2H2KA

Crystal structure analysis of human s100a13
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
93
structure length
93
Chain Sequence
SLMAAEPLTELEESIETVVTTFFTFARQEGRKDSLSVNEFKELVTQQLPHLLKDVGSLDEKMKSLDVNQDSELKFNEYWRLIGELAKEIRKKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein S100-A13
publication title Crystal structure study on human S100A13 at 2.0 A resolution
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal binding protein
total genus 36
structure length 93
sequence length 93
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2h2kA00
1DTLA 1B47A 1SL9A 1TRFA 5PALA 1BJFA 1DJZA 1K9KA 1M45A 1J7OA 1JC2A 2KFGA 1K93D 3NSIA 2KFFA 2RGIA 1S6IA 2BE6A 1LKJA 3OX6A 4GAOA 1TCOB 1S3PA 1CTRA 4QJ4B 4D1EA 1QX5B 2K7BA 2L5XB 2I2RE 1PSBA 4CPVA 3DF0A 3E3RA 3BOWA 5KSZA 1DJXA 4I5JA 1H8BA 1V1FA 4F0ZB 3KO0A 1XA5A 3I5IB 1C7WA 4DUQA 1UURA 3CR2A 1F55A 2JTTA 1KQMB 1NCYA 1ZOTB 3BYAA 5AANA 2K61A 2NCPA 1G33A 4IL1A 4AOMA 2F2OA 1X02A 2I7AA 1CLLA 2BCXA 3GOFA 4M2OA 1J7RA 1XFYO 1D1OA 1IRJA 4FTGA 4JPZB 5D7FA 1TNPA 1J1EA 2CBLA 1A03A 2JQ6A 2HETA 1ZACA 2CNPA 1M46A 1NYAA 1B9AA 2MAZA 1S36A 1JSAA 4PE0A 2D8NA 2FOTA 3CTNA 3SG2A 1CM1A 3VRNA 4HREE 2L2EA 2Q4UA 1DF0A 1TTXA 1QV0A 2MA2A 3PATA 2JT8A 5CSJA 5B8IB 1SMGA 1MR8A 1N65A 1SRAA 1ZUZA 2OS8B 1B8RA 1PK0D 2AAOA 2F33A 4TNCA 1M63B 1UUSA 2JOJA 3AKAA 4QJ3B 2KI4B 2LP2A 4MBEA 5D69A 1AJ4A 2LVKA 2O60A 1EG3A 1QTXA 1SK6D 1J7PA 1J7QA 3BUMB 1WY9A 3SG5A 1A29A 1TNXA 2CTNA 2BKIB 3TS5B 2M1UA 4L9MA 3SG3A 1BLQA 1DJWA 3SIAA 1KK8C 2AMIA 2KBIA 1SW8A 3TUYB 3CS1A 2FCEA 2P6BB 2ZNEA 1TCFA 1SKTA 3A4UB 2PSRA 3BXKA 3D0YB 1YVLA 4NDBA 3DVEA 3JVTC 1K2HA 2NLNA 1VRKA 2KAVA 1OOJA 1S6CA 4GNKB 1IQ3A 2OTGC 1SBJA 2KQYA 3LK0A 1K96A 4N1FA 1BR1B 4PHJA 4YRUA 1PRWA 1L2OB 1B4CA 2M8UA 4PALA 4MEWA 2KAXA 2G2BA 1UHHA 1KFUL 2JU0A 2SCPA 4YI8A 3M0WA 1FF1A 2LLTA 1AK8A 1HQVA 2O5GA 1CFCA 3KPXA 1XO5A 2ZRSA 1BG1A 1SR6C 1QS7A 4DIRA 1CFFA 1KFXS 1YX8A 1RJVA 4GGNA 2KI6D 3PLFB 3NXAA 1A75A 2E30A 1CKKA 1TOPA 3A8RA 3GK2A 1SPYA 3SG6A 1SYMA 1RK9A 3I5FB 3BOWB 4PHKA 4WQ3A 1JFKA 1IQ5A 2BCAA 1AP4A 1NX0A 4MLWA 3TDZA 3SG7A 1GJYA 2LCPA 1NX2A 1ZFSA 1K94A 1LXFC 1DT7B 2EC6C 1W7IB 2HF5A 2LC5A 5TNCA 4AQJA 1Y1XA 1FPWA 1KWOC 3VROA 1NPQA 3JTDC 5GQQC 4CIDA 2LVVA 4C0KA 3FIAA 2ZFDA 1CNPA 1Y6WA 5HYDA 1CLBA 1S26D 1KK7Z 1OE9B 2K0JA 4WRIA 4CFRA 5ER5A 4HSZA 1CLMA 1YURA 3D10A 3O6BA 2JULA 3WXAA 3EK4A 2L4IA 1KFUS 4PE1A 1CDPA 2COLB 1RWYA 3GK4X 4PE7A 4XJKA 4PHNA 2EHBA 2BE4A 2F2PA 1DF0B 1DJHA 2LLUA 3MSEB 5HKZA 4OR9B 2M7LA 2IS9A 1YX7A 3NSLA 4AQIA 4C0LA 2JT3A 3GK1A 3LL8B 1AJ5A 4E68A 3PN7C 3C1VA 2JXLA 3KEVA 1YUSA 1EG4A 1XFWO 4I5KA 3WNXB 4BY5A 1XK4C 1EJ3A 1DJYA 3I5HC 2KAYA 2JWWA 4OV2A 2LV7A 4N1GA 1EXRA 1PVBA 5CPVA 1XFXO 2Y1NA 1U5IA 4M2QA 2M29A 4FQOA 2JC2A 1F70A 1IGVA 3EVUA 3AAJA 1G8IA 1K90D 4OCIA 1QX2A 5F6TA 1Y1UA 1WLMA 2Q91A 1JF0A 5K89A 4N5XA 3LLEA 1NP8A 1CMGA 1F54A 4PE4A 4P2YB 2MLFC 1S6JA 3CWGA 2QACA 1SCMB 2M9GA 2MRDA 1B8CA 1PULA 2GGMA 1ODBA 1N0YA 2K7OA 2LUCA 1SL8A 2M7NA 1UHJA 2OPOA 2WCBA 2BL0B 3TZ1A 3DVKA 3I5GB 4Q04A 2JNXA 2ZN8A 3NSOA 3CLNA 1OZSA 4DS7A 1OMRA 1WDCC 1Q80A 2I18A 2EGDA 2LVIA 1LA0A 3ICBA 1MF8B 5AXIA 2ZNDA 3RLZA 3ZWHA 1KQVA 1LA3A 4ZCVA 3DD4A 1A75B 5I2OA 5AERA 3CR5X 3HX4A 3SG4A 1C07A 2L0PA 4GBAA 1JWDA 4M2PA 1OSAA 1QX7A 1TIZA 2V53A 2LUXA 2SASA 1TN4A 1FBVA 5HLOA 3I5IC 3TDUA 3AAKA 2CXJA 4YGEB 2BBNA 1KQMC 4I5NB 1KSMA 1OQPA 2NCOA 2LNKA 1F4QA 4CLNA 2WOSA 1R6PA 4P5OE 3QRXA 2K2AA 4DRWA 3TDIA 1PVAA 1DGVA 3F45A 5DKRA 1QVIY 3PSRA 2M49B 1K8UA 2K7CA 1RFJA 1UP5A 2KSPA 1XFUO 5ER4X 1BR4B 5HLVA 1B1GA 1QVIZ 5JJGA 2QPTA 3OB1B 1KSOA 3EK7A 4XJKB 2FCDA 3IQOA 1OMVA 1RROA 2K2FA 1BOCA 5DKQA 4GPLB 2L4HA 1SL7A 1QV1A 2OS8C 3DF0B 4CFQA 1KCYA 1PALA 2M3WA 3LK1A 1LVCD 3OB2B 1J55A 2F3YA 2K8MB 2BECA 2GGZA 1CMFA 2KI4C 2JZIA 2L51A 2MJWB 5CSNA 1EL4A 1V1GA 1YR5A 2LMVA 3EKJA 5HKYA 1MUXA 1N2DA 1QIWA 1M39A 1AHRA 5KU1A 1UHIA 3TS5C 1E8AA 1FI5A 1CB1A 2KGRA 4JWQA 1SY9A 2MBXA 1QLSA 2K7DA 2JPTA 1CDNA 4MRXA 3TUYC 1R2UA 3D0YA 1S1EA 1QATA 2LP3A 4PDZA 3IQQA 2LLSA 2KBMA 5CSIA 2M0RA 1WRLA 1BT6A 2WCFA 1L7ZA 1BF5A 3WHTB 4PCWA 1ZMZA 2F8PA 2KQ6A 2TN4A 1NCXA 2HPSA 5JOLA 4MZJA 5BPJA 1IG5A 2NZ0A 1DJGA 1XK4A 2KGBC 5IBWA 1XFVO 1SNLA 3K21A 2CT9A 2WC8A 4ORCB 1B7TY 1L2OC 2B1UA 3WHUB 2E6WA 4OKHA 2GV5A 1CFDA 1IH0A 2Y5IA 1YUUA 1IWQA 1B7TZ 3SIBA 3OHMB 1W7JB 4A4BA 1CDLA 1KK8B 1QASA 4HRHA 2BCBA 1DVIA 3HCMA 1XVJA 2PMYA 1NCZA 1NWDA 2M97A 3EVRA 1PSRA 3OX5A 2AUCA 5I2QA 4ETOA 4I5LB 3NSKA 4YGDB 4MN0A 2BBMA 3VRRA 3EK8A 3JVTB 2BKHB 2LHIA 3I5FC 2PVBA 1F8HA 2KHNA 2KI6C 1IKUA 4PHMA 3ZNIA 1YTZC 2KFHA 1A2XA 2OTGB 1G4YR 1QJTA 1RECA 1MHOA 1OMDA 2Y1MA 3CZTX 2A4JA 1Y1AA 5AFPA 3PFVA 5KTYA 1H4BA 2JNFA 5I2LA 2H2KA 4U8DA 2KNEA 1ALVA 4JQ0D 3DVMA 1XFZO 4MSPA 1DMOA 1K9UA 4HRGA 4ZCUA 2LMUA 5J3XA 2ZKMX 2JRFA 1JUOA 3VRPA 1EH2A 4YGCB 5CSFA 1ALWA 1FW4A 2Y4QA 1SR6B 2R2IA 2F3ZA 4ORBB 4UPGA 2JT0A 3BUOB 2ISDA 2L98A 1BU3A 3FWBA 2PRUA 1AUIB 4MZLA 1IJ5A 1CFPA 2M1KB 1TNWA 1A4PA 1TNQA 4ICBA 3BQ3A 1MWNA 1UHNA 3VRQA 1NSHA 1IJ6A 2JXCA 1WLZA 1YUTA 2EC6B 2LANA 2KOTA 2LAPA 2LHLA 4DCKA 1JBAA 4WQ2A 3EVVA 4MZKA 3FWCA 1YRUB 1XYDA 1KWOB 1DGUA 3PM8A 1MXLC 1QLKA 1QIVA 3JTDB 4ORAB 2FJUB 3KF9A 1RTP1 2DOQA 3BUNB 1KFXL 2WCEA 3AKBA 1HT9A 1K95A 1QXPA 3DVJA 4MVFA 1BMOA 2PASA 3PALA 3KHEA 1GQMA 3VGOA 4USLA 4GUKA 2HQ8A 3SJSA 4C0JA 1MXEA 4GFTA 2HQWA 1JF2A 4YBHB 4XYNA 1SCMC 1LINA 5FYXA 1B8LA 3OP0A 1OZOA 3PN7B 2LMTA 2BL0C 1SCVA 3I5GC 5G08A 2KYCA 2H61A 1YVHA 3I5HB 4GGFA 2H61C 3CR4X 4NQGA 1C7VA 1WRKA 4NDDA 4GGFC 1JFJA 3LCPC 2NXQA 4NDCA 1NX1A 1NIWA 4OVNF 1U5IB 1M31A 2CCMA 2LE9B 2JTZA 2LM5A 4YGBB 2ZRTA 1FI6A 2KYFA 2WNDA 3FS7A 2WORA 3BUWB 4YGAA 4MRYA 1F4OA 1CM4A 2MHHA 2KDHA 2I94A 2LVJA 2PALA 3BUXB 1GGZA 3H4SE 3O78A 5HKWA 1GGWA 3RM1A 2VRGA 3CGAA 1F71A 5DKNA 2G9BA 3O2PA 3EKHA 4QJ5B 1CDMA 1MQ1A 1K9PA 3O4YA 1YRTB 1UHKA 1J1DA 1KK7Y 1S5GY 5AEQA 1DJIA 1WDCB 1WRZA 4A4CA 1BODA 4YI9A 1NUBA 1NX3A 3IF7A 4BY4A 1UWOA 1S5GZ 5I8NA 4R1EA 2L50A 2MLEC 1AVSA 2ZN9A 1Y0VH
