3R1OA

Odorant binding protein 7 from anopheles gambiae with four disulfide bridges
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
119
structure length
110
Chain Sequence
b'RYKKPAKMLHEICIAESGASEEQLRTCLDGTVPTAPAAKCYIHCLFDKIDVVDEATGRILLDRLLYIIHLTRECSHIVTPDKCETAYETVKCYFNAHDEVIKFCHLLVLE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Odorant binding protein, antennal
publication title The Crystal Structure of Odorant Binding Protein 7 from Anopheles gambiae Exhibits an Outstanding Adaptability of Its Binding Site.
pubmed doi rcsb
source organism Anopheles gambiae
molecule tags Transport protein
total genus 32
structure length 110
sequence length 119
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-03-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01395 PBP_GOBP PBP/GOBP family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.20 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 Pheromone/general odorant binding protein domain 3r1oA00
3R1OA 3S0AA 5EL2A 3CZ0A 2QEVA 3BFHA 1OOFA 1C3ZA 3L4LA 4OZDA 3B7AA 3D73A 3BFBA 1P28A 2H8VA 1OOIX 3S0BA 3R1PA 3CZ2A 2WCMA 1LS8A 1OOGA 3B88A 3FE8A 3K1EA 2ERBA 2WC6A 1DQEA 3D76A 2JPOA 2QEBA 4INWA 5DICA 1ORGA 1T14A 2QDIA 3OGNA 3CDNA 2WCKA 3NGVA 3VB1A 3D75A 2WCHA 3B86A 3CABA 2WC5A 3DY9A 4INXA 1TWOA 3BJHA 2KPHA 3S0GA 3L4AA 4FQTA 3S0EA 3FE9A 4F7FA 3V2LA 3R1VA 2L2CA 1QWVA 2QEOA 2QEHA 3DYEA 3N7HA 2FJYA 3BFAA 3D78A 3NHTA 3DXLA 3CZ1A 2WCLA 1OW4A 2GTEA 2P71A 3S0DA 1GM0A 2PQLA 3FE6A 3CYZA 3PJIA 1C3YA 3S0FA 4PT1A 2P70A 3RZSA 3D74A 3D77A 3R72A 3L47A 3B6XA 1TUJA 3Q8IA 3B87A 3DZTA 4JD9A 1XFRA 2WCJA 1OOHA 3NHIA 3QMEA
chains in the Genus database with same CATH superfamily
2LE9B 2OTGB 1YUUA 1YVHA 3M0WA 1MR8A 3SG5A 3BFHA 1OOFA 1IIOA 3L4LA 3BUXB 2KI4C 1NCXA 1SR6C 3B7AA 4I5LB 4NDCA 1FF1A 4DS7A 1C7VA 1YTZC 2ZKMX 4YGDB 5HYDA 4R1EA 2Q91A 3I5IC 2MLEC 3EVUA 3A4UB 4USLA 1UURA 4AQJA 1K93D 4GGFC 3CLNA 2HF5A 1NP8A 4AOMA 3SS5A 2BAPA 2JOJA 2BCAA 2WCFA 4PE7A 3WNXB 4NQGA 3SS4A 4DUQA 1RK9A 4YGAA 4DIRA 1PSRA 3KHEA 2K60A 1DQEA 1W7IB 3CR5X 2KBIA 1SNLA 1MF8B 1C07A 5DICA 4BY4A 1KWOC 1CMGA 1KQMC 1ORGA 1LINA 1XK4C 2ZN8A 1QLKA 1CM1A 1UWOA 3CDNA 4NDBA 2KFGA 2BCXA 2Y4QA 3D75A 1BMOA 2WCHA 5HLVA 4C0JA 1M46A 3MSEB 4MSPA 1DJWA 1K90D 3JVTC 2KPHA 1QASA 3VRRA 1DF0B 1DJHA 1OZSA 2KI6C 1BR1B 2WNDA 4PE4A 1UUSA 4FQTA 2KBMA 3GK1A 1S5GZ 2ZNDA 1S6JA 4D1EA 2LLTA 1IJ6A 1PK0D 4PHJA 3VROA 4P5OE 3D0YB 5AANA 5DKQA 2AUCA 2LV7A 1ZACA 1WRZA 5AEQA 3D10A 4OKHA 1DJXA 