2H2KA

Crystal structure analysis of human s100a13
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
93
structure length
93
Chain Sequence
SLMAAEPLTELEESIETVVTTFFTFARQEGRKDSLSVNEFKELVTQQLPHLLKDVGSLDEKMKSLDVNQDSELKFNEYWRLIGELAKEIRKKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein S100-A13
publication title Crystal structure study on human S100A13 at 2.0 A resolution
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal binding protein
total genus 36
structure length 93
sequence length 93
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2h2kA00
1BMOA 1QV1A 2I18A 3CWGA 3DVMA 3EVVA 2VRGA 2O5GA 3BOWB 2K8MB 5HLVA 2LP3A 2B1UA 3HCMA 1OOJA 3OHMB 1TNPA 3VGOA 1U5IB 1TNQA 3NXAA 2PASA 2MHHA 2A4JA 2MBXA 1DVIA 1G33A 2LV7A 4MSPA 1SKTA 2Y4QA 2MJWB 2LLTA 3JTDB 3RM1A 1UHNA 4AQJA 4CFQA 2JWWA 3TS5B 2WNDA 3SG3A 1XVJA 1AUIB 1K8UA 2MAZA 3ZWHA 2KNEA 2JQ6A 2H2KA 3GK2A 1BJFA 1BR1B 2GGZA 3TDUA 1A03A 2E6WA 1DJGA 1CDLA 1QX2A 2Y1NA 4DUQA 2BL0C 1XK4A 1WRLA 3I5GC 1VRKA 5HKWA 1ALWA 1NCZA 1JFKA 3DD4A 1S6CA 1DTLA 3F45A 1K9KA 2JT8A 2LHLA 2SCPA 1K95A 2KAYA 1KQMC 5CSJA 4GBAA 1N0YA 3BYAA 3JVTB 1NX3A 2MRDA 4PE1A 1SL9A 1YURA 3LCPC 1PVBA 2K0JA 4PHKA 2LM5A 1S5GZ 1NIWA 1QX5B 3FIAA 2RGIA 2F8PA 5K89A 4ZCVA 1KFXS 1NWDA 5PALA 5CSNA 1BG1A 3FWBA 1JUOA 4P5OE 1XFVO 1X02A 1RFJA 1XFXO 2KFGA 3CLNA 1PALA 1S26D 2K7DA 1ZFSA 2KI6D 3CGAA 3VRPA 1RROA 3A4UB 4CPVA 3VRNA 2WCFA 4XYNA 1Y1UA 2JNFA 2LMTA 3EKJA 1S6IA 1CDMA 2KI6C 2PMYA 2BBNA 2FJUB 4FTGA 1IWQA 4R1EA 4GGFA 2JXLA 1JC2A 2HQ8A 1WRZA 1EL4A 3NSOA 2L51A 4YRUA 4AOMA 1CMFA 1TIZA 3DVJA 1B8LA 3ICBA 1EG3A 2D8NA 2L2EA 3VRRA 2K7CA 5I2QA 2M97A 3FWCA 2HPSA 4HREE 2K61A 4N1GA 4GFTA 4MBEA 4OKHA 1K96A 1QLKA 2JT0A 2LHIA 5D7FA 2K2AA 2M7LA 1M46A 1CLLA 1MF8B 3NSLA 4Q04A 3EVRA 3AAJA 1CNPA 3BUNB 4I5LB 1BOCA 1WLZA 1AVSA 3GK4X 3SG4A 4IL1A 1S36A 1F4OA 1ALVA 1IRJA 2ZN8A 1N2DA 1B7TZ 1QVIY 3D0YA 2M1UA 3SIAA 3WNXB 3CS1A 1CTRA 1SYMA 2LLUA 2CBLA 3KPXA 4C0JA 1CM1A 1XK4C 1ZACA 1YRTB 3A8RA 4MN0A 1EH2A 4TNCA 2JNXA 1Y6WA 1DJYA 3BOWA 2AUCA 1KK8C 2EHBA 3I5FC 4GPLB 1SNLA 1JWDA 2K7OA 3BXKA 1U5IA 1ZOTB 3OB1B 3BQ3A 4PALA 1K9UA 2AMIA 1MQ1A 2M7NA 2O60A 1NCYA 2H61A 2ZKMX 2JULA 4NDCA 1J7QA 1YR5A 3ZNIA 5B8IB 3O4YA 5I8NA 5I2LA 4QJ5B 2V53A 3OP0A 1CDNA 1J1DA 1UHIA 2OTGB 3I5IC 3I5GB 5AANA 1F4QA 2LLSA 4YGDB 1GJYA 1MR8A 2WOSA 3SG7A 1QXPA 1RK9A 2BKHB 1KFUS 4XJKB 1KCYA 1PK0D 1YTZC 2L98A 4M2QA 2LVVA 3GOFA 3KEVA 2JXCA 1FPWA 1K93D 2M1KB 2WCBA 1PVAA 1UHHA 2KGBC 1OMRA 2ZFDA 4DIRA 3SG6A 1BT6A 1B4CA 3TDIA 1SCMB 3RLZA 4PE0A 2FCEA 1V1GA 2KHNA 2I94A 5G08A 1D1OA 1IKUA 2BCBA 2EGDA 2CCMA 3O78A 4WQ3A 2WORA 3CR4X 4GGFC 1M31A 1PSRA 4L9MA 4E68A 3BUMB 3VROA 3D10A 3O6BA 4MZJA 2LE9B 1K94A 1YX7A 4AQIA 2NLNA 3SIBA 2WC8A 3DVKA 2L4HA 4NDDA 4P2YB 2ZN9A 1JFJA 1R2UA 3PLFB 4M2OA 1WDCC 1QV0A 1SY9A 2GGMA 1C7VA 1KWOB 1NX0A 1EXRA 4NDBA 1RJVA 1LVCD 1MWNA 1KSOA 2LAPA 3TUYB 3DVEA 1CMGA 1W7IB 1LKJA 1IJ6A 1H4BA 1E8AA 1EG4A 3I5HB 1L2OC 5IBWA 1GQMA 3CZTX 1SR6C 1B9AA 1B47A 3PN7C 1UHKA 4DCKA 1YVHA 1TRFA 3VRQA 5TNCA 1NUBA 4FQOA 3PALA 1CB1A 1RECA 1CFDA 1QATA 4PE4A 4WQ2A 5HKYA 2G9BA 1SMGA 2ZRTA 1JBAA 4JQ0D 4MZKA 1TN4A 1J7OA 1J1EA 3LLEA 1WLMA 1TNXA 2H61C 1SPYA 1F8HA 1BF5A 2L0PA 2MLEC 3JTDC 1XFZO 4CLNA 2KQ6A 3TS5C 2JOJA 4YI8A 4F0ZB 1QASA 2SASA 1OZOA 3LK1A 1KFUL 1TCOB 2EC6B 3CR5X 5KSZA 5HKZA 1DF0B 1M63B 1ODBA 5DKQA 3WHTB 3GK1A 2KAXA 4HRGA 1DJHA 1SK6D 2P6BB 4MEWA 1FW4A 1NX2A 2E30A 1K9PA 4A4BA 2COLB 5AERA 1MXLC 2KI4B 1L7ZA 3AKBA 4ETOA 4ORAB 2ISDA 2BBMA 3IQOA 1SL7A 2JTTA 2KBMA 2OS8B 2JU0A 5I2OA 3EK4A 1KK7Y 4MZLA 3DF0B 1IQ3A 2LP2A 1DT7B 5D69A 1LA0A 1Y1AA 2Y5IA 4NQGA 3MSEB 5CSFA 3PSRA 3EK7A 3JVTC 1JF2A 3K21A 2KSPA 3EK8A 1OSAA 1A29A 2LMUA 2NCOA 4OVNF 1XYDA 1RTP1 1SW8A 2M0RA 2LVJA 1FI5A 1BODA 4N5XA 4XJKA 1UP5A 4QJ4B 1Y0VH 2KQYA 3E3RA 2BE6A 1S1EA 1A75B 3EVUA 5FYXA 4MRYA 2BCAA 4A4CA 1AK8A 2L5XB 3KF9A 4OCIA 4C0KA 1UHJA 4ORCB 1TTXA 1XFYO 2BL0B 2CT9A 3TDZA 1QVIZ 3BUXB 2PSRA 5AFPA 4USLA 4MVFA 1UWOA 1YUSA 1DGVA 2I2RE 4D1EA 2IS9A 2LNKA 1A2XA 1B8RA 1YRUB 1OQPA 2KYFA 3CTNA 4I5NB 1KQMB 4PCWA 4CIDA 2LC5A 1LXFC 1F54A 1CLMA 2Q91A 3IQQA 1DGUA 1OE9B 5CSIA 1MXEA 1BLQA 1YVLA 2LVKA 1CFPA 3HX4A 4N1FA 2JPTA 1BR4B 1OMDA 1S6JA 5GQQC 2F3YA 1TNWA 3KO0A 1J7RA 4MLWA 1SBJA 5AEQA 4YGEB 2JT3A 2BKIB 2PALA 1LINA 2QPTA 5ER4X 3EKHA 1C07A 4PE7A 2CTNA 1S3PA 3OX6A 3LL8B 5F6TA 1LA3A 1HT9A 1XFWO 4HSZA 5J3XA 5HLOA 1J55A 1KSMA 1CDPA 1CFFA 5HYDA 5KTYA 2I7AA 4ZCUA 3BUWB 4BY5A 1FF1A 4GGNA 1AHRA 2Y1MA 3TZ1A 1QTXA 1MUXA 1QJTA 1QX7A 1S5GY 2BE4A 5AXIA 2CXJA 2M49B 5DKNA 2OTGC 1IH0A 5JJGA 1UURA 1DJZA 1XO5A 1SRAA 1DF0A 2K2FA 4WRIA 2HF5A 1J7PA 1DJWA 1QLSA 1IJ5A 4ORBB 4YGCB 2F2OA 2JZIA 3AAKA 1JSAA 2PVBA 1M45A 1A4PA 2PRUA 2M9GA 1K2HA 1ZMZA 5ER5A 3SG2A 3CR2A 1YUTA 1WRKA 2K7BA 4ICBA 2MA2A 2DOQA 2LANA 1SCMC 1MHOA 1ZUZA 1TOPA 3DF0A 3WHUB 1NP8A 2KGRA 3PFVA 1M39A 2L4IA 2ZNEA 2ZNDA 4PDZA 2WCEA 3QRXA 4OV2A 4YBHB 5JOLA 4UPGA 1AJ5A 2GV5A 4QJ3B 2KOTA 1JF0A 1G4YR 1KK8B 1DJIA 1R6PA 3I5FB 1H8BA 4YI9A 4OR9B 1AP4A 1CLBA 1YUUA 2BECA 1HQVA 1NX1A 1XA5A 4I5KA 2OPOA 2L50A 1BU3A 1CFCA 2F2PA 4GAOA 1NSHA 1KWOC 4C0LA 2HQWA 2FOTA 2JRFA 3TUYC 1A75A 4DS7A 4YGAA 1B8CA 3I5IB 2ZRSA 2F3ZA 1B7TY 2HETA 3I5HC 2KYCA 1K90D 1WY9A 1FI6A 1NCXA 1PULA 2CNPA 1W7JB 3M0WA 1EJ3A 1Q80A 2TN4A 2JC2A 2LMVA 1Y1XA 4JPZB 5KU1A 3PM8A 2LUXA 1PSBA 4U8DA 4BY4A 1PRWA 4MRXA 1C7WA 1G8IA 3C1VA 2G2BA 2KFHA 2QACA 3BUOB 2M29A 2M3WA 5BPJA 1DJXA 2Q4UA 1IG5A 2BCXA 1SL8A 1KQVA 1IQ5A 1FBVA 4JWQA 2R2IA 4M2PA 1F55A 1QIVA 1KK7Z 1N65A 4CFRA 3IF7A 4PHNA 1CKKA 2LCPA 4DRWA 2KDHA 3WXAA 2M8UA 4I5JA 3FS7A 1OZSA 5CPVA 2NZ0A 1SCVA 4PHJA 1AJ4A 4HRHA 1YX8A 2EC6C 1CM4A 3OX5A 1TCFA 3NSKA 1B1GA 2KBIA 1F71A 1XFUO 2AAOA 1UUSA 1WDCB 3AKAA 3KHEA 2NCPA 2MLFC 2LVIA 1QIWA 3LK0A 3H4SE 1GGWA 2F33A 2KI4C 2NXQA 2KFFA 4GNKB 1IGVA 4GUKA 2FCDA 4PHMA 1L2OB 2OS8C 2LUCA 2JTZA 1DMOA 3O2PA 5DKRA 3OB2B 1OMVA 1RWYA 3NSIA 3SJSA 3D0YB 1F70A 1V1FA 1SR6B 1GGZA 1NPQA 1QS7A 2KAVA 3SG5A 1NYAA 4YGBB 3PN7B 3PATA 1KFXL
