  1B4C A;  1B8L A;  3E3R A;  3EKJ A;  3SG2 A;  2M7N A;  1SBJ A;  3BXK A;  3VRO A;  3D0Y B;  1J7O A;  2LC5 A;  4N5X A;  4C0L A;  1NCY A;  3PAT A;  3NSK A;  1A03 A;  1J1E A;  4P2Y B;  4CLN A;  4QJ3 B;  2KAY A;  2LVV A;  1K96 A;  2K8M B;  1CM1 A;  3AAJ A;  1SNL A;  3GK4 X;  1MR8 A;  1JSA A;  1OSA A;  1QLK A;  3SIB A;  1QV1 A;  2O60 A;  1S1E A;  2BBN A;  5AER A;  3BOW B;  5G08 A;  2V53 A;  1TCO B;  1L2O C;  2PRU A;  5J3X A;  1OMR A;  1SR6 B;  3BUO B;  1CFP A;  1ZOT B;  2JU0 A;  3CTN A;  2KAX A;  1K9P A;  1XFZ O;  1DGU A;  1TNP A;  1JFJ A;  3NSL A;  1LXF C;  1L2O B;  3OB1 B;  1ZAC A;  3BOW A;  2GGZ A;  1SK6 D;  3VRR A;  4CFR A;  1F4O A;  2LUC A;  4JPZ B;  2HET A;  1NCX A;  1REC A;  2KI4 C;  1OZO A;  1UUS A;  4XJK B;  2F33 A;  4HRG A;  2BKI B;  4P5O E;  3SG3 A;  3OP0 A;  2LMT A;  1XK4 A;  1KFX S;  4YGB B;  1BOD A;  4NDD A;  4UPG A;  2QPT A;  2NZ0 A;  1SMG A;  4DIR A;  1EL4 A;  5KSZ A;  1BLQ A;  1YUT A;  3I5G C;  3PFV A;  1Y1X A;  5DKQ A;  3BUX B;  1QTX A;  1CDM A;  3DVE A;  4M2Q A;  1H8B A;  2O5G A;  2JOJ A;  1S3P A;  2ZNE A;  3PSR A;  1XYD A;  3RM1 A;  2PMY A;  1YTZ C;  1JWD A;  1SY9 A;  2ZN8 A;  2E30 A;  2JPT A;  4GNK B;  1LIN A;  4NDC A;  2KGB C;  1F70 A;  1RFJ A;  1K90 D;  1K93 D;  2KFH A;  1NUB A;  4I5K A;  1XFY O;  3SG5 A;  1XVJ A;  4M2P A;  1EH2 A;  1N0Y A;  1LKJ A;  1QVI Z;  1NCZ A;  3JTD C;  3NSO A;  4GUK A;  1TNW A;  1LA3 A;  2L5X B;  4MZL A;  2LUX A;  3SG4 A;  1Q80 A;  1SYM A;  1GGZ A;  5TNC A;  3AKA A;  1SL9 A;  3TUY B;  1JF2 A;  1ZMZ A;  2PVB A;  2JZI A;  1DVI A;  1KK7 Y;  1NX2 A;  2BCA A;  3BUW B;  1XFU O;  3O2P A;  4N1G A;  1SRA A;  2CXJ A;  1ALV A;  1UP5 A;  1WRK A;  2M97 A;  2BE4 A;  2Y5I A;  3TDZ A;  1DJH A;  2HPS A;  1KCY A;  4PHJ A;  1LVC D;  1WLM A;  4GGF C;  4WQ2 A;  2NCO A;  5DKN A;  1MXL C;  4L9M A;  1SCM B;  1K9K A;  1KQM C;  1BG1 A;  1IWQ A;  3FWC A;  5CSN A;  2WCE A;  1B8R A;  2KQ6 A;  1NP8 A;  1JC2 A;  3HCM A;  4GFT A;  2ZFD A;  2CCM A;  1JFK A;  2LLU A;  2ZRT A;  3OX6 A;  5CSJ A;  1J1D A;  2L4H A;  1KQM B;  1KK7 Z;  3GK1 A;  3NXA A;  2FCD A;  3I5H B;  2L4I A;  1CM4 A;  2LP2 A;  3VRN A;  3M0W A;  2JQ6 A;  1K95 A;  1VRK A;  1TTX A;  3BYA A;  1CFD A;  4GGF A;  4NDB A;  4MZJ A;  2Y1M A;  5K89 A;  1NIW A;  1OQP A;  2I18 A;  2R2I A;  3DF0 B;  3O6B A;  1KK8 C;  4PHM A;  1F55 A;  2COL B;  2M29 A;  3DVJ A;  2LLS A;  1R2U A;  2FCE A;  2NCP A;  1TOP A;  2OPO A;  5HLV A;  2Q91 A;  2F2O A;  1KWO C;  1IG5 A;  1CFF A;  4GGN A;  2ZN9 A;  1KK8 