1Y0VH 2Q4UA 2K7DA 5AFPA 3TUYB 5FI2A 1CDPA 2KAVA 3UO9A 3DXLA 1QIVA 3IQOA 4AQIA 1OW4A 1B47A 2K61A 1UHNA 3JTDB 3S0DA 2JULA 2LHLA 3NSIA 1E8AA 1D1OA 1JFKA 1L2OC 1ALVA 2L51A 3LK1A 4ORCB 1K2HA 3EK4A 3CWGA 1RTP1 2JU0A 1A2XA 3VRQA 1BR4B 1DTLA 1RFJA 3I5GC 4PT1A 5IBWA 1UHJA 5I2OA 3LLEA 3E3RA 1CB1A 3PFVA 2LVKA 1LKJA 2NCPA 1JF0A 1NYAA 1U5IB 1LA3A 1XVJA 3L47A 3QRXA 5ER4X 1VRKA 2WOSA 2GGZA 5FI7A 2LMUA 1KK8C 2BE6A 1RECA 1TN4A 1IQ5A 1DVIA 1XO5A 4HRHA 1QLSA 2LVIA 2G2BA 1S3PA 4ETOA 5KTYA 4ORAB 1ZUZA 2MLFC 3CZTX 2K2FA 3EKJA 1SCMC 3BUWB 2KI4B 1B7TY 3DZTA 3LCPC 3O2PA 2FCDA 1SR6B 1PRWA 4JD9A 4XYNA 2M29A 3PSRA 4MLWA 2F2PA 1KFXL 5D7FA 2L2EA 3UNWA 3I5FC 1AVSA 3I5IB 3O4XA 1N65A 5AXIA 2LP2A 4MZKA 3R1OA 2CT9A 1YRUB 2CCMA 2HETA 2Y1MA 1N2DA 5JJGA 1OQPA 2BNXA 5G08A 3WHUB 1DT7B 3DVJA 3GK4X 2WC8A 2JNXA 3D73A 4YI9A 1DJZA 1FBVA 1A75B 3BFBA 2L5XB 1P28A 1Q80A 4I5NB 2MA2A 1AK8A 1F70A 4ZCVA 4PHNA 2K8MB 4M2OA 1KWOB 2L50A 1RWYA 1F4OA 1KQMB 2BBNA 2M7NA 1JBAA 1KCYA 4C0LA 5F6TA 1Y6WA 3OHMB 1GJYA 1BU3A 5ER5A 5J3XA 1XFVO 3B88A 3FE8A 3OP0A 1H8BA 3K1EA 1G8IA 3PATA 2CNPA 2KDHA 1C7WA 1EJ3A 3AKBA 3JVTB 2WC6A 3TZ1A 4XJKA 2QPTA 2D8NA 3SG7A 2JPOA 1QIWA 1NX2A 2QEBA 1KK7Z 2Y1NA 4INWA 2WCEA 4GNKB 2LC5A 4C0KA 3BUOB 2QDIA 3OGNA 1YURA 3NSLA 1MXLC 1EL4A 2WCKA 2JZIA 3KF9A 4OR9B 1JWDA 5I8NA 3DF0A 2CXJA 2JT3A 3OBVA 1TNQA 1RROA 1JC2A 1LXFC 4I5KA 1CLBA 1QXPA 2KGRA 3F45A 1TWOA 2F33A 3CTNA 1W9ZA 1FI6A 5DKNA 1PSBA 2O5GA 3L4AA 1L7ZA 3DVMA 2L4HA 2KFHA 5I2LA 4I5JA 1IJ5A 1L2OB 1GGZA 2BKIB 5FYXA 1MQ1A 4KYNA 4P2YB 2OS8C 3S0EA 3SG4A 2LNKA 4F7FA 2LCPA 2WORA 2KI6D 1EH2A 3R1VA 1TCOB 1AJ5A 2K7OA 1DJGA 2L2CA 3I5GB 1SCVA 2QEHA 4QJ3B 2LANA 3DYEA 2CTNA 1TRFA 3CGAA 5CPVA 3D78A 1OMDA 4MEWA 4JKTA 2NXQA 4YRUA 1IWQA 1QVIY 2EGDA 1KK8B 2P71A 2PMYA 3OB2B 4GPLB 1KQVA 1W7JB 4QJ4B 1PULA 1YX7A 1GM0A 1TTXA 2IS9A 2VRGA 3A8RA 3IF7A 3CYZA 1C3YA 1SCMB 1J55A 1PVBA 2BBMA 2Y5IA 3EK8A 2LUXA 3FWBA 4N1FA 3S0FA 1F8HA 2G9BA 2P70A 1CLMA 2K0JA 3RZSA 3I5FB 1SL7A 2H2KA 3R72A 2MAZA 4MVFA 1PALA 1CM4A 2TN4A 2LMTA 4WRIA 1MXEA 3SJSA 5DKRA 4GUKA 1B8LA 1MHOA 1V1GA 1F55A 1ALWA 1MUXA 3K21A 2K2AA 2M3WA 1DC1A 2F3ZA 1TCFA 2LP3A 4GGNA 3BOWA 2R2IA 1YR5A 2JQ6A 1KSOA 1B8CA 2MJWB 1CFFA 3VRPA 3OX5A 2BKHB 1OOJA 2BE4A 2KGBC 4PHKA 4PHMA 2ISDA 1XFZO 1LA0A 1X02A 3TDZA 1B9AA 1FW4A 5B8IB 2PVBA 1K9PA 2M0RA 2I18A 3S0AA 3FIAA 5K89A 2HQ8A 3EKHA 1K9KA 1A4PA 3NSKA 1JUOA 2AAOA 1C3ZA 1Z2CB 1DJYA 2HQWA 1R2UA 1NCYA 3CR2A 1SL8A 5AERA 1CDMA 1TNWA 4ZCUA 4IJ7A 1FPWA 1OOIX 2KYFA 3S0BA 5GQQC 3OX6A 