chains in the Genus database with same CATH superfamily
1BMOA 1QV1A 2I18A 3CWGA 3DVMA 3EVVA 3D74A 4INXA 2VRGA 2O5GA 3BOWB 2K8MB 5HLVA 2LP3A 2B1UA 3HCMA 1F70A 1LS8A 1OOJA 3OHMB 1TNPA 3VGOA 1U5IB 1TNQA 3NXAA 2PASA 2MHHA 2A4JA 2MBXA 1DVIA 1G33A 3V2LA 2LV7A 4MSPA 1SKTA 2Y4QA 2MJWB 2LLTA 2WCHA 3JTDB 3RM1A 1UHNA 4AQJA 4CFQA 2JWWA 3TS5B 2WNDA 3SS4A 3SG3A 1XVJA 3S0FA 3L4AA 1AUIB 1K8UA 2MAZA 3ZWHA 2KNEA 3VB1A 2JQ6A 2H2KA 3GK2A 1BJFA 1BR1B 2GGZA 3TDUA 1A03A 2E6WA 1DJGA 1CDLA 1QX2A 2Y1NA 4DUQA 2BL0C 3B6XA 1XK4A 1WRLA 3DXLA 3I5GC 1VRKA 5HKWA 1ALWA 5EL2A 1NCZA 1JFKA 3DD4A 3S0AA 1S6CA 1DTLA 3F45A 3D75A 1K9KA 2JT8A 2LHLA 3O4XA 2SCPA 1K95A 2KAYA 1KQMC 2P70A 5CSJA 4GBAA 4F7FA 1N0YA 2WCLA 3BYAA 3JVTB 1NX3A 2MRDA 4PE1A 1SL9A 1YURA 3LCPC 1PVBA 2K0JA 4PHKA 2LM5A 1S5GZ 1NIWA 1QX5B 2YGUA 3FIAA 2RGIA 1Z2CB 2F8PA 5K89A 4ZCVA 1KFXS 1NWDA 4INWA 1C3ZA 5CSNA 5FI6A 3CZ2A 3FWBA 1JUOA 5PALA 4P5OE 1XFVO 1X02A 1RFJA 1XFXO 2KFGA 3FE8A 3CLNA 1DQEA 1PALA 1S26D 2K7DA 1ZFSA 2KI6D 3CGAA 3VRPA 1RROA 3A4UB 3CZ1A 2P71A 4CPVA 3VRNA 2WCFA 3R1OA 1T14A 4XYNA 1Y1UA 2JNFA 2LMTA 3NHIA 3EKJA 1S6IA 1CDMA 2KI6C 3FE6A 2PMYA 2BBNA 2FJUB 4FTGA 1IWQA 3CABA 4R1EA 4GGFA 2JXLA 1JC2A 2HQ8A 1WRZA 1GM0A 1EL4A 3R1PA 3NSOA 2L51A 4YRUA 4AOMA 1CMFA 1TIZA 3DVJA 1B8LA 5DKRA 3ICBA 1EG3A 2L5YA 3PJIA 2D8NA 2L2EA 3VRRA 2K7CA 5I2QA 2M97A 3FWCA 2HPSA 4HREE 3S0EA 1OOHA 1OW4A 2K61A 2K60A 4N1GA 4GFTA 3D77A 4MBEA 4OKHA 1K96A 1QLKA 2JT0A 2LHIA 5D7FA 2K2AA 2M7LA 1M46A 1CLLA 1MF8B 3NSLA 4Q04A 3EVRA 3AAJA 1CNPA 3BUNB 4I5LB 1BOCA 1WLZA 1AVSA 3GK4X 3SG4A 4IL1A 1S36A 1F4OA 1ALVA 1IRJA 2ZN8A 1N2DA 1B7TZ 1QVIY 2ERBA 2M1UA 3D0YA 3SIAA 3CS1A 1CTRA 3DYEA 1SYMA 2LLUA 2CBLA 3SS5A 3PM2A 3KPXA 4C0JA 1CM1A 1XK4C 1ZACA 1YRTB 3A8RA 4MN0A 1EH2A 4TNCA 2JNXA 1Y6WA 1DJYA 3BOWA 2AUCA 3L4LA 1KK8C 2EHBA 3I5FC 4GPLB 1SNLA 1JWDA 2K7OA 3BXKA 1U5IA 1ZOTB 3OB1B 3BQ3A 4PALA 1K9UA 2AMIA 2BAPA 1MQ1A 2M7NA 2O60A 1NCYA 2H61A 2ZKMX 2JULA 4NDCA 1J7QA 1YR5A 2GTEA 3ZNIA 1IH0A 5B8IB 3O4YA 5I8NA 5I2LA 4QJ5B 2V53A 3OP0A 1CDNA 1J1DA 1UHIA 2OTGB 3I5IC 3I5GB 5AANA 1IIOA 1F4QA 2LLSA 4YGDB 3OGNA 1GJYA 1MR8A 3UNWA 2WOSA 3SG7A 1QXPA 1RK9A 2BKHB 1KFUS 4XJKB 1KCYA 1PK0D 1BG1A 1YTZC 2L98A 4M2QA 2LVVA 3GOFA 3KEVA 2JXCA 1FPWA 1K93D 2M1KB 2WCBA 1PVAA 1UHHA 2KGBC 1OMRA 2ZFDA 4DIRA 3SG6A 1BT6A 1W9ZA 3IVTA 1B4CA 3TDIA 1DC1A 1SCMB 3RLZA 4PE0A 2FCEA 1V1GA 2KHNA 2I94A 5G08A 1D1OA 1IKUA 2BCBA 2EGDA 2CCMA 3O78A 4WQ3A 2WORA 3CR4X 4GGFC 1M31A 1PSRA 4L9MA 3B88A 4E68A 3BUMB 3VROA 3D10A 3O6BA 4MZJA 2LE9B 1K94A 1YX7A 3CYZA 3OBVA 4AQIA 2JPOA 3UO9A 2NLNA 3SIBA 2WC8A 3DVKA 2L4HA 4NDDA 4P2YB 2ZN9A 1JFJA 1R2UA 3PLFB 4M2OA 2QEHA 1WDCC 1QV0A 1SY9A 2GGMA 1C7VA 2WCKA 1KWOB 1NX0A 1EXRA 3R1VA 1RJVA 4NDBA 1LVCD 1MWNA 1KSOA 3CDNA 2LAPA 3TUYB 3DVEA 1C3YA 1CMGA 1W7IB 1LKJA 1IJ6A 1H4BA 2KLDA 1E8AA 2QEVA 1EG4A 3I5HB 3QMEA 1L2OC 3S0DA 5IBWA 1GQMA 2KLEA 3CZTX 1SR6C 2FJYA 1B9AA 2KPHA 1B47A 4YBHB 3PN7C 1UHKA 4DCKA 1YVHA 1TRFA 3VRQA 5TNCA 5HL1A 1NUBA 4FQOA 3PALA 1CB1A 1RECA 1CFDA 1QATA 4PE4A 4WQ2A 5HKYA 2G9BA 1SMGA 2ZRTA 1JBAA 4JQ0D 4MZKA 1TN4A 1J7OA 1J1EA 3LLEA 1WLMA 1TNXA 2H61C 1SPYA 1F8HA 1BF5A 2L0PA 2MLEC 2QEOA 1XFZO 3JTDC 4CLNA 2KQ6A 3TS5C 2JOJA 4YI8A 4F0ZB 5I94A 1QASA 2BNXA 2SASA 3FE9A 1OZOA 3LK1A 3L47A 1KFUL 1TCOB 2EC6B 3CR5X 5KSZA 5HKZA 1DF0B 1M63B 1ODBA 5DKQA 3WHTB 3GK1A 2KAXA 4HRGA 1DJHA 1SK6D 2P6BB 4MEWA 3D78A 1FW4A 1NX2A 2E30A 1K9PA 4A4BA 2COLB 5AERA 1MXLC 2KI4B 1L7ZA 3AKBA 4ETOA 4ORAB 2ISDA 2BBMA 3IQOA 1SL7A 2JTTA 2KBMA 2OS8B 2JU0A 5I2OA 3EK4A 3NHTA 1KK7Y 4MZLA 3DF0B 1IQ3A 2LP2A 1DT7B 5D69A 1LA0A 1Y1AA 2Y5IA 4NQGA 3MSEB 5CSFA 3PSRA 3EK7A 3JVTC 1JF2A 3K21A 2KSPA 3EK8A 3BFHA 1OSAA 1A29A 2LMUA 2NCOA 4OVNF 1XYDA 1RTP1 1SSEB 1SW8A 2LVJA 2M0RA 1BODA 1FI5A 4N5XA 4XJKA 1UP5A 4QJ4B 1Y0VH 2KQYA 3E3RA 2BE6A 1S1EA 1A75B 3EVUA 5FYXA 3RZSA 3BFAA 2WC5A 4MRYA 2BCAA 4A4CA 3B7AA 1AK8A 2L5XB 3KF9A 4OCIA 4C0KA 1UHJA 4ORCB 1TTXA 1XFYO 2BL0B 2CT9A 3TDZA 1QVIZ 3BUXB 2PSRA 5AFPA 4USLA 4MVFA 1UWOA 1YUSA 1DGVA 2I2RE 4D1EA 3D76A 2IS9A 5DICA 2LNKA 1A2XA 1B8RA 1YRUB 1OQPA 2KYFA 3CTNA 4I5NB 1KQMB 4PCWA 4CIDA 2LC5A 1LXFC 1F54A 1CLMA 2Q91A 3IQQA 1DGUA 1OE9B 5CSIA 3K1EA 1MXEA 1BLQA 1YVLA 2LVKA 3N7HA 3HX4A 4N1FA 1CFPA 2JPTA 1BR4B 1OMDA 1S6JA 5GQQC 2F3YA 1TNWA 3KO0A 1J7RA 4MLWA 1SBJA 5AEQA 1QWVA 4YGEB 2JT3A 2BKIB 2PALA 1LINA 2QPTA 5ER4X 3EKHA 1C07A 4PE7A 2CTNA 1S3PA 3OX6A 3LL8B 3EG5B 5F6TA 1LA3A 1HT9A 1XFWO 4HSZA 5J3XA 5HLOA 1J55A 3S0BA 1KSMA 1CDPA 1CFFA 5HYDA 5KTYA 2I7AA 4ZCUA 3BUWB 4BY5A 1FF1A 4GGNA 1AHRA 2Y1MA 3TZ1A 1QTXA 3DY9A 1MUXA 1QJTA 3NGVA 1OOFA 1QX7A 1S5GY 2BE4A 5AXIA 2CXJA 2M49B 5DKNA 1TWOA 2OTGC 5JJGA 1UURA 1DJZA 1XO5A 1SRAA 1DF0A 2K2FA 3B86A 4WRIA 2HF5A 1ORGA 1J7PA 1OOIX 1P28A 1DJWA 1QLSA 1Z4HA 1IJ5A 4ORBB 4YGCB 2F2OA 2JZIA 3AAKA 1JSAA 2PVBA 1M45A 1A4PA 2PRUA 2M9GA 1K2HA 1ZMZA 5ER5A 3SG2A 3CR2A 1YUTA 1WRKA 2K7BA 4FQTA 