3R1OA

Odorant binding protein 7 from anopheles gambiae with four disulfide bridges
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
119
structure length
110
Chain Sequence
RYKKPAKMLHEICIAESGASEEQLRTCLDGTVPTAPAAKCYIHCLFDKIDVVDEATGRILLDRLLYIIHLTRECSHIVTPDKCETAYETVKCYFNAHDEVIKFCHLLVLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Odorant binding protein, antennal
publication title The Crystal Structure of Odorant Binding Protein 7 from Anopheles gambiae Exhibits an Outstanding Adaptability of Its Binding Site.
pubmed doi rcsb
source organism Anopheles gambiae
molecule tags Transport protein
total genus 32
structure length 110
sequence length 119
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-03-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01395 PBP_GOBP PBP/GOBP family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.20 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 Pheromone/general odorant binding protein domain 3r1oA00
3CZ0A 3B86A 5EL2A 1OOFA 3BFBA 3CABA 2QEBA 3R1OA 2P71A 4JD9A 2KPHA 2L2CA 3CZ1A 2QEOA 3D74A 3DY9A 2WCHA 3B7AA 2FJYA 3CZ2A 3DXLA 3RZSA 1C3ZA 1GM0A 2WCLA 3R1VA 4OZDA 3S0DA 2H8VA 3R72A 1OOHA 1P28A 1LS8A 1OOGA 4INXA 3FE9A 1OW4A 1TUJA 1TWOA 3VB1A 2WC5A 3QMEA 2ERBA 1QWVA 1C3YA 3L47A 3DZTA 3L4LA 2QEHA 3L4AA 2WCKA 1ORGA 3N7HA 3BFHA 2PQLA 2WCJA 3S0FA 4INWA 3S0EA 3BJHA 2WCMA 1OOIX 3CDNA 3BFAA 3B87A 2WC6A 3OGNA 5DICA 3FE8A 4F7FA 3D76A 4FQTA 3CYZA 3B6XA 3NGVA 2GTEA 1T14A 2JPOA 3K1EA 3D77A 3DYEA 4PT1A 3NHIA 3FE6A 3NHTA 1DQEA 3D73A 3D75A 3B88A 2QEVA 3V2LA 3PJIA 3S0GA 3S0BA 3D78A 3S0AA 2P70A 1XFRA 3Q8IA 3R1PA 2QDIA
chains in the Genus database with same CATH superfamily
3PATA 1CFPA 1ZOTB 3VGOA 2LVKA 2SCPA 1ZFSA 3VRPA 1IJ5A 5EL2A 3EKJA 4MRYA 1QJTA 3SJSA 1TRFA 5ER5A 1M39A 3EKHA 2M7NA 1BU3A 1IWQA 1PSRA 2MA2A 1KCYA 1TIZA 1TNWA 2I94A 3CGAA 2LHIA 3O4YA 4QJ4B 1ODBA 1MHOA 1RFJA 2VRGA 1SY9A 4XJKB 1YURA 2KPHA 3NSOA 1MUXA 4DUQA 2L2CA 1SBJA 1BF5A 1A29A 2LHLA 2BBMA 4GFTA 2EC6B 2FCEA 4A4BA 4PHMA 2KBIA 2WCHA 2NCOA 1F54A 1UHIA 1DJIA 4JPZB 3LL8B 1JFJA 1DJYA 1QIWA 2LVVA 1CFFA 1SW8A 2M0RA 4YGEB 1LKJA 3FWBA 4PALA 4PCWA 1N0YA 2BCXA 1S36A 1MXLC 1Y1XA 2ZRSA 1CFCA 1GM0A 2K2FA 2ZFDA 4PHKA 1S3PA 1SL8A 3AAJA 3TDUA 3R72A 2HF5A 1G4YR 3JVTC 1OOHA 3DF0A 2IS9A 1B9AA 1P28A 1K95A 5HLVA 1UHKA 4MVFA 5HKZA 3SG2A 1OOGA 1MWNA 2LM5A 2JC2A 2PYQA 2WNDA 3FE9A 1FI6A 1OW4A 5I94A 1KK8C 1TWOA 2MHHA 4L9MA 2JZIA 3SS3A 5HYDA 1U5IB 4U8DA 2ISDA 2Y5IA 1CMGA 1JFKA 