1BT6A 3R1PA 1SPYA 1XFUO 1Y1AA 2KFFA 3CZ2A 3O4YA 1DMOA 4MRXA 1LS8A 2P6BB 3VGOA 1BJFA 2EC6C 1SYMA 2LM5A 1QX2A 4ORBB 1NWDA 5PALA 4MZLA 1H4BA 3PLFB 1UP5A 1G33A 2LMVA 1YRTB 1J7OA 1XA5A 2FJUB 1XYDA 5JOLA 2LUCA 2OS8B 2SCPA 2V53A 4Q04A 2KAYA 4YGEB 4F0ZB 2LHIA 3VB1A 1UHKA 3B86A 2KYCA 3CABA 2JWWA 2WC5A 3DY9A 3BYAA 1TOPA 5KU1A 1J1DA 1Y1XA 2MHHA 2SASA 1NX0A 4INXA 1K95A 2ZFDA 3S0GA 2M97A 2GV5A 1J1EA 2JPTA 2MRDA 3LK0A 2JXLA 4HREE 1WDCC 2EHBA 2LVVA 1NSHA 2COLB 1S26D 3AAKA 3CS1A 5D3OA 5I2QA 1J7QA 1ZFSA 1DGVA 4JPZB 1AUIB 2GGMA 1DEKA 2KSPA 4MN0A 4WQ2A 2F8PA 5TNCA 4QJ5B 4XJKB 2ZRTA 3RLZA 2L5YA 3OB1B 1SKTA 5HLOA 3V2LA 2QACA 1CMFA 3IVTA 1JF2A 1QWVA 2QEOA 2KQYA 4GAOA 1XFXO 1QATA 3HCMA 2M49B 1MWNA 3PN7C 3N7HA 2LAPA 1K94A 4UPGA 4M2QA 2OPOA 3BFAA 3NHTA 3O78A 3DF0B 2I94A 2F3YA 2DOQA 2PRUA 3AKAA 4YGBB 2B1UA 2WCLA 1NX1A 2K7CA 3DD4A 3GOFA 1GQMA 2KHNA 1B7TZ 1XK4A 1QX7A 2BCBA 3SG3A 2E6WA 4N5XA 2KNEA 1BOCA 4JQ0D 4BY5A 1NX3A 1F71A 1UHIA 1IH0A 2PQLA 3NXAA 1HQVA 1QV0A 1ZOTB 2JT0A 2E30A 1EG4A 2RGIA 3FE6A 3IQQA 1SMGA 3KPXA 3PJIA 4MZJA 4E68A 3RM1A 1S5GY 1AHRA 3EK7A 1KFUS 2KAXA 2LVJA 3SG6A 5BPJA 1DJIA 1EXRA 1K8UA 4HRGA 1B1GA 1QX5B 3WHTB 1IG5A 2JNFA 1CFDA 3B6XA 1IRJA 2PALA 1TNPA 1TUZA 2JTTA 3BUMB 4IL1A 4WQ3A 1CFPA 3Q8IA 3I5HC 2PYQA 3LL8B 1N0YA 2BL0B 3B87A 1TNXA 4MRYA 4N1GA 4OV2A 2KOTA 4ICBA 1RJVA 4PE0A 1HT9A 1CDLA 4HSZA 3SIBA 3NSOA 1YUSA 1NPQA 2WCJA 1BODA 1EG3A 2KLEA 1OOHA 1A29A 2I7AA 4OCIA 1CFCA 2JT8A 3BQ3A 3QMEA 4PCWA 5HKZA 3FWCA 4PALA 1LVCD 4CPVA 1QTXA 3CZ0A 2F2OA 2CBLA 5EL2A 2QEVA 2EC6B 4PDZA 4M2PA 1M63B 2LLUA 3PM8A 1WY9A 1OSAA 4OZDA 4U8DA 4YI8A 1CTRA 1AP4A 1M39A 2NCOA 3TS5C 3EG5B 1S6CA 2KLDA 2H8VA 1YX8A 1SW8A 1A03A 1QJTA 2L4IA 4JWQA 3BOWB 1Z4HA 1K9UA 1NCZA 3BXKA 5CSJA 2OTGC 2WCMA 2AMIA 5HL1A 2BECA 1J7RA 1B4CA 1OOGA 1DF0A 1Y1UA 1J7PA 1IGVA 3AAJA 1OMVA 2ERBA 3EVVA 4FQOA 2NZ0A 4PE1A 1M45A 1QV1A 3ZNIA 4GBAA 1BLQA 1F54A 1WDCB 1G4YR 3D76A 1F4QA 3D0YA 3DVKA 4A4BA 1IQ3A 2M8UA 5I94A 1CDNA 1GGWA 1SBJA 2BL0C 1AJ4A 1SL9A 4FTGA 1T14A 2M1KB 1DELA 4YGCB 5HKWA 1OE9B 3GK2A 3FS7A 3ZWHA 1S36A 2M1UA 3H4SE 2JC2A 3NGVA 2M9GA 3PM2A 1WLMA 1QVIZ 2LLSA 2L0PA 3PN7B 3DVEA 3BJHA 3KO0A 5D69A 3SIAA 1SRAA 2H61A 1NUBA 1QS7A 3VRNA 1S1EA 2A4JA 2ZN9A 1V1FA 1S6IA 3WXAA 2JRFA 1WLZA 4MBEA 5CSFA 3FE9A 4YBHB 4CLNA 2ZRSA 1CKKA 1K96A 1B8RA 4CFRA 3EVRA 1WRLA 2JTZA 1KK7Y 1U5IA 2YGUA 3PALA 4L9MA 2O60A 2PSRA 1FI5A 2K7BA 2HPSA 2FJYA 5CSIA 1BG1A 1JSAA 2PASA 3CZ1A 1ODBA 4OVNF 1OMRA 2GTEA 1OZOA 3SS3A 4GFTA 3O6BA 5FI6A 4CFQA 3SG2A 