4ICBA 3BFBA 2MA2A 2DOQA 2LANA 1DEKA 1SCMC 1MHOA 1ZUZA 1TOPA 2PQLA 3DF0A 1NP8A 2KGRA 3WHUB 3BJHA 1M39A 2L4IA 2ZNEA 2ZNDA 3PFVA 2WCEA 3QRXA 4OV2A 4PDZA 5JOLA 3Q8IA 4UPGA 1AJ5A 2GV5A 4QJ3B 2KOTA 1JF0A 1G4YR 1KK8B 1DJIA 1R6PA 3I5FB 1H8BA 4YI9A 4OR9B 1AP4A 1CLBA 1YUUA 2BECA 1HQVA 1NX1A 1XA5A 4I5KA 2OPOA 2L50A 1BU3A 1CFCA 2L2CA 4IJ7A 2F2PA 3SS3A 4GAOA 1NSHA 1KWOC 4C0LA 2HQWA 2FOTA 2JRFA 3TUYC 1A75A 2WC6A 4DS7A 4YGAA 1B8CA 3I5IB 2ZRSA 2F3ZA 1B7TY 2HETA 5FI2A 3I5HC 2KYCA 1K90D 1WY9A 1FI6A 4JKTA 1NCXA 1PULA 2CNPA 1W7JB 3M0WA 5D3OA 1EJ3A 1Q80A 2TN4A 2JC2A 2LMVA 1Y1XA 4JPZB 5KU1A 3D73A 2H8VA 3PM8A 3B87A 2LUXA 1PSBA 4U8DA 4BY4A 1PRWA 4MRXA 1C7WA 1G8IA 3C1VA 2G2BA 2KFHA 2QACA 1OOGA 3BUOB 2M29A 2M3WA 5BPJA 1DJXA 2Q4UA 1IG5A 2BCXA 2PYQA 4JD9A 1SL8A 1KQVA 1IQ5A 1FBVA 4JWQA 2R2IA 4M2PA 2WCJA 1QIVA 1F55A 1KK7Z 1N65A 3R72A 3S0GA 4CFRA 3IF7A 4PHNA 1CKKA 2LCPA 4DRWA 2KDHA 3WXAA 2M8UA 4I5JA 3FS7A 1OZSA 5CPVA 2NZ0A 1SCVA 3CZ0A 5FI7A 1TUJA 4PHJA 1AJ4A 4HRHA 1YX8A 2EC6C 3WNXB 1CM4A 3OX5A 1TCFA 3NSKA 4KYNA 2KBIA 1B1GA 1F71A 1XFUO 2AAOA 1UUSA 1WDCB 3AKAA 3KHEA 2NCPA 2MLFC 2LVIA 1QIWA 3LK0A 3H4SE 1GGWA 2F33A 2KI4C 2NXQA 2KFFA 1XFRA 4GNKB 4OZDA 1IGVA 4GUKA 2FCDA 4PHMA 1L2OB 2OS8C 2LUCA 2JTZA 1DMOA 3DZTA 3O2PA 3OB2B 1OMVA 1RWYA 3NSIA 2QEBA 3D0YB 1DELA 1V1FA 3SJSA 1SR6B 1GGZA 1NPQA 1QS7A 2KAVA 4PT1A 3SG5A 1NYAA 4YGBB 2QDIA 1TUZA 3PN7B 3PATA 2WCMA 1KFXL
chains in the Genus database with same CATH topology
1BMOA 1QV1A 2I18A 3CWGA 3DVMA 3EVVA 2VRGA 2O5GA 3BOWB 2K8MB 5HLVA 2LP3A 2B1UA 3HCMA 1OOJA 3OHMB 1TNPA 3VGOA 1U5IB 1TNQA 3NXAA 2PASA 2MHHA 2A4JA 2MBXA 1DVIA 1G33A 2LV7A 4MSPA 1SKTA 2Y4QA 2MJWB 2LLTA 3JTDB 3RM1A 1UHNA 4AQJA 4CFQA 2JWWA 3TS5B 2WNDA 3SG3A 1XVJA 1AUIB 1K8UA 2MAZA 3ZWHA 2KNEA 2JQ6A 2H2KA 3GK2A 1BJFA 1BR1B 2GGZA 3TDUA 1A03A 2E6WA 1DJGA 1CDLA 1QX2A 2Y1NA 4DUQA 2BL0C 1XK4A 1WRLA 3I5GC 1VRKA 5HKWA 1ALWA 1NCZA 1JFKA 3DD4A 1S6CA 1DTLA 3F45A 1K9KA 2JT8A 2LHLA 2SCPA 1K95A 2KAYA 1KQMC 5CSJA 4GBAA 1N0YA 3BYAA 3JVTB 1NX3A 2MRDA 4PE1A 1SL9A 1YURA 3LCPC 1PVBA 2K0JA 4PHKA 2LM5A 1S5GZ 1NIWA 1QX5B 3FIAA 2RGIA 2F8PA 5K89A 4ZCVA 1KFXS 1NWDA 5PALA 5CSNA 1BG1A 3FWBA 1JUOA 4P5OE 1XFVO 1X02A 1RFJA 1XFXO 2KFGA 3CLNA 1PALA 1S26D 2K7DA 1ZFSA 2KI6D 3CGAA 3VRPA 1RROA 3A4UB 4CPVA 3VRNA 2WCFA 4XYNA 1Y1UA 2JNFA 2LMTA 3EKJA 1S6IA 1CDMA 2KI6C 2PMYA 2BBNA 2FJUB 4FTGA 1IWQA 4R1EA 4GGFA 2JXLA 1JC2A 2HQ8A 1WRZA 1EL4A 3NSOA 2L51A 4YRUA 4AOMA 1CMFA 1TIZA 3DVJA 1B8LA 3ICBA 1EG3A 2D8NA 2L2EA 3VRRA 2K7CA 5I2QA 2M97A 3FWCA 2HPSA 4HREE 2K61A 4N1GA 4GFTA 4MBEA 4OKHA 1K96A 1QLKA 2JT0A 2LHIA 5D7FA 2K2AA 2M7LA 1M46A 1CLLA 1MF8B 3NSLA 4Q04A 3EVRA 3AAJA 1CNPA 3BUNB 4I5LB 1BOCA 1WLZA 1AVSA 3GK4X 3SG4A 4IL1A 1S36A 1F4OA 1ALVA 1IRJA 2ZN8A 1N2DA 1B7TZ 1QVIY 3D0YA 2M1UA 3SIAA 3WNXB 3CS1A 1CTRA 1SYMA 2LLUA 2CBLA 3KPXA 4C0JA 1CM1A 1XK4C 1ZACA 1YRTB 3A8RA 4MN0A 1EH2A 4TNCA 2JNXA 1Y6WA 1DJYA 3BOWA 2AUCA 1KK8C 2EHBA 3I5FC 4GPLB 1SNLA 1JWDA 2K7OA 3BXKA 1U5IA 1ZOTB 3OB1B 3BQ3A 4PALA 1K9UA 2AMIA 1MQ1A 2M7NA 2O60A 1NCYA 2H61A 2ZKMX 2JULA 4NDCA 1J7QA 1YR5A 3ZNIA 5B8IB 3O4YA 5I8NA 5I2LA 4QJ5B 2V53A 3OP0A 1CDNA 1J1DA 1UHIA 2OTGB 3I5IC 3I5GB 5AANA 1F4QA 2LLSA 4YGDB 1GJYA 1MR8A 2WOSA 3SG7A 1QXPA 1RK9A 2BKHB 1KFUS 4XJKB 1KCYA 1PK0D 1YTZC 2L98A 4M2QA 2LVVA 3GOFA 3KEVA 2JXCA 1FPWA 1K93D 2M1KB 2WCBA 1PVAA 1UHHA 2KGBC 1OMRA 2ZFDA 4DIRA 3SG6A 1BT6A 1B4CA 3TDIA 1SCMB 3RLZA 4PE0A 2FCEA 1V1GA 2KHNA 2I94A 5G08A 1D1OA 1IKUA 2BCBA 2EGDA 2CCMA 3O78A 4WQ3A 2WORA 3CR4X 4GGFC 1M31A 1PSRA 4L9MA 4E68A 3BUMB 3VROA 3D10A 3O6BA 4MZJA 2LE9B 1K94A 1YX7A 4AQIA 2NLNA 3SIBA 2WC8A 3DVKA 2L4HA 4NDDA 4P2YB 2ZN9A 1JFJA 1R2UA 3PLFB 4M2OA 1WDCC 1QV0A 1SY9A 2GGMA 1C7VA 1KWOB 1NX0A 1EXRA 4NDBA 1RJVA 1LVCD 1MWNA 1KSOA 2LAPA 3TUYB 3DVEA 1CMGA 1W7IB 1LKJA 1IJ6A 1H4BA 1E8AA 1EG4A 3I5HB 1L2OC 5IBWA 1GQMA 3CZTX 1SR6C 1B9AA 1B47A 3PN7C 1UHKA 4DCKA 1YVHA 1TRFA 3VRQA 5TNCA 1NUBA 4FQOA 3PALA 1CB1A 1RECA 1CFDA 1QATA 4PE4A 4WQ2A 5HKYA 2G9BA 1SMGA 2ZRTA 1JBAA 4JQ0D 4MZKA 1TN4A 1J7OA 1J1EA 3LLEA 1WLMA 1TNXA 2H61C 1SPYA 1F8HA 1BF5A 2L0PA 2MLEC 3JTDC 1XFZO 4CLNA 2KQ6A 3TS5C 2JOJA 4YI8A 4F0ZB 1QASA 2SASA 1OZOA 3LK1A 1KFUL 1TCOB 2EC6B 3CR5X 5KSZA 5HKZA 1DF0B 1M63B 1ODBA 5DKQA 3WHTB 3GK1A 2KAXA 4HRGA 1DJHA 1SK6D 2P6BB 4MEWA 1FW4A 1NX2A 2E30A 1K9PA 4A4BA 2COLB 5AERA 1MXLC 2KI4B 1L7ZA 3AKBA 4ETOA 4ORAB 2ISDA 2BBMA 3IQOA 1SL7A 2JTTA 2KBMA 2OS8B 2JU0A 5I2OA 3EK4A 1KK7Y 4MZLA 3DF0B 1IQ3A 2LP2A 1DT7B 5D69A 1LA0A 1Y1AA 2Y5IA 4NQGA 3MSEB 5CSFA 3PSRA 3EK7A 3JVTC 1JF2A 3K21A 2KSPA 3EK8A 1OSAA 1A29A 2LMUA 2NCOA 4OVNF 1XYDA 1RTP1 1SW8A 2M0RA 2LVJA 1FI5A 1BODA 4N5XA 4XJKA 1UP5A 4QJ4B 1Y0VH 2KQYA 3E3RA 2BE6A 1S1EA 1A75B 3EVUA 5FYXA 4MRYA 2BCAA 4A4CA 1AK8A 2L5XB 3KF9A 4OCIA 4C0KA 1UHJA 4ORCB 1TTXA 1XFYO 2BL0B 2CT9A 3TDZA 1QVIZ 3BUXB 2PSRA 5AFPA 4USLA 4MVFA 1UWOA 1YUSA 1DGVA 2I2RE 4D1EA 2IS9A 2LNKA 1A2XA 1B8RA 1YRUB 1OQPA 2KYFA 3CTNA 4I5NB 1KQMB 4PCWA 4CIDA 2LC5A 1LXFC 1F54A 1CLMA 2Q91A 3IQQA 1DGUA 1OE9B 5CSIA 1MXEA 1BLQA 1YVLA 2LVKA 1CFPA 3HX4A 4N1FA 2JPTA 1BR4B 1OMDA 1S6JA 5GQQC 2F3YA 1TNWA 3KO0A 1J7RA 4MLWA 1SBJA 5AEQA 4YGEB 2JT3A 2BKIB 2PALA 1LINA 2QPTA 5ER4X 3EKHA 1C07A 4PE7A 2CTNA 1S3PA 3OX6A 3LL8B 5F6TA 1LA3A 1HT9A 1XFWO 4HSZA 5J3XA 5HLOA 1J55A 1KSMA 1CDPA 1CFFA 5HYDA 5KTYA 2I7AA 4ZCUA 3BUWB 4BY5A 1FF1A 4GGNA 1AHRA 2Y1MA 3TZ1A 1QTXA 1MUXA 1QJTA 1QX7A 1S5GY 2BE4A 5AXIA 2CXJA 2M49B 5DKNA 2OTGC 