2H2KA

Crystal structure analysis of human s100a13
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
93
structure length
93
Chain Sequence
SLMAAEPLTELEESIETVVTTFFTFARQEGRKDSLSVNEFKELVTQQLPHLLKDVGSLDEKMKSLDVNQDSELKFNEYWRLIGELAKEIRKKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure study on human S100A13 at 2.0 A resolution
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal binding protein
molecule keywords Protein S100-A13
total genus 36
structure length 93
sequence length 93
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2h2kA00
1IJ5A 1KK7Y 3NSKA 3M0WA 1S6CA 1Y1XA 1A03A 1CM4A 3PM8A 3BUXB 1V1FA 5JOLA 1IWQA 1JF0A 1OMVA 2EHBA 2K8MB 5AERA 1M39A 3GK2A 3O78A 1J7RA 1Q80A 3QRXA 3CGAA 1SCMC 4PALA 1WLMA 1B7TY 1OZOA 1EG4A 2LE9B 2M7NA 3BYAA 3FIAA 3GK4X 1MWNA 5IBWA 4CFQA 2LUXA 2D8NA 2KGBC 2TN4A 5DKQA 1TNXA 3IQQA 4NDCA 1KK8B 1K9KA 2K61A 1QX5B 2CXJA 1K2HA 4MZKA 3TUYC 1ZACA 1B8LA 1MF8B 1QXPA 1XO5A 4M2QA 1J1DA 4AQJA 3BUNB 1TTXA 1C07A 1CNPA 1PULA 3LK0A 5G08A 2K2FA 1DVIA 4GGFC 2JXLA 4N1FA 3DD4A 2M9GA 2BECA 1PSBA 4PE1A 2HETA 2BBNA 4CFRA 1DJWA 2H61A 3SG2A 4OV2A 4DS7A 5JJGA 1KWOB 1KK7Z 1VRKA 1LKJA 2KI4B 1YUTA 1E8AA 1K96A 2CNPA 1TNPA 1XVJA 2F2PA 3DVKA 2MLFC 1DTLA 2L0PA 2KI4C 2NLNA 1CFDA 1SYMA 2F3YA 5HLVA 2Q91A 2LVIA 4OKHA 4WQ3A 1FF1A 3D10A 1ALVA 1A2XA 2LHIA 1BJFA 3EKJA 4FQOA 4YI8A 5HKYA 1Y1UA 1SMGA 1K8UA 1DMOA 1UHHA 4GUKA 4NDBA 3O4YA 3BUOB 4QJ5B 4Q04A 1NX1A 4HRHA 1M63B 1MUXA 2L4HA 1ZOTB 1YX7A 4MVFA 4USLA 4A4BA 2KDHA 1CDNA 1JWDA 1XFYO 1Y6WA 2PVBA 1QX7A 5KTYA 5CSJA 1QX2A 2M97A 3SG4A 3HX4A 2LLUA 4MRXA 3SG5A 1QIWA 1SL7A 2F8PA 4M2OA 1MHOA 2H2KA 4MRYA 2NXQA 3OHMB 4U8DA 2Y1NA 3CR5X 3JTDB 3KEVA 2EC6B 1DJIA 2PALA 1DJGA 1NX0A 2SASA 1Y0VH 4PHNA 1NPQA 1PALA 2L51A 2NZ0A 1XFZO 1CTRA 3OP0A 3EK8A 1YR5A 3KHEA 2KBIA 2I18A 3PN7B 2F2OA 4XJKB 1CLBA 1M46A 1Y1AA 3NSOA 1IRJA 2WNDA 4UPGA 2MA2A 1CKKA 1CB1A 1DF0B 2HQ8A 2R2IA 4WQ2A 3PLFB 1J55A 1DJHA 1W7JB 1F8HA 4OVNF 3I5HC 1IG5A 1WLZA 2KSPA 4YGDB 1OMDA 1QASA 1J1EA 4GGFA 4MZLA 2G2BA 3EVVA 2JRFA 3I5HB 1TN4A 4I5KA 4ORBB 1QJTA 1F55A 1NX2A 3KPXA 2KFHA 1ODBA 1QATA 1SY9A 1K94A 2KOTA 5HKWA 2VRGA 1SL9A 3TS5B 1V1GA 1XFUO 5DKRA 1QS7A 1NUBA 1S5GZ 4PHMA 2LANA 5DKNA 2SCPA 3ZNIA 2G9BA 3ZWHA 2JULA 4CLNA 1L2OB 3C1VA 2BL0C 4DIRA 1JC2A 2WOSA 1IGVA 2MBXA 3SJSA 1RTP1 1RJVA 2K7BA 1BR1B 1OQPA 4QJ3B 2OPOA 1B47A 1S3PA 4JQ0D 4MZJA 3EK4A 1NX3A 1EJ3A 1EXRA 5CSFA 2V53A 3VGOA 1NCXA 4GAOA 2L98A 4AQIA 1BF5A 2Y4QA 3NSLA 2CT9A 1F71A 3WHTB 1AUIB 2L2EA 1S36A 2GGMA 2LV7A 3BQ3A 1DF0A 2RGIA 1YVHA 2I2RE 1KWOC 2JU0A 3GK1A 2KGRA 5HKZA 1F4QA 1B7TZ 1A4PA 4QJ4B 1CMGA 4ZCVA 1BMOA 4M2PA 2M7LA 2JQ6A 3CS1A 1SRAA 1K93D 1XA5A 2QACA 1KFXS 3BOWB 1GGWA 1MXLC 1HT9A 4I5NB 5K89A 2BE4A 3SIBA 4XYNA 3VRRA 2OTGB 3EVUA 1LA0A 1OSAA 1U5IA 2ZKMX 1KFXL 4NDDA 2EC6C 4XJKA 1JSAA 2BCXA 4YGBB 5PALA 3BUWB 3CWGA 1A75B 1AJ4A 2JTZA 1X02A 1SPYA 1W7IB 3FS7A 4N1GA 2MLEC 3PFVA 1KSOA 1YUUA 3PN7C 2KYCA 2PMYA 4JWQA 1J7QA 2JNFA 1QVIZ 3TDUA 1N0YA 1YUSA 3LL8B 2L4IA 4CPVA 3FWBA 3CLNA 5BPJA 3TDIA 1HQVA 2JTTA 1YTZC 3JTDC 1DJYA 2HPSA 2JT3A 4YRUA 2MJWB 1KQMB 