4CIDA 1M31A 4DCKA 1XFWO 3I5HB 5CSNA 1DGUA 3TDIA 1WRKA 2WCBA 3HX4A 1KFUL 4A4CA 5KSZA 1SSEB 1TIZA 3BUNB 5HKYA 1YVLA 2L98A 1PVAA 3D74A 4GGFA 3TUYC 1JFJA 1YUTA 3D77A 4DRWA 1CNPA 3KEVA 1NIWA 1R6PA 1XFYO 3CR4X 2JXCA 1SK6D 3JTDC 1BF5A 1TUJA 2FCEA 2ZNEA 2H61C 3ICBA 1A75A 3TDUA 1UHHA 1ZMZA 1XFRA 2I2RE 2MBXA 2NLNA 1KSMA 3TS5B 2FOTA 4NDDA 1IKUA 3NHIA 1KFXS 2KQ6A 3C1VA 1CLLA 4TNCA 2M7LA 1SY9A
chains in the Genus database with same CATH topology
3R1OA 3S0AA 5EL2A 3CZ0A 2QEVA 3BFHA 1OOFA 1C3ZA 3L4LA 4OZDA 3B7AA 3D73A 3BFBA 1P28A 2H8VA 1OOIX 3S0BA 3R1PA 3CZ2A 2WCMA 1LS8A 1OOGA 3B88A 3FE8A 3K1EA 2ERBA 2WC6A 1DQEA 3D76A 2JPOA 2QEBA 4INWA 5DICA 1ORGA 1T14A 2QDIA 3OGNA 3CDNA 2WCKA 3NGVA 3VB1A 3D75A 2WCHA 3B86A 3CABA 2WC5A 3DY9A 4INXA 1TWOA 3BJHA 2KPHA 3S0GA 3L4AA 4FQTA 3S0EA 3FE9A 4F7FA 3V2LA 3R1VA 2L2CA 1QWVA 2QEOA 2QEHA 3DYEA 3N7HA 2FJYA 3BFAA 3D78A 3NHTA 3DXLA 3CZ1A 2WCLA 1OW4A 2GTEA 2P71A 3S0DA 1GM0A 2PQLA 3FE6A 3CYZA 3PJIA 1C3YA 3S0FA 4PT1A 2P70A 3RZSA 3D74A 3D77A 3R72A 3L47A 3B6XA 1TUJA 3Q8IA 3B87A 3DZTA 4JD9A 1XFRA 2WCJA 1OOHA 3NHIA 3QMEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3R1O A;  3S0A A;  5EL2 A;  3CZ0 A;  2QEV A;  3BFH A;  1OOF A;  1C3Z A;  3L4L A;  4OZD A;  3B7A A;  3D73 A;  3BFB A;  1P28 A;  2H8V A;  1OOI X;  3S0B A;  3R1P A;  3CZ2 A;  2WCM A;  1LS8 A;  1OOG A;  3B88 A;  3FE8 A;  3K1E A;  2ERB A;  2WC6 A;  1DQE A;  3D76 A;  2JPO A;  2QEB A;  4INW A;  5DIC A;  1ORG A;  1T14 A;  2QDI A;  3OGN A;  3CDN A;  2WCK A;  3NGV A;  3VB1 A;  3D75 A;  2WCH A;  3B86 A;  3CAB A;  2WC5 A;  3DY9 A;  4INX A;  1TWO A;  3BJH A;  2KPH A;  3S0G A;  3L4A A;  4FQT A;  3S0E A;  3FE9 A;  4F7F A;  3V2L A;  3R1V A;  2L2C A;  1QWV A;  2QEO A;  2QEH A;  3DYE A;  3N7H A;  2FJY A;  3BFA A;  3D78 A;  3NHT A;  3DXL A;  3CZ1 A;  2WCL A;  1OW4 A;  2GTE A;  2P71 A;  3S0D A;  1GM0 A;  2PQL A;  3FE6 A;  3CYZ A;  3PJI A;  1C3Y A;  3S0F A;  4PT1 A;  2P70 A;  3RZS A;  3D74 A;  3D77 A;  3R72 A;  3L47 A;  3B6X A;  1TUJ A;  3Q8I A;  3B87 A;  3DZT A;  4JD9 A;  1XFR A;  2WCJ A;  1OOH A;  3NHI A;  3QME A; 
#chains in the Genus database with same CATH topology
