3R1OA

Odorant binding protein 7 from anopheles gambiae with four disulfide bridges
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
119
structure length
110
Chain Sequence
RYKKPAKMLHEICIAESGASEEQLRTCLDGTVPTAPAAKCYIHCLFDKIDVVDEATGRILLDRLLYIIHLTRECSHIVTPDKCETAYETVKCYFNAHDEVIKFCHLLVLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Odorant binding protein, antennal
publication title The Crystal Structure of Odorant Binding Protein 7 from Anopheles gambiae Exhibits an Outstanding Adaptability of Its Binding Site.
pubmed doi rcsb
source organism Anopheles gambiae
molecule tags Transport protein
total genus 32
structure length 110
sequence length 119
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-03-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01395 PBP_GOBP PBP/GOBP family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.20 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 Pheromone/general odorant binding protein domain 3r1oA00
3BFBA 3D73A 3B6XA 4F7FA 2JPOA 3NHIA 3CZ1A 3D77A 3B88A 1TUJA 2WC6A 3B87A 3DYEA 1ORGA 1XFRA 2WCJA 3CDNA 4INXA 3D74A 1C3YA 2WCHA 3QMEA 1C3ZA 3DZTA 3B86A 3BJHA 4PT1A 4OZDA 1TWOA 3FE6A 3L47A 3CZ0A 1QWVA 2KPHA 2WC5A 3D75A 2PQLA 3BFAA 3S0EA 3FE8A 3DY9A 3NHTA 3S0GA 3S0AA 1GM0A 3PJIA 2P70A 3L4LA 3CYZA 3K1EA 3R1OA 3NGVA 3Q8IA 2QEOA 2L2CA 1LS8A 2QEHA 2FJYA 5DICA 3N7HA 3S0DA 1OOFA 1P28A 2QEBA 1T14A 3RZSA 2WCLA 2ERBA 1OOGA 3CZ2A 2WCMA 2WCKA 3B7AA 1OOHA 4FQTA 2GTEA 2P71A 3BFHA 3R1PA 3R1VA 3V2LA 2QDIA 3R72A 1DQEA 5EL2A 3OGNA 2H8VA 3FE9A 1OOIX 3L4AA 1OW4A 3S0FA 4JD9A 4INWA 3VB1A 3D76A 3S0BA 3DXLA 2QEVA 3CABA 3D78A
chains in the Genus database with same CATH superfamily
1SKTA 4M2OA 3DVEA 3VRPA 1C07A 3O2PA 3TUYB 1L2OC 3D73A 1RJVA 2BCAA 3EVRA 2COLB 5HL1A 1PULA 1S5GY 3NHIA 4P2YB 2L0PA 3D77A 2I7AA 3FIAA 4M2PA 2MHHA 1GGWA 3SS5A 1Y1UA 2JZIA 3MSEB 1KSMA 1W7IB 4WRIA 3PALA 3SIBA 3I5GC 1A75A 5DKQA 1IRJA 1ORGA 1BR4B 2WC8A 2M8UA 5D3OA 3IVTA 1PK0D 1SR6C 3LK1A 4MBEA 3UO9A 2PSRA 3CLNA 3SG4A 1NUBA 1NX0A 4YGAA 1C3YA 1SL7A 1XFVO 1NX1A 3GOFA 4HREE 3NSIA 1QIVA 5D7FA 1KFUL 2EC6C 3LLEA 1CFDA 4C0KA 2F3YA 4OZDA 1S3PA 3FE6A 3CZ0A 4GGNA 3FWBA 5HKYA 4AQJA 2K7CA 2KPHA 3PM8A 1TRFA 3BXKA 2LVIA 1KK7Y 3OX5A 4I5KA 4XJKB 2LLUA 4ORBB 5D69A 3EK7A 1J7OA 3S0EA 1KQMC 2JT8A 1QTXA 2K61A 4YRUA 2I94A 5DKRA 2O5GA 1CMGA 1BR1B 4PE4A 4WQ3A 2L98A 4PHMA 1BLQA 4D1EA 1NWDA 4CLNA 2MJWB 1HT9A 1JWDA 3E3RA 2G2BA 2KFFA 2KQ6A 4I5LB 4MSPA 1JFKA 1LINA 1SY9A 1S6JA 3R1OA 