chains in the Genus database with same CATH superfamily
1DTLA 1B47A 1SL9A 1OOHA 1TRFA 1BJFA 1DJZA 1K9KA 1M45A 5D3OA 5PALA 1J7OA 1JC2A 2KFGA 2PQLA 1K93D 3NSIA 2KFFA 2RGIA 1S6IA 2BE6A 1LKJA 3OX6A 4GAOA 4F7FA 1TCOB 1S3PA 1CTRA 4QJ4B 4D1EA 1QX5B 2K7BA 2L5XB 2I2RE 3B87A 1PSBA 4CPVA 3DF0A 3E3RA 3S0FA 3BOWA 5KSZA 1DJXA 4I5JA 1H8BA 1V1FA 4F0ZB 3KO0A 1OOGA 1XA5A 3I5IB 1C7WA 4DUQA 1UURA 3CR2A 3R1PA 1F55A 2JTTA 1KQMB 1NCYA 1ZOTB 3BFHA 3BYAA 5AANA 2K61A 2NCPA 3CZ1A 1G33A 3OGNA 4IL1A 4AOMA 2F2OA 1X02A 2I7AA 1CLLA 2BCXA 3GOFA 4M2OA 1J7RA 1XFYO 3D77A 1D1OA 1IRJA 4FTGA 4JPZB 5D7FA 1TNPA 1J1EA 1P28A 2CBLA 2JQ6A 2GTEA 2HETA 1A03A 1ZACA 2CNPA 1M46A 1NYAA 1B9AA 2MAZA 1S36A 1JSAA 4PE0A 2D8NA 2FOTA 3CTNA 3SG2A 1CM1A 2QEOA 3VRNA 4HREE 2L2EA 2Q4UA 1DF0A 1TTXA 1QV0A 2MA2A 2FJYA 3PATA 2JT8A 5CSJA 4FQTA 5B8IB 2L2CA 1SMGA 1MR8A 1N65A 1SRAA 1ZUZA 2OS8B 1B8RA 1PK0D 2AAOA 2F33A 4TNCA 1M63B 1UUSA 2JOJA 3AKAA 4QJ3B 2KI4B 2LP2A 4MBEA 1C3ZA 5D69A 1AJ4A 2LVKA 2O60A 1Z2CB 3NHTA 1EG3A 1QTXA 1SK6D 1J7PA 1J7QA 3BUMB 1WY9A 2WC5A 3SG5A 1A29A 1TNXA 2CTNA 2BKIB 3TS5B 2M1UA 4L9MA 3SG3A 1BLQA 1DJWA 3SIAA 1KK8C 2AMIA 2KBIA 1SW8A 3TUYB 3CS1A 2FCEA 2P6BB 2ZNEA 1TCFA 1SKTA 3A4UB 2PSRA 3BXKA 3D0YB 1YVLA 4NDBA 3DVEA 3JVTC 3CDNA 1K2HA 2NLNA 1VRKA 2KAVA 1OOJA 1S6CA 4GNKB 1IQ3A 1C3YA 2OTGC 1SBJA 2KQYA 3LK0A 1K96A 4N1FA 1BR1B 4PHJA 4YRUA 1DELA 1PRWA 1L2OB 1W9ZA 1B4CA 2M8UA 4PALA 4MEWA 2KAXA 2G2BA 1UHHA 1KFUL 2JU0A 2SCPA 4YI8A 3CYZA 3M0WA 3UO9A 1FF1A 2LLTA 1AK8A 1HQVA 2O5GA 1CFCA 3KPXA 1XO5A 2BAPA 2ZRSA 5I94A 1BG1A 1SR6C 1QS7A 4DIRA 1CFFA 1KFXS 1YX8A 1RJVA 4GGNA 2KI6D 3PLFB 3NXAA 1A75A 2E30A 1CKKA 1TOPA 1Z4HA 3A8RA 3GK2A 1SPYA 3SG6A 1SYMA 3R1VA 1RK9A 2QEVA 3BOWB 3I5FB 3FE8A 4PHKA 1JFKA 4WQ3A 1IQ5A 2BCAA 1AP4A 1NX0A 4MLWA 3TDZA 3SG7A 1GJYA 2LCPA 1NX2A 1ZFSA 1K94A 1DEKA 1LXFC 2EC6C 2KLDA 1W7IB 2HF5A 1DT7B 2LC5A 5TNCA 3S0EA 4AQJA 1Y1XA 1FPWA 3L47A 1KWOC 3SS5A 2QDIA 1NPQA 2YGUA 3JTDC 5GQQC 3VROA 2LVVA 4C0KA 3FIAA 4CIDA 2ZFDA 1CNPA 1Y6WA 1GM0A 5HYDA 1CLBA 1S26D 1KK7Z 1OE9B 2K0JA 4WRIA 4CFRA 5ER5A 4HSZA 1CLMA 1YURA 3D10A 3O6BA 2JULA 3WXAA 3EK4A 2L4IA 1KFUS 4PE1A 1CDPA 2COLB 1RWYA 3D75A 3GK4X 4PE7A 4XJKA 4PHNA 2EHBA 2BE4A 2F2PA 1DF0B 1DJHA 2LLUA 2H8VA 3MSEB 3CZ2A 3N7HA 1ORGA 3VB1A 5HKZA 4OR9B 1OOIX 2M7LA 2IS9A 1YX7A 3NSLA 4AQIA 4C0LA 2JT3A 3GK1A 3LL8B 1AJ5A 4E68A 3PN7C 3C1VA 2JXLA 3KEVA 1YUSA 1EG4A 1XFWO 3L4AA 4I5KA 3WNXB 4BY5A 1XK4C 1EJ3A 1DJYA 3I5HC 2KAYA 2JWWA 3DYEA 4OV2A 2LV7A 4N1GA 1EXRA 1PVBA 5CPVA 1XFXO 2Y1NA 1U5IA 4M2QA 2M29A 4IJ7A 4FQOA 2P71A 2JC2A 1XFRA 1F70A 1IGVA 3EVUA 3S0GA 3AAJA 1SSEB 1G8IA 1K90D 4OCIA 1QX2A 3NGVA 1Y1UA 5F6TA 3IVTA 1WLMA 2Q91A 1JF0A 5K89A 2K60A 3LLEA 1NP8A 4N5XA 1CMGA 4PE4A 4P2YB 1F54A 2MLFC 1S6JA 3CWGA 2WC6A 2QACA 1SCMB 2M9GA 2MRDA 1B8CA 4KYNA 1PULA 2GGMA 1ODBA 1N0YA 2K7OA 2LUCA 1SL8A 2M7NA 1UHJA 2OPOA 3R1OA 2WCBA 2BL0B 3TZ1A 3DVKA 3I5GB 4Q04A 2JNXA 3D74A 2ZN8A 3NSOA 3CLNA 1OZSA 4DS7A 1OMRA 1WDCC 1Q80A 2I18A 2EGDA 2LVIA 1LA0A 3ICBA 1MF8B 5AXIA 2ZNDA 3RLZA 3S0AA 3ZWHA 3D78A 1KQVA 4JD9A 1LA3A 4ZCVA 3DD4A 1A75B 5I2OA 5AERA 3CR5X 3HX4A 3SG4A 1C07A 2L0PA 3QMEA 4GBAA 1JWDA 4M2PA 1OSAA 1QX7A 1TIZA 2V53A 2LUXA 2SASA 1TN4A 1FBVA 5HLOA 3I5IC 3TDUA 3AAKA 2CXJA 3O4XA 4YGEB 2BBNA 1QWVA 3BFAA 1KQMC 4I5NB 1KSMA 1OQPA 2NCOA 3SS4A 3BFBA 2LNKA 1F4QA 4CLNA 2WOSA 1R6PA 3CZ0A 4P5OE 3QRXA 2K2AA 2WCKA 4DRWA 3TDIA 1PVAA 1DGVA 3F45A 1DQEA 5DKRA 1QVIY 3D76A 3PSRA 2M49B 1K8UA 2K7CA 1RFJA 1UP5A 2KSPA 1XFUO 5ER4X 1BR4B 5HLVA 2PYQA 1QVIZ 1B1GA 3BJHA 3CABA 5JJGA 2QPTA 3OB1B 1KSOA 3EK7A 4XJKB 1LS8A 2FCDA 3IQOA 3NHIA 1OMVA 1RROA 2K2FA 1BOCA 5DKQA 4GPLB 2L4HA 1SL7A 1QV1A 2OS8C 3DF0B 3EG5B 4CFQA 1T14A 1KCYA 1PALA 2M3WA 3LK1A 5FI2A 1LVCD 3OB2B 1J55A 2F3YA 2K8MB 2BECA 2GGZA 1CMFA 2KI4C 2JZIA 2L51A 2MJWB 5CSNA 1EL4A 1V1GA 1YR5A 2LMVA 2L5YA 3EKJA 3R72A 5HKYA 1MUXA 5FI7A 2P70A 1N2DA 1QIWA 1M39A 1AHRA 5KU1A 1UHIA 3TS5C 1E8AA 2ERBA 1CB1A 1FI5A 2KGRA 4JWQA 1SY9A 2MBXA 1QLSA 3K1EA 2K7DA 2JPTA 1CDNA 4MRXA 3TUYC 1R2UA 3D0YA 1S1EA 1QATA 2LP3A 4PDZA 3IQQA 2LLSA 2KBMA 5CSIA 2M0RA 1WRLA 1BT6A 2WCFA 1L7ZA 1BF5A 3WHTB 4PCWA 3DXLA 1ZMZA 2F8PA 2KQ6A 2TN4A 1NCXA 2HPSA 5JOLA 4MZJA 5BPJA 1IG5A 2NZ0A 4OZDA 1DJGA 1XK4A 2KGBC 5IBWA 1XFVO 2QEBA 1SNLA 3K21A 2CT9A 2WC8A 4ORCB 1B7TY 1L2OC 1TUZA 2B1UA 3WHUB 2E6WA 3Q8IA 4OKHA 2GV5A 1CFDA 1IH0A 2Y5IA 1YUUA 1IWQA 1B7TZ 3SIBA 3UNWA 3OHMB 1W7JB 4A4BA 1CDLA 3B7AA 1KK8B 1QASA 4HRHA 3S0BA 2BCBA 1DVIA 3B6XA 1XVJA 3HCMA 2PMYA 4PT1A 2WCHA 1NCZA 1NWDA 2M97A 3EVRA 1PSRA 3OX5A 2AUCA 5I2QA 4ETOA 4I5LB 3NSKA 3S0DA 4YGDB 4MN0A 2BBMA 3VRRA 3EK8A 3JVTB 2BKHB 2LHIA 3I5FC 2PVBA 1DC1A 1F8HA 1IIOA 2KHNA 2KI6C 1IKUA 4PHMA 3ZNIA 1YTZC 2KFHA 1A2XA 2OTGB 1G4YR 1QJTA 1RECA 1MHOA 1OMDA 2Y1MA 3CZTX 2A4JA 1Y1AA 5AFPA 3PFVA 5KTYA 3PM2A 2JNFA 1H4BA 5I2LA 2H2KA 4U8DA 2KNEA 1ALVA 4JQ0D 3DVMA 1XFZO 4MSPA 2KPHA 1DMOA 1K9UA 