1IH0A 5JJGA 1UURA 1DJZA 1XO5A 1SRAA 1DF0A 2K2FA 4WRIA 2HF5A 1J7PA 1DJWA 1QLSA 1IJ5A 4ORBB 4YGCB 2F2OA 2JZIA 3AAKA 1JSAA 2PVBA 1M45A 1A4PA 2PRUA 2M9GA 1K2HA 1ZMZA 5ER5A 3SG2A 3CR2A 1YUTA 1WRKA 2K7BA 4ICBA 2MA2A 2DOQA 2LANA 1SCMC 1MHOA 1ZUZA 1TOPA 3DF0A 3WHUB 1NP8A 2KGRA 3PFVA 1M39A 2L4IA 2ZNEA 2ZNDA 4PDZA 2WCEA 3QRXA 4OV2A 4YBHB 5JOLA 4UPGA 1AJ5A 2GV5A 4QJ3B 2KOTA 1JF0A 1G4YR 1KK8B 1DJIA 1R6PA 3I5FB 1H8BA 4YI9A 4OR9B 1AP4A 1CLBA 1YUUA 2BECA 1HQVA 1NX1A 1XA5A 4I5KA 2OPOA 2L50A 1BU3A 1CFCA 2F2PA 4GAOA 1NSHA 1KWOC 4C0LA 2HQWA 2FOTA 2JRFA 3TUYC 1A75A 4DS7A 4YGAA 1B8CA 3I5IB 2ZRSA 2F3ZA 1B7TY 2HETA 3I5HC 2KYCA 1K90D 1WY9A 1FI6A 1NCXA 1PULA 2CNPA 1W7JB 3M0WA 1EJ3A 1Q80A 2TN4A 2JC2A 2LMVA 1Y1XA 4JPZB 5KU1A 3PM8A 2LUXA 1PSBA 4U8DA 4BY4A 1PRWA 4MRXA 1C7WA 1G8IA 3C1VA 2G2BA 2KFHA 2QACA 3BUOB 2M29A 2M3WA 5BPJA 1DJXA 2Q4UA 1IG5A 2BCXA 1SL8A 1KQVA 1IQ5A 1FBVA 4JWQA 2R2IA 4M2PA 1F55A 1QIVA 1KK7Z 1N65A 4CFRA 3IF7A 4PHNA 1CKKA 2LCPA 4DRWA 2KDHA 3WXAA 2M8UA 4I5JA 3FS7A 1OZSA 5CPVA 2NZ0A 1SCVA 4PHJA 1AJ4A 4HRHA 1YX8A 2EC6C 1CM4A 3OX5A 1TCFA 3NSKA 1B1GA 2KBIA 1F71A 1XFUO 2AAOA 1UUSA 1WDCB 3AKAA 3KHEA 2NCPA 2MLFC 2LVIA 1QIWA 3LK0A 3H4SE 1GGWA 2F33A 2KI4C 2NXQA 2KFFA 4GNKB 1IGVA 4GUKA 2FCDA 4PHMA 1L2OB 2OS8C 2LUCA 2JTZA 1DMOA 3O2PA 5DKRA 3OB2B 1OMVA 1RWYA 3NSIA 3SJSA 3D0YB 1F70A 1V1FA 1SR6B 1GGZA 1NPQA 1QS7A 2KAVA 3SG5A 1NYAA 4YGBB 3PN7B 3PATA 1KFXL
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BMO A;  1QV1 A;  2I18 A;  3CWG A;  3DVM A;  3EVV A;  2VRG A;  2O5G A;  3BOW B;  2K8M B;  5HLV A;  2LP3 A;  2B1U A;  3HCM A;  1OOJ A;  3OHM B;  1TNP A;  3VGO A;  1U5I B;  1TNQ A;  3NXA A;  2PAS A;  2MHH A;  2A4J A;  2MBX A;  1DVI A;  1G33 A;  2LV7 A;  4MSP A;  1SKT A;  2Y4Q A;  2MJW B;  2LLT A;  3JTD B;  3RM1 A;  1UHN A;  4AQJ A;  4CFQ A;  2JWW A;  3TS5 B;  2WND A;  3SG3 A;  1XVJ A;  1AUI B;  1K8U A;  2MAZ A;  3ZWH A;  2KNE A;  2JQ6 A;  2H2K A;  3GK2 A;  1BJF A;  1BR1 B;  2GGZ A;  3TDU A;  1A03 A;  2E6W A;  1DJG A;  1CDL A;  1QX2 A;  2Y1N A;  4DUQ A;  2BL0 C;  1XK4 A;  1WRL A;  3I5G C;  1VRK A;  5HKW A;  1ALW A;  1NCZ A;  1JFK A;  3DD4 A;  1S6C A;  1DTL A;  3F45 A;  1K9K A;  2JT8 A;  2LHL A;  2SCP A;  1K95 A;  2KAY A;  1KQM C;  5CSJ A;  4GBA A;  1N0Y A;  3BYA A;  3JVT B;  1NX3 A;  2MRD A;  4PE1 A;  1SL9 A;  1YUR A;  3LCP C;  1PVB A;  2K0J A;  4PHK A;  2LM5 A;  1S5G Z;  1NIW A;  1QX5 B;  3FIA A;  2RGI A;  2F8P A;  5K89 A;  4ZCV A;  1KFX S;  1NWD A;  5PAL A;  5CSN A;  1BG1 A;  3FWB A;  1JUO A;  4P5O E;  1XFV O;  1X02 A;  1RFJ A;  1XFX O;  2KFG A;  3CLN A;  1PAL A;  1S26 D;  2K7D A;  1ZFS A;  2KI6 D;  3CGA A;  3VRP A;  1RRO A;  3A4U B;  4CPV A;  3VRN A;  2WCF A;  4XYN A;  1Y1U A;  2JNF A;  2LMT A;  3EKJ A;  1S6I A;  1CDM A;  2KI6 C;  2PMY A;  2BBN A;  2FJU B;  4FTG A;  1IWQ A;  4R1E A;  4GGF A;  2JXL A;  1JC2 A;  2HQ8 A;  1WRZ A;  1EL4 A;  3NSO A;  2L51 A;  4YRU A;  4AOM A;  1CMF A;  1TIZ A;  3DVJ A;  1B8L A;  3ICB A;  1EG3 A;  2D8N A;  2L2E A;  3VRR A;  2K7C A;  5I2Q A;  2M97 A;  3FWC A;  2HPS A;  4HRE E;  2K61 A;  4N1G A;  4GFT A;  4MBE A;  4OKH A;  1K96 A;  1QLK A;  2JT0 A;  2LHI A;  5D7F A;  2K2A A;  2M7L A;  1M46 A;  1CLL A;  1MF8 B;  3NSL A;  4Q04 A;  3EVR A;  3AAJ A;  1CNP A;  3BUN B;  4I5L B;  1BOC A;  1WLZ A;  1AVS A;  3GK4 X;  3SG4 A;  4IL1 A;  1S36 A;  1F4O A;  1ALV A;  1IRJ A;  2ZN8 A;  1N2D A;  1B7T Z;  1QVI Y;  3D0Y A;  2M1U A;  3SIA A;  3WNX B;  3CS1 A;  1CTR A;  1SYM A;  2LLU A;  2CBL A;  3KPX A;  4C0J A;  1CM1 A;  1XK4 C;  1ZAC A;  1YRT B;  3A8R A;  4MN0 A;  1EH2 A;  4TNC A;  2JNX A;  1Y6W A;  1DJY A;  3BOW A;  2AUC A;  1KK8 C;  2EHB A;  3I5F C;  4GPL B;  1SNL A;  1JWD A;  2K7O A;  3BXK A;  1U5I A;  1ZOT B;  3OB1 B;  3BQ3 A;  4PAL A;  1K9U A;  2AMI A;  1MQ1 A;  2M7N A;  2O60 A;  1NCY A;  2H61 A;  2ZKM X;  2JUL A;  4NDC A;  1J7Q A;  1YR5 A;  3ZNI A;  5B8I B;  3O4Y A;  5I8N A;  5I2L A;  4QJ5 B;  2V53 A;  3OP0 A;  1CDN A;  1J1D A;  1UHI A;  2OTG B;  3I5I C;  3I5G B;  5AAN A;  1F4Q A;  2LLS A;  4YGD B;  1GJY A;  1MR8 A;  2WOS A;  3SG7 A;  1QXP A;  1RK9 A;  2BKH B;  1KFU S;  4XJK B;  1KCY A;  1PK0 D;  1YTZ C;  2L98 A;  4M2Q A;  2LVV A;  3GOF A;  3KEV A;  2JXC A;  1FPW A;  1K93 D;  2M1K B;  2WCB A;  1PVA A;  1UHH A;  2KGB C;  1OMR A;  2ZFD A;  4DIR A;  3SG6 A;  1BT6 A;  1B4C A;  3TDI A;  1SCM B;  3RLZ A;  4PE0 A;  2FCE A;  1V1G A;  2KHN A;  2I94 A;  5G08 A;  1D1O A;  1IKU A;  2BCB A;  2EGD A;  2CCM A;  3O78 A;  4WQ3 A;  2WOR A;  3CR4 X;  4GGF C;  1M31 A;  1PSR A;  4L9M A;  4E68 A;  3BUM B;  3VRO A;  3D10 A;  3O6B A;  4MZJ A;  2LE9 B;  1K94 A;  1YX7 A;  4AQI A;  2NLN A;  3SIB A;  2WC8 A;  3DVK A;  2L4H A;  4NDD A;  4P2Y B;  2ZN9 A;  1JFJ A;  1R2U A;  3PLF B;  4M2O A;  1WDC C;  1QV0 A;  1SY9 A;  2GGM A;  1C7V A;  1KWO B;  1NX0 A;  1EXR A;  4NDB A;  1RJV A;  1LVC D;  1MWN A;  1KSO A;  2LAP A;  3TUY B;  3DVE A;  1CMG A;  1W7I B;  1LKJ A;  1IJ6 A;  1H4B A;  1E8A A;  1EG4 A;  3I5H B;  1L2O C;  5IBW A;  1GQM A;  3CZT X;  1SR6 C;  1B9A A;  1B47 A;  3PN7 C;  1UHK A;  4DCK A;  1YVH A;  1TRF A;  3VRQ A;  5TNC A;  1NUB A;  4FQO A;  3PAL A;  1CB1 A;  1REC A;  1CFD A;  1QAT A;  4PE4 A;  4WQ2 A;  5HKY A;  2G9B A;  1SMG A;  2ZRT A;  1JBA A;  4JQ0 D;  4MZK A;  1TN4 A;  1J7O A;  1J1E A;  3LLE A;  1WLM A;  1TNX A;  2H61 C;  1SPY A;  1F8H A;  1BF5 A;  2L0P A;  2MLE C;  3JTD C;  1XFZ O;  