3NGVA 3TDZA 1IWQA 1M63B 2V53A 1DT7B 1BODA 2G9BA 1H4BA 1NCXA 1XK4C 2NXQA 1A2XA 1RECA 1DGVA 3DVJA 1TNQA 1U5IA 2KLDA 5DICA 1JUOA 3S0DA 4GPLB 1IH0A 1JF0A 1SL8A 3SJSA 4C0JA 1T14A 5HYDA 4OVNF 2PYQA 2WCFA 2ERBA 3JTDC 4C0LA 3CZ2A 1ZMZA 2L51A 1L7ZA 2WCMA 1CMFA 4PDZA 1S6IA 5FI2A 1S26D 2PRUA 2FJUB 4I5NB 1SCVA 2BECA 1XK4A 5CSFA 3KEVA 2F3ZA 3BOWA 2GTEA 2LV7A 2P71A 4M2QA 1AK8A 1J7QA 2WCEA 1C7VA 2KGBC 3OB1B 3R1PA 1NCZA 1TCFA 3BQ3A 1K8UA 1A75B 1YX7A 4N1FA 1TNXA 3R72A 2KI6C 1XA5A 4OKHA 1DQEA 2VRGA 2JPTA 2H8VA 3FE9A 3SG7A 1YVHA 3L4AA 1QLSA 1LVCD 4KYNA 1ALWA 1R2UA 3S0FA 1CDNA 2KI6D 1AP4A 2K2FA 1AHRA 3WHUB 3VB1A 3VRRA 1NYAA 2RGIA 4CFRA 1CTRA 4MZLA 1M46A 1YUTA 5AEQA 3D78A 2JRFA 3GK2A 2AUCA 5AXIA 2LMUA 1AUIB 1FW4A 2BE4A 2FCEA 3SS4A 1X02A 2M1UA 3AKAA 2EC6B 4F7FA 2M49B 3BYAA 1CFCA 3H4SE 4MLWA 2CNPA 4YGCB 2L50A 5PALA 1CDPA 1QS7A 1PVBA 1MUXA 2KFGA 2LC5A 3EKHA 3BUWB 2MA2A 1GQMA 2K2AA 1JF2A 2SCPA 2WNDA 5JOLA 1KQMB 1ZUZA 2WCJA 1CLMA 2FOTA 3CDNA 3D74A 4INXA 5I2QA 5KSZA 2L4IA 1C7WA 1U5IB 3M0WA 1F71A 4HRGA 1EL4A 2JXLA 1SBJA 4PT1A 1KFXL 1OE9B 1YRTB 2LHIA 1TWOA 1H8BA 2H61C 2M97A 3FS7A 2QPTA 2KAVA 2ZRSA 2WC5A 1KWOC 1KK8C 2LLSA 3BFAA 1PSRA 2K8MB 2NCOA 2R2IA 3I5HB 3FE8A 1DJIA 3BOWB 4P5OE 5CSNA 4JQ0D 1E8AA 1DJWA 1B47A 1B7TY 1M39A 1ZACA 1DJXA 1MF8B 3OP0A 5CSIA 2AAOA 3S0AA 3KF9A 1CDLA 2H61A 3WNXB 2HQ8A 1LA3A 3JTDB 1YTZC 1CFFA 1ALVA 2P70A 5I2LA 1LXFC 3CYZA 4JWQA 2Y1NA 4BY5A 3IQQA 1F4OA 4ORAB 5IBWA 3Q8IA 1J7RA 1W9ZA 3ZNIA 2M3WA 1LS8A 1B8RA 2AMIA 2JWWA 3PATA 3C1VA 1OMRA 4HRHA 4JPZB 3VGOA 3DVMA 1Z4HA 2KI4B 4QJ5B 1DGUA 2FJYA 2ZNEA 1RROA 4PHNA 1M45A 2L5XB 2P6BB 1PRWA 2LMTA 1S5GZ 1W7JB 2CBLA 2LUXA 1NX2A 1OOGA 5K89A 1NP8A 4NDCA 1K90D 1QLKA 1YUSA 1HQVA 1YURA 4MZJA 1RWYA 1NX3A 1OOHA 2JQ6A 4FQTA 4QJ3B 5ER4X 4IJ7A 3SG5A 4MVFA 1J1DA 1K93D 1IG5A 3EVVA 3EVUA 2LVVA 4YGEB 3BFHA 1G8IA 1GJYA 2LANA 2M0RA 3CZTX 2KOTA 2MRDA 3R1VA 4WQ2A 1UHKA 1YUUA 5AANA 4PE0A 1SL9A 3V2LA 4IL1A 2QDIA 2LE9B 2BE6A 1V1FA 2KNEA 3I5HC 2MBXA 1QATA 2O60A 3OGNA 1AJ5A 5I8NA 2EGDA 1TUZA 4HSZA 4MEWA 1QVIY 5HLVA 1B8CA 1WDCC 1OW4A 1SYMA 1KK7Z 2GV5A 2BKIB 3OX6A 3S0BA 4XYNA 2Y1MA 3EG5B 5KU1A 1KSOA 4NDDA 3UNWA 1B1GA 2HETA 1XFZO 1WRKA 5B8IB 2M1KB 1YRUB 2F33A 1K2HA 2KI4C 2K7OA 2K60A 2NLNA 3BFBA 3JVTC 4N1GA 5TNCA 1RTP1 2JT3A 4MRXA 3CZ1A 3LL8B 1DF0A 2KYFA 2ZFDA 1AJ4A 4DUQA 3B87A 3DYEA 1WRLA 2D8NA 3CS1A 5AFPA 1KWOB 3NXAA 1KK8B 1TN4A 4PALA 1QASA 3WXAA 1DJYA 3VRNA 1BF5A 1QVIZ 1CKKA 3IQOA 2WCHA 2LP3A 2WORA 3CR4X 2HQWA 1B8LA 1C3ZA 3QMEA 4GFTA 1OMVA 