1DJZA 4CIDA 4C0KA 5CSIA 1B1GA 1SBJA 3I5IB 1LXFC 4WRIA 4YBHB 1CLLA 2WC8A 4ORAB 1BG1A 3DVEA 3NSIA 5B8IB 2BCBA 2I94A 1DJXA 5I2LA 4MEWA 1KQVA 1BLQA 1FBVA 1RK9A 1UWOA 1XFWO 2JNXA 4HSZA 4I5LB 3NXAA 4YGCB 2E6WA 3AKAA 5ER4X 2PSRA 1CDPA 3KO0A 1NCZA 4ETOA 3CZTX 3OX5A 1DGVA 2HQWA 2ZRTA 2M1KB 2K7CA 3DF0B 4YGEB 3WHUB 1S26D 3DVMA 1LVCD 1G33A 1XFVO 4AOMA 1BODA 2M3WA 1B9AA 2WCEA 2OS8C 1H8BA 2Y1MA 1UP5A 5AXIA 1BT6A 1C7VA 2BL0B 5KU1A 2WCFA 4ICBA 3O6BA 3D0YB 4OR9B 1CMFA 1B8RA 1GQMA 1OMRA 4ZCUA 2AUCA 1MR8A 2ZN8A 1TNWA 5TNCA 4ORCB 4C0JA 1BOCA 1KFUL 1EG3A 1K9UA 3BXKA 3I5FC 3BUMB 4HREE 2JWWA 2KAYA 3A8RA 2LM5A 1CLMA 3CR2A 3IQOA 4GGNA 1DGUA 1R2UA 1JUOA 3D0YA 2LMVA 4GNKB 1IQ5A 1R6PA 2KAVA 1UHKA 1NP8A 2WCBA 3BOWA 4N5XA 3VRNA 1TOPA 1QTXA 2AAOA 4DUQA 5HLOA 3RM1A 1CDMA 1QLKA 1QV1A 3OB1B 1FI6A 1WDCC 3ICBA 1XK4A 5D7FA 1ZUZA 1J7PA 1SCVA 1G4YR 1PVAA 2H61C 2JZIA 2LNKA 4GPLB 1A75A 4DRWA 1XK4C 2KI6D 3TUYB 1PRWA 1RFJA 4R1EA 3I5GB 1G8IA 3FWCA 3MSEB 1B8CA 3JVTC 2LMTA 5D69A 2K2AA 3E3RA 2M0RA 3I5GC 3LK1A 1TIZA 2JC2A 2ZNEA 1M31A 2Y5IA 2ZRSA 4IL1A 4MSPA 1F54A 2PRUA 2K0JA 5AANA 1IQ3A 1OZSA 1RWYA 3EKHA 2MRDA 2B1UA 4F0ZB 2K7OA 3SG6A 3KF9A 2BBMA 2O5GA 1LINA 2MHHA 2JT8A 4GFTA 2PASA 1UURA 2ZFDA 2LLTA 2JOJA 3A4UB 1PK0D 2LC5A 2OTGC 2L50A 1NCYA 4E68A 1JBAA 1DT7B 2P6BB 1PVBA 2Q4UA 1YRUB 1L7ZA 2KBMA 1S1EA 5CSNA 4HRGA 3WNXB 2LVVA 1K90D 3K21A 1CDLA 1BU3A 3CR4X 4NQGA 1QV0A 1IH0A 1WRKA 4C0LA 1YRTB 2LAPA 1LA3A 1CFPA 1A29A 3PALA 1L2OC 2BCAA 1SL8A 2F33A 1ALWA 4PCWA 1KCYA 5AEQA 3PATA 1SR6B 1CFFA 5I2OA 2HF5A 1SNLA 4MLWA 2BE6A 2I7AA 1OE9B 2FCEA 4BY4A 1IJ6A 1F4OA 5AFPA 1CFCA 2GGZA 1KSMA 2KFFA 4I5JA 1TRFA 2L5XB 4PDZA 1M45A 2M1UA 3LLEA 4YI9A 2M29A 1JFJA 1SKTA 2DOQA 3O2PA 5HYDA 2KI6C 1AHRA 1NSHA 3PSRA 1AJ5A 4PHKA 5GQQC 2MAZA 2IS9A 2OS8B 2CTNA 3DVJA 1TNQA 1AK8A 1FPWA 5F6TA 1S6JA 1D1OA 2ISDA 1SCMB 1UHJA 1JF2A 2E30A 1JFKA 2F3ZA 2JXCA 4JPZB 1WRLA 2O60A 2FJUB 1S5GY 1YVLA 3CTNA 2ZN9A 1QLSA 1WY9A 2KAXA 2KQ6A 2LUCA 2JPTA 1GGZA 3SIAA 3OX6A 2QPTA 1AP4A 1UHNA 2FOTA 1BR4B 1B4CA 3AAJA 1NYAA 3HCMA 2COLB 1WRZA 3GOFA 1N2DA 2KHNA 4PE0A 3WXAA 3TS5C 1KK8C 1N65A 3SG3A 3VROA 1NWDA 4TNCA 3EK7A 1F70A 3I5FB 1RECA 1IKUA 4P5OE 3RLZA 2CBLA 4PE7A 1WDCB 1ZMZA 4FTGA 1C7WA 2WORA 2LP3A 4BY5A 1NIWA 1EH2A 3H4SE 4L9MA 1FW4A 3EVRA 1S6IA 2LP2A 5I2QA 2A4JA 2M49B 1K9PA 2CCMA 1RROA 2GV5A 4YGAA 1CM1A 2ZNDA 3F45A 3SG7A 1KQMC 2BKHB 3LCPC 1MQ1A 4PHJA 1YX8A 1OOJA 1J7OA 2LVJA 3OB2B 4MBEA 1PSRA 1GJYA 2LHLA 1KFUS 3JVTB 3IF7A 4PE4A 5I8NA 1MXEA 1UUSA 4GBAA 1SW8A 1K95A 5CPVA 1EL4A 1ZFSA 2KYFA 2JT0A 1SR6C 3VRQA 3TDZA 1TCFA 3I5IC 3DF0A 2K7DA 2KNEA 1QIVA 1XFXO 3AAKA 1QVIY 4P2YB 5ER5A 5J3XA 2NCOA 3TZ1A 1SK6D 1AVSA 2AMIA 1TCOB 2KFGA 2LCPA 2LLSA 3VRPA 1FI5A 1YURA 2FCDA 1U5IB 2EGDA 4MN0A 4DCKA 2BKIB 1XYDA 2LMUA 5KSZA 1UHIA 2LVKA 2KQYA 2NCPA 4OCIA 4D1EA 1H4BA 4A4CA 2M8UA 5FYXA 3AKBA
chains in the Genus database with same CATH superfamily