4CLN A;  2KQ6 A;  3TS5 C;  2JOJ A;  4YI8 A;  4F0Z B;  1QAS A;  2SAS A;  1OZO A;  3LK1 A;  1KFU L;  1TCO B;  2EC6 B;  3CR5 X;  5KSZ A;  5HKZ A;  1DF0 B;  1M63 B;  1ODB A;  5DKQ A;  3WHT B;  3GK1 A;  2KAX A;  4HRG A;  1DJH A;  1SK6 D;  2P6B B;  4MEW A;  1FW4 A;  1NX2 A;  2E30 A;  1K9P A;  4A4B A;  2COL B;  5AER A;  1MXL C;  2KI4 B;  1L7Z A;  3AKB A;  4ETO A;  4ORA B;  2ISD A;  2BBM A;  3IQO A;  1SL7 A;  2JTT A;  2KBM A;  2OS8 B;  2JU0 A;  5I2O A;  3EK4 A;  1KK7 Y;  4MZL A;  3DF0 B;  1IQ3 A;  2LP2 A;  1DT7 B;  5D69 A;  1LA0 A;  1Y1A A;  2Y5I A;  4NQG A;  3MSE B;  5CSF A;  3PSR A;  3EK7 A;  3JVT C;  1JF2 A;  3K21 A;  2KSP A;  3EK8 A;  1OSA A;  1A29 A;  2LMU A;  2NCO A;  4OVN F;  1XYD A;  1RTP 1;  1SW8 A;  2M0R A;  2LVJ A;  1FI5 A;  1BOD A;  4N5X A;  4XJK A;  1UP5 A;  4QJ4 B;  1Y0V H;  2KQY A;  3E3R A;  2BE6 A;  1S1E A;  1A75 B;  3EVU A;  5FYX A;  4MRY A;  2BCA A;  4A4C A;  1AK8 A;  2L5X B;  3KF9 A;  4OCI A;  4C0K A;  1UHJ A;  4ORC B;  1TTX A;  1XFY O;  2BL0 B;  2CT9 A;  3TDZ A;  1QVI Z;  3BUX B;  2PSR A;  5AFP A;  4USL A;  4MVF A;  1UWO A;  1YUS A;  1DGV A;  2I2R E;  4D1E A;  2IS9 A;  2LNK A;  1A2X A;  1B8R A;  1YRU B;  1OQP A;  2KYF A;  3CTN A;  4I5N B;  1KQM B;  4PCW A;  4CID A;  2LC5 A;  1LXF C;  1F54 A;  1CLM A;  2Q91 A;  3IQQ A;  1DGU A;  1OE9 B;  5CSI A;  1MXE A;  1BLQ A;  1YVL A;  2LVK A;  1CFP A;  3HX4 A;  4N1F A;  2JPT A;  1BR4 B;  1OMD A;  1S6J A;  5GQQ C;  2F3Y A;  1TNW A;  3KO0 A;  1J7R A;  4MLW A;  1SBJ A;  5AEQ A;  4YGE B;  2JT3 A;  2BKI B;  2PAL A;  1LIN A;  2QPT A;  5ER4 X;  3EKH A;  1C07 A;  4PE7 A;  2CTN A;  1S3P A;  3OX6 A;  3LL8 B;  5F6T A;  1LA3 A;  1HT9 A;  1XFW O;  4HSZ A;  5J3X A;  5HLO A;  1J55 A;  1KSM A;  1CDP A;  1CFF A;  5HYD A;  5KTY A;  2I7A A;  4ZCU A;  3BUW B;  4BY5 A;  1FF1 A;  4GGN A;  1AHR A;  2Y1M A;  3TZ1 A;  1QTX A;  1MUX A;  1QJT A;  1QX7 A;  1S5G Y;  2BE4 A;  5AXI A;  2CXJ A;  2M49 B;  5DKN A;  2OTG C;  1IH0 A;  5JJG A;  1UUR A;  1DJZ A;  1XO5 A;  1SRA A;  1DF0 A;  2K2F A;  4WRI A;  2HF5 A;  1J7P A;  1DJW A;  1QLS A;  1IJ5 A;  4ORB B;  4YGC B;  2F2O A;  2JZI A;  3AAK A;  1JSA A;  2PVB A;  1M45 A;  1A4P A;  2PRU A;  2M9G A;  1K2H A;  1ZMZ A;  5ER5 A;  3SG2 A;  3CR2 A;  1YUT A;  1WRK A;  2K7B A;  4ICB A;  2MA2 A;  2DOQ A;  2LAN A;  1SCM C;  1MHO A;  1ZUZ A;  1TOP A;  3DF0 A;  3WHU B;  1NP8 A;  2KGR A;  3PFV A;  1M39 A;  2L4I A;  2ZNE A;  2ZND A;  4PDZ A;  2WCE A;  3QRX A;  4OV2 A;  4YBH B;  5JOL A;  4UPG A;  1AJ5 A;  2GV5 A;  4QJ3 B;  2KOT A;  1JF0 A;  1G4Y R;  1KK8 B;  1DJI A;  1R6P A;  3I5F B;  1H8B A;  4YI9 A;  4OR9 B;  1AP4 A;  1CLB A;  1YUU A;  2BEC A;  1HQV A;  1NX1 A;  1XA5 A;  4I5K A;  2OPO A;  2L50 A;  1BU3 A;  1CFC A;  2F2P A;  4GAO A;  1NSH A;  1KWO C;  4C0L A;  2HQW A;  2FOT A;  2JRF A;  3TUY C;  1A75 A;  4DS7 A;  4YGA A;  1B8C A;  3I5I B;  2ZRS A;  2F3Z A;  1B7T Y;  2HET A;  3I5H C;  2KYC A;  1K90 D;  1WY9 A;  1FI6 A;  1NCX A;  1PUL A;  2CNP A;  1W7J B;  3M0W A;  1EJ3 A;  1Q80 A;  2TN4 A;  2JC2 A;  2LMV A;  1Y1X A;  4JPZ B;  5KU1 A;  3PM8 A;  2LUX A;  1PSB A;  4U8D A;  4BY4 A;  1PRW A;  4MRX A;  1C7W A;  1G8I A;  3C1V A;  2G2B A;  2KFH A;  2QAC A;  3BUO B;  2M29 A;  2M3W A;  5BPJ A;  1DJX A;  2Q4U A;  1IG5 A;  2BCX A;  1SL8 A;  1KQV A;  1IQ5 A;  1FBV A;  4JWQ A;  2R2I A;  4M2P A;  1F55 A;  1QIV A;  1KK7 Z;  1N65 A;  4CFR A;  3IF7 A;  4PHN A;  1CKK A;  2LCP A;  4DRW A;  2KDH A;  3WXA A;  2M8U A;  4I5J A;  3FS7 A;  1OZS A;  5CPV A;  2NZ0 A;  1SCV A;  4PHJ A;  1AJ4 A;  4HRH A;  1YX8 A;  2EC6 C;  1CM4 A;  3OX5 A;  1TCF A;  3NSK A;  1B1G A;  2KBI A;  1F71 A;  1XFU O;  2AAO A;  1UUS A;  1WDC B;  3AKA A;  3KHE A;  2NCP A;  2MLF C;  2LVI A;  1QIW A;  3LK0 A;  3H4S E;  1GGW A;  2F33 A;  2KI4 C;  2NXQ A;  2KFF A;  4GNK B;  1IGV A;  4GUK A;  2FCD A;  4PHM A;  1L2O B;  2OS8 C;  2LUC A;  2JTZ A;  1DMO A;  3O2P A;  5DKR A;  3OB2 B;  1OMV A;  1RWY A;  3NSI A;  3SJS A;  3D0Y B;  1F70 A;  1V1F A;  1SR6 B;  1GGZ A;  1NPQ A;  1QS7 A;  2KAV A;  3SG5 A;  1NYA A;  4YGB B;  3PN7 B;  3PAT A;  1KFX L; 
#chains in the Genus database with same CATH topology
 1BMO A;  1QV1 A;  2I18 A;  3CWG A;  3DVM A;  3EVV A;  3D74 A;  4INX A;  2VRG A;  2O5G A;  3BOW B;  2K8M B;  5HLV A;  2LP3 A;  2B1U A;  3HCM A;  1F70 A;  1LS8 A;  1OOJ A;  3OHM B;  1TNP A;  3VGO A;  1U5I B;  1TNQ A;  3NXA A;  2PAS A;  2MHH A;  2A4J A;  2MBX A;  1DVI A;  1G33 A;  3V2L A;  2LV7 A;  4MSP A;  1SKT A;  2Y4Q A;  2MJW B;  2LLT A;  2WCH A;  3JTD B;  3RM1 A;  1UHN A;  4AQJ A;  4CFQ A;  2JWW A;  3TS5 B;  2WND A;  3SS4 A;  3SG3 A;  1XVJ A;  3S0F A;  3L4A A;  1AUI B;  1K8U A;  2MAZ A;  3ZWH A;  2KNE A;  3VB1 A;  2JQ6 A;  2H2K A;  3GK2 A;  1BJF A;  1BR1 B;  2GGZ A;  3TDU A;  1A03 A;  2E6W A;  1DJG A;  1CDL A;  1QX2 A;  2Y1N A;  4DUQ A;  2BL0 C;  3B6X A;  1XK4 A;  1WRL A;  3DXL A;  3I5G C;  1VRK A;  5HKW A;  1ALW A;  5EL2 A;  1NCZ A;  1JFK A;  3DD4 A;  3S0A A;  1S6C A;  1DTL A;  3F45 A;  3D75 A;  1K9K A;  2JT8 A;  2LHL A;  3O4X A;  2SCP A;  1K95 A;  2KAY A;  1KQM C;  2P70 A;  5CSJ A;  4GBA A;  4F7F A;  1N0Y A;  2WCL A;  3BYA A;  3JVT B;  1NX3 A;  2MRD A;  4PE1 A;  1SL9 A;  1YUR A;  3LCP C;  1PVB A;  2K0J A;  4PHK A;  2LM5 A;  1S5G Z;  1NIW A;  1QX5 B;  2YGU A;  3FIA A;  2RGI A;  1Z2C B;  2F8P A;  5K89 A;  4ZCV A;  1KFX S;  1NWD A;  4INW A;  1C3Z A;  5CSN A;  5FI6 A;  3CZ2 