B;  1N65 A;  4GBA A;  1SL8 A;  1DMO A;  4YGA A;  2LVJ A;  2LM5 A;  3HX4 A;  5B8I B;  1G33 A;  4HRE E;  5HYD A;  2NLN A;  1PSR A;  1MUX A;  2SCP A;  1QAS A;  5ER4 X;  1HQV A;  4I5L B;  2M1K B;  2CNP A;  3AKB A;  2BCB A;  1AJ5 A;  1LA0 A;  1B8C A;  1QV0 A;  2JT8 A;  2KDH A;  2BL0 C;  4DUQ A;  3OB2 B;  1GGW A;  2KAV A;  1OE9 B;  4PHN A;  1Y1A A;  1QAT A;  3BUN B;  3VRQ A;  4ZCV A;  3CR2 A;  1MHO A;  3JVT C;  2BL0 B;  2L0P A;  1XK4 C;  2LAN A;  1UHJ A;  1CB1 A;  2K7C A;  1TNX A;  2BE6 A;  1TNQ A;  2LAP A;  1XA5 A;  2KI6 D;  3DVK A;  4OV2 A;  2JRF A;  1QXP A;  1C7V A;  3A4U B;  1ZFS A;  2P6B B;  3ICB A;  5AAN A;  1H4B A;  1DTL A;  1YX7 A;  1AVS A;  4DS7 A;  1QLS A;  3O78 A;  1FF1 A;  1DF0 A;  2WOR A;  4PE1 A;  3DVM A;  1PSB A;  1DGV A;  2F8P A;  4M2O A;  1UUR A;  3F45 A;  4D1E A;  1YUR A;  4ORC B;  2ZKM X;  3ZWH A;  1M46 A;  5HLO A;  2KI4 B;  4ETO A;  1F8H A;  5CSF A;  2WND A;  3LK1 A;  1RRO A;  2WOS A;  1DJW A;  1DJY A;  3WXA A;  3EKH A;  3SJS A;  2PSR A;  1IQ3 A;  3QRX A;  2LMV A;  2KGR A;  2MLF C;  5AFP A;  1Y6W A;  2KFF A;  1CFC A;  3EK7 A;  3I5G B;  3CR5 X;  3FWB A;  1PVA A;  1BMO A;  3CLN A;  2M8U A;  4PE7 A;  2K2F A;  3PN7 C;  3LK0 A;  2EC6 C;  2L51 A;  2Y4Q A;  5KU1 A;  1M31 A;  1NX3 A;  1SCV A;  2KSP A;  3KEV A;  3LL8 B;  2KHN A;  2MRD A;  3TZ1 A;  2G9B A;  4WRI A;  2LVK A;  1A29 A;  2JNF A;  1CKK A;  2LNK A;  4YGC B;  3PN7 B;  1DJX A;  2EC6 B;  1A2X A;  1CDP A;  1CMG A;  2QAC A;  2JT0 A;  2DOQ A;  2ZND A;  3JTD B;  1WDC C;  2EHB A;  2L50 A;  4MN0 A;  5AXI A;  2JXL A;  1QX2 A;  1AHR A;  4QJ4 B;  1KQV A;  4BY4 A;  2BCX A;  4E68 A;  1KFU S;  2BKH B;  4QJ5 B;  4NQG A;  1YVL A;  3O4Y A;  4ZCU A;  3RLZ A;  2M0R A;  2FJU B;  1WDC B;  1G8I A;  3AAK A;  1A75 B;  1F54 A;  3PM8 A;  1UWO A;  1BJF A;  5JJG A;  1YUS A;  2BBM A;  1XO5 A;  1AP4 A;  3IQQ A;  3C1V A;  1WRL A;  1B9A A;  4YGD B;  2K7O A;  1QIW A;  2MHH A;  2MJW B;  4TNC A;  3VGO A;  1QS7 A;  1YX8 A;  1MQ1 A;  1Y0V H;  2F3Z A;  5DKR A;  2FOT A;  1JUO A;  1KFX L;  1MWN A;  2AUC A;  1S5G Y;  2JTZ A;  2M49 B;  1A75 A;  1BF5 A;  3OHM B;  3CWG A;  4PE0 A;  1GJY A;  2Q4U A;  1NX0 A;  1D1O A;  3WHT B;  3EVV A;  2MAZ A;  2TN4 A;  1PK0 D;  1V1G A;  2L2E A;  1NYA A;  4GAO A;  1ZUZ A;  1W7I B;  1WRZ A;  2MLE C;  4ICB A;  3WNX B;  2JXC A;  3CS1 A;  3PLF B;  2M1U A;  1EG3 A;  1QX7 A;  1SKT A;  2M7L A;  4F0Z B;  2ZRS A;  1CNP A;  1YVH A;  3TS5 C;  5AEQ A;  1AJ4 A;  1S5G Z;  1JBA A;  1CLM A;  4YRU A;  3EVU A;  1PRW