1XFWO 3L47A 3DZTA 2HQ8A 2NXQA 1RK9A 2LUXA 3C1VA 5K89A 1SPYA 1Z2CB 2QEHA 2PASA 2H61A 1JSAA 2QACA 1F4OA 2E30A 1ORGA 3N7HA 3D0YA 4M2QA 4OR9B 3BUXB 3OB2B 4MZJA 4INWA 2JULA 3S0EA 4AQIA 1LA3A 1ZMZA 3DVKA 1OZOA 3SS5A 4P5OE 1JWDA 1IJ6A 3CDNA 3BFAA 3BQ3A 3D10A 4OCIA 2KLEA 1G33A 2R2IA 2L4HA 2CT9A 5J3XA 4WRIA 4WQ2A 3DD4A 1N65A 4XJKA 1WLMA 3D76A 2O60A 4MZKA 2HPSA 3EVVA 3NGVA 2NLNA 1SL7A 1A75B 5FYXA 2MBXA 1EJ3A 2F3YA 2GTEA 2MRDA 2K7OA 1EH2A 3GK4X 1BOCA 3BOWB 1SMGA 3TDIA 3WHTB 1TCOB 1RROA 2LP2A 2Y1NA 2HETA 2RGIA 2BBNA 2LANA 3NHIA 1OMVA 2M8UA 3PALA 5FI2A 3NHTA 4NDDA 4UPGA 3EG5B 1NX0A 1WLZA 1YVHA 1XFXO 2QEVA 4DRWA 1J1EA 2CBLA 4DCKA 1NCZA 1S6IA 3S0GA 1SK6D 1YTZC 1GGZA 3CR2A 3HCMA 4HSZA 2P70A 1S6CA 2BCAA 4FTGA 5D3OA 1GJYA 1ZUZA 1DGVA 1RTP1 1NP8A 2BECA 3SIBA 2QDIA 1XFZO 2BKHB 1JF0A 1Y0VH 2M9GA 1KQVA 1K8UA 3CZ0A 3CZTX 4I5KA 4MSPA 5DKNA 1OOFA 4CIDA 5HL1A 2QEBA 1NSHA 1QLKA 2L50A 3JTDC 1QX2A 1PALA 3JVTB 3SG6A 1EG4A 1CM4A 1DJXA 4M2OA 5ER4X 1QLSA 2LMUA 3FIAA 1M31A 4JD9A 1CFDA 2OTGC 1B7TY 1CMFA 4AOMA 1MXEA 4GGFA 1KWOC 3TUYC 4P2YB 2BE6A 2JXLA 4DIRA 1XK4A 1NX1A 2LMVA 4TNCA 2FJYA 2JOJA 4N1GA 1J7QA 1F70A 4YGAA 2CTNA 1VRKA 1ALWA 1OMRA 2KLDA 1IRJA 1YRUB 2AMIA 2KYCA 2KOTA 1XA5A 3M0WA 2ZKMX 1XFYO 1CNPA 3DVMA 2Q4UA 3OX5A 1FI5A 2LLSA 3I5GC 3S0DA 3PFVA 1S26D 1NYAA 5PALA 4GAOA 2K7CA 5FI6A 2JT0A 2D8NA 1KQMC 1IG5A 1Y6WA 1UP5A 4OKHA 1W7IB 2KAXA 1DF0B 4ORAB 1F4QA 1V1GA 2G9BA 1UWOA 2M1KB 2OPOA 3QMEA 1IQ3A 1RJVA 1YX8A 3BXKA 1QX7A 1QWVA 4ICBA 5DKRA 1C3YA 2BCBA 4YGBB 2ZN8A 1LXFC 4OV2A 5KU1A 1IIOA 1KK7Y 3VROA 4BY4A 3FS7A 3BUOB 1SCVA 3L4AA 2OS8C 2L98A 3WHUB 1K93D 1WRKA 1K96A 5TNCA 2SASA 3A8RA 2EGDA 1DMOA 2WCJA 1SNLA 3S0FA 1G8IA 2WCMA 1DGUA 5F6TA 3O6BA 2BE4A 1B8CA 1K90D 1OOJA 3HX4A 1GGWA 2KFGA 2KYFA 1AJ5A 1BR1B 4HREE 1C7WA 1QX5B 2FOTA 1SRAA 1WRZA 5DICA 3EK8A 3IQOA 1FW4A 3IF7A 2JXCA 3JTDB 4OVNF 5AEQA 4GUKA 3CYZA 3B6XA 2Y4QA 2MJWB 1IKUA 2ZNDA 1QASA 1T14A 2LLTA 1C07A 1W9ZA 2KI6C 3K1EA 1FPWA 4PE4A 2JT3A 3D77A 1KFUL 2KDHA 3DYEA 4PT1A 3VRNA 3SG7A 2OTGB 2P6BB 2JTTA 3FE6A 2I2RE 1DQEA 1KWOB 2L4IA 4JQ0D 4YGDB 3TUYB 1H4BA 1DVIA 3OP0A 1XO5A 1NX2A 3PJIA 1K9KA 1RWYA 1CLBA 2PRUA 4GPLB 1XFVO 1CDMA 2LNKA 3TS5C 3KHEA 3I5FC 1SYMA 5HKWA 2BL0C 4C0JA 1PRWA 3UO9A 2JTZA 2NZ0A 1NX3A 2H61C 3SG4A 1DT7B 1S6JA 1TN4A 2K7BA 1XFUO 3I5GB 1DEKA 4YBHB 4D1EA 3K21A 1PSBA 3GOFA 4HRHA 1DTLA 3AKAA 4GBAA 3WXAA 1KQMB 1B47A 4IJ7A 1BODA 2DOQA 3NSLA 3R1OA 2L5YA 2LMTA 1YRTB 1F55A 1IH0A 5JOLA 1KFUS 1UURA 2P71A 1WY9A 2L0PA 3TZ1A 1TOPA 4C0KA 