A;  3FWB A;  1JUO A;  5PAL A;  4P5O E;  1XFV O;  1X02 A;  1RFJ A;  1XFX O;  2KFG A;  3FE8 A;  3CLN A;  1DQE A;  1PAL A;  1S26 D;  2K7D A;  1ZFS A;  2KI6 D;  3CGA A;  3VRP A;  1RRO A;  3A4U B;  3CZ1 A;  2P71 A;  4CPV A;  3VRN A;  2WCF A;  3R1O A;  1T14 A;  4XYN A;  1Y1U A;  2JNF A;  2LMT A;  3NHI A;  3EKJ A;  1S6I A;  1CDM A;  2KI6 C;  3FE6 A;  2PMY A;  2BBN A;  2FJU B;  4FTG A;  1IWQ A;  3CAB A;  4R1E A;  4GGF A;  2JXL A;  1JC2 A;  2HQ8 A;  1WRZ A;  1GM0 A;  1EL4 A;  3R1P A;  3NSO A;  2L51 A;  4YRU A;  4AOM A;  1CMF A;  1TIZ A;  3DVJ A;  1B8L A;  5DKR A;  3ICB A;  1EG3 A;  2L5Y A;  3PJI A;  2D8N A;  2L2E A;  3VRR A;  2K7C A;  5I2Q A;  2M97 A;  3FWC A;  2HPS A;  4HRE E;  3S0E A;  1OOH A;  1OW4 A;  2K61 A;  2K60 A;  4N1G A;  4GFT A;  3D77 A;  4MBE A;  4OKH A;  1K96 A;  1QLK A;  2JT0 A;  2LHI A;  5D7F A;  2K2A A;  2M7L A;  1M46 A;  1CLL A;  1MF8 B;  3NSL A;  4Q04 A;  3EVR A;  3AAJ A;  1CNP A;  3BUN B;  4I5L B;  1BOC A;  1WLZ A;  1AVS A;  3GK4 X;  3SG4 A;  4IL1 A;  1S36 A;  1F4O A;  1ALV A;  1IRJ A;  2ZN8 A;  1N2D A;  1B7T Z;  1QVI Y;  2ERB A;  2M1U A;  3D0Y A;  3SIA A;  3CS1 A;  1CTR A;  3DYE A;  1SYM A;  2LLU A;  2CBL A;  3SS5 A;  3PM2 A;  3KPX A;  4C0J A;  1CM1 A;  1XK4 C;  1ZAC A;  1YRT B;  3A8R A;  4MN0 A;  1EH2 A;  4TNC A;  2JNX A;  1Y6W A;  1DJY A;  3BOW A;  2AUC A;  3L4L A;  1KK8 C;  2EHB A;  3I5F C;  4GPL B;  1SNL A;  1JWD A;  2K7O A;  3BXK A;  1U5I A;  1ZOT B;  3OB1 B;  3BQ3 A;  4PAL A;  1K9U A;  2AMI A;  2BAP A;  1MQ1 A;  2M7N A;  2O60 A;  1NCY A;  2H61 A;  2ZKM X;  2JUL A;  4NDC A;  1J7Q A;  1YR5 A;  2GTE A;  3ZNI A;  1IH0 A;  5B8I B;  3O4Y A;  5I8N A;  5I2L A;  4QJ5 B;  2V53 A;  3OP0 A;  1CDN A;  1J1D A;  1UHI A;  2OTG B;  3I5I C;  3I5G B;  5AAN A;  1IIO A;  1F4Q A;  2LLS A;  4YGD B;  3OGN A;  1GJY A;  1MR8 A;  3UNW A;  2WOS A;  3SG7 A;  1QXP A;  1RK9 A;  2BKH B;  1KFU S;  4XJK B;  1KCY A;  1PK0 D;  1BG1 A;  1YTZ C;  2L98 A;  4M2Q A;  2LVV A;  3GOF A;  3KEV A;  2JXC A;  1FPW A;  1K93 D;  2M1K B;  2WCB A;  1PVA A;  1UHH A;  2KGB C;  1OMR A;  2ZFD A;  4DIR A;  3SG6 A;  1BT6 A;  1W9Z A;  3IVT A;  1B4C A;  3TDI A;  1DC1 A;  1SCM B;  3RLZ A;  4PE0 A;  2FCE A;  1V1G A;  2KHN A;  2I94 A;  5G08 A;  1D1O A;  1IKU A;  2BCB A;  2EGD A;  2CCM A;  3O78 A;  4WQ3 A;  2WOR A;  3CR4 X;  4GGF C;  1M31 A;  1PSR A;  4L9M A;  3B88 A;  4E68 A;  3BUM B;  3VRO A;  3D10 A;  3O6B A;  4MZJ A;  2LE9 B;  1K94 A;  1YX7 A;  3CYZ A;  3OBV A;  4AQI A;  2JPO A;  3UO9 A;  2NLN A;  3SIB A;  2WC8 A;  3DVK A;  2L4H A;  4NDD A;  4P2Y B;  2ZN9 A;  1JFJ A;  1R2U A;  3PLF B;  4M2O A;  2QEH A;  1WDC C;  1QV0 A;  1SY9 A;  2GGM A;  1C7V A;  2WCK A;  1KWO B;  1NX0 A;  1EXR A;  3R1V A;  1RJV A;  4NDB A;  1LVC D;  1MWN A;  1KSO A;  3CDN A;  2LAP A;  3TUY B;  3DVE A;  1C3Y A;  1CMG A;  1W7I B;  1LKJ A;  1IJ6 A;  1H4B A;  2KLD A;  1E8A A;  2QEV A;  1EG4 A;  3I5H B;  3QME A;  1L2O C;  3S0D A;  5IBW A;  1GQM A;  2KLE A;  3CZT X;  1SR6 C;  2FJY A;  1B9A A;  2KPH A;  1B47 A;  4YBH B;  3PN7 C;  1UHK A;  4DCK A;  1YVH A;  1TRF A;  3VRQ A;  5TNC A;  5HL1 A;  1NUB A;  4FQO A;  3PAL A;  1CB1 A;  1REC A;  1CFD A;  1QAT A;  4PE4 A;  4WQ2 A;  5HKY A;  2G9B A;  1SMG A;  2ZRT A;  1JBA A;  4JQ0 D;  4MZK A;  1TN4 A;  1J7O A;  1J1E A;  3LLE A;  1WLM A;  1TNX A;  2H61 C;  1SPY A;  1F8H A;  1BF5 A;  2L0P A;  2MLE C;  2QEO A;  1XFZ O;  3JTD C;  4CLN A;  2KQ6 A;  3TS5 C;  2JOJ A;  4YI8 A;  4F0Z B;  5I94 A;  1QAS A;  2BNX A;  2SAS A;  3FE9 A;  1OZO A;  3LK1 A;  3L47 A;  1KFU L;  1TCO B;  2EC6 B;  3CR5 X;  5KSZ A;  5HKZ A;  1DF0 B;  1M63 B;  1ODB A;  5DKQ A;  3WHT B;  3GK1 A;  2KAX A;  4HRG A;  1DJH A;  1SK6 D;  2P6B B;  4MEW A;  3D78 A;  1FW4 A;  1NX2 A;  2E30 A;  1K9P A;  4A4B A;  2COL B;  5AER A;  1MXL C;  2KI4 B;  1L7Z A;  3AKB A;  4ETO A;  4ORA B;  2ISD A;  2BBM A;  3IQO A;  1SL7 A;  2JTT A;  2KBM A;  2OS8 B;  2JU0 A;  5I2O A;  3EK4 A;  3NHT A;  1KK7 Y;  4MZL A;  3DF0 B;  1IQ3 A;  2LP2 A;  1DT7 B;  5D69 A;  1LA0 A;  1Y1A A;  2Y5I A;  4NQG A;  3MSE B;  5CSF A;  3PSR A;  3EK7 A;  3JVT C;  1JF2 A;  3K21 A;  2KSP A;  3EK8 A;  3BFH A;  1OSA A;  1A29 A;  2LMU A;  2NCO A;  4OVN F;  1XYD A;  1RTP 1;  1SSE B;  1SW8 A;  2LVJ A;  2M0R A;  1BOD A;  1FI5 A;  4N5X A;  4XJK A;  1UP5 A;  4QJ4 B;  1Y0V H;  2KQY A;  3E3R A;  2BE6 A;  1S1E A;  1A75 B;  3EVU A;  5FYX A;  3RZS A;  3BFA A;  2WC5 A;  4MRY A;  2BCA A;  4A4C A;  3B7A A;  1AK8 A;  2L5X B;  3KF9 A;  4OCI A;  4C0K A;  1UHJ A;  4ORC B;  1TTX A;  1XFY O;  2BL0 B;  2CT9 A;  3TDZ A;  1QVI Z;  3BUX B;  2PSR A;  5AFP A;  4USL A;  4MVF A;  1UWO A;  1YUS A;  1DGV A;  2I2R E;  4D1E A;  3D76 A;  2IS9 A;  5DIC A;  2LNK A;  1A2X A;  1B8R A;  1YRU B;  1OQP A;  2KYF A;  3CTN A;  4I5N B;  1KQM B;  4PCW A;  4CID A;  2LC5 A;  1LXF C;  1F54 A;  1CLM A;  2Q91 A;  3IQQ A;  1DGU A;  1OE9 B;  5CSI A;  3K1E A;  1MXE A;  1BLQ A;  1YVL A;  2LVK A;  3N7H A;  3HX4 A;  4N1F A;  1CFP A;  2JPT A;  1BR4 B;  1OMD A;  1S6J A;  5GQQ C;  2F3Y A;  1TNW A;  3KO0 A;  1J7R A;  4MLW A;  1SBJ A;  5AEQ A;  1QWV A;  4YGE B;  2JT3 A;  2BKI B;  2PAL A;  1LIN A;  2QPT A;  5ER4 X;  3EKH A;  1C07 A;  4PE7 A;  2CTN A;  1S3P A;  3OX6 A;  3LL8 B;  3EG5 B;  5F6T A;  1LA3 A;  1HT9 A;  1XFW O;  4HSZ A;  5J3X A;  5HLO A;  1J55 A;  3S0B A;  1KSM A;  1CDP A;  1CFF A;  5HYD A;  5KTY A;  2I7A A;  4ZCU A;  3BUW B;  4BY5 A;  