 2LE9 B;  2OTG B;  1YUU A;  1YVH A;  3M0W A;  1MR8 A;  3SG5 A;  3BFH A;  1OOF A;  1IIO A;  3L4L A;  3BUX B;  2KI4 C;  1NCX A;  1SR6 C;  3B7A A;  4I5L B;  4NDC A;  1FF1 A;  4DS7 A;  1C7V A;  1YTZ C;  2ZKM X;  4YGD B;  5HYD A;  4R1E A;  2Q91 A;  3I5I C;  2MLE C;  3EVU A;  3A4U B;  4USL A;  1UUR A;  4AQJ A;  1K93 D;  4GGF C;  3CLN A;  2HF5 A;  1NP8 A;  4AOM A;  3SS5 A;  2BAP A;  2JOJ A;  2BCA A;  2WCF A;  4PE7 A;  3WNX B;  4NQG A;  3SS4 A;  4DUQ A;  1RK9 A;  4YGA A;  4DIR A;  1PSR A;  3KHE A;  2K60 A;  1DQE A;  1W7I B;  3CR5 X;  2KBI A;  1SNL A;  1MF8 B;  1C07 A;  5DIC A;  4BY4 A;  1KWO C;  1CMG A;  1KQM C;  1ORG A;  1LIN A;  1XK4 C;  2ZN8 A;  1QLK A;  1CM1 A;  1UWO A;  3CDN A;  4NDB A;  2KFG A;  2BCX A;  2Y4Q A;  3D75 A;  1BMO A;  2WCH A;  5HLV A;  4C0J A;  1M46 A;  3MSE B;  4MSP A;  1DJW A;  1K90 D;  3JVT C;  2KPH A;  1QAS A;  3VRR A;  1DF0 B;  1DJH A;  1OZS A;  2KI6 C;  1BR1 B;  2WND A;  4PE4 A;  1UUS A;  4FQT A;  2KBM A;  3GK1 A;  1S5G Z;  2ZND A;  1S6J A;  4D1E A;  2LLT A;  1IJ6 A;  1PK0 D;  4PHJ A;  3VRO A;  4P5O E;  3D0Y B;  5AAN A;  5DKQ A;  2AUC A;  2LV7 A;  1ZAC A;  1WRZ A;  5AEQ A;  3D10 A;  4OKH A;  1DJX A;  1Y0V H;  2Q4U A;  2K7D A;  5AFP A;  3TUY B;  5FI2 A;  1CDP A;  2KAV A;  3UO9 A;  3DXL A;  1QIV A;  3IQO A;  4AQI A;  1OW4 A;  1B47 A;  2K61 A;  1UHN A;  3JTD B;  3S0D A;  2JUL A;  2LHL A;  3NSI A;  1E8A A;  1D1O A;  1JFK A;  1L2O C;  1ALV A;  2L51 A;  3LK1 A;  4ORC B;  1K2H A;  3EK4 A;  3CWG A;  1RTP 1;  2JU0 A;  1A2X A;  3VRQ A;  1BR4 B;  1DTL A;  1RFJ A;  3I5G C;  4PT1 A;  5IBW A;  1UHJ A;  5I2O A;  3LLE A;  3E3R A;  1CB1 A;  3PFV A;  2LVK A;  1LKJ A;  2NCP A;  1JF0 A;  1NYA A;  1U5I B;  1LA3 A;  1XVJ A;  3L47 A;  3QRX A;  5ER4 X;  1VRK A;  2WOS A;  2GGZ A;  5FI7 A;  2LMU A;  1KK8 C;  2BE6 A;  1REC A;  1TN4 A;  1IQ5 A;  1DVI A;  1XO5 A;  4HRH A;  1QLS A;  2LVI A;  2G2B A;  1S3P A;  4ETO A;  5KTY A;  4ORA B;  1ZUZ A;  2MLF C;  3CZT X;  2K2F A;  3EKJ A;  1SCM C;  3BUW B;  2KI4 B;  1B7T Y;  3DZT A;  3LCP C;  3O2P A;  2FCD A;  1SR6 B;  1PRW A;  4JD9 A;  4XYN A;  2M29 A;  3PSR A;  4MLW A;  2F2P A;  1KFX L;  5D7F A;  2L2E A;  3UNW A;  3I5F C;  1AVS A;  3I5I B;  3O4X A;  1N65 A;  5AXI A;  2LP2 A;  4MZK A;  3R1O A;  2CT9 A;  1YRU B;  2CCM A;  2HET A;  2Y1M A;  1N2D A;  5JJG A;  1OQP A;  2BNX A;  5G08 A;  3WHU B;  1DT7 B;  3DVJ A;  3GK4 X;  2WC8 A;  2JNX A;  3D73 A;  4YI9 A;  1DJZ A;  1FBV A;  1A75 B;  3BFB A;  2L5X B;  1P28 A;  1Q80 A;  4I5N B;  2MA2 A;  1AK8 A;  1F70 A;  4ZCV A;  4PHN A;  2K8M B;  4M2O A;  1KWO B;  2L50 A;  1RWY A;  1F4O A;  1KQM B;  2BBN A;  2M7N A;  1JBA A;  1KCY A;  4C0L A;  5F6T A;  1Y6W A;  3OHM B;  1GJY A;  1BU3 A;  5ER5 A;  5J3X A;  1XFV O;  3B88 A;  3FE8 A;  3OP0 A;  1H8B A;  3K1E A;  1G8I A;  3PAT A;  2CNP A;  2KDH A;  1C7W A;  1EJ3 A;  3AKB