4ZCUA 4DS7A 3CZ1A 1NIWA 1OSAA 1QTXA 2F3ZA 2QEOA 4CFQA 1J7OA 3D74A 3DY9A 1TNXA 1MQ1A 1D1OA 2BKIB 1ZACA 3OB1B 3CZ2A 1QVIY 3KEVA 2ZN9A 4PE7A 2OS8B 3DXLA 3I5HC 1RECA 3WNXB 3PLFB 1CLMA 3SS4A 2KGBC 1C3ZA 2A4JA 1FBVA 5CSNA 3KO0A 1U5IA 4FQOA 3R1VA 1SCMC 4OZDA 1KSOA 2H8VA 2WCEA 1CLLA 3LK0A 1DC1A 4AQJA 3LCPC 2KQYA 2E6WA 4A4CA 3SG5A 1AJ4A 1LS8A 2KFHA 2PALA 1OZSA 4ZCVA 2LLUA 4E68A 4KYNA 2EHBA 2JNXA 1QV0A 4N5XA 4MZLA 1WDCC 3UNWA 1JC2A 1R2UA 5I2OA 1JBAA 1E8AA 4JKTA 2ERBA 1DJZA 3F45A 3CS1A 2KAVA 2F8PA 2F2OA 3CR4X 2KI6D 3DF0B 1ALVA 1F71A 3BYAA 1IGVA 1KK7Z 1PK0D 2KNEA 1J1DA 1DJWA 5I8NA 1F8HA 2ZNEA 1TTXA 1YUTA 2PQLA 5IBWA 1TUZA 4NDBA 1CKKA 3OBVA 1TCFA 4PE0A 5AXIA 3SIAA 3E3RA 5GQQC 4YRUA 2CCMA 1A75A 1YVLA 2Q91A 4GGFC 5HKYA 5JJGA 4M2PA 1OOIX 1W7JB 3TS5B 3BOWA 1XK4C 1SKTA 3I5FB 5CSFA 5I2QA 2BL0B 2NCPA 2WC6A 3NXAA 3ZNIA 5CSIA 1OQPA 3BUMB 4MRXA 4CFRA 1JUOA 1TNPA 2JRFA 2KFFA 1K9PA 3D0YB 1KSMA 5AERA 1S5GY 1BJFA 4F7FA 2AAOA 2LC5A 1HT9A 1NCYA 2LUCA 3CTNA 2V53A 1UHNA 1GQMA 2WORA 1JF2A 2JPOA 4GGNA 3NSKA 4IL1A 3ICBA 4YI8A 2LE9B 1YX7A 2K7DA 4WQ3A 2LAPA 3EVUA 1NCXA 1UUSA 3D73A 5HLOA 2PSRA 3CR5X 3B88A 4ORCB 2M49B 4Q04A 1SR6C 3S0BA 1X02A 1BG1A 1A03A 1QS7A 3I5HB 1L2OC 1OE9B 1YUUA 1XFRA 4PHJA 2LP3A 3ZWHA 1CDLA 1AP4A 2JT8A 2WC8A 2LCPA 2KI4C 1K2HA 4GNKB 5I2LA 3B86A 3BFBA 3CABA 4PHNA 3DVJA 2M1UA 1SCMB 1LVCD 5BPJA 1BMOA 2WCBA 3NSIA 5CSJA 1C7VA 1MF8B 1IQ5A 4ETOA 1AK8A 1CB1A 1CTRA 4QJ3B 1N2DA 2MAZA 3CLNA 3CWGA 1Q80A 1AVSA 1QATA 1Z4HA 2HQWA 1WDCB 3H4SE 1PVAA 1B8RA 3EVRA 1UHJA 5AANA 1V1FA 2LVJA 1AUIB 2PMYA 3A4UB 3GK2A 3EK7A 3GK1A 1FF1A 3QRXA 4F0ZB 1Y1UA 2KSPA 3OX6A 4NDCA 3KF9A 3B7AA 3BUWB 2L51A 2MLFC 1DELA 5G08A 2JQ6A 1DJHA 2K2AA 3I5IC 4JWQA 1A2XA 4N1FA 1BR4B 1QVIZ 1YR5A 3IQQA 1B8LA 3AAKA 1DF0A 3RZSA 4YGCB 2GV5A 3O4XA 2L5XB 4ORBB 1UHHA 2M3WA 2WCLA 4I5NB 2CNPA 1K94A 1OMDA 1J55A 1QV1A 1CDPA 2K60A 2M29A 1KFXL 5AFPA 3PN7B 1A4PA 1TNQA 3RLZA 4C0LA 2AUCA 1J7RA 5FI7A 2KGRA 4INXA 2QPTA 3O78A 2K8MB 1B1GA 3DVEA 1J7PA 4PE1A 1TUJA 1B4CA 3FWCA 3VB1A 1B7TZ 2WC5A 1SSEB 1WRLA 2LVIA 2BAPA 1HQVA 2B1UA 1EG3A 2F33A 2WOSA 1M46A 2EC6C 4MBEA 4YI9A 1AHRA 2I7AA 3O2PA 4NQGA 3RM1A 1CM1A 2KQ6A 2GGMA 1PVBA 3L4LA 3PM8A 1M63B 4MEWA 1BT6A 2PVBA 1YUSA 1LINA 2WCKA 4CPVA 1PULA 1Y1AA 2Y1MA 3BFHA 1NUBA 2JNFA 1H8BA 1K9UA 1SR6B 4XYNA 3BJHA 2F2PA 3VRQA 4CLNA 5CPVA 2FCDA 1L2OB 2G2BA 4HRGA 3PM2A 1KFXS 1R6PA 2KAYA 3B87A 5KSZA 4QJ5B 2JWWA 3TDZA 3OGNA 2I18A 2KI4B 3FE8A 5D7FA 2COLB 3IVTA 3OHMB 3PSRA 1XYDA 1LA0A 3EK4A 1NPQA 1M45A 1CDNA 