1FF1 A;  4GGN A;  1AHR A;  2Y1M A;  3TZ1 A;  1QTX A;  3DY9 A;  1MUX A;  1QJT A;  3NGV A;  1OOF A;  1QX7 A;  1S5G Y;  2BE4 A;  5AXI A;  2CXJ A;  2M49 B;  5DKN A;  1TWO A;  2OTG C;  5JJG A;  1UUR A;  1DJZ A;  1XO5 A;  1SRA A;  1DF0 A;  2K2F A;  3B86 A;  4WRI A;  2HF5 A;  1ORG A;  1J7P A;  1OOI X;  1P28 A;  1DJW A;  1QLS A;  1Z4H A;  1IJ5 A;  4ORB B;  4YGC B;  2F2O A;  2JZI A;  3AAK A;  1JSA A;  2PVB A;  1M45 A;  1A4P A;  2PRU A;  2M9G A;  1K2H A;  1ZMZ A;  5ER5 A;  3SG2 A;  3CR2 A;  1YUT A;  1WRK A;  2K7B A;  4FQT A;  4ICB A;  3BFB A;  2MA2 A;  2DOQ A;  2LAN A;  1DEK A;  1SCM C;  1MHO A;  1ZUZ A;  1TOP A;  2PQL A;  3DF0 A;  1NP8 A;  2KGR A;  3WHU B;  3BJH A;  1M39 A;  2L4I A;  2ZNE A;  2ZND A;  3PFV A;  2WCE A;  3QRX A;  4OV2 A;  4PDZ A;  5JOL A;  3Q8I A;  4UPG A;  1AJ5 A;  2GV5 A;  4QJ3 B;  2KOT A;  1JF0 A;  1G4Y R;  1KK8 B;  1DJI A;  1R6P A;  3I5F B;  1H8B A;  4YI9 A;  4OR9 B;  1AP4 A;  1CLB A;  1YUU A;  2BEC A;  1HQV A;  1NX1 A;  1XA5 A;  4I5K A;  2OPO A;  2L50 A;  1BU3 A;  1CFC A;  2L2C A;  4IJ7 A;  2F2P A;  3SS3 A;  4GAO A;  1NSH A;  1KWO C;  4C0L A;  2HQW A;  2FOT A;  2JRF A;  3TUY C;  1A75 A;  2WC6 A;  4DS7 A;  4YGA A;  1B8C A;  3I5I B;  2ZRS A;  2F3Z A;  1B7T Y;  2HET A;  5FI2 A;  3I5H C;  2KYC A;  1K90 D;  1WY9 A;  1FI6 A;  4JKT A;  1NCX A;  1PUL A;  2CNP A;  1W7J B;  3M0W A;  5D3O A;  1EJ3 A;  1Q80 A;  2TN4 A;  2JC2 A;  2LMV A;  1Y1X A;  4JPZ B;  5KU1 A;  3D73 A;  2H8V A;  3PM8 A;  3B87 A;  2LUX A;  1PSB A;  4U8D A;  4BY4 A;  1PRW A;  4MRX A;  1C7W A;  1G8I A;  3C1V A;  2G2B A;  2KFH A;  2QAC A;  1OOG A;  3BUO B;  2M29 A;  2M3W A;  5BPJ A;  1DJX A;  2Q4U A;  1IG5 A;  2BCX A;  2PYQ A;  4JD9 A;  1SL8 A;  1KQV A;  1IQ5 A;  1FBV A;  4JWQ A;  2R2I A;  4M2P A;  2WCJ A;  1QIV A;  1F55 A;  1KK7 Z;  1N65 A;  3R72 A;  3S0G A;  4CFR A;  3IF7 A;  4PHN A;  1CKK A;  2LCP A;  4DRW A;  2KDH A;  3WXA A;  2M8U A;  4I5J A;  3FS7 A;  1OZS A;  5CPV A;  2NZ0 A;  1SCV A;  3CZ0 A;  5FI7 A;  1TUJ A;  4PHJ A;  1AJ4 A;  4HRH A;  1YX8 A;  2EC6 C;  3WNX B;  1CM4 A;  3OX5 A;  1TCF A;  3NSK A;  4KYN A;  2KBI A;  1B1G A;  1F71 A;  1XFU O;  2AAO A;  1UUS A;  1WDC B;  3AKA A;  3KHE A;  2NCP A;  2MLF C;  2LVI A;  1QIW A;  3LK0 A;  3H4S E;  1GGW A;  2F33 A;  2KI4 C;  2NXQ A;  2KFF A;  1XFR A;  4GNK B;  4OZD A;  1IGV A;  4GUK A;  2FCD A;  4PHM A;  1L2O B;  2OS8 C;  2LUC A;  2JTZ A;  1DMO A;  3DZT A;  3O2P A;  3OB2 B;  1OMV A;  1RWY A;  3NSI A;  2QEB A;  3D0Y B;  1DEL A;  1V1F A;  3SJS A;  1SR6 B;  1GGZ A;  1NPQ A;  1QS7 A;  2KAV A;  4PT1 A;  3SG5 A;  1NYA A;  4YGB B;  2QDI A;  1TUZ A;  3PN7 B;  3PAT A;  2WCM A;  1KFX L; 
#chains in the Genus database with same CATH homology
 1BMO A;  1QV1 A;  2I18 A;  3CWG A;  3DVM A;  3EVV A;  2VRG A;  2O5G A;  3BOW B;  2K8M B;  5HLV A;  2LP3 A;  2B1U A;  3HCM A;  1OOJ A;  3OHM B;  1TNP A;  3VGO A;  1U5I B;  1TNQ A;  3NXA A;  2PAS A;  2MHH A;  2A4J A;  2MBX A;  1DVI A;  1G33 A;  2LV7 A;  4MSP A;  1SKT A;  2Y4Q A;  2MJW B;  2LLT A;  3JTD B;  3RM1 A;  1UHN A;  4AQJ A;  4CFQ A;  2JWW A;  3TS5 B;  2WND A;  3SG3 A;  1XVJ A;  1AUI B;  1K8U A;  2MAZ A;  3ZWH A;  2KNE A;  2JQ6 A;  2H2K A;  3GK2 A;  1BJF A;  1BR1 B;  2GGZ A;  3TDU A;  1A03 A;  2E6W A;  1DJG A;  1CDL A;  1QX2 A;  2Y1N A;  4DUQ A;  2BL0 C;  1XK4 A;  1WRL A;  3I5G C;  1VRK A;  5HKW A;  1ALW A;  1NCZ A;  1JFK A;  3DD4 A;  1S6C A;  1DTL A;  3F45 A;  1K9K A;  2JT8 A;  2LHL A;  2SCP A;  1K95 A;  2KAY A;  1KQM C;  5CSJ A;  4GBA A;  1N0Y A;  3BYA A;  3JVT B;  1NX3 A;  2MRD A;  4PE1 A;  1SL9 A;  1YUR A;  3LCP C;  1PVB A;  2K0J A;  4PHK A;  2LM5 A;  1S5G Z;  1NIW A;  1QX5 B;  3FIA A;  2RGI A;  2F8P A;  5K89 A;  4ZCV A;  1KFX S;  1NWD A;  5PAL A;  5CSN A;  1BG1 A;  3FWB A;  1JUO A;  4P5O E;  1XFV O;  1X02 A;  1RFJ A;  1XFX O;  2KFG A;  3CLN A;  1PAL A;  1S26 D;  2K7D A;  1ZFS A;  2KI6 D;  3CGA A;  3VRP A;  1RRO A;  3A4U B;  4CPV A;  3VRN A;  2WCF A;  4XYN A;  1Y1U A;  2JNF A;  2LMT A;  3EKJ A;  1S6I A;  1CDM A;  2KI6 C;  2PMY A;  2BBN A;  2FJU B;  4FTG A;  1IWQ A;  4R1E A;  4GGF A;  2JXL A;  1JC2 A;  2HQ8 A;  1WRZ A;  1EL4 A;  3NSO A;  2L51 A;  4YRU A;  4AOM A;  1CMF A;  1TIZ A;  3DVJ A;  1B8L A;  3ICB A;  1EG3 A;  2D8N A;  2L2E A;  3VRR A;  2K7C A;  5I2Q A;  2M97 A;  3FWC A;  2HPS A;  4HRE E;  2K61 A;  4N1G A;  4GFT A;  4MBE A;  4OKH A;  1K96 A;  1QLK A;  2JT0 A;  2LHI A;  5D7F A;  2K2A A;  2M7L A;  1M46 A;  1CLL A;  1MF8 B;  3NSL A;  4Q04 A;  3EVR A;  3AAJ A;  1CNP A;  3BUN B;  4I5L B;  1BOC A;  1WLZ A;  1AVS A;  3GK4 X;  3SG4 A;  4IL1 A;  1S36 A;  1F4O A;  1ALV A;  1IRJ A;  2ZN8 A;  1N2D A;  1B7T Z;  1QVI Y;  3D0Y A;  2M1U A;  3SIA A;  3WNX B;  3CS1 A;  1CTR A;  1SYM A;  2LLU A;  2CBL A;  3KPX A;  4C0J A;  1CM1 A;  1XK4 C;  1ZAC A;  1YRT B;  3A8R A;  4MN0 A;  1EH2 A;  4TNC A;  2JNX A;  1Y6W A;  1DJY A;  3BOW A;  2AUC A;  1KK8 C;  2EHB A;  3I5F C;  4GPL B;  1SNL A;  1JWD A;  2K7O A;  3BXK A;  1U5I A;  1ZOT B;  3OB1 B;  3BQ3 A;  4PAL A;  1K9U A;  2AMI A;  1MQ1 A;  2M7N A;  2O60 A;  1NCY A;  2H61 A;  2ZKM X;  2JUL A;  4NDC A;  1J7Q A;  1YR5 A;  3ZNI A;  5B8I B;  3O4Y A;  5I8N A;  5I2L A;  4QJ5 B;  2V53 A;  3OP0 A;  1CDN A;  1J1D A;  1UHI A;  2OTG B;  3I5I C;  3I5G B;  5AAN A;  1F4Q A;  2LLS A;  4YGD B;  1GJY A;  1MR8 A;  2WOS A;  3SG7 A;  1QXP A;  1RK9 A;  2BKH B;  1KFU S;  4XJK B;  1KCY A;  1PK0 