4HRGA 4ZCUA 2LMUA 5J3XA 2ZKMX 2JRFA 1JUOA 3OBVA 3VRPA 1EH2A 4YGCB 5CSFA 1ALWA 1FW4A 2Y4QA 1SR6B 2R2IA 2F3ZA 4ORBB 4UPGA 2JT0A 3BUOB 2KLEA 2ISDA 2L98A 3RZSA 1BU3A 1TUJA 3FWBA 1OW4A 2PRUA 5EL2A 1AUIB 4MZLA 1IJ5A 1CFPA 2M1KB 1TNWA 5FI6A 1A4PA 1TNQA 4ICBA 3BQ3A 1MWNA 1UHNA 3VRQA 1NSHA 1IJ6A 2JXCA 1WLZA 1YUTA 2EC6B 2LANA 2KOTA 2LAPA 2LHLA 4DCKA 1JBAA 4WQ2A 3D73A 3EVVA 4MZKA 3FWCA 1YRUB 1XYDA 1KWOB 3SS3A 1DGUA 3PM8A 1MXLC 1QLKA 1QIVA 3JTDB 4ORAB 2FJUB 3KF9A 1RTP1 2DOQA 3BUNB 1KFXL 2WCEA 3L4LA 3AKBA 1HT9A 1K95A 1QXPA 3DVJA 2WCLA 4MVFA 1BMOA 2PASA 3PALA 3KHEA 1GQMA 3FE6A 3VGOA 4USLA 4GUKA 2HQ8A 3SJSA 3DZTA 4C0JA 1MXEA 4GFTA 2HQWA 1JF2A 4YBHB 4XYNA 1SCMC 1LINA 2QEHA 5FYXA 1B8LA 3OP0A 1OZOA 3PN7B 2LMTA 4INWA 2BL0C 1SCVA 2WCJA 3I5GC 5G08A 2KYCA 2H61A 4JKTA 1YVHA 3I5HB 4GGFA 3V2LA 2H61C 3CR4X 4NQGA 1C7VA 2WCMA 1WRKA 4NDDA 4GGFC 1JFJA 2JPOA 2NXQA 3LCPC 4NDCA 1NX1A 3B88A 1NIWA 4OVNF 1U5IB 1M31A 2CCMA 3PJIA 2LE9B 2JTZA 2LM5A 4YGBB 2ZRTA 1FI6A 5DICA 2KYFA 2WNDA 3FS7A 5HL1A 2WORA 3BUWB 1TWOA 4MRYA 4YGAA 1F4OA 1CM4A 2MHHA 2KDHA 2I94A 2LVJA 2PALA 3BUXB 1GGZA 3H4SE 3O78A 5HKWA 1GGWA 3RM1A 2VRGA 3CGAA 1F71A 3DY9A 5DKNA 2G9BA 1OOFA 3O2PA 3EKHA 4QJ5B 1CDMA 1MQ1A 1K9PA 2BNXA 3O4YA 4INXA 1YRTB 3B86A 1UHKA 1J1DA 1KK7Y 1S5GY 5AEQA 1DJIA 1WDCB 1WRZA 3FE9A 4A4CA 1BODA 4YI9A 1NUBA 1NX3A 3IF7A 4BY4A 1UWOA 1S5GZ 5I8NA 4R1EA 2L50A 2MLEC 1AVSA 2ZN9A 1Y0VH
chains in the Genus database with same CATH topology
1DTLA 1B47A 1SL9A 1TRFA 5PALA 1BJFA 1DJZA 1K9KA 1M45A 1J7OA 1JC2A 2KFGA 1K93D 3NSIA 2KFFA 2RGIA 1S6IA 2BE6A 1LKJA 3OX6A 4GAOA 1TCOB 1S3PA 1CTRA 4QJ4B 4D1EA 1QX5B 2K7BA 2L5XB 2I2RE 1PSBA 4CPVA 3DF0A 3E3RA 3BOWA 5KSZA 1DJXA 4I5JA 1H8BA 1V1FA 4F0ZB 3KO0A 1XA5A 3I5IB 1C7WA 4DUQA 1UURA 3CR2A 1F55A 2JTTA 1KQMB 1NCYA 1ZOTB 3BYAA 5AANA 2K61A 2NCPA 1G33A 4IL1A 4AOMA 2F2OA 1X02A 2I7AA 1CLLA 2BCXA 3GOFA 4M2OA 1J7RA 1XFYO 1D1OA 1IRJA 4FTGA 4JPZB 5D7FA 1TNPA 1J1EA 2CBLA 1A03A 2JQ6A 2HETA 1ZACA 2CNPA 1M46A 1NYAA 1B9AA 2MAZA 1S36A 1JSAA 4PE0A 2D8NA 2FOTA 3CTNA 3SG2A 1CM1A 3VRNA 4HREE 2L2EA 2Q4UA 1DF0A 1TTXA 1QV0A 2MA2A 3PATA 2JT8A 5CSJA 5B8IB 1SMGA 1MR8A 1N65A 1SRAA 1ZUZA 2OS8B 1B8RA 1PK0D 2AAOA 2F33A 4TNCA 1M63B 1UUSA 2JOJA 3AKAA 4QJ3B 2KI4B 2LP2A 4MBEA 5D69A 1AJ4A 2LVKA 2O60A 1EG3A 1QTXA 1SK6D 1J7PA 1J7QA 3BUMB 1WY9A 3SG5A 1A29A 1TNXA 2CTNA 2BKIB 3TS5B 2M1UA 4L9MA 3SG3A 1BLQA 1DJWA 3SIAA 1KK8C 2AMIA 2KBIA 1SW8A 3TUYB 3CS1A 2FCEA 2P6BB 2ZNEA 1TCFA 1SKTA 3A4UB 2PSRA 3BXKA 3D0YB 1YVLA 4NDBA 3DVEA 3JVTC 1K2HA 2NLNA 1VRKA 2KAVA 1OOJA 1S6CA 4GNKB 1IQ3A 2OTGC 1SBJA 2KQYA 3LK0A 1K96A 4N1FA 1BR1B 4PHJA 4YRUA 1PRWA 1L2OB 1B4CA 2M8UA 4PALA 4MEWA 2KAXA 2G2BA 1UHHA 1KFUL 2JU0A 2SCPA 4YI8A 3M0WA 1FF1A 2LLTA 1AK8A 1HQVA 2O5GA 1CFCA 3KPXA 1XO5A 2ZRSA 1BG1A 1SR6C 1QS7A 4DIRA 1CFFA 1KFXS 1YX8A 1RJVA 4GGNA 2KI6D 3PLFB 3NXAA 1A75A 2E30A 1CKKA 1TOPA 3A8RA 3GK2A 1SPYA 3SG6A 1SYMA 1RK9A 3I5FB 3BOWB 4PHKA 4WQ3A 1JFKA 1IQ5A 2BCAA 1AP4A 1NX0A 4MLWA 3TDZA 3SG7A 1GJYA 2LCPA 1NX2A 1ZFSA 1K94A 1LXFC 1DT7B 2EC6C 1W7IB 2HF5A 2LC5A 5TNCA 4AQJA 1Y1XA 1FPWA 1KWOC 3VROA 1NPQA 3JTDC 5GQQC 4CIDA 2LVVA 4C0KA 3FIAA 2ZFDA 1CNPA 1Y6WA 5HYDA 1CLBA 1S26D 1KK7Z 1OE9B 2K0JA 4WRIA 4CFRA 5ER5A 4HSZA 1CLMA 1YURA 3D10A 3O6BA 2JULA 3WXAA 3EK4A 2L4IA 1KFUS 4PE1A 1CDPA 2COLB 1RWYA 3GK4X 4PE7A 4XJKA 4PHNA 2EHBA 2BE4A 2F2PA 1DF0B 1DJHA 2LLUA 3MSEB 5HKZA 4OR9B 2M7LA 2IS9A 1YX7A 3NSLA 4AQIA 4C0LA 2JT3A 3GK1A 3LL8B 1AJ5A 4E68A 3PN7C 3C1VA 2JXLA 3KEVA 1YUSA 1EG4A 1XFWO 4I5KA 3WNXB 4BY5A 1XK4C 1EJ3A 1DJYA 3I5HC 2KAYA 2JWWA 4OV2A 2LV7A 4N1GA 1EXRA 1PVBA 5CPVA 1XFXO 2Y1NA 1U5IA 4M2QA 2M29A 4FQOA 2JC2A 1F70A 1IGVA 3EVUA 3AAJA 1G8IA 1K90D 4OCIA 1QX2A 5F6TA 1Y1UA 1WLMA 2Q91A 1JF0A 5K89A 4N5XA 3LLEA 1NP8A 1CMGA 1F54A 4PE4A 4P2YB 2MLFC 1S6JA 3CWGA 2QACA 1SCMB 2M9GA 2MRDA 1B8CA 1PULA 2GGMA 1ODBA 1N0YA 2K7OA 2LUCA 1SL8A 2M7NA 1UHJA 2OPOA 2WCBA 2BL0B 3TZ1A 3DVKA 3I5GB 4Q04A 2JNXA 2ZN8A 3NSOA 3CLNA 1OZSA 4DS7A 1OMRA 1WDCC 1Q80A 2I18A 2EGDA 2LVIA 1LA0A 3ICBA 1MF8B 5AXIA 2ZNDA 3RLZA 3ZWHA 1KQVA 1LA3A 4ZCVA 3DD4A 1A75B 5I2OA 5AERA 3CR5X 3HX4A 3SG4A 1C07A 2L0PA 4GBAA 1JWDA 4M2PA 1OSAA 1QX7A 1TIZA 2V53A 2LUXA 2SASA 1TN4A 1FBVA 5HLOA 3I5IC 3TDUA 3AAKA 2CXJA 4YGEB 2BBNA 1KQMC 4I5NB 1KSMA 1OQPA 2NCOA 2LNKA 1F4QA 4CLNA 2WOSA 1R6PA 4P5OE 3QRXA 2K2AA 4DRWA 3TDIA 1PVAA 1DGVA 3F45A 5DKRA 1QVIY 3PSRA 2M49B 1K8UA 2K7CA 1RFJA 1UP5A 2KSPA 1XFUO 5ER4X 1BR4B 5HLVA 1B1GA 1QVIZ 5JJGA 2QPTA 3OB1B 1KSOA 3EK7A 4XJKB 2FCDA 3IQOA 1OMVA 1RROA 2K2FA 1BOCA 5DKQA 4GPLB 2L4HA 1SL7A 1QV1A 2OS8C 3DF0B 4CFQA 1KCYA 1PALA 2M3WA 3LK1A 1LVCD 3OB2B 1J55A 2F3YA 2K8MB 2BECA 2GGZA 1CMFA 2KI4C 2JZIA 2L51A 2MJWB 5CSNA 1EL4A 1V1GA 1YR5A 2LMVA 3EKJA 5HKYA 1MUXA 1N2DA 1QIWA 1M39A 1AHRA 5KU1A 1UHIA 3TS5C 1E8AA 1FI5A 1CB1A 2KGRA 4JWQA 1SY9A 2MBXA 1QLSA 2K7DA 2JPTA 1CDNA 4MRXA 3TUYC 1R2UA 3D0YA 1S1EA 1QATA 2LP3A 4PDZA 3IQQA 2LLSA 2KBMA 5CSIA 2M0RA 1WRLA 1BT6A 2WCFA 1L7ZA 1BF5A 3WHTB 4PCWA 1ZMZA 2F8PA 2KQ6A 2TN4A 1NCXA 2HPSA 5JOLA 4MZJA 5BPJA 1IG5A 2NZ0A 1DJGA 1XK4A 2KGBC 5IBWA 1XFVO 1SNLA 3K21A 2CT9A 2WC8A 4ORCB 1B7TY 1L2OC 2B1UA 3WHUB 2E6WA 4OKHA 2GV5A 1CFDA 1IH0A 2Y5IA 1YUUA 1IWQA 1B7TZ 3SIBA 3OHMB 1W7JB 4A4BA 1CDLA 1KK8B 1QASA 4HRHA 2BCBA 1DVIA 3HCMA 1XVJA 2PMYA 1NCZA 1NWDA 2M97A 3EVRA 1PSRA 3OX5A 2AUCA 5I2QA 4ETOA 4I5LB 3NSKA 4YGDB 4MN0A 2BBMA 3VRRA 3EK8A 3JVTB 2BKHB 2LHIA 3I5FC 2PVBA 1F8HA 2KHNA 2KI6C 