1IJ5A 1KK7Y 3NSKA 3M0WA 3S0FA 1S6CA 1Y1XA 1A03A 1CM4A 3PM8A 1OW4A 3BUXB 1V1FA 5JOLA 3NHIA 1IWQA 3DYEA 1JF0A 1OMVA 2EHBA 3D76A 2K8MB 5AERA 1M39A 3FE6A 3GK2A 3O78A 1J7RA 1Q80A 3QRXA 3CGAA 1SCMC 4PALA 1WLMA 1B7TY 1OZOA 1EG4A 2LE9B 2M7NA 3BYAA 3FIAA 3GK4X 1MWNA 5IBWA 4CFQA 2LUXA 2D8NA 2JPOA 2KGBC 1OOGA 2TN4A 3CABA 3CYZA 5DKQA 1TNXA 3IQQA 4NDCA 1KK8B 1K9KA 2K61A 1TUZA 1QX5B 2CXJA 1K2HA 4MZKA 3TUYC 1ZACA 1B8LA 1MF8B 1QXPA 1XO5A 4M2QA 1J1DA 4AQJA 3BUNB 1TTXA 1C07A 1CNPA 4FQTA 1PULA 3LK0A 5G08A 2K2FA 1DVIA 4GGFC 2JXLA 4N1FA 3S0DA 3DD4A 2M9GA 2BECA 1PSBA 4PE1A 2HETA 2BBNA 4CFRA 1DJWA 2H61A 3SG2A 4OV2A 1T14A 3PM2A 4DS7A 5JJGA 1KWOB 1KK7Z 4IJ7A 1VRKA 1LKJA 2KI4B 1YUTA 1E8AA 1K96A 2CNPA 1TNPA 1XVJA 2F2PA 3DVKA 2WC5A 2MLFC 1DTLA 2L0PA 1GM0A 2KI4C 2NLNA 1CFDA 1SYMA 2F3YA 5FI2A 5HLVA 2Q91A 2LVIA 3CZ2A 4OKHA 4WQ3A 1FF1A 3D10A 1ALVA 1A2XA 2LHIA 3D78A 1BJFA 3EKJA 4FQOA 4YI8A 5HKYA 1Y1UA 3S0GA 1SMGA 1K8UA 1DMOA 1UHHA 4GUKA 4NDBA 3O4YA 3BUOB 4QJ5B 1C3YA 4Q04A 1NX1A 4HRHA 1M63B 1MUXA 2L4HA 1ZOTB 1YX7A 4MVFA 4USLA 4A4BA 2KDHA 1CDNA 1JWDA 1XFYO 1Y6WA 2PVBA 1QX7A 5KTYA 5CSJA 2WCLA 1QX2A 2M97A 3SG4A 3HX4A 2LLUA 4MRXA 3SG5A 1QIWA 1SL7A 2F8PA 4M2OA 1MHOA 2H2KA 4MRYA 2NXQA 3OHMB 4U8DA 2Y1NA 3CR5X 2L5YA 3JTDB 3KEVA 2EC6B 1DJIA 2PALA 1DJGA 1NX0A 2SASA 1Y0VH 4PHNA 1NPQA 1PALA 2L51A 2NZ0A 1XFZO 1CTRA 3OP0A 5HL1A 3EK8A 1YR5A 3KHEA 2KBIA 2I18A 3PN7B 2F2OA 4XJKB 1CLBA 1M46A 1Y1AA 3NSOA 1IRJA 2WNDA 4UPGA 2MA2A 1CKKA 1CB1A 1DF0B 2HQ8A 2R2IA 4WQ2A 3PLFB 1J55A 1DJHA 2KPHA 1W7JB 1F8HA 4OVNF 3I5HC 1IG5A 1C3ZA 1WLZA 2KSPA 4YGDB 1OMDA 1QASA 1J1EA 4GGFA 2BNXA 4MZLA 2G2BA 3EVVA 2JRFA 3I5HB 1TN4A 4I5KA 4ORBB 1QJTA 1F55A 1NX2A 3KPXA 2PQLA 2KFHA 3DXLA 3R1VA 1ODBA 1QATA 1SY9A 1K94A 2KOTA 5FI7A 2VRGA 5HKWA 3B87A 3V2LA 1SL9A 3TS5B 1V1GA 1XFUO 5DKRA 1LS8A 1QS7A 1NUBA 4JKTA 1S5GZ 4PHMA 2LANA 5DKNA 2SCPA 3ZNIA 2G9BA 3ZWHA 2JULA 4CLNA 1L2OB 3C1VA 2BL0C 4DIRA 1JC2A 3S0AA 2WOSA 1IGVA 3NGVA 2MBXA 3SJSA 2P70A 1RTP1 1RJVA 2K7BA 1BR1B 1Z4HA 1OQPA 4QJ3B 2OPOA 1B47A 1S3PA 3PJIA 4JQ0D 3EK4A 4MZJA 1NX3A 1EJ3A 1EXRA 5CSFA 2V53A 3VGOA 1NCXA 1Z2CB 4GAOA 2L98A 4AQIA 1BF5A 2Y4QA 3NSLA 1DQEA 2CT9A 1F71A 3CDNA 3D77A 3WHTB 3S0EA 1AUIB 2L2EA 1S36A 2GGMA 2LV7A 3BQ3A 1DF0A 2RGIA 1IIOA 1YVHA 2I2RE 2WC6A 1KWOC 2JU0A 3GK1A 2KGRA 5HKZA 1F4QA 1B7TZ 1A4PA 1OOHA 4QJ4B 1CMGA 4ZCVA 1BMOA 3B7AA 4M2PA 2M7LA 2JQ6A 3D74A 3CS1A 1SRAA 1K93D 1XA5A 2QACA 4INWA 3L4LA 1KFXS 3BOWB 1OOIX 1ORGA 1MXLC 1GGWA 1HT9A 4I5NB 5K89A 2BE4A 3SIBA 4XYNA 3VRRA 3CZ0A 2OTGB 3EVUA 1LA0A 1OSAA 1U5IA 2ZKMX 3DZTA 1KFXL 4NDDA 2EC6C 4XJKA 1JSAA 2BCXA 4YGBB 5PALA 3BFBA 1OOFA 3BUWB 3CWGA 1A75B 1AJ4A 2JTZA 1X02A 1SPYA 1W7IB 3FS7A 4N1GA 2WCJA 2MLEC 5FI6A 3PFVA 1KSOA 1YUUA 3PN7C 2KYCA 2PMYA 4JWQA 1J7QA 2JNFA 3FE8A 1QVIZ 3TDUA 1N0YA 1YUSA 4JD9A 3LL8B 2L4IA 4CPVA 3FWBA 1DELA 3CLNA 5BPJA 3TDIA 1HQVA 2JTTA 1YTZC 3JTDC 3UNWA 1DJYA 2HPSA 2JT3A 4YRUA 2MJWB 1KQMB 1DJZA 4CIDA 4C0KA 5CSIA 1B1GA 1SBJA 3I5IB 1LXFC 4WRIA 4YBHB 1CLLA 2WC8A 4ORAB 1BG1A 3DVEA 3NSIA 2PYQA 5B8IB 2BCBA 2I94A 1DJXA 5I2LA 4MEWA 1KQVA 1BLQA 1FBVA 1RK9A 1UWOA 1XFWO 2JNXA 4HSZA 4I5LB 3NXAA 4YGCB 2E6WA 3AKAA 5ER4X 2PSRA 1CDPA 3R1OA 3KO0A 1NCZA 3QMEA 4ETOA 3CZTX 3OX5A 1DGVA 2HQWA 2ZRTA 2M1KB 2K7CA 3DF0B 4YGEB 3WHUB 1S26D 3DVMA 