A;  3JVT B;  2WC6 A;  3TZ1 A;  4XJK A;  2QPT A;  2D8N A;  3SG7 A;  2JPO A;  1QIW A;  1NX2 A;  2QEB A;  1KK7 Z;  2Y1N A;  4INW A;  2WCE A;  4GNK B;  2LC5 A;  4C0K A;  3BUO B;  2QDI A;  3OGN A;  1YUR A;  3NSL A;  1MXL C;  1EL4 A;  2WCK A;  2JZI A;  3KF9 A;  4OR9 B;  1JWD A;  5I8N A;  3DF0 A;  2CXJ A;  2JT3 A;  3OBV A;  1TNQ A;  1RRO A;  1JC2 A;  1LXF C;  4I5K A;  1CLB A;  1QXP A;  2KGR A;  3F45 A;  1TWO A;  2F33 A;  3CTN A;  1W9Z A;  1FI6 A;  5DKN A;  1PSB A;  2O5G A;  3L4A A;  1L7Z A;  3DVM A;  2L4H A;  2KFH A;  5I2L A;  4I5J A;  1IJ5 A;  1L2O B;  1GGZ A;  2BKI B;  5FYX A;  1MQ1 A;  4KYN A;  4P2Y B;  2OS8 C;  3S0E A;  3SG4 A;  2LNK A;  4F7F A;  2LCP A;  2WOR A;  2KI6 D;  1EH2 A;  3R1V A;  1TCO B;  1AJ5 A;  2K7O A;  1DJG A;  2L2C A;  3I5G B;  1SCV A;  2QEH A;  4QJ3 B;  2LAN A;  3DYE A;  2CTN A;  1TRF A;  3CGA A;  5CPV A;  3D78 A;  1OMD A;  4MEW A;  4JKT A;  2NXQ A;  4YRU A;  1IWQ A;  1QVI Y;  2EGD A;  1KK8 B;  2P71 A;  2PMY A;  3OB2 B;  4GPL B;  1KQV A;  1W7J B;  4QJ4 B;  1PUL A;  1YX7 A;  1GM0 A;  1TTX A;  2IS9 A;  2VRG A;  3A8R A;  3IF7 A;  3CYZ A;  1C3Y A;  1SCM B;  1J55 A;  1PVB A;  2BBM A;  2Y5I A;  3EK8 A;  2LUX A;  3FWB A;  4N1F A;  3S0F A;  1F8H A;  2G9B A;  2P70 A;  1CLM A;  2K0J A;  3RZS A;  3I5F B;  1SL7 A;  2H2K A;  3R72 A;  2MAZ A;  4MVF A;  1PAL A;  1CM4 A;  2TN4 A;  2LMT A;  4WRI A;  1MXE A;  3SJS A;  5DKR A;  4GUK A;  1B8L A;  1MHO A;  1V1G A;  1F55 A;  1ALW A;  1MUX A;  3K21 A;  2K2A A;  2M3W A;  1DC1 A;  2F3Z A;  1TCF A;  2LP3 A;  4GGN A;  3BOW A;  2R2I A;  1YR5 A;  2JQ6 A;  1KSO A;  1B8C A;  2MJW B;  1CFF A;  3VRP A;  3OX5 A;  2BKH B;  1OOJ A;  2BE4 A;  2KGB C;  4PHK A;  4PHM A;  2ISD A;  1XFZ O;  1LA0 A;  1X02 A;  3TDZ A;  1B9A A;  1FW4 A;  5B8I B;  2PVB A;  1K9P A;  2M0R A;  2I18 A;  3S0A A;  3FIA A;  5K89 A;  2HQ8 A;  3EKH A;  1K9K A;  1A4P A;  3NSK A;  1JUO A;  2AAO A;  1C3Z A;  1Z2C B;  1DJY A;  2HQW A;  1R2U A;  1NCY A;  3CR2 A;  1SL8 A;  5AER A;  1CDM A;  1TNW A;  4ZCU A;  4IJ7 A;  1FPW A;  1OOI X;  2KYF A;  3S0B A;  5GQQ C;  3OX6 A;  1BT6 A;  3R1P A;  1SPY A;  1XFU O;  1Y1A A;  2KFF A;  3CZ2 A;  3O4Y A;  1DMO A;  4MRX A;  1LS8 A;  2P6B B;  3VGO A;  1BJF A;  2EC6 C;  1SYM A;  2LM5 A;  1QX2 A;  4ORB B;  1NWD A;  5PAL A;  4MZL A;  1H4B A;  3PLF B;  1UP5 A;  1G33 A;  2LMV A;  1YRT B;  1J7O A;  1XA5 A;  2FJU B;  1XYD A;  5JOL A;  2LUC A;  2OS8 B;  2SCP A;  2V53 A;  4Q04 A;  2KAY A;  4YGE B;  4F0Z B;  2LHI A;  3VB1 A;  1UHK A;  