4FQTA 2M7LA 2O5GA 5B8IB 2KBMA 1S5GZ 1XVJA 1NWDA 2MLEC 1SL9A 1QIVA 4MN0A 2L2EA 1L7ZA 3MSEB 1EL4A 2K0JA 2TN4A 3SG3A 4I5JA 2CXJA 1EXRA 4R1EA 1BLQA 3LK1A 2WCFA 2ZRTA 3VRRA 2M97A 2JPTA 1KK8B 3D75A 4PDZA 3KPXA 3V2LA 5D69A 2K61A 2JU0A 4USLA 1MR8A 3D78A 1S1EA 5KTYA 1DJGA 3BUNB 3PN7C 3S0AA 2GGZA 3I5IB 3LLEA 2BNXA 1QXPA 2YGUA 3AKBA 2FJUB 3Q8IA 3R1PA 2LV7A 2KHNA 4I5LB 4MLWA 4BY5A 5DKQA 2H2KA
chains in the Genus database with same CATH topology
3CZ0A 3B86A 5EL2A 1OOFA 3BFBA 3CABA 2QEBA 3R1OA 2P71A 4JD9A 2KPHA 2L2CA 3CZ1A 2QEOA 3D74A 3DY9A 2WCHA 3B7AA 2FJYA 3CZ2A 3DXLA 3RZSA 1C3ZA 1GM0A 2WCLA 3R1VA 4OZDA 3S0DA 2H8VA 3R72A 1OOHA 1P28A 1LS8A 1OOGA 4INXA 3FE9A 1OW4A 1TUJA 1TWOA 3VB1A 2WC5A 3QMEA 2ERBA 1QWVA 1C3YA 3L47A 3DZTA 3L4LA 2QEHA 3L4AA 2WCKA 1ORGA 3N7HA 3BFHA 2PQLA 2WCJA 3S0FA 4INWA 3S0EA 3BJHA 2WCMA 1OOIX 3CDNA 3BFAA 3B87A 2WC6A 3OGNA 5DICA 3FE8A 4F7FA 3D76A 4FQTA 3CYZA 3B6XA 3NGVA 2GTEA 1T14A 2JPOA 3K1EA 3D77A 3DYEA 4PT1A 3NHIA 3FE6A 3NHTA 1DQEA 3D73A 3D75A 3B88A 2QEVA 3V2LA 3PJIA 3S0GA 3S0BA 3D78A 3S0AA 2P70A 1XFRA 3Q8IA 3R1PA 2QDIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CZ0 A;  3B86 A;  5EL2 A;  1OOF A;  3BFB A;  3CAB A;  2QEB A;  3R1O A;  2P71 A;  4JD9 A;  2KPH A;  2L2C A;  3CZ1 A;  2QEO A;  3D74 A;  3DY9 A;  2WCH A;  3B7A A;  2FJY A;  3CZ2 A;  3DXL A;  3RZS A;  1C3Z A;  1GM0 A;  2WCL A;  3R1V A;  4OZD A;  3S0D A;  2H8V A;  3R72 A;  1OOH A;  1P28 A;  1LS8 A;  1OOG A;  4INX A;  3FE9 A;  1OW4 A;  1TUJ A;  1TWO A;  3VB1 A;  2WC5 A;  3QME A;  2ERB A;  1QWV A;  1C3Y A;  3L47 A;  3DZT A;  3L4L A;  2QEH A;  3L4A A;  2WCK A;  1ORG A;  3N7H A;  3BFH A;  2PQL A;  2WCJ A;  3S0F A;  4INW A;  3S0E A;  3BJH A;  2WCM A;  1OOI X;  3CDN A;  3BFA A;  3B87 A;  2WC6 A;  3OGN A;  5DIC A;  3FE8 A;  4F7F A;  3D76 A;  4FQT A;  3CYZ A;  3B6X A;  3NGV A;  2GTE A;  1T14 A;  2JPO A;  3K1E A;  3D77 A;  3DYE A;  4PT1 A;  3NHI A;  3FE6 A;  3NHT A;  1DQE A;  3D73 A;  3D75 A;  3B88 A;  2QEV A;  3V2L A;  3PJI A;  3S0G A;  3S0B A;  3D78 A;  3S0A A;  2P70 A;  1XFR A;  3Q8I A;  3R1P A;  2QDI A; 
#chains in the Genus database with same CATH topology