1LVCD 1G33A 1SSEB 1XFVO 4AOMA 1BODA 3SS3A 2M3WA 1B9AA 2WCEA 2OS8C 1H8BA 2Y1MA 1UP5A 5AXIA 3VB1A 1BT6A 1C7VA 2BL0B 5KU1A 2WCFA 4ICBA 3D75A 3O6BA 3D0YB 4OR9B 1CMFA 1B8RA 1GQMA 1OMRA 4ZCUA 2AUCA 3L47A 1MR8A 2ZN8A 1TNWA 5TNCA 4ORCB 4C0JA 1BOCA 1KFUL 1EG3A 1K9UA 3B86A 3BXKA 3I5FC 3BUMB 4HREE 2JWWA 2KAYA 3A8RA 2LM5A 1CLMA 3CR2A 3IQOA 4GGNA 1DGUA 1R2UA 1JUOA 3D0YA 2LMVA 4GNKB 1IQ5A 5DICA 1R6PA 2KAVA 3UO9A 1UHKA 1NP8A 2WCBA 3BOWA 4N5XA 3VRNA 1TOPA 1QTXA 2AAOA 4DUQA 5HLOA 3BFAA 3RM1A 3L4AA 1CDMA 1QLKA 1DC1A 3BJHA 1QV1A 3OB1B 1FI6A 2QEVA 1WDCC 3ICBA 5EL2A 1XK4A 5D7FA 1ZUZA 1J7PA 1SCVA 1G4YR 1PVAA 2H61C 2JZIA 2LNKA 4GPLB 1A75A 1QWVA 4DRWA 1XK4C 2KI6D 3TUYB 1PRWA 1RFJA 4R1EA 3I5GB 1G8IA 3FWCA 3MSEB 1B8CA 3JVTC 3IVTA 2LMTA 5D69A 2K2AA 3E3RA 2M0RA 3I5GC 3LK1A 1TIZA 2JC2A 2ZNEA 2WCHA 1M31A 2Y5IA 1W9ZA 2ZRSA 4IL1A 4MSPA 1F54A 2PRUA 2K0JA 5AANA 1IQ3A 1OZSA 1RWYA 2YGUA 3EKHA 2MRDA 2B1UA 3OGNA 2K60A 4F0ZB 2K7OA 3SG6A 3KF9A 2BBMA 2O5GA 1DEKA 1LINA 2MHHA 3SS4A 2JT8A 4GFTA 2PASA 3OBVA 1UURA 2ZFDA 2LLTA 2JOJA 3A4UB 1PK0D 2LC5A 2OTGC 2L50A 1NCYA 4E68A 1JBAA 1DT7B 2P6BB 1PVBA 2Q4UA 1YRUB 1L7ZA 2KBMA 1S1EA 3FE9A 5I94A 5CSNA 4HRGA 2KLDA 2WCKA 3S0BA 1P28A 3WNXB 2LVVA 1K90D 3K21A 1CDLA 1BU3A 3CR4X 4NQGA 1QV0A 1XFRA 2P71A 1IH0A 1WRKA 4C0LA 1YRTB 2LAPA 2ERBA 1LA3A 3K1EA 1CFPA 1A29A 2KLEA 3PALA 1L2OC 2BCAA 1SL8A 2F33A 1ALWA 2QEOA 4PCWA 1KCYA 5AEQA 3PATA 1SR6B 1CFFA 5I2OA 2HF5A 4F7FA 1SNLA 2L2CA 4MLWA 2BE6A 2I7AA 1OE9B 2FCEA 4BY4A 1IJ6A 1F4OA 5AFPA 3RZSA 1CFCA 2GGZA 1KSMA 2KFFA 2WCMA 4I5JA 1TRFA 2L5XB 4PDZA 1M45A 2M1UA 3LLEA 4YI9A 2M29A 1JFJA 1SKTA 2DOQA 3O2PA 5HYDA 2KI6C 1AHRA 1NSHA 3PSRA 1AJ5A 4PHKA 2BAPA 2MAZA 5GQQC 2IS9A 2OS8B 2CTNA 3DVJA 1TNQA 1AK8A 1FPWA 5F6TA 1S6JA 1D1OA 3B6XA 1SCMB 4KYNA 1UHJA 2ISDA 1JF2A 2E30A 1JFKA 2F3ZA 2JXCA 4JPZB 1WRLA 2O60A 2QDIA 2FJUB 2QEBA 1S5GY 1YVLA 3CTNA 2ZN9A 1QLSA 1WY9A 2KAXA 2GTEA 2KQ6A 2LUCA 4OZDA 3BFHA 2JPTA 1GGZA 3SIAA 3OX6A 2QPTA 1AP4A 1UHNA 2FOTA 1BR4B 1B4CA 3AAJA 1NYAA 3HCMA 2COLB 1WRZA 3GOFA 1N2DA 2KHNA 1TWOA 4PE0A 3R72A 3WXAA 3TS5C 1KK8C 1N65A 3B88A 3SG3A 3VROA 1NWDA 4TNCA 3EK7A 3O4XA 1F70A 3I5FB 1RECA 1IKUA 4P5OE 4INXA 3RLZA 2CBLA 4PE7A 1WDCB 1ZMZA 1TUJA 4FTGA 1C7WA 3D73A 2WORA 2FJYA 2LP3A 4BY5A 1NIWA 1EH2A 3H4SE 4L9MA 1FW4A 3EVRA 2H8VA 4PT1A 1S6IA 2LP2A 5I2QA 2A4JA 2M49B 1K9PA 3Q8IA 2CCMA 1RROA 2GV5A 4YGAA 1CM1A 2ZNDA 3F45A 3SG7A 1KQMC 2BKHB 2QEHA 3LCPC 1MQ1A 4PHJA 1YX8A 1OOJA 1J7OA 2LVJA 3OB2B 4MBEA 3CZ1A 1PSRA 1GJYA 2LHLA 3R1PA 1KFUS 3JVTB 3IF7A 4PE4A 5I8NA 3NHTA 1MXEA 3DY9A 1UUSA 4GBAA 1SW8A 1K95A 5CPVA 1EL4A 1ZFSA 2KYFA 5D3OA 2JT0A 1SR6C 3VRQA 3TDZA 1TCFA 3I5IC 3DF0A 2K7DA 2KNEA 1QIVA 1XFXO 3AAKA 1QVIY 4P2YB 5ER5A 5J3XA 2NCOA 3TZ1A 1SK6D 1AVSA 2AMIA 1TCOB 2KFGA 2LCPA 2LLSA 3VRPA 1FI5A 1YURA 2FCDA 1U5IB 2EGDA 4MN0A 4DCKA 2BKIB 1XYDA 2LMUA 5KSZA 1UHIA 2LVKA 2KQYA 2NCPA 3EG5B 3N7HA 4OCIA 3SS5A 4D1EA 1H4BA 4A4CA 2M8UA 5FYXA 3AKBA
chains in the Genus database with same CATH topology