3B86 A;  2KYC A;  3CAB A;  2JWW A;  2WC5 A;  3DY9 A;  3BYA A;  1TOP A;  5KU1 A;  1J1D A;  1Y1X A;  2MHH A;  2SAS A;  1NX0 A;  4INX A;  1K95 A;  2ZFD A;  3S0G A;  2M97 A;  2GV5 A;  1J1E A;  2JPT A;  2MRD A;  3LK0 A;  2JXL A;  4HRE E;  1WDC C;  2EHB A;  2LVV A;  1NSH A;  2COL B;  1S26 D;  3AAK A;  3CS1 A;  5D3O A;  5I2Q A;  1J7Q A;  1ZFS A;  1DGV A;  4JPZ B;  1AUI B;  2GGM A;  1DEK A;  2KSP A;  4MN0 A;  4WQ2 A;  2F8P A;  5TNC A;  4QJ5 B;  4XJK B;  2ZRT A;  3RLZ A;  2L5Y A;  3OB1 B;  1SKT A;  5HLO A;  3V2L A;  2QAC A;  1CMF A;  3IVT A;  1JF2 A;  1QWV A;  2QEO A;  2KQY A;  4GAO A;  1XFX O;  1QAT A;  3HCM A;  2M49 B;  1MWN A;  3PN7 C;  3N7H A;  2LAP A;  1K94 A;  4UPG A;  4M2Q A;  2OPO A;  3BFA A;  3NHT A;  3O78 A;  3DF0 B;  2I94 A;  2F3Y A;  2DOQ A;  2PRU A;  3AKA A;  4YGB B;  2B1U A;  2WCL A;  1NX1 A;  2K7C A;  3DD4 A;  3GOF A;  1GQM A;  2KHN A;  1B7T Z;  1XK4 A;  1QX7 A;  2BCB A;  3SG3 A;  2E6W A;  4N5X A;  2KNE A;  1BOC A;  4JQ0 D;  4BY5 A;  1NX3 A;  1F71 A;  1UHI A;  1IH0 A;  2PQL A;  3NXA A;  1HQV A;  1QV0 A;  1ZOT B;  2JT0 A;  2E30 A;  1EG4 A;  2RGI A;  3FE6 A;  3IQQ A;  1SMG A;  3KPX A;  3PJI A;  4MZJ A;  4E68 A;  3RM1 A;  1S5G Y;  1AHR A;  3EK7 A;  1KFU S;  2KAX A;  2LVJ A;  3SG6 A;  5BPJ A;  1DJI A;  1EXR A;  1K8U A;  4HRG A;  1B1G A;  1QX5 B;  3WHT B;  1IG5 A;  2JNF A;  1CFD A;  3B6X A;  1IRJ A;  2PAL A;  1TNP A;  1TUZ A;  2JTT A;  3BUM B;  4IL1 A;  4WQ3 A;  1CFP A;  3Q8I A;  3I5H C;  2PYQ A;  3LL8 B;  1N0Y A;  2BL0 B;  3B87 A;  1TNX A;  4MRY A;  4N1G A;  4OV2 A;  2KOT A;  4ICB A;  1RJV A;  4PE0 A;  1HT9 A;  1CDL A;  4HSZ A;  3SIB A;  3NSO A;  1YUS A;  1NPQ A;  2WCJ A;  1BOD A;  1EG3 A;  2KLE A;  1OOH A;  1A29 A;  2I7A A;  4OCI A;  1CFC A;  2JT8 A;  3BQ3 A;  3QME A;  4PCW A;  5HKZ A;  3FWC A;  4PAL A;  1LVC D;  4CPV A;  1QTX A;  3CZ0 A;  2F2O A;  2CBL A;  5EL2 A;  2QEV A;  2EC6 B;  4PDZ A;  4M2P A;  1M63 B;  2LLU A;  3PM8 A;  1WY9 A;  1OSA A;  4OZD A;  4U8D A;  4YI8 A;  1CTR A;  1AP4 A;  1M39 A;  2NCO A;  3TS5 C;  3EG5 B;  1S6C A;  2KLD A;  2H8V A;  1YX8 A;  1SW8 A;  1A03 A;  1QJT A;  2L4I A;  4JWQ A;  3BOW B;  1Z4H A;  1K9U A;  1NCZ A;  3BXK A;  5CSJ A;  2OTG C;  2WCM A;  2AMI A;  5HL1 A;  2BEC A;  1J7R A;  1B4C A;  1OOG A;  1DF0 A;  1Y1U A;  1J7P A;  1IGV A;  3AAJ A;  1OMV A;  2ERB A;  3EVV A;  4FQO A;  2NZ0 A;  4PE1 A;  1M45 A;  1QV1 A;  3ZNI A;  4GBA A;  1BLQ A;  1F54 A;  1WDC B;  1G4Y R;  3D76 A;  1F4Q A;  3D0Y A;  3DVK A;  4A4B A;  1IQ3 