1IKUA 4PHMA 3ZNIA 1YTZC 2KFHA 1A2XA 2OTGB 1G4YR 1QJTA 1RECA 1MHOA 1OMDA 2Y1MA 3CZTX 2A4JA 1Y1AA 5AFPA 3PFVA 5KTYA 1H4BA 2JNFA 5I2LA 2H2KA 4U8DA 2KNEA 1ALVA 4JQ0D 3DVMA 1XFZO 4MSPA 1DMOA 1K9UA 4HRGA 4ZCUA 2LMUA 5J3XA 2ZKMX 2JRFA 1JUOA 3VRPA 1EH2A 4YGCB 5CSFA 1ALWA 1FW4A 2Y4QA 1SR6B 2R2IA 2F3ZA 4ORBB 4UPGA 2JT0A 3BUOB 2ISDA 2L98A 1BU3A 3FWBA 2PRUA 1AUIB 4MZLA 1IJ5A 1CFPA 2M1KB 1TNWA 1A4PA 1TNQA 4ICBA 3BQ3A 1MWNA 1UHNA 3VRQA 1NSHA 1IJ6A 2JXCA 1WLZA 1YUTA 2EC6B 2LANA 2KOTA 2LAPA 2LHLA 4DCKA 1JBAA 4WQ2A 3EVVA 4MZKA 3FWCA 1YRUB 1XYDA 1KWOB 1DGUA 3PM8A 1MXLC 1QLKA 1QIVA 3JTDB 4ORAB 2FJUB 3KF9A 1RTP1 2DOQA 3BUNB 1KFXL 2WCEA 3AKBA 1HT9A 1K95A 1QXPA 3DVJA 4MVFA 1BMOA 2PASA 3PALA 3KHEA 1GQMA 3VGOA 4USLA 4GUKA 2HQ8A 3SJSA 4C0JA 1MXEA 4GFTA 2HQWA 1JF2A 4YBHB 4XYNA 1SCMC 1LINA 5FYXA 1B8LA 3OP0A 1OZOA 3PN7B 2LMTA 2BL0C 1SCVA 3I5GC 5G08A 2KYCA 2H61A 1YVHA 3I5HB 4GGFA 2H61C 3CR4X 4NQGA 1C7VA 1WRKA 4NDDA 4GGFC 1JFJA 3LCPC 2NXQA 4NDCA 1NX1A 1NIWA 4OVNF 1U5IB 1M31A 2CCMA 2LE9B 2JTZA 2LM5A 4YGBB 2ZRTA 1FI6A 2KYFA 2WNDA 3FS7A 2WORA 3BUWB 4YGAA 4MRYA 1F4OA 1CM4A 2MHHA 2KDHA 2I94A 2LVJA 2PALA 3BUXB 1GGZA 3H4SE 3O78A 5HKWA 1GGWA 3RM1A 2VRGA 3CGAA 1F71A 5DKNA 2G9BA 3O2PA 3EKHA 4QJ5B 1CDMA 1MQ1A 1K9PA 3O4YA 1YRTB 1UHKA 1J1DA 1KK7Y 1S5GY 5AEQA 1DJIA 1WDCB 1WRZA 4A4CA 1BODA 4YI9A 1NUBA 1NX3A 3IF7A 4BY4A 1UWOA 1S5GZ 5I8NA 4R1EA 2L50A 2MLEC 1AVSA 2ZN9A 1Y0VH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DTL A;  1B47 A;  1SL9 A;  1TRF A;  5PAL A;  1BJF A;  1DJZ A;  1K9K A;  1M45 A;  1J7O A;  1JC2 A;  2KFG A;  1K93 D;  3NSI A;  2KFF A;  2RGI A;  1S6I A;  2BE6 A;  1LKJ A;  3OX6 A;  4GAO A;  1TCO B;  1S3P A;  1CTR A;  4QJ4 B;  4D1E A;  1QX5 B;  2K7B A;  2L5X B;  2I2R E;  1PSB A;  4CPV A;  3DF0 A;  3E3R A;  3BOW A;  5KSZ A;  1DJX A;  4I5J A;  1H8B A;  1V1F A;  4F0Z B;  3KO0 A;  1XA5 A;  3I5I B;  1C7W A;  4DUQ A;  1UUR A;  3CR2 A;  1F55 A;  2JTT A;  1KQM B;  1NCY A;  1ZOT B;  3BYA A;  5AAN A;  2K61 A;  2NCP A;  1G33 A;  4IL1 A;  4AOM A;  2F2O A;  1X02 A;  2I7A A;  1CLL A;  2BCX A;  3GOF A;  4M2O A;  1J7R A;  1XFY O;  1D1O A;  1IRJ A;  4FTG A;  4JPZ B;  5D7F A;  1TNP A;  1J1E A;  2CBL A;  1A03 A;  2JQ6 A;  2HET A;  1ZAC A;  2CNP A;  1M46 A;  1NYA A;  1B9A A;  2MAZ A;  1S36 A;  1JSA A;  4PE0 A;  2D8N A;  2FOT A;  3CTN A;  3SG2 A;  1CM1 A;  3VRN A;  4HRE E;  2L2E A;  2Q4U A;  1DF0 A;  1TTX A;  1QV0 A;  2MA2 A;  3PAT A;  2JT8 A;  5CSJ A;  5B8I B;  1SMG A;  1MR8 A;  1N65 A;  1SRA A;  1ZUZ A;  2OS8 B;  1B8R A;  1PK0 D;  2AAO A;  2F33 A;  4TNC A;  1M63 B;  1UUS A;  2JOJ A;  3AKA A;  4QJ3 B;  2KI4 B;  2LP2 A;  4MBE A;  5D69 A;  1AJ4 A;  2LVK A;  2O60 A;  1EG3 A;  1QTX A;  1SK6 D;  1J7P A;  1J7Q A;  3BUM B;  1WY9 A;  3SG5 A;  1A29 A;  1TNX A;  2CTN A;  2BKI B;  3TS5 B;  2M1U A;  4L9M A;  3SG3 A;  1BLQ A;  1DJW A;  3SIA A;  1KK8 C;  2AMI A;  2KBI A;  1SW8 A;  3TUY B;  3CS1 A;  2FCE A;  2P6B B;  2ZNE A;  1TCF A;  1SKT A;  3A4U B;  2PSR A;  3BXK A;  3D0Y B;  1YVL A;  4NDB A;  3DVE A;  3JVT C;  1K2H A;  2NLN A;  1VRK A;  2KAV A;  1OOJ A;  1S6C A;  4GNK B;  1IQ3 A;  2OTG C;  1SBJ A;  2KQY A;  3LK0 A;  1K96 A;  4N1F A;  1BR1 B;  4PHJ A;  4YRU A;  1PRW A;  1L2O B;  1B4C A;  2M8U A;  4PAL A;  4MEW A;  2KAX A;  2G2B A;  1UHH A;  1KFU L;  2JU0 A;  2SCP A;  4YI8 A;  3M0W A;  1FF1 A;  2LLT A;  1AK8 A;  1HQV A;  2O5G A;  1CFC A;  3KPX A;  1XO5 A;  2ZRS A;  1BG1 A;  1SR6 C;  1QS7 A;  4DIR A;  1CFF A;  1KFX S;  1YX8 A;  1RJV A;  4GGN A;  2KI6 D;  3PLF B;  3NXA A;  1A75 A;  2E30 A;  1CKK A;  1TOP A;  3A8R A;  3GK2 A;  1SPY A;  3SG6 A;  1SYM A;  1RK9 A;  3I5F B;  3BOW B;  4PHK A;  4WQ3 A;  1JFK A;  1IQ5 A;  2BCA A;  1AP4 A;  1NX0 A;  4MLW A;  3TDZ A;  3SG7 A;  1GJY A;  2LCP A;  1NX2 A;  1ZFS A;  1K94 A;  1LXF C;  1DT7 B;  2EC6 C;  1W7I B;  2HF5 A;  2LC5 A;  5TNC A;  4AQJ A;  1Y1X A;  1FPW A;  1KWO C;  3VRO A;  1NPQ A;  3JTD C;  5GQQ C;  4CID A;  2LVV A;  4C0K A;  3FIA A;  2ZFD A;  1CNP A;  1Y6W A;  5HYD A;  1CLB A;  1S26 D;  1KK7 Z;  1OE9 B;  2K0J A;  4WRI A;  4CFR A;  5ER5 A;  4HSZ A;  1CLM A;  1YUR A;  3D10 A;  3O6B A;  2JUL A;  3WXA A;  3EK4 A;  2L4I A;  1KFU S;  4PE1 A;  1CDP A;  2COL B;  1RWY A;  3GK4 X;  4PE7 A;  4XJK A;  4PHN A;  2EHB A;  2BE4 A;  2F2P A;  1DF0 B;  1DJH A;  2LLU A;  3MSE B;  5HKZ A;  4OR9 B;  2M7L A;  2IS9 A;  1YX7 A;  3NSL A;  4AQI A;  4C0L A;  2JT3 A;  3GK1 A;  3LL8 B;  1AJ5 A;  4E68 A;  3PN7 C;  3C1V A;  2JXL A;  3KEV A;  1YUS A;  1EG4 A;  1XFW O;  4I5K A;  3WNX B;  4BY5 A;  1XK4 C;  1EJ3 A;  1DJY A;  3I5H C;  2KAY A;  2JWW A;  4OV2 A;  2LV7 A;  4N1G A;  1EXR A;  1PVB A;  5CPV A;  1XFX O;  2Y1N A;  1U5I A;  4M2Q A;  2M29 A;  4FQO A;  2JC2 A;  1F70 A;  1IGV A;  3EVU A;  3AAJ A;  1G8I A;  1K90 D;  4OCI A;  1QX2 A;  5F6T A;  1Y1U A;  1WLM A;  2Q91 A;  1JF0 A;  5K89 A;  4N5X A;  3LLE A;  1NP8 A;  1CMG A;  1F54 A;  4PE4 A;  4P2Y B;  2MLF C;  1S6J A;  3CWG A;  2QAC A;  1SCM B;  2M9G A;  2MRD A;  1B8C A;  1PUL A;  2GGM A;  1ODB A;  1N0Y A;  2K7O A;  2LUC A;  1SL8 A;  2M7N A;  1UHJ A;  2OPO A;  2WCB A;  2BL0 B;  3TZ1 A;  3DVK A;  3I5G B;  4Q04 A;  2JNX A;  2ZN8 A;  3NSO A;  3CLN A;  1OZS A;  4DS7 A;  1OMR A;  1WDC C;  1Q80 A;  2I18 A;  2EGD A;  2LVI A;  1LA0 A;  3ICB A;  1MF8 B;  5AXI A;  2ZND A;  3RLZ A;  3ZWH A;  1KQV A;  1LA3 A;  4ZCV A;  3DD4 A;  1A75 B;  5I2O A;  5AER A;  3CR5 X;  