1IJ5A 1KK7Y 3NSKA 3M0WA 1S6CA 1Y1XA 1A03A 1CM4A 3PM8A 3BUXB 1V1FA 5JOLA 1IWQA 1JF0A 1OMVA 2EHBA 2K8MB 5AERA 1M39A 3GK2A 3O78A 1J7RA 1Q80A 3QRXA 3CGAA 1SCMC 4PALA 1WLMA 1B7TY 1OZOA 1EG4A 2LE9B 2M7NA 3BYAA 3FIAA 3GK4X 1MWNA 5IBWA 4CFQA 2LUXA 2D8NA 2KGBC 2TN4A 5DKQA 1TNXA 3IQQA 4NDCA 1KK8B 1K9KA 2K61A 1QX5B 2CXJA 1K2HA 4MZKA 3TUYC 1ZACA 1B8LA 1MF8B 1QXPA 1XO5A 4M2QA 1J1DA 4AQJA 3BUNB 1TTXA 1C07A 1CNPA 1PULA 3LK0A 5G08A 2K2FA 1DVIA 4GGFC 2JXLA 4N1FA 3DD4A 2M9GA 2BECA 1PSBA 4PE1A 2HETA 2BBNA 4CFRA 1DJWA 2H61A 3SG2A 4OV2A 4DS7A 5JJGA 1KWOB 1KK7Z 1VRKA 1LKJA 2KI4B 1YUTA 1E8AA 1K96A 2CNPA 1TNPA 1XVJA 2F2PA 3DVKA 2MLFC 1DTLA 2L0PA 2KI4C 2NLNA 1CFDA 1SYMA 2F3YA 5HLVA 2Q91A 2LVIA 4OKHA 4WQ3A 1FF1A 3D10A 1ALVA 1A2XA 2LHIA 1BJFA 3EKJA 4FQOA 4YI8A 5HKYA 1Y1UA 1SMGA 1K8UA 1DMOA 1UHHA 4GUKA 4NDBA 3O4YA 3BUOB 4QJ5B 4Q04A 1NX1A 4HRHA 1M63B 1MUXA 2L4HA 1ZOTB 1YX7A 4MVFA 4USLA 4A4BA 2KDHA 1CDNA 1JWDA 1XFYO 1Y6WA 2PVBA 1QX7A 5KTYA 5CSJA 1QX2A 2M97A 3SG4A 3HX4A 2LLUA 4MRXA 3SG5A 1QIWA 1SL7A 2F8PA 4M2OA 1MHOA 2H2KA 4MRYA 2NXQA 3OHMB 4U8DA 2Y1NA 3CR5X 3JTDB 3KEVA 2EC6B 1DJIA 2PALA 1DJGA 1NX0A 2SASA 1Y0VH 4PHNA 1NPQA 1PALA 2L51A 2NZ0A 1XFZO 1CTRA 3OP0A 3EK8A 1YR5A 3KHEA 2KBIA 2I18A 3PN7B 2F2OA 4XJKB 1CLBA 1M46A 1Y1AA 3NSOA 1IRJA 2WNDA 4UPGA 2MA2A 1CKKA 1CB1A 1DF0B 2HQ8A 2R2IA 4WQ2A 3PLFB 1J55A 1DJHA 1W7JB 1F8HA 4OVNF 3I5HC 1IG5A 1WLZA 2KSPA 4YGDB 1OMDA 1QASA 1J1EA 4GGFA 4MZLA 2G2BA 3EVVA 2JRFA 3I5HB 1TN4A 4I5KA 4ORBB 1QJTA 1F55A 1NX2A 3KPXA 2KFHA 1ODBA 1QATA 1SY9A 1K94A 2KOTA 5HKWA 2VRGA 1SL9A 3TS5B 1V1GA 1XFUO 5DKRA 1QS7A 1NUBA 1S5GZ 4PHMA 2LANA 5DKNA 2SCPA 3ZNIA 2G9BA 3ZWHA 2JULA 4CLNA 1L2OB 3C1VA 2BL0C 4DIRA 1JC2A 2WOSA 1IGVA 2MBXA 3SJSA 1RTP1 1RJVA 2K7BA 1BR1B 1OQPA 4QJ3B 2OPOA 1B47A 1S3PA 4JQ0D 4MZJA 3EK4A 1NX3A 1EJ3A 1EXRA 5CSFA 2V53A 3VGOA 1NCXA 4GAOA 2L98A 4AQIA 1BF5A 2Y4QA 3NSLA 2CT9A 1F71A 3WHTB 1AUIB 2L2EA 1S36A 2GGMA 2LV7A 3BQ3A 1DF0A 2RGIA 1YVHA 2I2RE 1KWOC 2JU0A 3GK1A 2KGRA 5HKZA 1F4QA 1B7TZ 1A4PA 4QJ4B 1CMGA 4ZCVA 1BMOA 4M2PA 2M7LA 2JQ6A 3CS1A 1SRAA 1K93D 1XA5A 2QACA 1KFXS 3BOWB 1GGWA 1MXLC 1HT9A 4I5NB 5K89A 2BE4A 3SIBA 4XYNA 3VRRA 2OTGB 3EVUA 1LA0A 1OSAA 1U5IA 2ZKMX 1KFXL 4NDDA 2EC6C 4XJKA 1JSAA 2BCXA 4YGBB 5PALA 3BUWB 3CWGA 1A75B 1AJ4A 2JTZA 1X02A 1SPYA 1W7IB 3FS7A 4N1GA 2MLEC 3PFVA 1KSOA 1YUUA 3PN7C 2KYCA 2PMYA 4JWQA 1J7QA 2JNFA 1QVIZ 3TDUA 1N0YA 1YUSA 3LL8B 2L4IA 4CPVA 3FWBA 3CLNA 5BPJA 3TDIA 1HQVA 2JTTA 1YTZC 3JTDC 1DJYA 2HPSA 2JT3A 4YRUA 2MJWB 1KQMB 1DJZA 4CIDA 4C0KA 5CSIA 1B1GA 1SBJA 3I5IB 1LXFC 4WRIA 4YBHB 1CLLA 2WC8A 4ORAB 1BG1A 3DVEA 3NSIA 5B8IB 2BCBA 2I94A 1DJXA 5I2LA 4MEWA 1KQVA 1BLQA 1FBVA 1RK9A 1UWOA 1XFWO 2JNXA 4HSZA 4I5LB 3NXAA 4YGCB 2E6WA 3AKAA 5ER4X 2PSRA 1CDPA 3KO0A 1NCZA 4ETOA 3CZTX 3OX5A 1DGVA 2HQWA 2ZRTA 2M1KB 2K7CA 3DF0B 4YGEB 3WHUB 1S26D 3DVMA 1LVCD 1G33A 1XFVO 4AOMA 1BODA 2M3WA 1B9AA 2WCEA 2OS8C 1H8BA 2Y1MA 1UP5A 5AXIA 1BT6A 1C7VA 2BL0B 5KU1A 2WCFA 4ICBA 3O6BA 3D0YB 4OR9B 1CMFA 1B8RA 1GQMA 1OMRA 4ZCUA 2AUCA 1MR8A 2ZN8A 1TNWA 5TNCA 4ORCB 4C0JA 1BOCA 1KFUL 1EG3A 1K9UA 3BXKA 3I5FC 3BUMB 4HREE 2JWWA 2KAYA 3A8RA 2LM5A 1CLMA 3CR2A 3IQOA 4GGNA 1DGUA 1R2UA 1JUOA 3D0YA 2LMVA 