 3PAT A;  1CFP A;  1ZOT B;  3VGO A;  2LVK A;  2SCP A;  1ZFS A;  3VRP A;  1IJ5 A;  5EL2 A;  3EKJ A;  4MRY A;  1QJT A;  3SJS A;  1TRF A;  5ER5 A;  1M39 A;  3EKH A;  2M7N A;  1BU3 A;  1IWQ A;  1PSR A;  2MA2 A;  1KCY A;  1TIZ A;  1TNW A;  2I94 A;  3CGA A;  2LHI A;  3O4Y A;  4QJ4 B;  1ODB A;  1MHO A;  1RFJ A;  2VRG A;  1SY9 A;  4XJK B;  1YUR A;  2KPH A;  3NSO A;  1MUX A;  4DUQ A;  2L2C A;  1SBJ A;  1BF5 A;  1A29 A;  2LHL A;  2BBM A;  4GFT A;  2EC6 B;  2FCE A;  4A4B A;  4PHM A;  2KBI A;  2WCH A;  2NCO A;  1F54 A;  1UHI A;  1DJI A;  4JPZ B;  3LL8 B;  1JFJ A;  1DJY A;  1QIW A;  2LVV A;  1CFF A;  1SW8 A;  2M0R A;  4YGE B;  1LKJ A;  3FWB A;  4PAL A;  4PCW A;  1N0Y A;  2BCX A;  1S36 A;  1MXL C;  1Y1X A;  2ZRS A;  1CFC A;  1GM0 A;  2K2F A;  2ZFD A;  4PHK A;  1S3P A;  1SL8 A;  3AAJ A;  3TDU A;  3R72 A;  2HF5 A;  1G4Y R;  3JVT C;  1OOH A;  3DF0 A;  2IS9 A;  1B9A A;  1P28 A;  1K95 A;  5HLV A;  1UHK A;  4MVF A;  5HKZ A;  3SG2 A;  1OOG A;  1MWN A;  2LM5 A;  2JC2 A;  2PYQ A;  2WND A;  3FE9 A;  1FI6 A;  1OW4 A;  5I94 A;  1KK8 C;  1TWO A;  2MHH A;  4L9M A;  2JZI A;  3SS3 A;  5HYD A;  1U5I B;  4U8D A;  2ISD A;  2Y5I A;  1CMG A;  1JFK A;  1XFW O;  3L47 A;  3DZT A;  2HQ8 A;  2NXQ A;  1RK9 A;  2LUX A;  3C1V A;  5K89 A;  1SPY A;  1Z2C B;  2QEH A;  2PAS A;  2H61 A;  1JSA A;  2QAC A;  1F4O A;  2E30 A;  1ORG A;  3N7H A;  3D0Y A;  4M2Q A;  4OR9 B;  3BUX B;  3OB2 B;  4MZJ A;  4INW A;  2JUL A;  3S0E A;  4AQI A;  1LA3 A;  1ZMZ A;  3DVK A;  1OZO A;  3SS5 A;  4P5O E;  1JWD A;  1IJ6 A;  3CDN A;  3BFA A;  3BQ3 A;  3D10 A;  4OCI A;  2KLE A;  1G33 A;  2R2I A;  2L4H A;  2CT9 A;  5J3X A;  4WRI A;  4WQ2 A;  3DD4 A;  1N65 A;  4XJK A;  1WLM A;  3D76 A;  2O60 A;  4MZK A;  2HPS A;  3EVV A;  3NGV A;  2NLN A;  1SL7 A;  1A75 B;  5FYX A;  2MBX A;  1EJ3 A;  2F3Y A;  2GTE A;  2MRD A;  2K7O A;  1EH2 A;  3GK4 X;  1BOC A;  3BOW B;  1SMG A;  3TDI A;  3WHT B;  1TCO B;  1RRO A;  2LP2 A;  2Y1N A;  2HET A;  2RGI A;  2BBN A;  2LAN A;  3NHI A;  1OMV A;  2M8U A;  3PAL A;  5FI2 A;  3NHT A;  4NDD A;  4UPG A;  3EG5 B;  1NX0 A;  1WLZ A;  1YVH A;  1XFX O;  2QEV A;  4DRW A;  1J1E A;  2CBL A;  4DCK A;  1NCZ A;  1S6I A;  3S0G A;  1SK6 D;  1YTZ C;  1GGZ A;  3CR2 A;  3HCM A;  4HSZ A;  2P70 A;  1S6C A;  2BCA A;  4FTG A;  5D3O A;  1GJY A;  1ZUZ A;  1DGV A;  1RTP 1;  1NP8 A;  2BEC A;  3SIB A;  2QDI A;  1XFZ O;  2BKH B;  1JF0 A;  1Y0V H;  2M9G A;  1KQV A;  1K8U A;  3CZ0 A;  3CZT X;  4I5K A;  4MSP A;  5DKN A;  1OOF A;  4CID A;  5HL1 A;  2QEB A;  1NSH A;  1QLK A;  2L50 A;  3JTD C;  1QX2 A;  1PAL A;  3JVT B;  3SG6 A;  1EG4 A;  1CM4 A;  1DJX A;  4M2O A;  5ER4 X;  1QLS A;  2LMU A;  3FIA A;  1M31 A;  4JD9 A;  1CFD A;  2OTG C;  1B7T Y;  1CMF A;  4AOM A;  1MXE A;  4GGF A;  1KWO C;  3TUY C;  4P2Y B;  2BE6 A;  2JXL A;  4DIR A;  1XK4 A;  1NX1 A;  2LMV A;  4TNC