3HX4 A;  3SG4 A;  1C07 A;  2L0P A;  4GBA A;  1JWD A;  4M2P A;  1OSA A;  1QX7 A;  1TIZ A;  2V53 A;  2LUX A;  2SAS A;  1TN4 A;  1FBV A;  5HLO A;  3I5I C;  3TDU A;  3AAK A;  2CXJ A;  4YGE B;  2BBN A;  1KQM C;  4I5N B;  1KSM A;  1OQP A;  2NCO A;  2LNK A;  1F4Q A;  4CLN A;  2WOS A;  1R6P A;  4P5O E;  3QRX A;  2K2A A;  4DRW A;  3TDI A;  1PVA A;  1DGV A;  3F45 A;  5DKR A;  1QVI Y;  3PSR A;  2M49 B;  1K8U A;  2K7C A;  1RFJ A;  1UP5 A;  2KSP A;  1XFU O;  5ER4 X;  1BR4 B;  5HLV A;  1B1G A;  1QVI Z;  5JJG A;  2QPT A;  3OB1 B;  1KSO A;  3EK7 A;  4XJK B;  2FCD A;  3IQO A;  1OMV A;  1RRO A;  2K2F A;  1BOC A;  5DKQ A;  4GPL B;  2L4H A;  1SL7 A;  1QV1 A;  2OS8 C;  3DF0 B;  4CFQ A;  1KCY A;  1PAL A;  2M3W A;  3LK1 A;  1LVC D;  3OB2 B;  1J55 A;  2F3Y A;  2K8M B;  2BEC A;  2GGZ A;  1CMF A;  2KI4 C;  2JZI A;  2L51 A;  2MJW B;  5CSN A;  1EL4 A;  1V1G A;  1YR5 A;  2LMV A;  3EKJ A;  5HKY A;  1MUX A;  1N2D A;  1QIW A;  1M39 A;  1AHR A;  5KU1 A;  1UHI A;  3TS5 C;  1E8A A;  1FI5 A;  1CB1 A;  2KGR A;  4JWQ A;  1SY9 A;  2MBX A;  1QLS A;  2K7D A;  2JPT A;  1CDN A;  4MRX A;  3TUY C;  1R2U A;  3D0Y A;  1S1E A;  1QAT A;  2LP3 A;  4PDZ A;  3IQQ A;  2LLS A;  2KBM A;  5CSI A;  2M0R A;  1WRL A;  1BT6 A;  2WCF A;  1L7Z A;  1BF5 A;  3WHT B;  4PCW A;  1ZMZ A;  2F8P A;  2KQ6 A;  2TN4 A;  1NCX A;  2HPS A;  5JOL A;  4MZJ A;  5BPJ A;  1IG5 A;  2NZ0 A;  1DJG A;  1XK4 A;  2KGB C;  5IBW A;  1XFV O;  1SNL A;  3K21 A;  2CT9 A;  2WC8 A;  4ORC B;  1B7T Y;  1L2O C;  2B1U A;  3WHU B;  2E6W A;  4OKH A;  2GV5 A;  1CFD A;  1IH0 A;  2Y5I A;  1YUU A;  1IWQ A;  1B7T Z;  3SIB A;  3OHM B;  1W7J B;  4A4B A;  1CDL A;  1KK8 B;  1QAS A;  4HRH A;  2BCB A;  1DVI A;  3HCM A;  1XVJ A;  2PMY A;  1NCZ A;  1NWD A;  2M97 A;  3EVR A;  1PSR A;  3OX5 A;  2AUC A;  5I2Q A;  4ETO A;  4I5L B;  3NSK A;  4YGD B;  4MN0 A;  2BBM A;  3VRR A;  3EK8 A;  3JVT B;  2BKH B;  2LHI A;  3I5F C;  2PVB A;  1F8H A;  2KHN A;  2KI6 C;  1IKU A;  4PHM A;  3ZNI A;  1YTZ C;  2KFH A;  1A2X A;  2OTG B;  1G4Y R;  1QJT A;  1REC A;  1MHO A;  1OMD A;  2Y1M A;  3CZT X;  2A4J A;  1Y1A A;  5AFP A;  3PFV A;  5KTY A;  1H4B A;  2JNF A;  5I2L A;  2H2K A;  4U8D A;  2KNE A;  1ALV A;  4JQ0 D;  3DVM A;  1XFZ O;  4MSP A;  1DMO A;  1K9U A;  4HRG A;  4ZCU A;  2LMU A;  5J3X A;  2ZKM X;  2JRF A;  1JUO A;  3VRP A;  1EH2 A;  4YGC B;  5CSF A;  1ALW A;  1FW4 A;  2Y4Q A;  1SR6 B;  2R2I A;  2F3Z A;  4ORB B;  4UPG A;  2JT0 A;  3BUO B;  2ISD A;  2L98 A;  1BU3 A;  3FWB A;  2PRU A;  1AUI B;  4MZL A;  1IJ5 A;  1CFP A;  2M1K B;  1TNW A;  1A4P A;  1TNQ A;  4ICB A;  3BQ3 A;  1MWN A;  1UHN A;  3VRQ A;  1NSH A;  1IJ6 A;  2JXC A;  1WLZ A;  1YUT A;  2EC6 B;  2LAN A;  2KOT A;  2LAP A;  2LHL A;  4DCK A;  1JBA A;  4WQ2 A;  3EVV A;  4MZK A;  3FWC A;  1YRU B;  1XYD A;  1KWO B;  1DGU A;  3PM8 A;  1MXL C;  1QLK A;  1QIV A;  3JTD B;  4ORA B;  2FJU B;  3KF9 A;  1RTP 1;  2DOQ A;  3BUN B;  1KFX L;  2WCE A;  3AKB A;  1HT9 A;  1K95 A;  1QXP A;  3DVJ A;  4MVF A;  1BMO A;  2PAS A;  3PAL A;  3KHE A;  1GQM A;  3VGO A;  4USL A;  4GUK A;  2HQ8 A;  3SJS A;  4C0J A;  1MXE A;  4GFT A;  2HQW A;  1JF2 A;  4YBH B;  4XYN A;  1SCM C;  1LIN A;  5FYX A;  1B8L A;  3OP0 A;  1OZO A;  3PN7 B;  2LMT A;  2BL0 C;  1SCV A;  3I5G C;  5G08 A;  2KYC A;  2H61 A;  1YVH A;  3I5H B;  4GGF A;  2H61 C;  3CR4 X;  4NQG A;  1C7V A;  1WRK A;  4NDD A;  4GGF C;  1JFJ A;  3LCP C;  2NXQ A;  4NDC A;  1NX1 A;  1NIW A;  4OVN F;  1U5I B;  1M31 A;  2CCM A;  2LE9 B;  2JTZ A;  2LM5 A;  4YGB B;  2ZRT A;  1FI6 A;  2KYF A;  2WND A;  3FS7 A;  2WOR A;  3BUW B;  4YGA A;  4MRY A;  1F4O A;  1CM4 A;  2MHH A;  2KDH A;  2I94 A;  2LVJ A;  2PAL A;  3BUX B;  1GGZ A;  3H4S E;  3O78 A;  5HKW A;  1GGW A;  3RM1 A;  2VRG A;  3CGA A;  1F71 A;  5DKN A;  2G9B A;  3O2P A;  3EKH A;  4QJ5 B;  1CDM A;  1MQ1 A;  1K9P A;  3O4Y A;  1YRT B;  1UHK A;  1J1D A;  1KK7 Y;  1S5G Y;  5AEQ A;  1DJI A;  1WDC B;  1WRZ A;  4A4C A;  1BOD A;  4YI9 A;  1NUB A;  1NX3 A;  3IF7 A;  4BY4 A;  1UWO A;  1S5G Z;  5I8N A;  4R1E A;  2L50 A;  2MLE C;  1AVS A;  2ZN9 A;  1Y0V H; 
#chains in the Genus database with same CATH topology
 1DTL A;  1B47 A;  1SL9 A;  1OOH A;  1TRF A;  1BJF A;  1DJZ A;  1K9K A;  1M45 A;  5D3O A;  5PAL A;  1J7O A;  1JC2 A;  2KFG A;  2PQL A;  1K93 D;  3NSI A;  2KFF A;  2RGI A;  1S6I A;  2BE6 A;  1LKJ A;  3OX6 A;  4GAO A;  4F7F A;  1TCO B;  1S3P A;  1CTR A;  4QJ4 B;  4D1E A;  1QX5 B;  2K7B A;  2L5X B;  2I2R E;  3B87 A;  1PSB A;  4CPV A;  3DF0 A;  3E3R A;  3S0F A;  3BOW A;  5KSZ A;  1DJX A;  4I5J A;  1H8B A;  1V1F A;  4F0Z B;  3KO0 A;  1OOG A;  1XA5 A;  3I5I B;  1C7W A;  4DUQ A;  1UUR A;  3CR2 A;  3R1P A;  1F55 A;  2JTT A;  1KQM B;  1NCY A;  1ZOT B;  3BFH A;  3BYA A;  5AAN A;  2K61 A;  2NCP A;  3CZ1 A;  1G33 A;  3OGN A;  4IL1 A;  4AOM A;  2F2O A;  1X02 A;  2I7A A;  1CLL A;  2BCX A;  3GOF A;  4M2O A;  1J7R A;  1XFY O;  3D77 A;  1D1O A;  1IRJ A;  4FTG A;  4JPZ B;  5D7F A;  1TNP A;  1J1E A;  1P28 A;  2CBL A;  2JQ6 A;  2GTE A;  2HET A;  1A03 A;  1ZAC A;  2CNP A;  1M46 A;  1NYA A;  1B9A A;  2MAZ A;  1S36 A;  1JSA A;  4PE0 A;  2D8N A;  2FOT A;  3CTN A;  3SG2 A;  1CM1 A;  2QEO A;  3VRN A;  4HRE E;  2L2E A;  2Q4U A;  1DF0 A;  1TTX A;  1QV0 A;  2MA2 A;  2FJY A;  3PAT A;  2JT8 A;  5CSJ A;  4FQT A;  5B8I B;  2L2C A;  1SMG A;  1MR8 A;  1N65 A;  1SRA A;  1ZUZ A;  2OS8 B;  1B8R A;  1PK0 D;  2AAO