4FTGA 4L9MA 3B86A 3NSOA 1QX5B 1WLMA 2NCPA 3O78A 4YGDB 3BUNB 2F2PA 4PHJA 4USLA 1F55A 3PLFB 1G33A 1CM4A 1OQPA 2E6WA 1FBVA 1QIWA 2K0JA 3L47A 2LCPA 4GNKB 4R1EA 1QWVA 3GK4X 4YBHB 2JXCA 4DCKA 1IKUA 1YR5A 3BUXB 1K9PA 3I5IC 1N0YA 1Z2CB 3LK0A 3D75A 1CFPA 2LNKA 5I94A 2JTZA 1IQ3A 2WCBA 1OOJA 1NSHA 4ORCB 3SS3A 4NDBA 1N2DA 2LHLA 1YVLA 1CLBA 2F2OA 3NHTA 1S36A 2K7BA 1B9AA 1TNWA 1VRKA 3S0GA 1IIOA 3VROA 2SASA 3DF0B 4FQOA 1DTLA 1CLLA 1QX2A 1XYDA 2JT0A 4YI8A 1LA0A 1F4QA 1S1EA 1M31A 2LM5A 3TDUA 1DMOA 1K9UA 2JOJA 2MLEC 3TZ1A 5I2OA 2Q91A 2QEHA 1K96A 3N7HA 5GQQC 2KHNA 3SIAA 2JU0A 2QEBA 1XFYO 3CGAA 2JC2A 1WRZA 1JFJA 3KHEA 2WCLA 4GGFA 3CWGA 5FYXA 4U8DA 3OB2B 2WCKA 2KBIA 3BUOB 1WDCB 1SCMC 2BCXA 2OS8C 3SG2A 2CCMA 1DF0B 1UHHA 2JULA 2PVBA 3CABA 4E68A 4ETOA 1KFUS 2LVJA 2PALA 4GAOA 1PSBA 2F8PA 4ICBA 2HPSA 1A4PA 1PALA 5JJGA 3I5FB 2KGRA 3EKJA 3PM2A 1CB1A 4CFQA 5F6TA 1EXRA 2QACA 1UURA 3JVTB 4AOMA 1ZFSA 1K94A 1DJHA 2M29A 2OTGB 2Y5IA 4PCWA 2M7LA 2KQYA 2BAPA 1DJZA 2HF5A 3TS5B 2H2KA 1IQ5A 3TDIA 1Y1XA 2ZN9A 4JD9A 5G08A 1TCOB 1CDMA 1QX7A 1CNPA 2BKHB 1DJGA 1XFUO 4UPGA 3D76A 2ZNDA 1TIZA 4JKTA 3OBVA 2KFHA 3CR2A 2BL0C 2NZ0A 3DXLA 1B7TZ 1SMGA 4MZKA 2PASA 2M7NA 4AQIA 1FI5A 1OMDA 2LLTA 2I2RE 1BT6A 1Y6WA 4ZCUA 1FPWA 4F0ZB 3PN7C 4I5JA 2KSPA 4PE7A 1IJ5A 5BPJA 2ZN8A 3B6XA 5J3XA 2ZRTA 3D0YA 1TNPA 2JPOA 1B4CA 1BOCA 1JSAA 4A4BA 1DC1A 3B88A 3KO0A 1TUJA 2WC6A 1Q80A 3BUMB 3KPXA 3DF0A 1FF1A 1SPYA 2EHBA 1DEKA 2LP2A 2LVKA 4ZCVA 3GK1A 1UWOA 4YGBB 3OHMB 2JNFA 3F45A 3I5IB 3SG3A 1F8HA 1K9KA 1SK6D 3NSLA 2CTNA 1UHJA 1TOPA 1MWNA 1XFRA 4BY4A 5HKWA 5AERA 1NIWA 5DKNA 1Y1AA 1BMOA 2E30A 1V1GA 2ISDA 1IGVA 2YGUA 1JC2A 1F54A 3NSKA 2GGZA 1EG4A 3TUYC 3HCMA 3DZTA 3RLZA 3O4YA 4OCIA 1FI6A 2KBMA 4OV2A 3BJHA 3FWCA 4GBAA 3I5FC 5KTYA 2BBMA 2LAPA 1TTXA 1OZOA 4MN0A 1WY9A 3VRQA 3WHTB 5FI6A 1K95A 1MXEA 4CIDA 3QRXA 2DOQA 2OTGC 3AKBA 4DIRA 1XFXO 1WLZA 1Y0VH 2PQLA 1MXLC 1EG3A 1BJFA 3AAKA 3TS5C 1OSAA 3HX4A 4YI9A 2IS9A 2M9GA 1ODBA 2TN4A 1XFWO 2MAZA 3DVKA 3DY9A 4PE1A 1PVAA 2BCBA 5HKZA 2LUCA 1ZOTB 1UHIA 1AVSA 2L5YA 3PJIA 4MRYA 3IF7A 2I18A 1JBAA 1G4YR 3ICBA 1GM0A 1EJ3A 1QV0A 3L4LA 1MR8A 3K1EA 2KAXA 1S6CA 1LKJA 3K21A 4A4CA 1DELA 1N65A 1SCMB 2QEOA 2OS8B 1EH2A 3DD4A 4N5XA 2Q4UA 4Q04A 1J7PA 2L4HA 3EK4A 1OZSA 3D10A 2KYCA 2L2CA 4DS7A 1R6PA 2BNXA 2KLEA 3AAJA 1L2OB 1KQVA 5ER5A 2A4JA 1YX8A 1A29A 1OOFA 1IJ6A 1P28A 1QV1A 2MLFC 2PMYA 1XO5A 3EK8A 3SG6A 1NPQA 2JNXA 3O6BA 1MHOA 1NCYA 2FCDA 1DVIA 2WOSA 4PHKA 3RZSA 1SNLA 1CM1A 3CR5X 3O4XA 3LCPC 4GUKA 3ZWHA 