4GNKB 1IQ5A 1R6PA 2KAVA 1UHKA 1NP8A 2WCBA 3BOWA 4N5XA 3VRNA 1TOPA 1QTXA 2AAOA 4DUQA 5HLOA 3RM1A 1CDMA 1QLKA 1QV1A 3OB1B 1FI6A 1WDCC 3ICBA 1XK4A 5D7FA 1ZUZA 1J7PA 1SCVA 1G4YR 1PVAA 2H61C 2JZIA 2LNKA 4GPLB 1A75A 4DRWA 1XK4C 2KI6D 3TUYB 1PRWA 1RFJA 4R1EA 3I5GB 1G8IA 3FWCA 3MSEB 1B8CA 3JVTC 2LMTA 5D69A 2K2AA 3E3RA 2M0RA 3I5GC 3LK1A 1TIZA 2JC2A 2ZNEA 1M31A 2Y5IA 2ZRSA 4IL1A 4MSPA 1F54A 2PRUA 2K0JA 5AANA 1IQ3A 1OZSA 1RWYA 3EKHA 2MRDA 2B1UA 4F0ZB 2K7OA 3SG6A 3KF9A 2BBMA 2O5GA 1LINA 2MHHA 2JT8A 4GFTA 2PASA 1UURA 2ZFDA 2LLTA 2JOJA 3A4UB 1PK0D 2LC5A 2OTGC 2L50A 1NCYA 4E68A 1JBAA 1DT7B 2P6BB 1PVBA 2Q4UA 1YRUB 1L7ZA 2KBMA 1S1EA 5CSNA 4HRGA 3WNXB 2LVVA 1K90D 3K21A 1CDLA 1BU3A 3CR4X 4NQGA 1QV0A 1IH0A 1WRKA 4C0LA 1YRTB 2LAPA 1LA3A 1CFPA 1A29A 3PALA 1L2OC 2BCAA 1SL8A 2F33A 1ALWA 4PCWA 1KCYA 5AEQA 3PATA 1SR6B 1CFFA 5I2OA 2HF5A 1SNLA 4MLWA 2BE6A 2I7AA 1OE9B 2FCEA 4BY4A 1IJ6A 1F4OA 5AFPA 1CFCA 2GGZA 1KSMA 2KFFA 4I5JA 1TRFA 2L5XB 4PDZA 1M45A 2M1UA 3LLEA 4YI9A 2M29A 1JFJA 1SKTA 2DOQA 3O2PA 5HYDA 2KI6C 1AHRA 1NSHA 3PSRA 1AJ5A 4PHKA 5GQQC 2MAZA 2IS9A 2OS8B 2CTNA 3DVJA 1TNQA 1AK8A 1FPWA 5F6TA 1S6JA 1D1OA 2ISDA 1SCMB 1UHJA 1JF2A 2E30A 1JFKA 2F3ZA 2JXCA 4JPZB 1WRLA 2O60A 2FJUB 1S5GY 1YVLA 3CTNA 2ZN9A 1QLSA 1WY9A 2KAXA 2KQ6A 2LUCA 2JPTA 1GGZA 3SIAA 3OX6A 2QPTA 1AP4A 1UHNA 2FOTA 1BR4B 1B4CA 3AAJA 1NYAA 3HCMA 2COLB 1WRZA 3GOFA 1N2DA 2KHNA 4PE0A 3WXAA 3TS5C 1KK8C 1N65A 3SG3A 3VROA 1NWDA 4TNCA 3EK7A 1F70A 3I5FB 1RECA 1IKUA 4P5OE 3RLZA 2CBLA 4PE7A 1WDCB 1ZMZA 4FTGA 1C7WA 2WORA 2LP3A 4BY5A 1NIWA 1EH2A 3H4SE 4L9MA 1FW4A 3EVRA 1S6IA 2LP2A 5I2QA 2A4JA 2M49B 1K9PA 2CCMA 1RROA 2GV5A 4YGAA 1CM1A 2ZNDA 3F45A 3SG7A 1KQMC 2BKHB 3LCPC 1MQ1A 4PHJA 1YX8A 1OOJA 1J7OA 2LVJA 3OB2B 4MBEA 1PSRA 1GJYA 2LHLA 1KFUS 3JVTB 3IF7A 4PE4A 5I8NA 1MXEA 1UUSA 4GBAA 1SW8A 1K95A 5CPVA 1EL4A 1ZFSA 2KYFA 2JT0A 1SR6C 3VRQA 3TDZA 1TCFA 3I5IC 3DF0A 2K7DA 2KNEA 1QIVA 1XFXO 3AAKA 1QVIY 4P2YB 5ER5A 5J3XA 2NCOA 3TZ1A 1SK6D 1AVSA 2AMIA 1TCOB 2KFGA 2LCPA 2LLSA 3VRPA 1FI5A 1YURA 2FCDA 1U5IB 2EGDA 4MN0A 4DCKA 2BKIB 1XYDA 2LMUA 5KSZA 1UHIA 2LVKA 2KQYA 2NCPA 4OCIA 4D1EA 1H4BA 4A4CA 2M8UA 5FYXA 3AKBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IJ5 A;  1KK7 Y;  3NSK A;  3M0W A;  1S6C A;  1Y1X A;  1A03 A;  1CM4 A;  3PM8 A;  3BUX B;  1V1F A;  5JOL A;  1IWQ A;  1JF0 A;  1OMV A;  2EHB A;  2K8M B;  5AER A;  1M39 A;  3GK2 A;  3O78 A;  1J7R A;  1Q80 A;  3QRX A;  3CGA A;  1SCM C;  4PAL A;  1WLM A;  1B7T Y;  1OZO A;  1EG4 A;  2LE9 B;  2M7N A;  3BYA A;  3FIA A;  3GK4 X;  1MWN A;  5IBW A;  4CFQ A;  2LUX A;  2D8N A;  2KGB C;  2TN4 A;  5DKQ A;  1TNX A;  3IQQ A;  4NDC A;  1KK8 B;  1K9K A;  2K61 A;  1QX5 B;  2CXJ A;  1K2H A;  4MZK A;  3TUY C;  1ZAC A;  1B8L A;  1MF8 B;  1QXP A;  1XO5 A;  4M2Q A;  1J1D A;  4AQJ A;  3BUN B;  1TTX A;  1C07 A;  1CNP A;  1PUL A;  3LK0 A;  5G08 A;  2K2F A;  1DVI A;  4GGF C;  2JXL A;  4N1F A;  3DD4 A;  2M9G A;  2BEC A;  1PSB A;  4PE1 A;  2HET A;  2BBN A;  4CFR A;  1DJW A;  2H61 A;  3SG2 A;  4OV2 A;  4DS7 A;  5JJG A;  1KWO B;  1KK7 Z;  1VRK A;  1LKJ A;  