A;  2F33 A;  4TNC A;  1M63 B;  1UUS A;  2JOJ A;  3AKA A;  4QJ3 B;  2KI4 B;  2LP2 A;  4MBE A;  1C3Z A;  5D69 A;  1AJ4 A;  2LVK A;  2O60 A;  1Z2C B;  3NHT A;  1EG3 A;  1QTX A;  1SK6 D;  1J7P A;  1J7Q A;  3BUM B;  1WY9 A;  2WC5 A;  3SG5 A;  1A29 A;  1TNX A;  2CTN A;  2BKI B;  3TS5 B;  2M1U A;  4L9M A;  3SG3 A;  1BLQ A;  1DJW A;  3SIA A;  1KK8 C;  2AMI A;  2KBI A;  1SW8 A;  3TUY B;  3CS1 A;  2FCE A;  2P6B B;  2ZNE A;  1TCF A;  1SKT A;  3A4U B;  2PSR A;  3BXK A;  3D0Y B;  1YVL A;  4NDB A;  3DVE A;  3JVT C;  3CDN A;  1K2H A;  2NLN A;  1VRK A;  2KAV A;  1OOJ A;  1S6C A;  4GNK B;  1IQ3 A;  1C3Y A;  2OTG C;  1SBJ A;  2KQY A;  3LK0 A;  1K96 A;  4N1F A;  1BR1 B;  4PHJ A;  4YRU A;  1DEL A;  1PRW A;  1L2O B;  1W9Z A;  1B4C A;  2M8U A;  4PAL A;  4MEW A;  2KAX A;  2G2B A;  1UHH A;  1KFU L;  2JU0 A;  2SCP A;  4YI8 A;  3CYZ A;  3M0W A;  3UO9 A;  1FF1 A;  2LLT A;  1AK8 A;  1HQV A;  2O5G A;  1CFC A;  3KPX A;  1XO5 A;  2BAP A;  2ZRS A;  5I94 A;  1BG1 A;  1SR6 C;  1QS7 A;  4DIR A;  1CFF A;  1KFX S;  1YX8 A;  1RJV A;  4GGN A;  2KI6 D;  3PLF B;  3NXA A;  1A75 A;  2E30 A;  1CKK A;  1TOP A;  1Z4H A;  3A8R A;  3GK2 A;  1SPY A;  3SG6 A;  1SYM A;  3R1V A;  1RK9 A;  2QEV A;  3BOW B;  3I5F B;  3FE8 A;  4PHK A;  1JFK A;  4WQ3 A;  1IQ5 A;  2BCA A;  1AP4 A;  1NX0 A;  4MLW A;  3TDZ A;  3SG7 A;  1GJY A;  2LCP A;  1NX2 A;  1ZFS A;  1K94 A;  1DEK A;  1LXF C;  2EC6 C;  2KLD A;  1W7I B;  2HF5 A;  1DT7 B;  2LC5 A;  5TNC A;  3S0E A;  4AQJ A;  1Y1X A;  1FPW A;  3L47 A;  1KWO C;  3SS5 A;  2QDI A;  1NPQ A;  2YGU A;  3JTD C;  5GQQ C;  3VRO A;  2LVV A;  4C0K A;  3FIA A;  4CID A;  2ZFD A;  1CNP A;  1Y6W A;  1GM0 A;  5HYD A;  1CLB A;  1S26 D;  1KK7 Z;  1OE9 B;  2K0J A;  4WRI A;  4CFR A;  5ER5 A;  4HSZ A;  1CLM A;  1YUR A;  3D10 A;  3O6B A;  2JUL A;  3WXA A;  3EK4 A;  2L4I A;  1KFU S;  4PE1 A;  1CDP A;  2COL B;  1RWY A;  3D75 A;  3GK4 X;  4PE7 A;  4XJK A;  4PHN A;  2EHB A;  2BE4 A;  2F2P A;  1DF0 B;  1DJH A;  2LLU A;  2H8V A;  3MSE B;  3CZ2 A;  3N7H A;  1ORG A;  3VB1 A;  5HKZ A;  4OR9 B;  1OOI X;  2M7L A;  2IS9 A;  1YX7 A;  3NSL A;  4AQI A;  4C0L A;  2JT3 A;  3GK1 A;  3LL8 B;  1AJ5 A;  4E68 A;  3PN7 C;  3C1V A;  2JXL A;  3KEV A;  1YUS A;  1EG4 A;  1XFW O;  3L4A A;  4I5K A;  3WNX B;  4BY5 A;  1XK4 C;  1EJ3 A;  1DJY A;  3I5H C;  2KAY A;  2JWW A;  3DYE A;  4OV2 A;  2LV7 A;  4N1G A;  1EXR A;  1PVB A;  5CPV A;  1XFX O;  2Y1N A;  1U5I A;  4M2Q A;  2M29 A;  4IJ7 A;  4FQO A;  2P71 A;  2JC2 A;  1XFR A;  1F70 A;  1IGV A;  3EVU A;  3S0G A;  3AAJ A;  1SSE B;  1G8I A;  1K90 D;  4OCI A;  1QX2 A;  3NGV A;  1Y1U A;  5F6T A;  3IVT A;  1WLM A;  2Q91 A;  1JF0 A;  5K89 A;  2K60 A;  3LLE A;  1NP8 A;  4N5X A;  1CMG A;  4PE4 A;  4P2Y B;  1F54 A;  2MLF C;  1S6J A;  3CWG A;  2WC6 A;  2QAC A;  1SCM B;  2M9G A;  2MRD A;  1B8C A;  4KYN A;  1PUL A;  2GGM A;  1ODB A;  1N0Y A;  2K7O A;  2LUC A;  1SL8 A;  2M7N A;  1UHJ A;  2OPO A;  3R1O A;  2WCB A;  2BL0 B;  3TZ1 A;  3DVK A;  3I5G B;  4Q04 A;  2JNX A;  3D74 A;  2ZN8 A;  3NSO A;  3CLN A;  1OZS A;  4DS7 A;  1OMR A;  1WDC C;  1Q80 A;  2I18 A;  2EGD A;  2LVI A;  1LA0 A;  3ICB A;  1MF8 B;  5AXI A;  2ZND A;  3RLZ A;  3S0A A;  3ZWH A;  3D78 A;  1KQV A;  4JD9 A;  1LA3 A;  4ZCV A;  3DD4 A;  1A75 B;  5I2O A;  5AER A;  3CR5 X;  3HX4 A;  3SG4 A;  1C07 A;  2L0P A;  3QME A;  4GBA A;  1JWD A;  4M2P A;  1OSA A;  1QX7 A;  1TIZ A;  2V53 A;  2LUX A;  2SAS A;  1TN4 A;  1FBV A;  5HLO A;  3I5I C;  3TDU A;  3AAK A;  2CXJ A;  3O4X A;  4YGE B;  2BBN A;  1QWV A;  3BFA A;  1KQM C;  4I5N B;  1KSM A;  1OQP A;  2NCO A;  3SS4 A;  3BFB A;  2LNK A;  1F4Q A;  4CLN A;  2WOS A;  1R6P A;  3CZ0 A;  4P5O E;  3QRX A;  2K2A A;  2WCK A;  4DRW A;  3TDI A;  1PVA A;  1DGV A;  3F45 A;  1DQE A;  5DKR A;  1QVI Y;  3D76 A;  3PSR A;  2M49 B;  1K8U A;  2K7C A;  1RFJ A;  1UP5 A;  2KSP A;  1XFU O;  5ER4 X;  1BR4 B;  5HLV A;  2PYQ A;  1QVI Z;  1B1G A;  3BJH A;  3CAB A;  5JJG A;  2QPT A;  3OB1 B;  1KSO A;  3EK7 A;  4XJK B;  1LS8 A;  2FCD A;  3IQO A;  3NHI A;  1OMV A;  1RRO A;  2K2F A;  1BOC A;  5DKQ A;  4GPL B;  2L4H A;  1SL7 A;  1QV1 A;  2OS8 C;  3DF0 B;  3EG5 B;  4CFQ A;  1T14 A;  1KCY A;  1PAL A;  2M3W A;  3LK1 A;  5FI2 A;  1LVC D;  3OB2 B;  1J55 A;  2F3Y A;  2K8M B;  2BEC A;  2GGZ A;  1CMF A;  2KI4 C;  2JZI A;  2L51 A;  2MJW B;  5CSN A;  1EL4 A;  1V1G A;  1YR5 A;  2LMV A;  2L5Y A;  3EKJ A;  3R72 A;  5HKY A;  1MUX A;  5FI7 A;  2P70 A;  1N2D A;  1QIW A;  1M39 A;  1AHR A;  5KU1 A;  1UHI A;  3TS5 C;  1E8A A;  2ERB A;  1CB1 A;  1FI5 A;  2KGR A;  4JWQ A;  1SY9 A;  2MBX A;  1QLS A;  3K1E A;  2K7D A;  2JPT A;  1CDN A;  4MRX A;  3TUY C;  1R2U A;  3D0Y A;  1S1E A;  1QAT A;  2LP3 A;  4PDZ A;  3IQQ A;  2LLS A;  2KBM A;  5CSI A;  2M0R A;  1WRL A;  1BT6 A;  2WCF A;  1L7Z A;  1BF5 A;  3WHT B;  4PCW A;  3DXL A;  1ZMZ A;  2F8P A;  2KQ6 A;  2TN4 A;  1NCX A;  2HPS A;  5JOL A;  4MZJ A;  5BPJ A;  1IG5 A;  2NZ0 A;  4OZD A;  1DJG A;  1XK4 A;  2KGB C;  5IBW A;  1XFV O;  2QEB A;  1SNL A;  3K21 A;  2CT9 A;  2WC8 A;  4ORC B;  1B7T Y;  1L2O C;  1TUZ A;  2B1U A;  3WHU B;  2E6W A;  3Q8I A;  4OKH A;  2GV5 A;  1CFD A;  1IH0 A;  2Y5I A;  1YUU A;  1IWQ A;  1B7T Z;  3SIB A;  3UNW A;  3OHM B;  1W7J B;  4A4B A;  1CDL A;  3B7A A;  1KK8 B;  1QAS A;  4HRH A;  3S0B A;  2BCB A;  1DVI A;  3B6X A;  1XVJ A;  3HCM A;  2PMY A;  4PT1 A;  2WCH A;  1NCZ A;  1NWD A;  2M97 A;  