1SW8A 3B7AA 1QJTA 3CTNA 3D0YB 3I5GB 4XJKA 1RFJA 3PSRA 4GGFC 1SR6B 1MQ1A 1UHNA 1KFXS 2BL0B 1SSEB 4CPVA 4OR9B 1RK9A 1F70A 1J55A 5EL2A 2K7DA 3PN7B 2OPOA 5CPVA 3PFVA 5CSJA 1OOIX 1XVJA 2L2EA 1A03A 1SRAA 4NQGA 5HLOA 1KCYA 2ZKMX 4DRWA 1GGZA 1UP5A 2Y4QA 4INWA 5FI7A 3A8RA 1UUSA 2GGMA 2CT9A 2CXJA 2KDHA 1J1EA 4TNCA 3RM1A 1QXPA 1D1OA 1BU3A 2B1UA 2LMVA 2KAYA 1BG1A 2QEVA 2BBNA 4QJ4B 3A4UB 2JTTA
chains in the Genus database with same CATH topology
3BFBA 3D73A 3B6XA 4F7FA 2JPOA 3NHIA 3CZ1A 3D77A 3B88A 1TUJA 2WC6A 3B87A 3DYEA 1ORGA 1XFRA 2WCJA 3CDNA 4INXA 3D74A 1C3YA 2WCHA 3QMEA 1C3ZA 3DZTA 3B86A 3BJHA 4PT1A 4OZDA 1TWOA 3FE6A 3L47A 3CZ0A 1QWVA 2KPHA 2WC5A 3D75A 2PQLA 3BFAA 3S0EA 3FE8A 3DY9A 3NHTA 3S0GA 3S0AA 1GM0A 3PJIA 2P70A 3L4LA 3CYZA 3K1EA 3R1OA 3NGVA 3Q8IA 2QEOA 2L2CA 1LS8A 2QEHA 2FJYA 5DICA 3N7HA 3S0DA 1OOFA 1P28A 2QEBA 1T14A 3RZSA 2WCLA 2ERBA 1OOGA 3CZ2A 2WCMA 2WCKA 3B7AA 1OOHA 4FQTA 2GTEA 2P71A 3BFHA 3R1PA 3R1VA 3V2LA 2QDIA 3R72A 1DQEA 5EL2A 3OGNA 2H8VA 3FE9A 1OOIX 3L4AA 1OW4A 3S0FA 4JD9A 4INWA 3VB1A 3D76A 3S0BA 3DXLA 2QEVA 3CABA 3D78A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BFB A;  3D73 A;  3B6X A;  4F7F A;  2JPO A;  3NHI A;  3CZ1 A;  3D77 A;  3B88 A;  1TUJ A;  2WC6 A;  3B87 A;  3DYE A;  1ORG A;  1XFR A;  2WCJ A;  3CDN A;  4INX A;  3D74 A;  1C3Y A;  2WCH A;  3QME A;  1C3Z A;  3DZT A;  3B86 A;  3BJH A;  4PT1 A;  4OZD A;  1TWO A;  3FE6 A;  3L47 A;  3CZ0 A;  1QWV A;  2KPH A;  2WC5 A;  3D75 A;  2PQL A;  3BFA A;  3S0E A;  3FE8 A;  3DY9 A;  3NHT A;  3S0G A;  3S0A A;  1GM0 A;  3PJI A;  2P70 A;  3L4L A;  3CYZ A;  3K1E A;  3R1O A;  3NGV A;  3Q8I A;  2QEO A;  2L2C A;  1LS8 A;  2QEH A;  2FJY A;  5DIC A;  3N7H A;  3S0D A;  1OOF A;  1P28 A;  2QEB A;  1T14 A;  3RZS A;  2WCL A;  2ERB A;  1OOG A;  3CZ2 A;  2WCM A;  2WCK A;  3B7A A;  1OOH A;  4FQT A;  2GTE A;  2P71 A;  3BFH A;  3R1P A;  3R1V A;  3V2L A;  2QDI A;  3R72 A;  1DQE A;  5EL2 A;  3OGN A;  2H8V A;  3FE9 A;  1OOI X;  3L4A A;  1OW4 A;  3S0F A;  4JD9 A;  4INW A;  3VB1 A;  3D76 A;  3S0B A;  3DXL A;  2QEV A;  3CAB A;  3D78 A; 
#chains in the Genus database with same CATH topology