2KI4 B;  1YUT A;  1E8A A;  1K96 A;  2CNP A;  1TNP A;  1XVJ A;  2F2P A;  3DVK A;  2MLF C;  1DTL A;  2L0P A;  2KI4 C;  2NLN A;  1CFD A;  1SYM A;  2F3Y A;  5HLV A;  2Q91 A;  2LVI A;  4OKH A;  4WQ3 A;  1FF1 A;  3D10 A;  1ALV A;  1A2X A;  2LHI A;  1BJF A;  3EKJ A;  4FQO A;  4YI8 A;  5HKY A;  1Y1U A;  1SMG A;  1K8U A;  1DMO A;  1UHH A;  4GUK A;  4NDB A;  3O4Y A;  3BUO B;  4QJ5 B;  4Q04 A;  1NX1 A;  4HRH A;  1M63 B;  1MUX A;  2L4H A;  1ZOT B;  1YX7 A;  4MVF A;  4USL A;  4A4B A;  2KDH A;  1CDN A;  1JWD A;  1XFY O;  1Y6W A;  2PVB A;  1QX7 A;  5KTY A;  5CSJ A;  1QX2 A;  2M97 A;  3SG4 A;  3HX4 A;  2LLU A;  4MRX A;  3SG5 A;  1QIW A;  1SL7 A;  2F8P A;  4M2O A;  1MHO A;  2H2K A;  4MRY A;  2NXQ A;  3OHM B;  4U8D A;  2Y1N A;  3CR5 X;  3JTD B;  3KEV A;  2EC6 B;  1DJI A;  2PAL A;  1DJG A;  1NX0 A;  2SAS A;  1Y0V H;  4PHN A;  1NPQ A;  1PAL A;  2L51 A;  2NZ0 A;  1XFZ O;  1CTR A;  3OP0 A;  3EK8 A;  1YR5 A;  3KHE A;  2KBI A;  2I18 A;  3PN7 B;  2F2O A;  4XJK B;  1CLB A;  1M46 A;  1Y1A A;  3NSO A;  1IRJ A;  2WND A;  4UPG A;  2MA2 A;  1CKK A;  1CB1 A;  1DF0 B;  2HQ8 A;  2R2I A;  4WQ2 A;  3PLF B;  1J55 A;  1DJH A;  1W7J B;  1F8H A;  4OVN F;  3I5H C;  1IG5 A;  1WLZ A;  2KSP A;  4YGD B;  1OMD A;  1QAS A;  1J1E A;  4GGF A;  4MZL A;  2G2B A;  3EVV A;  2JRF A;  3I5H B;  1TN4 A;  4I5K A;  4ORB B;  1QJT A;  1F55 A;  1NX2 A;  3KPX A;  2KFH A;  1ODB A;  1QAT A;  1SY9 A;  1K94 A;  2KOT A;  5HKW A;  2VRG A;  1SL9 A;  3TS5 B;  1V1G A;  1XFU O;  5DKR A;  1QS7 A;  1NUB A;  1S5G Z;  4PHM A;  2LAN A;  5DKN A;  2SCP A;  3ZNI A;  2G9B A;  3ZWH A;  2JUL A;  4CLN A;  1L2O B;  3C1V A;  2BL0 C;  4DIR A;  1JC2 A;  2WOS A;  1IGV A;  2MBX A;  3SJS A;  1RTP 1;  1RJV A;  2K7B A;  1BR1 B;  1OQP A;  4QJ3 B;  2OPO A;  1B47 A;  1S3P A;  4JQ0 D;  4MZJ A;  3EK4 A;  1NX3 A;  1EJ3 A;  1EXR A;  5CSF A;  2V53 A;  3VGO A;  1NCX A;  4GAO A;  2L98 A;  4AQI A;  1BF5 A;  2Y4Q A;  3NSL A;  2CT9 A;  1F71 A;  3WHT B;  1AUI B;  2L2E A;  1S36 A;  2GGM A;  2LV7 A;  3BQ3 A;  1DF0 A;  2RGI A;  1YVH A;  2I2R E;  1KWO C;  2JU0 A;  3GK1 A;  2KGR A;  5HKZ A;  1F4Q A;  1B7T Z;  1A4P A;  4QJ4 B;  1CMG A;  4ZCV A;  1BMO A;  4M2P A;  2M7L A;  2JQ6 A;  3CS1 A;  1SRA A;  1K93 D;  1XA5 A;  2QAC A;  1KFX S;  3BOW B;  1GGW A;  1MXL C;  1HT9 A;  4I5N B;  5K89 A;  2BE4 A;  3SIB A;  4XYN A;  3VRR A;  2OTG B;  3EVU A;  1LA0 A;  1OSA A;  1U5I A;  2ZKM X;  1KFX L;  4NDD A;  2EC6 C;  4XJK A;  1JSA A;  2BCX A;  4YGB B;  5PAL A;  3BUW B;  3CWG A;  1A75 B;  1AJ4 A;  2JTZ A;  1X02 A;  1SPY A;  1W7I B;  3FS7 A;  4N1G A;  2MLE C;  3PFV A;  1KSO A;  1YUU A;  3PN7 C;  2KYC A;  2PMY A;  4JWQ A;  1J7Q A;  2JNF A;  1QVI Z;  3TDU A;  1N0Y A;  1YUS A;  3LL8 B;  2L4I A;  4CPV A;  3FWB A;  3CLN A;  5BPJ A;  3TDI A;  1HQV A;  2JTT A;  1YTZ C;  3JTD C;  1DJY A;  2HPS A;  2JT3 A;  4YRU A;  2MJW B;  1KQM B;  1DJZ A;  4CID A;  4C0K A;  5CSI A;  1B1G A;  1SBJ A;  3I5I B;  1LXF C;  4WRI A;  4YBH B;  1CLL A;  2WC8 A;  4ORA B;  1BG1 A;  3DVE A;  3NSI A;  5B8I B;  2BCB A;  2I94 A;  1DJX A;  5I2L A;  4MEW A;  