3EVR A;  1PSR A;  3OX5 A;  2AUC A;  5I2Q A;  4ETO A;  4I5L B;  3NSK A;  3S0D A;  4YGD B;  4MN0 A;  2BBM A;  3VRR A;  3EK8 A;  3JVT B;  2BKH B;  2LHI A;  3I5F C;  2PVB A;  1DC1 A;  1F8H A;  1IIO A;  2KHN A;  2KI6 C;  1IKU A;  4PHM A;  3ZNI A;  1YTZ C;  2KFH A;  1A2X A;  2OTG B;  1G4Y R;  1QJT A;  1REC A;  1MHO A;  1OMD A;  2Y1M A;  3CZT X;  2A4J A;  1Y1A A;  5AFP A;  3PFV A;  5KTY A;  3PM2 A;  2JNF A;  1H4B A;  5I2L A;  2H2K A;  4U8D A;  2KNE A;  1ALV A;  4JQ0 D;  3DVM A;  1XFZ O;  4MSP A;  2KPH A;  1DMO A;  1K9U A;  4HRG A;  4ZCU A;  2LMU A;  5J3X A;  2ZKM X;  2JRF A;  1JUO A;  3OBV A;  3VRP A;  1EH2 A;  4YGC B;  5CSF A;  1ALW A;  1FW4 A;  2Y4Q A;  1SR6 B;  2R2I A;  2F3Z A;  4ORB B;  4UPG A;  2JT0 A;  3BUO B;  2KLE A;  2ISD A;  2L98 A;  3RZS A;  1BU3 A;  1TUJ A;  3FWB A;  1OW4 A;  2PRU A;  5EL2 A;  1AUI B;  4MZL A;  1IJ5 A;  1CFP A;  2M1K B;  1TNW A;  5FI6 A;  1A4P A;  1TNQ A;  4ICB A;  3BQ3 A;  1MWN A;  1UHN A;  3VRQ A;  1NSH A;  1IJ6 A;  2JXC A;  1WLZ A;  1YUT A;  2EC6 B;  2LAN A;  2KOT A;  2LAP A;  2LHL A;  4DCK A;  1JBA A;  4WQ2 A;  3D73 A;  3EVV A;  4MZK A;  3FWC A;  1YRU B;  1XYD A;  1KWO B;  3SS3 A;  1DGU A;  3PM8 A;  1MXL C;  1QLK A;  1QIV A;  3JTD B;  4ORA B;  2FJU B;  3KF9 A;  1RTP 1;  2DOQ A;  3BUN B;  1KFX L;  2WCE A;  3L4L A;  3AKB A;  1HT9 A;  1K95 A;  1QXP A;  3DVJ A;  2WCL A;  4MVF A;  1BMO A;  2PAS A;  3PAL A;  3KHE A;  1GQM A;  3FE6 A;  3VGO A;  4USL A;  4GUK A;  2HQ8 A;  3SJS A;  3DZT A;  4C0J A;  1MXE A;  4GFT A;  2HQW A;  1JF2 A;  4YBH B;  4XYN A;  1SCM C;  1LIN A;  2QEH A;  5FYX A;  1B8L A;  3OP0 A;  1OZO A;  3PN7 B;  2LMT A;  4INW A;  2BL0 C;  1SCV A;  2WCJ A;  3I5G C;  5G08 A;  2KYC A;  2H61 A;  4JKT A;  1YVH A;  3I5H B;  4GGF A;  3V2L A;  2H61 C;  3CR4 X;  4NQG A;  1C7V A;  2WCM A;  1WRK A;  4NDD A;  4GGF C;  1JFJ A;  2JPO A;  2NXQ A;  3LCP C;  4NDC A;  1NX1 A;  3B88 A;  1NIW A;  4OVN F;  1U5I B;  1M31 A;  2CCM A;  3PJI A;  2LE9 B;  2JTZ A;  2LM5 A;  4YGB B;  2ZRT A;  1FI6 A;  5DIC A;  2KYF A;  2WND A;  3FS7 A;  5HL1 A;  2WOR A;  3BUW B;  1TWO A;  4MRY A;  4YGA A;  1F4O A;  1CM4 A;  2MHH A;  2KDH A;  2I94 A;  2LVJ A;  2PAL A;  3BUX B;  1GGZ A;  3H4S E;  3O78 A;  5HKW A;  1GGW A;  3RM1 A;  2VRG A;  3CGA A;  1F71 A;  3DY9 A;  5DKN A;  2G9B A;  1OOF A;  3O2P A;  3EKH A;  4QJ5 B;  1CDM A;  1MQ1 A;  1K9P A;  2BNX A;  3O4Y A;  4INX A;  1YRT B;  3B86 A;  1UHK A;  1J1D A;  1KK7 Y;  1S5G Y;  5AEQ A;  1DJI A;  1WDC B;  1WRZ A;  3FE9 A;  4A4C A;  1BOD A;  4YI9 A;  1NUB A;  1NX3 A;  3IF7 A;  4BY4 A;  1UWO A;  1S5G Z;  5I8N A;  4R1E A;  2L50 A;  2MLE C;  1AVS A;  2ZN9 A;  1Y0V H; 
#chains in the Genus database with same CATH homology
 1DTL A;  1B47 A;  1SL9 A;  1TRF A;  5PAL A;  1BJF A;  1DJZ A;  1K9K A;  1M45 A;  1J7O A;  1JC2 A;  2KFG A;  1K93 D;  3NSI A;  2KFF A;  2RGI A;  1S6I A;  2BE6 A;  1LKJ A;  3OX6 A;  4GAO A;  1TCO B;  1S3P A;  1CTR A;  4QJ4 B;  4D1E A;  1QX5 B;  2K7B A;  2L5X B;  2I2R E;  1PSB A;  4CPV A;  3DF0 A;  3E3R A;  3BOW A;  5KSZ A;  1DJX A;  4I5J A;  1H8B A;  1V1F A;  4F0Z B;  3KO0 A;  1XA5 A;  3I5I B;  1C7W A;  4DUQ A;  1UUR A;  3CR2 A;  1F55 A;  2JTT A;  1KQM B;  1NCY A;  1ZOT B;  3BYA A;  5AAN A;  2K61 A;  2NCP A;  1G33 A;  4IL1 A;  4AOM A;  2F2O A;  1X02 A;  2I7A A;  1CLL A;  2BCX A;  3GOF A;  4M2O A;  1J7R A;  1XFY O;  1D1O A;  1IRJ A;  4FTG A;  4JPZ B;  5D7F A;  1TNP A;  1J1E A;  2CBL A;  1A03 A;  2JQ6 A;  2HET A;  1ZAC A;  2CNP A;  1M46 A;  1NYA A;  1B9A A;  2MAZ A;  1S36 A;  1JSA A;  4PE0 A;  2D8N A;  2FOT A;  3CTN A;  3SG2 A;  1CM1 A;  3VRN A;  4HRE E;  2L2E A;  2Q4U A;  1DF0 A;  1TTX A;  1QV0 A;  2MA2 A;  3PAT A;  2JT8 A;  5CSJ A;  5B8I B;  1SMG A;  1MR8 A;  1N65 A;  1SRA A;  1ZUZ A;  2OS8 B;  1B8R A;  1PK0 D;  2AAO A;  2F33 A;  4TNC A;  1M63 B;  1UUS A;  2JOJ A;  3AKA A;  4QJ3 B;  2KI4 B;  2LP2 A;  4MBE A;  5D69 A;  1AJ4 A;  2LVK A;  2O60 A;  1EG3 A;  1QTX A;  1SK6 D;  1J7P A;  1J7Q A;  3BUM B;  1WY9 A;  3SG5 A;  1A29 A;  1TNX A;  2CTN A;  2BKI B;  3TS5 B;  2M1U A;  4L9M A;  3SG3 A;  1BLQ A;  1DJW A;  3SIA A;  1KK8 C;  2AMI A;  2KBI A;  1SW8 A;  3TUY B;  3CS1 A;  2FCE A;  2P6B B;  2ZNE A;  1TCF A;  1SKT A;  3A4U B;  2PSR A;  3BXK A;  3D0Y B;  1YVL A;  4NDB A;  3DVE A;  3JVT C;  1K2H A;  2NLN A;  1VRK A;  2KAV A;  1OOJ A;  1S6C A;  4GNK B;  1IQ3 A;  2OTG C;  1SBJ A;  2KQY A;  3LK0 A;  1K96 A;  4N1F A;  1BR1 B;  4PHJ A;  4YRU A;  1PRW A;  1L2O B;  1B4C A;  2M8U A;  4PAL A;  4MEW A;  2KAX A;  2G2B A;  1UHH A;  1KFU L;  2JU0 A;  2SCP A;  4YI8 A;  3M0W A;  1FF1 A;  2LLT A;  1AK8 A;  1HQV A;  2O5G A;  1CFC A;  3KPX A;  1XO5 A;  2ZRS A;  1BG1 A;  1SR6 C;  1QS7 A;  4DIR A;  1CFF A;  1KFX S;  1YX8 A;  1RJV A;  4GGN A;  2KI6 D;  3PLF B;  3NXA A;  1A75 A;  2E30 A;  1CKK A;  1TOP A;  3A8R A;  3GK2 A;  1SPY A;  3SG6 A;  1SYM A;  1RK9 A;  3I5F B;  3BOW B;  4PHK A;  4WQ3 A;  1JFK A;  1IQ5 A;  2BCA A;  1AP4 A;  1NX0 A;  4MLW A;  3TDZ A;  3SG7 A;  1GJY A;  2LCP A;  1NX2 A;  1ZFS A;  1K94 A;  1LXF C;  1DT7 B;  2EC6 C;  1W7I B;  2HF5 A;  2LC5 A;  5TNC A;  4AQJ A;  1Y1X A;  1FPW A;  1KWO C;  3VRO A;  1NPQ A;  3JTD C;  5GQQ C;  4CID A;  2LVV A;  4C0K A;  3FIA A;  2ZFD A;  1CNP A;  1Y6W A;  5HYD A;  1CLB A;  1S26 D;  1KK7 Z;  1OE9 B;  2K0J A;  4WRI A;  4CFR A;  5ER5 A;  4HSZ A;  1CLM A;  1YUR A;  3D10 A;  3O6B A;  2JUL A;  3WXA