D;  1YTZ C;  2L98 A;  4M2Q A;  2LVV A;  3GOF A;  3KEV A;  2JXC A;  1FPW A;  1K93 D;  2M1K B;  2WCB A;  1PVA A;  1UHH A;  2KGB C;  1OMR A;  2ZFD A;  4DIR A;  3SG6 A;  1BT6 A;  1B4C A;  3TDI A;  1SCM B;  3RLZ A;  4PE0 A;  2FCE A;  1V1G A;  2KHN A;  2I94 A;  5G08 A;  1D1O A;  1IKU A;  2BCB A;  2EGD A;  2CCM A;  3O78 A;  4WQ3 A;  2WOR A;  3CR4 X;  4GGF C;  1M31 A;  1PSR A;  4L9M A;  4E68 A;  3BUM B;  3VRO A;  3D10 A;  3O6B A;  4MZJ A;  2LE9 B;  1K94 A;  1YX7 A;  4AQI A;  2NLN A;  3SIB A;  2WC8 A;  3DVK A;  2L4H A;  4NDD A;  4P2Y B;  2ZN9 A;  1JFJ A;  1R2U A;  3PLF B;  4M2O A;  1WDC C;  1QV0 A;  1SY9 A;  2GGM A;  1C7V A;  1KWO B;  1NX0 A;  1EXR A;  4NDB A;  1RJV A;  1LVC D;  1MWN A;  1KSO A;  2LAP A;  3TUY B;  3DVE A;  1CMG A;  1W7I B;  1LKJ A;  1IJ6 A;  1H4B A;  1E8A A;  1EG4 A;  3I5H B;  1L2O C;  5IBW A;  1GQM A;  3CZT X;  1SR6 C;  1B9A A;  1B47 A;  3PN7 C;  1UHK A;  4DCK A;  1YVH A;  1TRF A;  3VRQ A;  5TNC A;  1NUB A;  4FQO A;  3PAL A;  1CB1 A;  1REC A;  1CFD A;  1QAT A;  4PE4 A;  4WQ2 A;  5HKY A;  2G9B A;  1SMG A;  2ZRT A;  1JBA A;  4JQ0 D;  4MZK A;  1TN4 A;  1J7O A;  1J1E A;  3LLE A;  1WLM A;  1TNX A;  2H61 C;  1SPY A;  1F8H A;  1BF5 A;  2L0P A;  2MLE C;  3JTD C;  1XFZ O;  4CLN A;  2KQ6 A;  3TS5 C;  2JOJ A;  4YI8 A;  4F0Z B;  1QAS A;  2SAS A;  1OZO A;  3LK1 A;  1KFU L;  1TCO B;  2EC6 B;  3CR5 X;  5KSZ A;  5HKZ A;  1DF0 B;  1M63 B;  1ODB A;  5DKQ A;  3WHT B;  3GK1 A;  2KAX A;  4HRG A;  1DJH A;  1SK6 D;  2P6B B;  4MEW A;  1FW4 A;  1NX2 A;  2E30 A;  1K9P A;  4A4B A;  2COL B;  5AER A;  1MXL C;  2KI4 B;  1L7Z A;  3AKB A;  4ETO A;  4ORA B;  2ISD A;  2BBM A;  3IQO A;  1SL7 A;  2JTT A;  2KBM A;  2OS8 B;  2JU0 A;  5I2O A;  3EK4 A;  1KK7 Y;  4MZL A;  3DF0 B;  1IQ3 A;  2LP2 A;  1DT7 B;  5D69 A;  1LA0 A;  1Y1A A;  2Y5I A;  4NQG A;  3MSE B;  5CSF A;  3PSR A;  3EK7 A;  3JVT C;  1JF2 A;  3K21 A;  2KSP A;  3EK8 A;  1OSA A;  1A29 A;  2LMU A;  2NCO A;  4OVN F;  1XYD A;  1RTP 1;  1SW8 A;  2M0R A;  2LVJ A;  1FI5 A;  1BOD A;  4N5X A;  4XJK A;  1UP5 A;  4QJ4 B;  1Y0V H;  2KQY A;  3E3R A;  2BE6 A;  1S1E A;  1A75 B;  3EVU A;  5FYX A;  4MRY A;  2BCA A;  4A4C A;  1AK8 A;  2L5X B;  3KF9 A;  4OCI A;  4C0K A;  1UHJ A;  4ORC B;  1TTX A;  1XFY O;  2BL0 B;  2CT9 A;  3TDZ A;  1QVI Z;  3BUX B;  2PSR A;  5AFP A;  4USL A;  4MVF A;  1UWO A;  1YUS A;  1DGV A;  2I2R E;  4D1E A;  2IS9 A;  2LNK A;  1A2X A;  1B8R A;  1YRU B;  1OQP A;  2KYF A;  3CTN A;  4I5N B;  1KQM B;  4PCW A;  4CID A;  2LC5 A;  1LXF C;  1F54 A;  1CLM A;  2Q91 A;  3IQQ A;  1DGU A;  1OE9 B;  5CSI A;  1MXE A;  1BLQ A;  1YVL A;  2LVK A;  1CFP A;  3HX4 A;  4N1F A;  2JPT A;  1BR4 B;  1OMD A;  1S6J A;  5GQQ C;  2F3Y A;  1TNW A;  3KO0 A;  1J7R A;  4MLW A;  1SBJ A;  5AEQ A;  4YGE B;  2JT3 A;  2BKI B;  2PAL A;  1LIN A;  2QPT A;  5ER4 X;  3EKH A;  1C07 A;  4PE7 A;  2CTN A;  1S3P A;  3OX6 A;  3LL8 B;  5F6T A;  1LA3 A;  1HT9 A;  1XFW O;  4HSZ A;  5J3X A;  5HLO A;  1J55 A;  1KSM A;  1CDP A;  1CFF A;  5HYD A;  5KTY A;  2I7A A;  4ZCU A;  3BUW B;  4BY5 A;  1FF1 A;  4GGN A;  1AHR A;  2Y1M A;  3TZ1 A;  1QTX A;  1MUX A;  1QJT A;  1QX7 A;  1S5G Y;  2BE4 A;  5AXI A;  2CXJ A;  2M49 B;  5DKN A;  2OTG C;  1IH0 A;  5JJG A;  1UUR A;  1DJZ A;  1XO5 A;  1SRA A;  1DF0 A;  2K2F A;  4WRI A;  2HF5 A;  1J7P A;  1DJW A;  1QLS A;  1IJ5 A;  4ORB B;  4YGC B;  2F2O A;  2JZI A;  3AAK A;  1JSA A;  2PVB A;  1M45 A;  1A4P A;  2PRU A;  2M9G A;  1K2H A;  1ZMZ A;  5ER5 A;  3SG2 A;  3CR2 A;  1YUT A;  1WRK A;  2K7B A;  4ICB A;  2MA2 A;  2DOQ A;  2LAN A;  1SCM C;  1MHO A;  1ZUZ A;  1TOP A;  3DF0 A;  3WHU B;  1NP8 A;  2KGR A;  3PFV A;  1M39 A;  2L4I A;  2ZNE A;  2ZND A;  4PDZ A;  2WCE A;  3QRX A;  4OV2 A;  4YBH B;  5JOL A;  4UPG A;  1AJ5 A;  2GV5 A;  4QJ3 B;  2KOT A;  1JF0 A;  1G4Y R;  1KK8 B;  1DJI A;  1R6P A;  3I5F B;  1H8B A;  4YI9 A;  4OR9 B;  1AP4 A;  1CLB A;  1YUU A;  2BEC A;  1HQV A;  1NX1 A;  1XA5 A;  4I5K A;  2OPO A;  2L50 A;  1BU3 A;  1CFC A;  2F2P A;  4GAO A;  1NSH A;  1KWO C;  4C0L A;  2HQW A;  2FOT A;  2JRF A;  3TUY C;  1A75 A;  4DS7 A;  4YGA A;  1B8C A;  3I5I B;  2ZRS A;  2F3Z A;  1B7T Y;  2HET A;  3I5H C;  2KYC A;  1K90 D;  1WY9 A;  1FI6 A;  1NCX A;  1PUL A;  2CNP A;  1W7J B;  3M0W A;  1EJ3 A;  1Q80 A;  2TN4 A;  2JC2 A;  2LMV A;  1Y1X A;  4JPZ B;  5KU1 A;  3PM8 A;  2LUX A;  1PSB A;  4U8D A;  4BY4 A;  1PRW A;  4MRX A;  1C7W A;  1G8I A;  3C1V A;  2G2B A;  2KFH A;  2QAC A;  3BUO B;  2M29 A;  2M3W A;  5BPJ A;  1DJX A;  2Q4U A;  1IG5 A;  2BCX A;  1SL8 A;  1KQV A;  1IQ5 A;  1FBV A;  4JWQ A;  2R2I A;  4M2P A;  1F55 A;  1QIV A;  1KK7 Z;  1N65 A;  4CFR A;  3IF7 A;  4PHN A;  1CKK A;  2LCP A;  4DRW A;  2KDH A;  3WXA A;  2M8U A;  4I5J A;  3FS7 A;  1OZS A;  5CPV A;  2NZ0 A;  1SCV A;  4PHJ A;  1AJ4 A;  4HRH A;  1YX8 A;  2EC6 C;  1CM4 A;  3OX5 A;  1TCF A;  3NSK A;  1B1G A;  2KBI A;  1F71 A;  1XFU O;  2AAO A;  1UUS A;  1WDC B;  3AKA A;  3KHE A;  2NCP A;  2MLF C;  2LVI A;  1QIW A;  3LK0 A;  3H4S E;  1GGW A;  2F33 A;  2KI4 C;  2NXQ A;  2KFF A;  4GNK B;  1IGV A;  4GUK A;  2FCD A;  4PHM A;  1L2O B;  2OS8 C;  2LUC A;  2JTZ A;  1DMO A;  3O2P A;  5DKR A;  3OB2 B;  1OMV A;  1RWY A;  3NSI A;  3SJS A;  3D0Y B;  1F70 A;  1V1F A;  1SR6 B;  1GGZ A;  1NPQ A;  1QS7 A;  2KAV A;  3SG5 A;  1NYA A;  4YGB B;  3PN7 B;  3PAT A;  1KFX L; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...