A;  2FJY A;  2JOJ A;  4N1G A;  1J7Q A;  1F70 A;  4YGA A;  2CTN A;  1VRK A;  1ALW A;  1OMR A;  2KLD A;  1IRJ A;  1YRU B;  2AMI A;  2KYC A;  2KOT A;  1XA5 A;  3M0W A;  2ZKM X;  1XFY O;  1CNP A;  3DVM A;  2Q4U A;  3OX5 A;  1FI5 A;  2LLS A;  3I5G C;  3S0D A;  3PFV A;  1S26 D;  1NYA A;  5PAL A;  4GAO A;  2K7C A;  5FI6 A;  2JT0 A;  2D8N A;  1KQM C;  1IG5 A;  1Y6W A;  1UP5 A;  4OKH A;  1W7I B;  2KAX A;  1DF0 B;  4ORA B;  1F4Q A;  1V1G A;  2G9B A;  1UWO A;  2M1K B;  2OPO A;  3QME A;  1IQ3 A;  1RJV A;  1YX8 A;  3BXK A;  1QX7 A;  1QWV A;  4ICB A;  5DKR A;  1C3Y A;  2BCB A;  4YGB B;  2ZN8 A;  1LXF C;  4OV2 A;  5KU1 A;  1IIO A;  1KK7 Y;  3VRO A;  4BY4 A;  3FS7 A;  3BUO B;  1SCV A;  3L4A A;  2OS8 C;  2L98 A;  3WHU B;  1K93 D;  1WRK A;  1K96 A;  5TNC A;  2SAS A;  3A8R A;  2EGD A;  1DMO A;  2WCJ A;  1SNL A;  3S0F A;  1G8I A;  2WCM A;  1DGU A;  5F6T A;  3O6B A;  2BE4 A;  1B8C A;  1K90 D;  1OOJ A;  3HX4 A;  1GGW A;  2KFG A;  2KYF A;  1AJ5 A;  1BR1 B;  4HRE E;  1C7W A;  1QX5 B;  2FOT A;  1SRA A;  1WRZ A;  5DIC A;  3EK8 A;  3IQO A;  1FW4 A;  3IF7 A;  2JXC A;  3JTD B;  4OVN F;  5AEQ A;  4GUK A;  3CYZ A;  3B6X A;  2Y4Q A;  2MJW B;  1IKU A;  2ZND A;  1QAS A;  1T14 A;  2LLT A;  1C07 A;  1W9Z A;  2KI6 C;  3K1E A;  1FPW A;  4PE4 A;  2JT3 A;  3D77 A;  1KFU L;  2KDH A;  3DYE A;  4PT1 A;  3VRN A;  3SG7 A;  2OTG B;  2P6B B;  2JTT A;  3FE6 A;  2I2R E;  1DQE A;  1KWO B;  2L4I A;  4JQ0 D;  4YGD B;  3TUY B;  1H4B A;  1DVI A;  3OP0 A;  1XO5 A;  1NX2 A;  3PJI A;  1K9K A;  1RWY A;  1CLB A;  2PRU A;  4GPL B;  1XFV O;  1CDM A;  2LNK A;  3TS5 C;  3KHE A;  3I5F C;  1SYM A;  5HKW A;  2BL0 C;  4C0J A;  1PRW A;  3UO9 A;  2JTZ A;  2NZ0 A;  1NX3 A;  2H61 C;  3SG4 A;  1DT7 B;  1S6J A;  1TN4 A;  2K7B A;  1XFU O;  3I5G B;  1DEK A;  4YBH B;  4D1E A;  3K21 A;  1PSB A;  3GOF A;  4HRH A;  1DTL A;  3AKA A;  4GBA A;  3WXA A;  1KQM B;  1B47 A;  4IJ7 A;  1BOD A;  2DOQ A;  3NSL A;  3R1O A;  2L5Y A;  2LMT A;  1YRT B;  1F55 A;  1IH0 A;  5JOL A;  1KFU S;  1UUR A;  2P71 A;  1WY9 A;  2L0P A;  3TZ1 A;  1TOP A;  4C0K A;  4ZCU A;  4DS7 A;  3CZ1 A;  1NIW A;  1OSA A;  1QTX A;  2F3Z A;  2QEO A;  4CFQ A;  1J7O A;  3D74 A;  3DY9 A;  1TNX A;  1MQ1 A;  1D1O A;  2BKI B;  1ZAC A;  3OB1 B;  3CZ2 A;  1QVI Y;  3KEV A;  2ZN9 A;  4PE7 A;  2OS8 B;  3DXL A;  3I5H C;  1REC A;  3WNX B;  3PLF B;  1CLM A;  3SS4 A;  2KGB C;  1C3Z A;  2A4J A;  1FBV A;  5CSN A;  3KO0 A;  1U5I A;  4FQO A;  3R1V A;  1SCM C;  4OZD A;  1KSO A;  2H8V A;  