 1SKT A;  4M2O A;  3DVE A;  3VRP A;  1C07 A;  3O2P A;  3TUY B;  1L2O C;  3D73 A;  1RJV A;  2BCA A;  3EVR A;  2COL B;  5HL1 A;  1PUL A;  1S5G Y;  3NHI A;  4P2Y B;  2L0P A;  3D77 A;  2I7A A;  3FIA A;  4M2P A;  2MHH A;  1GGW A;  3SS5 A;  1Y1U A;  2JZI A;  3MSE B;  1KSM A;  1W7I B;  4WRI A;  3PAL A;  3SIB A;  3I5G C;  1A75 A;  5DKQ A;  1IRJ A;  1ORG A;  1BR4 B;  2WC8 A;  2M8U A;  5D3O A;  3IVT A;  1PK0 D;  1SR6 C;  3LK1 A;  4MBE A;  3UO9 A;  2PSR A;  3CLN A;  3SG4 A;  1NUB A;  1NX0 A;  4YGA A;  1C3Y A;  1SL7 A;  1XFV O;  1NX1 A;  3GOF A;  4HRE E;  3NSI A;  1QIV A;  5D7F A;  1KFU L;  2EC6 C;  3LLE A;  1CFD A;  4C0K A;  2F3Y A;  4OZD A;  1S3P A;  3FE6 A;  3CZ0 A;  4GGN A;  3FWB A;  5HKY A;  4AQJ A;  2K7C A;  2KPH A;  3PM8 A;  1TRF A;  3BXK A;  2LVI A;  1KK7 Y;  3OX5 A;  4I5K A;  4XJK B;  2LLU A;  4ORB B;  5D69 A;  3EK7 A;  1J7O A;  3S0E A;  1KQM C;  2JT8 A;  1QTX A;  2K61 A;  4YRU A;  2I94 A;  5DKR A;  2O5G A;  1CMG A;  1BR1 B;  4PE4 A;  4WQ3 A;  2L98 A;  4PHM A;  1BLQ A;  4D1E A;  1NWD A;  4CLN A;  2MJW B;  1HT9 A;  1JWD A;  3E3R A;  2G2B A;  2KFF A;  2KQ6 A;  4I5L B;  4MSP A;  1JFK A;  1LIN A;  1SY9 A;  1S6J A;  3R1O A;  3NGV A;  3TDZ A;  1IWQ A;  1M63 B;  2V53 A;  1DT7 B;  1BOD A;  2G9B A;  1H4B A;  1NCX A;  1XK4 C;  2NXQ A;  1A2X A;  1REC A;  1DGV A;  3DVJ A;  1TNQ A;  1U5I A;  2KLD A;  5DIC A;  1JUO A;  3S0D A;  4GPL B;  1IH0 A;  1JF0 A;  1SL8 A;  3SJS A;  4C0J A;  1T14 A;  5HYD A;  4OVN F;  2PYQ A;  2WCF A;  2ERB A;  3JTD C;  4C0L A;  3CZ2 A;  1ZMZ A;  2L51 A;  1L7Z A;  2WCM A;  1CMF A;  4PDZ A;  1S6I A;  5FI2 A;  1S26 D;  2PRU A;  2FJU B;  4I5N B;  1SCV A;  2BEC A;  1XK4 A;  5CSF A;  3KEV A;  2F3Z A;  3BOW A;  2GTE A;  2LV7 A;  2P71 A;  4M2Q A;  1AK8 A;  1J7Q A;  2WCE A;  1C7V A;  2KGB C;  3OB1 B;  3R1P A;  1NCZ A;  1TCF A;  3BQ3 A;  1K8U A;  1A75 B;  1YX7 A;  4N1F A;  1TNX A;  3R72 A;  2KI6 C;  1XA5 A;  4OKH A;  1DQE A;  2VRG A;  2JPT A;  2H8V A;  3FE9 A;  3SG7 A;  1YVH A;  3L4A A;  1QLS A;  1LVC D;  4KYN A;  1ALW A;  1R2U A;  3S0F A;  1CDN A;  2KI6 D;  1AP4 A;  2K2F A;  1AHR A;  3WHU B;  3VB1 A;  3VRR A;  1NYA A;  2RGI A;  4CFR A;  1CTR A;  4MZL A;  1M46 A;  1YUT A;  5AEQ A;  3D78 A;  2JRF A;  3GK2 A;  2AUC A;  5AXI A;  2LMU A;  1AUI B;  1FW4 A;  2BE4 A;  2FCE A;  3SS4 A;  1X02 A;  2M1U A;  3AKA A;  2EC6 B;  4F7F A;  2M49 B;  3BYA A;  1CFC A;  3H4S E;  4MLW A;  2CNP A;  4YGC B;  2L50 A;  5PAL A;  1CDP A;  1QS7 A;  1PVB A;  1MUX A;  2KFG A;  2LC5 A;  3EKH A;  3BUW B;  2MA2 A;  1GQM A;  2K2A A;  1JF2 A;  2SCP A;  2WND A;  5JOL A;  1KQM B;  1ZUZ A;  2WCJ A;  1CLM A;  2FOT A;  3CDN A;  3D74 A;  4INX A;  5I2Q A;  5KSZ A;  2L4I A;  1C7W A;  1U5I B;  3M0W A;  1F71 A;  4HRG A;  1EL4 A;  2JXL A;  1SBJ A;  4PT1 A;  1KFX L;  1OE9 B;  1YRT B;  2LHI A;  1TWO A;  1H8B A;  2H61 C;  2M97 