A;  2M8U A;  5I94 A;  1CDN A;  1GGW A;  1SBJ A;  2BL0 C;  1AJ4 A;  1SL9 A;  4FTG A;  1T14 A;  2M1K B;  1DEL A;  4YGC B;  5HKW A;  1OE9 B;  3GK2 A;  3FS7 A;  3ZWH A;  1S36 A;  2M1U A;  3H4S E;  2JC2 A;  3NGV A;  2M9G A;  3PM2 A;  1WLM A;  1QVI Z;  2LLS A;  2L0P A;  3PN7 B;  3DVE A;  3BJH A;  3KO0 A;  5D69 A;  3SIA A;  1SRA A;  2H61 A;  1NUB A;  1QS7 A;  3VRN A;  1S1E A;  2A4J A;  2ZN9 A;  1V1F A;  1S6I A;  3WXA A;  2JRF A;  1WLZ A;  4MBE A;  5CSF A;  3FE9 A;  4YBH B;  4CLN A;  2ZRS A;  1CKK A;  1K96 A;  1B8R A;  4CFR A;  3EVR A;  1WRL A;  2JTZ A;  1KK7 Y;  1U5I A;  2YGU A;  3PAL A;  4L9M A;  2O60 A;  2PSR A;  1FI5 A;  2K7B A;  2HPS A;  2FJY A;  5CSI A;  1BG1 A;  1JSA A;  2PAS A;  3CZ1 A;  1ODB A;  4OVN F;  1OMR A;  2GTE A;  1OZO A;  3SS3 A;  4GFT A;  3O6B A;  5FI6 A;  4CFQ A;  3SG2 A;  4CID A;  1M31 A;  4DCK A;  1XFW O;  3I5H B;  5CSN A;  1DGU A;  3TDI A;  1WRK A;  2WCB A;  3HX4 A;  1KFU L;  4A4C A;  5KSZ A;  1SSE B;  1TIZ A;  3BUN B;  5HKY A;  1YVL A;  2L98 A;  1PVA A;  3D74 A;  4GGF A;  3TUY C;  1JFJ A;  1YUT A;  3D77 A;  4DRW A;  1CNP A;  3KEV A;  1NIW A;  1R6P A;  1XFY O;  3CR4 X;  2JXC A;  1SK6 D;  3JTD C;  1BF5 A;  1TUJ A;  2FCE A;  2ZNE A;  2H61 C;  3ICB A;  1A75 A;  3TDU A;  1UHH A;  1ZMZ A;  1XFR A;  2I2R E;  2MBX A;  2NLN A;  1KSM A;  3TS5 B;  2FOT A;  4NDD A;  1IKU A;  3NHI A;  1KFX S;  2KQ6 A;  3C1V A;  1CLL A;  4TNC A;  2M7L A;  1SY9 A; 
#chains in the Genus database with same CATH homology
 3R1O A;  3S0A A;  5EL2 A;  3CZ0 A;  2QEV A;  3BFH A;  1OOF A;  1C3Z A;  3L4L A;  4OZD A;  3B7A A;  3D73 A;  3BFB A;  1P28 A;  2H8V A;  1OOI X;  3S0B A;  3R1P A;  3CZ2 A;  2WCM A;  1LS8 A;  1OOG A;  3B88 A;  3FE8 A;  3K1E A;  2ERB A;  2WC6 A;  1DQE A;  3D76 A;  2JPO A;  2QEB A;  4INW A;  5DIC A;  1ORG A;  1T14 A;  2QDI A;  3OGN A;  3CDN A;  2WCK A;  3NGV A;  3VB1 A;  3D75 A;  2WCH A;  3B86 A;  3CAB A;  2WC5 A;  3DY9 A;  4INX A;  1TWO A;  3BJH A;  2KPH A;  3S0G A;  3L4A A;  4FQT A;  3S0E A;  3FE9 A;  4F7F A;  3V2L A;  3R1V A;  2L2C A;  1QWV A;  2QEO A;  2QEH A;  3DYE A;  3N7H A;  2FJY A;  3BFA A;  3D78 A;  3NHT A;  3DXL A;  3CZ1 A;  2WCL A;  1OW4 A;  2GTE A;  2P71 A;  3S0D A;  1GM0 A;  2PQL A;  3FE6 A;  3CYZ A;  3PJI A;  1C3Y A;  3S0F A;  4PT1 A;  2P70 A;  3RZS A;  3D74 A;  3D77 A;  3R72 A;  3L47 A;  3B6X A;  1TUJ A;  3Q8I A;  3B87 A;  3DZT A;  4JD9 A;  1XFR A;  2WCJ A;  1OOH A;  3NHI A;  3QME A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...