2WCE A;  1CLL A;  3LK0 A;  1DC1 A;  4AQJ A;  3LCP C;  2KQY A;  2E6W A;  4A4C A;  3SG5 A;  1AJ4 A;  1LS8 A;  2KFH A;  2PAL A;  1OZS A;  4ZCV A;  2LLU A;  4E68 A;  4KYN A;  2EHB A;  2JNX A;  1QV0 A;  4N5X A;  4MZL A;  1WDC C;  3UNW A;  1JC2 A;  1R2U A;  5I2O A;  1JBA A;  1E8A A;  4JKT A;  2ERB A;  1DJZ A;  3F45 A;  3CS1 A;  2KAV A;  2F8P A;  2F2O A;  3CR4 X;  2KI6 D;  3DF0 B;  1ALV A;  1F71 A;  3BYA A;  1IGV A;  1KK7 Z;  1PK0 D;  2KNE A;  1J1D A;  1DJW A;  5I8N A;  1F8H A;  2ZNE A;  1TTX A;  1YUT A;  2PQL A;  5IBW A;  1TUZ A;  4NDB A;  1CKK A;  3OBV A;  1TCF A;  4PE0 A;  5AXI A;  3SIA A;  3E3R A;  5GQQ C;  4YRU A;  2CCM A;  1A75 A;  1YVL A;  2Q91 A;  4GGF C;  5HKY A;  5JJG A;  4M2P A;  1OOI X;  1W7J B;  3TS5 B;  3BOW A;  1XK4 C;  1SKT A;  3I5F B;  5CSF A;  5I2Q A;  2BL0 B;  2NCP A;  2WC6 A;  3NXA A;  3ZNI A;  5CSI A;  1OQP A;  3BUM B;  4MRX A;  4CFR A;  1JUO A;  1TNP A;  2JRF A;  2KFF A;  1K9P A;  3D0Y B;  1KSM A;  5AER A;  1S5G Y;  1BJF A;  4F7F A;  2AAO A;  2LC5 A;  1HT9 A;  1NCY A;  2LUC A;  3CTN A;  2V53 A;  1UHN A;  1GQM A;  2WOR A;  1JF2 A;  2JPO A;  4GGN A;  3NSK A;  4IL1 A;  3ICB A;  4YI8 A;  2LE9 B;  1YX7 A;  2K7D A;  4WQ3 A;  2LAP A;  3EVU A;  1NCX A;  1UUS A;  3D73 A;  5HLO A;  2PSR A;  3CR5 X;  3B88 A;  4ORC B;  2M49 B;  4Q04 A;  1SR6 C;  3S0B A;  1X02 A;  1BG1 A;  1A03 A;  1QS7 A;  3I5H B;  1L2O C;  1OE9 B;  1YUU A;  1XFR A;  4PHJ A;  2LP3 A;  3ZWH A;  1CDL A;  1AP4 A;  2JT8 A;  2WC8 A;  2LCP A;  2KI4 C;  1K2H A;  4GNK B;  5I2L A;  3B86 A;  3BFB A;  3CAB A;  4PHN A;  3DVJ A;  2M1U A;  1SCM B;  1LVC D;  5BPJ A;  1BMO A;  2WCB A;  3NSI A;  5CSJ A;  1C7V A;  1MF8 B;  1IQ5 A;  4ETO A;  1AK8 A;  1CB1 A;  1CTR A;  4QJ3 B;  1N2D A;  2MAZ A;  3CLN A;  3CWG A;  1Q80 A;  1AVS A;  1QAT A;  1Z4H A;  2HQW A;  1WDC B;  3H4S E;  1PVA A;  1B8R A;  3EVR A;  1UHJ A;  5AAN A;  1V1F A;  2LVJ A;  1AUI B;  2PMY A;  3A4U B;  3GK2 A;  3EK7 A;  3GK1 A;  1FF1 A;  3QRX A;  4F0Z B;  1Y1U A;  2KSP A;  3OX6 A;  4NDC A;  3KF9 A;  3B7A A;  3BUW B;  2L51 A;  2MLF C;  1DEL A;  5G08 A;  2JQ6 A;  1DJH A;  2K2A A;  3I5I C;  4JWQ A;  1A2X A;  4N1F A;  1BR4 B;  1QVI Z;  1YR5 A;  3IQQ A;  1B8L A;  3AAK A;  1DF0 A;  3RZS A;  4YGC B;  2GV5 A;  3O4X A;  2L5X B;  4ORB B;  1UHH A;  2M3W A;  2WCL A;  4I5N B;  2CNP A;  1K94 A;  1OMD A;  1J55 A;  1QV1 A;  1CDP A;  2K60 A;  2M29 A;  1KFX L;  5AFP A;  3PN7 B;  1A4P A;  1TNQ A;  3RLZ A;  4C0L A;  2AUC A;  1J7R A;  5FI7 A;  2KGR A;  4INX