A;  3FS7 A;  2QPT A;  2KAV A;  2ZRS A;  2WC5 A;  1KWO C;  1KK8 C;  2LLS A;  3BFA A;  1PSR A;  2K8M B;  2NCO A;  2R2I A;  3I5H B;  3FE8 A;  1DJI A;  3BOW B;  4P5O E;  5CSN A;  4JQ0 D;  1E8A A;  1DJW A;  1B47 A;  1B7T Y;  1M39 A;  1ZAC A;  1DJX A;  1MF8 B;  3OP0 A;  5CSI A;  2AAO A;  3S0A A;  3KF9 A;  1CDL A;  2H61 A;  3WNX B;  2HQ8 A;  1LA3 A;  3JTD B;  1YTZ C;  1CFF A;  1ALV A;  2P70 A;  5I2L A;  1LXF C;  3CYZ A;  4JWQ A;  2Y1N A;  4BY5 A;  3IQQ A;  1F4O A;  4ORA B;  5IBW A;  3Q8I A;  1J7R A;  1W9Z A;  3ZNI A;  2M3W A;  1LS8 A;  1B8R A;  2AMI A;  2JWW A;  3PAT A;  3C1V A;  1OMR A;  4HRH A;  4JPZ B;  3VGO A;  3DVM A;  1Z4H A;  2KI4 B;  4QJ5 B;  1DGU A;  2FJY A;  2ZNE A;  1RRO A;  4PHN A;  1M45 A;  2L5X B;  2P6B B;  1PRW A;  2LMT A;  1S5G Z;  1W7J B;  2CBL A;  2LUX A;  1NX2 A;  1OOG A;  5K89 A;  1NP8 A;  4NDC A;  1K90 D;  1QLK A;  1YUS A;  1HQV A;  1YUR A;  4MZJ A;  1RWY A;  1NX3 A;  1OOH A;  2JQ6 A;  4FQT A;  4QJ3 B;  5ER4 X;  4IJ7 A;  3SG5 A;  4MVF A;  1J1D A;  1K93 D;  1IG5 A;  3EVV A;  3EVU A;  2LVV A;  4YGE B;  3BFH A;  1G8I A;  1GJY A;  2LAN A;  2M0R A;  3CZT X;  2KOT A;  2MRD A;  3R1V A;  4WQ2 A;  1UHK A;  1YUU A;  5AAN A;  4PE0 A;  1SL9 A;  3V2L A;  4IL1 A;  2QDI A;  2LE9 B;  2BE6 A;  1V1F A;  2KNE A;  3I5H C;  2MBX A;  1QAT A;  2O60 A;  3OGN A;  1AJ5 A;  5I8N A;  2EGD A;  1TUZ A;  4HSZ A;  4MEW A;  1QVI Y;  5HLV A;  1B8C A;  1WDC C;  1OW4 A;  1SYM A;  1KK7 Z;  2GV5 A;  2BKI B;  3OX6 A;  3S0B A;  4XYN A;  2Y1M A;  3EG5 B;  5KU1 A;  1KSO A;  4NDD A;  3UNW A;  1B1G A;  2HET A;  1XFZ O;  1WRK A;  5B8I B;  2M1K B;  1YRU B;  2F33 A;  1K2H A;  2KI4 C;  2K7O A;  2K60 A;  2NLN A;  3BFB A;  3JVT C;  4N1G A;  5TNC A;  1RTP 1;  2JT3 A;  4MRX A;  3CZ1 A;  3LL8 B;  1DF0 A;  2KYF A;  2ZFD A;  1AJ4 A;  4DUQ A;  3B87 A;  3DYE A;  1WRL A;  2D8N A;  3CS1 A;  5AFP A;  1KWO B;  3NXA A;  1KK8 B;  1TN4 A;  4PAL A;  1QAS A;  3WXA A;  1DJY A;  3VRN A;  1BF5 A;  1QVI Z;  1CKK A;  3IQO A;  2WCH A;  2LP3 A;  2WOR A;  3CR4 X;  2HQW A;  1B8L A;  1C3Z A;  3QME A;  4GFT A;  1OMV A;  4FTG A;  4L9M A;  3B86 A;  3NSO A;  1QX5 B;  1WLM A;  2NCP A;  3O78 A;  4YGD B;  3BUN B;  2F2P A;  4PHJ A;  4USL A;  1F55 A;  3PLF B;  1G33 A;  1CM4 A;  1OQP A;  2E6W A;  1FBV A;  1QIW A;  2K0J A;  3L47 A;  2LCP A;  4GNK B;  4R1E A;  1QWV A;  3GK4 X;  4YBH B;  2JXC A;  4DCK A;  1IKU A;  1YR5 A;  3BUX B;  1K9P A;  3I5I C;  1N0Y A;  1Z2C B;  3LK0 A;  3D75 A;  1CFP A;  2LNK A;  5I94 A;  2JTZ A;  