A;  3EK4 A;  2L4I A;  1KFU S;  4PE1 A;  1CDP A;  2COL B;  1RWY A;  3GK4 X;  4PE7 A;  4XJK A;  4PHN A;  2EHB A;  2BE4 A;  2F2P A;  1DF0 B;  1DJH A;  2LLU A;  3MSE B;  5HKZ A;  4OR9 B;  2M7L A;  2IS9 A;  1YX7 A;  3NSL A;  4AQI A;  4C0L A;  2JT3 A;  3GK1 A;  3LL8 B;  1AJ5 A;  4E68 A;  3PN7 C;  3C1V A;  2JXL A;  3KEV A;  1YUS A;  1EG4 A;  1XFW O;  4I5K A;  3WNX B;  4BY5 A;  1XK4 C;  1EJ3 A;  1DJY A;  3I5H C;  2KAY A;  2JWW A;  4OV2 A;  2LV7 A;  4N1G A;  1EXR A;  1PVB A;  5CPV A;  1XFX O;  2Y1N A;  1U5I A;  4M2Q A;  2M29 A;  4FQO A;  2JC2 A;  1F70 A;  1IGV A;  3EVU A;  3AAJ A;  1G8I A;  1K90 D;  4OCI A;  1QX2 A;  5F6T A;  1Y1U A;  1WLM A;  2Q91 A;  1JF0 A;  5K89 A;  4N5X A;  3LLE A;  1NP8 A;  1CMG A;  1F54 A;  4PE4 A;  4P2Y B;  2MLF C;  1S6J A;  3CWG A;  2QAC A;  1SCM B;  2M9G A;  2MRD A;  1B8C A;  1PUL A;  2GGM A;  1ODB A;  1N0Y A;  2K7O A;  2LUC A;  1SL8 A;  2M7N A;  1UHJ A;  2OPO A;  2WCB A;  2BL0 B;  3TZ1 A;  3DVK A;  3I5G B;  4Q04 A;  2JNX A;  2ZN8 A;  3NSO A;  3CLN A;  1OZS A;  4DS7 A;  1OMR A;  1WDC C;  1Q80 A;  2I18 A;  2EGD A;  2LVI A;  1LA0 A;  3ICB A;  1MF8 B;  5AXI A;  2ZND A;  3RLZ A;  3ZWH A;  1KQV A;  1LA3 A;  4ZCV A;  3DD4 A;  1A75 B;  5I2O A;  5AER A;  3CR5 X;  3HX4 A;  3SG4 A;  1C07 A;  2L0P A;  4GBA A;  1JWD A;  4M2P A;  1OSA A;  1QX7 A;  1TIZ A;  2V53 A;  2LUX A;  2SAS A;  1TN4 A;  1FBV A;  5HLO A;  3I5I C;  3TDU A;  3AAK A;  2CXJ A;  4YGE B;  2BBN A;  1KQM C;  4I5N B;  1KSM A;  1OQP A;  2NCO A;  2LNK A;  1F4Q A;  4CLN A;  2WOS A;  1R6P A;  4P5O E;  3QRX A;  2K2A A;  4DRW A;  3TDI A;  1PVA A;  1DGV A;  3F45 A;  5DKR A;  1QVI Y;  3PSR A;  2M49 B;  1K8U A;  2K7C A;  1RFJ A;  1UP5 A;  2KSP A;  1XFU O;  5ER4 X;  1BR4 B;  5HLV A;  1B1G A;  1QVI Z;  5JJG A;  2QPT A;  3OB1 B;  1KSO A;  3EK7 A;  4XJK B;  2FCD A;  3IQO A;  1OMV A;  1RRO A;  2K2F A;  1BOC A;  5DKQ A;  4GPL B;  2L4H A;  1SL7 A;  1QV1 A;  2OS8 C;  3DF0 B;  4CFQ A;  1KCY A;  1PAL A;  2M3W A;  3LK1 A;  1LVC D;  3OB2 B;  1J55 A;  2F3Y A;  2K8M B;  2BEC A;  2GGZ A;  1CMF A;  2KI4 C;  2JZI A;  2L51 A;  2MJW B;  5CSN A;  1EL4 A;  1V1G A;  1YR5 A;  2LMV A;  3EKJ A;  5HKY A;  1MUX A;  1N2D A;  1QIW A;  1M39 A;  1AHR A;  5KU1 A;  1UHI A;  3TS5 C;  1E8A A;  1FI5 A;  1CB1 A;  2KGR A;  4JWQ A;  1SY9 A;  2MBX A;  1QLS A;  2K7D A;  2JPT A;  1CDN A;  4MRX A;  3TUY C;  1R2U A;  3D0Y A;  1S1E A;  1QAT A;  2LP3 A;  4PDZ A;  3IQQ A;  2LLS A;  2KBM A;  5CSI A;  2M0R A;  1WRL A;  1BT6 A;  2WCF A;  1L7Z A;  1BF5 A;  3WHT B;  4PCW A;  1ZMZ A;  2F8P A;  2KQ6 A;  2TN4 A;  1NCX A;  2HPS A;  5JOL A;  4MZJ A;  5BPJ A;  1IG5 A;  2NZ0 A;  1DJG A;  1XK4 A;  2KGB C;  5IBW A;  1XFV O;  1SNL A;  3K21 A;  2CT9 A;  2WC8 A;  4ORC B;  1B7T Y;  1L2O C;  2B1U A;  3WHU B;  2E6W A;  4OKH A;  2GV5 A;  1CFD A;  1IH0 A;  2Y5I A;  1YUU A;  1IWQ A;  1B7T Z;  3SIB A;  3OHM B;  1W7J B;  4A4B A;  1CDL A;  1KK8 B;  1QAS A;  4HRH A;  2BCB A;  1DVI A;  3HCM A;  1XVJ A;  2PMY A;  1NCZ A;  1NWD A;  2M97 A;  3EVR A;  1PSR A;  3OX5 A;  2AUC A;  5I2Q A;  4ETO A;  4I5L B;  3NSK A;  4YGD B;  4MN0 A;  2BBM A;  3VRR A;  3EK8 A;  3JVT B;  2BKH B;  2LHI A;  3I5F C;  2PVB A;  1F8H A;  2KHN A;  2KI6 C;  1IKU A;  4PHM A;  3ZNI A;  1YTZ C;  2KFH A;  1A2X A;  2OTG B;  1G4Y R;  1QJT A;  1REC A;  1MHO A;  1OMD A;  2Y1M A;  3CZT X;  2A4J A;  1Y1A A;  5AFP A;  3PFV A;  5KTY A;  1H4B A;  2JNF A;  5I2L A;  2H2K A;  4U8D A;  2KNE A;  1ALV A;  4JQ0 D;  3DVM A;  1XFZ O;  4MSP A;  1DMO A;  1K9U A;  4HRG A;  4ZCU A;  2LMU A;  5J3X A;  2ZKM X;  2JRF A;  1JUO A;  3VRP A;  1EH2 A;  4YGC B;  5CSF A;  1ALW A;  1FW4 A;  2Y4Q A;  1SR6 B;  2R2I A;  2F3Z A;  4ORB B;  4UPG A;  2JT0 A;  3BUO B;  2ISD A;  2L98 A;  1BU3 A;  3FWB A;  2PRU A;  1AUI B;  4MZL A;  1IJ5 A;  1CFP A;  2M1K B;  1TNW A;  1A4P A;  1TNQ A;  4ICB A;  3BQ3 A;  1MWN A;  1UHN A;  3VRQ A;  1NSH A;  1IJ6 A;  2JXC A;  1WLZ A;  1YUT A;  2EC6 B;  2LAN A;  2KOT A;  2LAP A;  2LHL A;  4DCK A;  1JBA A;  4WQ2 A;  3EVV A;  4MZK A;  3FWC A;  1YRU B;  1XYD A;  1KWO B;  1DGU A;  3PM8 A;  1MXL C;  1QLK A;  1QIV A;  3JTD B;  4ORA B;  2FJU B;  3KF9 A;  1RTP 1;  2DOQ A;  3BUN B;  1KFX L;  2WCE A;  3AKB A;  1HT9 A;  1K95 A;  1QXP A;  3DVJ A;  4MVF A;  1BMO A;  2PAS A;  3PAL A;  3KHE A;  1GQM A;  3VGO A;  4USL A;  4GUK A;  2HQ8 A;  3SJS A;  4C0J A;  1MXE A;  4GFT A;  2HQW A;  1JF2 A;  4YBH B;  4XYN A;  1SCM C;  1LIN A;  5FYX A;  1B8L A;  3OP0 A;  1OZO A;  3PN7 B;  2LMT A;  2BL0 C;  1SCV A;  3I5G C;  5G08 A;  2KYC A;  2H61 A;  1YVH A;  3I5H B;  4GGF A;  2H61 C;  3CR4 X;  4NQG A;  1C7V A;  1WRK A;  4NDD A;  4GGF C;  1JFJ A;  3LCP C;  2NXQ A;  4NDC A;  1NX1 A;  1NIW A;  4OVN F;  1U5I B;  1M31 A;  2CCM A;  2LE9 B;  2JTZ A;  2LM5 A;  4YGB B;  2ZRT A;  1FI6 A;  2KYF A;  2WND A;  3FS7 A;  2WOR A;  3BUW B;  4YGA A;  4MRY A;  1F4O A;  1CM4 A;  2MHH A;  2KDH A;  2I94 A;  2LVJ A;  2PAL A;  3BUX B;  1GGZ A;  3H4S E;  3O78 A;  5HKW A;  1GGW A;  3RM1 A;  2VRG A;  3CGA A;  1F71 A;  5DKN A;  2G9B A;  3O2P A;  3EKH A;  4QJ5 B;  1CDM A;  1MQ1 A;  1K9P A;  3O4Y A;  1YRT B;  1UHK A;  1J1D A;  1KK7 Y;  1S5G Y;  5AEQ A;  1DJI A;  1WDC B;  1WRZ A;  4A4C A;  1BOD A;  4YI9 A;  1NUB A;  1NX3 A;  3IF7 A;  4BY4 A;  1UWO A;  1S5G Z;  5I8N A;  4R1E A;  2L50 A;  2MLE C;  1AVS A;  2ZN9 A;  1Y0V H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...