A;  2QPT A;  3O78 A;  2K8M B;  1B1G A;  3DVE A;  1J7P A;  4PE1 A;  1TUJ A;  1B4C A;  3FWC A;  3VB1 A;  1B7T Z;  2WC5 A;  1SSE B;  1WRL A;  2LVI A;  2BAP A;  1HQV A;  2B1U A;  1EG3 A;  2F33 A;  2WOS A;  1M46 A;  2EC6 C;  4MBE A;  4YI9 A;  1AHR A;  2I7A A;  3O2P A;  4NQG A;  3RM1 A;  1CM1 A;  2KQ6 A;  2GGM A;  1PVB A;  3L4L A;  3PM8 A;  1M63 B;  4MEW A;  1BT6 A;  2PVB A;  1YUS A;  1LIN A;  2WCK A;  4CPV A;  1PUL A;  1Y1A A;  2Y1M A;  3BFH A;  1NUB A;  2JNF A;  1H8B A;  1K9U A;  1SR6 B;  4XYN A;  3BJH A;  2F2P A;  3VRQ A;  4CLN A;  5CPV A;  2FCD A;  1L2O B;  2G2B A;  4HRG A;  3PM2 A;  1KFX S;  1R6P A;  2KAY A;  3B87 A;  5KSZ A;  4QJ5 B;  2JWW A;  3TDZ A;  3OGN A;  2I18 A;  2KI4 B;  3FE8 A;  5D7F A;  2COL B;  3IVT A;  3OHM B;  3PSR A;  1XYD A;  1LA0 A;  3EK4 A;  1NPQ A;  1M45 A;  1CDN A;  4FQT A;  2M7L A;  2O5G A;  5B8I B;  2KBM A;  1S5G Z;  1XVJ A;  1NWD A;  2MLE C;  1SL9 A;  1QIV A;  4MN0 A;  2L2E A;  1L7Z A;  3MSE B;  1EL4 A;  2K0J A;  2TN4 A;  3SG3 A;  4I5J A;  2CXJ A;  1EXR A;  4R1E A;  1BLQ A;  3LK1 A;  2WCF A;  2ZRT A;  3VRR A;  2M97 A;  2JPT A;  1KK8 B;  3D75 A;  4PDZ A;  3KPX A;  3V2L A;  5D69 A;  2K61 A;  2JU0 A;  4USL A;  1MR8 A;  3D78 A;  1S1E A;  5KTY A;  1DJG A;  3BUN B;  3PN7 C;  3S0A A;  2GGZ A;  3I5I B;  3LLE A;  2BNX A;  1QXP A;  2YGU A;  3AKB A;  2FJU B;  3Q8I A;  3R1P A;  2LV7 A;  2KHN A;  4I5L B;  4MLW A;  4BY5 A;  5DKQ A;  2H2K A; 
#chains in the Genus database with same CATH homology
 3CZ0 A;  3B86 A;  5EL2 A;  1OOF A;  3BFB A;  3CAB A;  2QEB A;  3R1O A;  2P71 A;  4JD9 A;  2KPH A;  2L2C A;  3CZ1 A;  2QEO A;  3D74 A;  3DY9 A;  2WCH A;  3B7A A;  2FJY A;  3CZ2 A;  3DXL A;  3RZS A;  1C3Z A;  1GM0 A;  2WCL A;  3R1V A;  4OZD A;  3S0D A;  2H8V A;  3R72 A;  1OOH A;  1P28 A;  1LS8 A;  1OOG A;  4INX A;  3FE9 A;  1OW4 A;  1TUJ A;  1TWO A;  3VB1 A;  2WC5 A;  3QME A;  2ERB A;  1QWV A;  1C3Y A;  3L47 A;  3DZT A;  3L4L A;  2QEH A;  3L4A A;  2WCK A;  1ORG A;  3N7H A;  3BFH A;  2PQL A;  2WCJ A;  3S0F A;  4INW A;  3S0E A;  3BJH A;  2WCM A;  1OOI X;  3CDN A;  3BFA A;  3B87 A;  2WC6 A;  3OGN A;  5DIC A;  3FE8 A;  4F7F A;  3D76 A;  4FQT A;  3CYZ A;  3B6X A;  3NGV A;  2GTE A;  1T14 A;  2JPO A;  3K1E A;  3D77 A;  3DYE A;  4PT1 A;  3NHI A;  3FE6 A;  3NHT A;  1DQE A;  3D73 A;  3D75 A;  3B88 A;  2QEV A;  3V2L A;  3PJI A;  3S0G A;  3S0B A;  3D78 A;  3S0A A;  2P70 A;  1XFR A;  3Q8I A;  3R1P A;  2QDI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...