1IQ3 A;  2WCB A;  1OOJ A;  1NSH A;  4ORC B;  3SS3 A;  4NDB A;  1N2D A;  2LHL A;  1YVL A;  1CLB A;  2F2O A;  3NHT A;  1S36 A;  2K7B A;  1B9A A;  1TNW A;  1VRK A;  3S0G A;  1IIO A;  3VRO A;  2SAS A;  3DF0 B;  4FQO A;  1DTL A;  1CLL A;  1QX2 A;  1XYD A;  2JT0 A;  4YI8 A;  1LA0 A;  1F4Q A;  1S1E A;  1M31 A;  2LM5 A;  3TDU A;  1DMO A;  1K9U A;  2JOJ A;  2MLE C;  3TZ1 A;  5I2O A;  2Q91 A;  2QEH A;  1K96 A;  3N7H A;  5GQQ C;  2KHN A;  3SIA A;  2JU0 A;  2QEB A;  1XFY O;  3CGA A;  2JC2 A;  1WRZ A;  1JFJ A;  3KHE A;  2WCL A;  4GGF A;  3CWG A;  5FYX A;  4U8D A;  3OB2 B;  2WCK A;  2KBI A;  3BUO B;  1WDC B;  1SCM C;  2BCX A;  2OS8 C;  3SG2 A;  2CCM A;  1DF0 B;  1UHH A;  2JUL A;  2PVB A;  3CAB A;  4E68 A;  4ETO A;  1KFU S;  2LVJ A;  2PAL A;  4GAO A;  1PSB A;  2F8P A;  4ICB A;  2HPS A;  1A4P A;  1PAL A;  5JJG A;  3I5F B;  2KGR A;  3EKJ A;  3PM2 A;  1CB1 A;  4CFQ A;  5F6T A;  1EXR A;  2QAC A;  1UUR A;  3JVT B;  4AOM A;  1ZFS A;  1K94 A;  1DJH A;  2M29 A;  2OTG B;  2Y5I A;  4PCW A;  2M7L A;  2KQY A;  2BAP A;  1DJZ A;  2HF5 A;  3TS5 B;  2H2K A;  1IQ5 A;  3TDI A;  1Y1X A;  2ZN9 A;  4JD9 A;  5G08 A;  1TCO B;  1CDM A;  1QX7 A;  1CNP A;  2BKH B;  1DJG A;  1XFU O;  4UPG A;  3D76 A;  2ZND A;  1TIZ A;  4JKT A;  3OBV A;  2KFH A;  3CR2 A;  2BL0 C;  2NZ0 A;  3DXL A;  1B7T Z;  1SMG A;  4MZK A;  2PAS A;  2M7N A;  4AQI A;  1FI5 A;  1OMD A;  2LLT A;  2I2R E;  1BT6 A;  1Y6W A;  4ZCU A;  1FPW A;  4F0Z B;  3PN7 C;  4I5J A;  2KSP A;  4PE7 A;  1IJ5 A;  5BPJ A;  2ZN8 A;  3B6X A;  5J3X A;  2ZRT A;  3D0Y A;  1TNP A;  2JPO A;  1B4C A;  1BOC A;  1JSA A;  4A4B A;  1DC1 A;  3B88 A;  3KO0 A;  1TUJ A;  2WC6 A;  1Q80 A;  3BUM B;  3KPX A;  3DF0 A;  1FF1 A;  1SPY A;  2EHB A;  1DEK A;  2LP2 A;  2LVK A;  4ZCV A;  3GK1 A;  1UWO A;  4YGB B;  3OHM B;  2JNF A;  3F45 A;  3I5I B;  3SG3 A;  1F8H A;  1K9K A;  1SK6 D;  3NSL A;  2CTN A;  1UHJ A;  1TOP A;  1MWN A;  1XFR A;  4BY4 A;  5HKW A;  5AER A;  1NIW A;  5DKN A;  1Y1A A;  1BMO A;  2E30 A;  1V1G A;  2ISD A;  1IGV A;  2YGU A;  1JC2 A;  1F54 A;  3NSK A;  2GGZ A;  1EG4 A;  3TUY C;  3HCM A;  3DZT A;  3RLZ A;  3O4Y A;  4OCI A;  1FI6 A;  2KBM A;  4OV2 A;  3BJH A;  3FWC A;  4GBA A;  3I5F C;  5KTY A;  2BBM A;  2LAP A;  1TTX A;  1OZO A;  4MN0 A;  1WY9 A;  3VRQ A;  3WHT B;  5FI6 A;  1K95 A;  1MXE A;  4CID A;  3QRX A;  2DOQ A;  2OTG C;  3AKB A;  4DIR A;  1XFX O;  1WLZ A;  1Y0V H;  2PQL A;  1MXL C;  1EG3 A;  1BJF A;  3AAK A;  3TS5 C;  1OSA A;  3HX4 A;  4YI9 A;  2IS9 