A;  4WQ3 A;  1NX1 A;  1CLL A;  2JT3 A;  4U8D A;  3TS5 B;  3LLE A;  1KWO B;  2L98 A;  3OX5 A;  4FTG A;  1WY9 A;  5D7F A;  3SIA A;  2Y1N A;  5ER5 A;  5HKZ A;  1DJI A;  1K9U A;  1ODB A;  2F2P A;  4YI9 A;  1IRJ A;  1FW4 A;  4HRH A;  2KOT A;  1J7P A;  1HT9 A;  1MXE A;  1CTR A;  2WCB A;  5I2L A;  1CMF A;  4MLW A;  1PVB A;  1YR5 A;  2M3W A;  1M63 B;  1KSM A;  2I2R E;  1DF0 B;  1M45 A;  5D69 A;  1RJV A;  1ALW A;  1RWY A;  2HQ8 A;  3WHU B;  4PCW A;  3JVT B;  2MBX A;  1YRT B;  4OKH A;  3CR4 X;  5BPJ A;  1XFV O;  1MF8 B;  5I2Q A;  5IBW A;  1IKU A;  2E6W A;  2PAS A;  5FYX A;  1NSH A;  2I7A A;  2ISD A;  1TN4 A;  5HKW A;  3KF9 A;  1CDN A;  4MSP A;  1FBV A;  1YUU A;  3EK4 A;  3A8R A;  3D0Y A;  1SR6 C;  1S6J A;  4I5N B;  5I8N A;  3CGA A;  4Q04 A;  4R1E A;  1K8U A;  4YBH B;  2HF5 A;  2LMU A;  3IQO A;  1YRU B;  5HKY A;  3PAL A;  4AQJ A;  1AUI B;  1X02 A;  1R6P A;  2K61 A;  2AMI A;  4MRY A;  1U5I B;  1CDL A;  4OVN F;  1IH0 A;  4FQO A;  2A4J A;  1EG4 A;  1OMV A;  2K7D A;  4ORB B;  1Y1U A;  5GQQ C;  2OTG C;  1J7R A;  3KHE A;  4PDZ A;  5CPV A;  1J7Q A;  1K2H A;  3SG7 A;  1V1F A;  2H2K A;  3KPX A;  3KO0 A;  4BY5 A;  2KQY A;  2PAL A;  1TIZ A;  1C07 A;  1U5I A;  4MZK A;  1IGV A;  5CSI A;  2OTG B;  2KBM A;  4PE4 A;  1QVI Y;  1DJG A;  2KBI A;  1QJT A;  2K7B A;  4C0J A;  4AOM A;  1B1G A;  4XJK A;  4OR9 B;  1M39 A;  1BU3 A;  2F3Y A;  3TDU A;  2H61 C;  2IS9 A;  2NXQ A;  2LHI A;  2WCF A;  3SG6 A;  1XFW O;  4OCI A;  2CBL A;  4AQI A;  2G2B A;  1S6I A;  1AK8 A;  2JUL A;  1B7T Y;  3K21 A;  4YGE B;  2LLT A;  1GQM A;  2WC8 A;  4MBE A;  2JTT A;  2CT9 A;  2EGD A;  1JF0 A;  4CID A;  2LCP A;  3TDI A;  4USL A;  3TUY C;  1OMD A;  1PUL A;  1B47 A;  3CZT X;  1FPW A;  1EJ3 A;  1IJ6 A;  1A4P A;  4JWQ A;  4XYN A;  3EK8 A;  5I2O A;  4HSZ A;  4ORA B;  1OZS A;  4JQ0 D;  1SPY A;  1DJZ A;  4A4C A;  3NSI A;  2H61 A;  2M9G A;  3FS7 A;  2VRG A;  2D8N A;  1EXR A;  2JC2 A;  3BUM B;  4A4B A;  1NPQ A;  4CPV A;  2LV7 A;  1N2D A;  2BEC A;  1UHH A;  5JOL A;  1B7T Z;  1UHI A;  2JWW A;  1SCM C;  2LE9 B;  1RTP 1;  1QX5 B;  2KFG A;  1CLB A;  3DD4 A;  2RGI A;  1S26 D;  1L7Z A;  1TRF A;  1F4Q A;  3VRP A;  1G4Y R;  4C0K A;  3MSE B;  5KTY A;  1WLZ A;  3I5I C;  4YI8 A;  1C7W A;  1DT7 B;  2SAS A;  4N1F A;  2LVI A;  3I5H C;  4GPL B;  4DCK A;  3BQ3 A;  1SL7 A;  2KI6 C;  1F71 A;  3LCP C;  1TCF A;  1FI5 A;  2K2A A;  3GK2 A;  3H4S E;  1BT6 A;  3I5I B;  2OS8 C;  3I5F C;  2KYF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...