A;  2M9G A;  1ODB A;  2TN4 A;  1XFW O;  2MAZ A;  3DVK A;  3DY9 A;  4PE1 A;  1PVA A;  2BCB A;  5HKZ A;  2LUC A;  1ZOT B;  1UHI A;  1AVS A;  2L5Y A;  3PJI A;  4MRY A;  3IF7 A;  2I18 A;  1JBA A;  1G4Y R;  3ICB A;  1GM0 A;  1EJ3 A;  1QV0 A;  3L4L A;  1MR8 A;  3K1E A;  2KAX A;  1S6C A;  1LKJ A;  3K21 A;  4A4C A;  1DEL A;  1N65 A;  1SCM B;  2QEO A;  2OS8 B;  1EH2 A;  3DD4 A;  4N5X A;  2Q4U A;  4Q04 A;  1J7P A;  2L4H A;  3EK4 A;  1OZS A;  3D10 A;  2KYC A;  2L2C A;  4DS7 A;  1R6P A;  2BNX A;  2KLE A;  3AAJ A;  1L2O B;  1KQV A;  5ER5 A;  2A4J A;  1YX8 A;  1A29 A;  1OOF A;  1IJ6 A;  1P28 A;  1QV1 A;  2MLF C;  2PMY A;  1XO5 A;  3EK8 A;  3SG6 A;  1NPQ A;  2JNX A;  3O6B A;  1MHO A;  1NCY A;  2FCD A;  1DVI A;  2WOS A;  4PHK A;  3RZS A;  1SNL A;  1CM1 A;  3CR5 X;  3O4X A;  3LCP C;  4GUK A;  3ZWH A;  1SW8 A;  3B7A A;  1QJT A;  3CTN A;  3D0Y B;  3I5G B;  4XJK A;  1RFJ A;  3PSR A;  4GGF C;  1SR6 B;  1MQ1 A;  1UHN A;  1KFX S;  2BL0 B;  1SSE B;  4CPV A;  4OR9 B;  1RK9 A;  1F70 A;  1J55 A;  5EL2 A;  2K7D A;  3PN7 B;  2OPO A;  5CPV A;  3PFV A;  5CSJ A;  1OOI X;  1XVJ A;  2L2E A;  1A03 A;  1SRA A;  4NQG A;  5HLO A;  1KCY A;  2ZKM X;  4DRW A;  1GGZ A;  1UP5 A;  2Y4Q A;  4INW A;  5FI7 A;  3A8R A;  1UUS A;  2GGM A;  2CT9 A;  2CXJ A;  2KDH A;  1J1E A;  4TNC A;  3RM1 A;  1QXP A;  1D1O A;  1BU3 A;  2B1U A;  2LMV A;  2KAY A;  1BG1 A;  2QEV A;  2BBN A;  4QJ4 B;  3A4U B;  2JTT A; 
#chains in the Genus database with same CATH homology
 3BFB A;  3D73 A;  3B6X A;  4F7F A;  2JPO A;  3NHI A;  3CZ1 A;  3D77 A;  3B88 A;  1TUJ A;  2WC6 A;  3B87 A;  3DYE A;  1ORG A;  1XFR A;  2WCJ A;  3CDN A;  4INX A;  3D74 A;  1C3Y A;  2WCH A;  3QME A;  1C3Z A;  3DZT A;  3B86 A;  3BJH A;  4PT1 A;  4OZD A;  1TWO A;  3FE6 A;  3L47 A;  3CZ0 A;  1QWV A;  2KPH A;  2WC5 A;  3D75 A;  2PQL A;  3BFA A;  3S0E A;  3FE8 A;  3DY9 A;  3NHT A;  3S0G A;  3S0A A;  1GM0 A;  3PJI A;  2P70 A;  3L4L A;  3CYZ A;  3K1E A;  3R1O A;  3NGV A;  3Q8I A;  2QEO A;  2L2C A;  1LS8 A;  2QEH A;  2FJY A;  5DIC A;  3N7H A;  3S0D A;  1OOF A;  1P28 A;  2QEB A;  1T14 A;  3RZS A;  2WCL A;  2ERB A;  1OOG A;  3CZ2 A;  2WCM A;  2WCK A;  3B7A A;  1OOH A;  4FQT A;  2GTE A;  2P71 A;  3BFH A;  3R1P A;  3R1V A;  3V2L A;  2QDI A;  3R72 A;  1DQE A;  5EL2 A;  3OGN A;  2H8V A;  3FE9 A;  1OOI X;  3L4A A;  1OW4 A;  3S0F A;  4JD9 A;  4INW A;  3VB1 A;  3D76 A;  3S0B A;  3DXL A;  2QEV A;  3CAB A;  3D78 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...