1KQV A;  1BLQ A;  1FBV A;  1RK9 A;  1UWO A;  1XFW O;  2JNX A;  4HSZ A;  4I5L B;  3NXA A;  4YGC B;  2E6W A;  3AKA A;  5ER4 X;  2PSR A;  1CDP A;  3KO0 A;  1NCZ A;  4ETO A;  3CZT X;  3OX5 A;  1DGV A;  2HQW A;  2ZRT A;  2M1K B;  2K7C A;  3DF0 B;  4YGE B;  3WHU B;  1S26 D;  3DVM A;  1LVC D;  1G33 A;  1XFV O;  4AOM A;  1BOD A;  2M3W A;  1B9A A;  2WCE A;  2OS8 C;  1H8B A;  2Y1M A;  1UP5 A;  5AXI A;  1BT6 A;  1C7V A;  2BL0 B;  5KU1 A;  2WCF A;  4ICB A;  3O6B A;  3D0Y B;  4OR9 B;  1CMF A;  1B8R A;  1GQM A;  1OMR A;  4ZCU A;  2AUC A;  1MR8 A;  2ZN8 A;  1TNW A;  5TNC A;  4ORC B;  4C0J A;  1BOC A;  1KFU L;  1EG3 A;  1K9U A;  3BXK A;  3I5F C;  3BUM B;  4HRE E;  2JWW A;  2KAY A;  3A8R A;  2LM5 A;  1CLM A;  3CR2 A;  3IQO A;  4GGN A;  1DGU A;  1R2U A;  1JUO A;  3D0Y A;  2LMV A;  4GNK B;  1IQ5 A;  1R6P A;  2KAV A;  1UHK A;  1NP8 A;  2WCB A;  3BOW A;  4N5X A;  3VRN A;  1TOP A;  1QTX A;  2AAO A;  4DUQ A;  5HLO A;  3RM1 A;  1CDM A;  1QLK A;  1QV1 A;  3OB1 B;  1FI6 A;  1WDC C;  3ICB A;  1XK4 A;  5D7F A;  1ZUZ A;  1J7P A;  1SCV A;  1G4Y R;  1PVA A;  2H61 C;  2JZI A;  2LNK A;  4GPL B;  1A75 A;  4DRW A;  1XK4 C;  2KI6 D;  3TUY B;  1PRW A;  1RFJ A;  4R1E A;  3I5G B;  1G8I A;  3FWC A;  3MSE B;  1B8C A;  3JVT C;  2LMT A;  5D69 A;  2K2A A;  3E3R A;  2M0R A;  3I5G C;  3LK1 A;  1TIZ A;  2JC2 A;  2ZNE A;  1M31 A;  2Y5I A;  2ZRS A;  4IL1 A;  4MSP A;  1F54 A;  2PRU A;  2K0J A;  5AAN A;  1IQ3 A;  1OZS A;  1RWY A;  3EKH A;  2MRD A;  2B1U A;  4F0Z B;  2K7O A;  3SG6 A;  3KF9 A;  2BBM A;  2O5G A;  1LIN A;  2MHH A;  2JT8 A;  4GFT A;  2PAS A;  1UUR A;  2ZFD A;  2LLT A;  2JOJ A;  3A4U B;  1PK0 D;  2LC5 A;  2OTG C;  2L50 A;  1NCY A;  4E68 A;  1JBA A;  1DT7 B;  2P6B B;  1PVB A;  2Q4U A;  1YRU B;  1L7Z A;  2KBM A;  1S1E A;  5CSN A;  4HRG A;  3WNX B;  2LVV A;  1K90 D;  3K21 A;  1CDL A;  1BU3 A;  3CR4 X;  4NQG A;  1QV0 A;  1IH0 A;  1WRK A;  4C0L A;  1YRT B;  2LAP A;  1LA3 A;  1CFP A;  1A29 A;  3PAL A;  1L2O C;  2BCA A;  1SL8 A;  2F33 A;  1ALW A;  4PCW A;  1KCY A;  5AEQ A;  3PAT A;  1SR6 B;  1CFF A;  5I2O A;  2HF5 A;  1SNL A;  4MLW A;  2BE6 A;  2I7A A;  1OE9 B;  2FCE A;  4BY4 A;  1IJ6 A;  1F4O A;  5AFP A;  1CFC A;  2GGZ A;  1KSM A;  2KFF A;  4I5J A;  1TRF A;  2L5X B;  4PDZ A;  1M45 A;  2M1U A;  3LLE A;  4YI9 A;  2M29 A;  1JFJ A;  1SKT A;  2DOQ A;  3O2P A;  5HYD A;  2KI6 C;  1AHR A;  1NSH A;  3PSR A;  1AJ5 A;  4PHK A;  5GQQ C;  2MAZ A;  2IS9 A;  2OS8 B;  2CTN A;  3DVJ A;  1TNQ A;  1AK8 A;  1FPW A;  5F6T A;  1S6J A;  1D1O A;  2ISD A;  1SCM B;  1UHJ A;  1JF2 A;  2E30 A;  1JFK A;  2F3Z A;  2JXC A;  4JPZ B;  1WRL A;  2O60 A;  2FJU B;  1S5G Y;  1YVL A;  3CTN A;  2ZN9 A;  1QLS A;  1WY9 A;  2KAX A;  2KQ6 A;  2LUC A;  2JPT A;  1GGZ A;  3SIA A;  3OX6 A;  2QPT A;  1AP4 A;  1UHN A;  2FOT A;  1BR4 B;  1B4C A;  3AAJ A;  1NYA A;  3HCM A;  2COL B;  1WRZ A;  3GOF A;  1N2D A;  2KHN A;  4PE0 A;  3WXA A;  3TS5 C;  1KK8 C;  1N65 A;  3SG3 A;  3VRO A;  1NWD A;  4TNC A;  3EK7 A;  1F70 A;  3I5F B;  1REC A;  1IKU A;  4P5O E;  3RLZ A;  2CBL A;  4PE7 A;  1WDC B;  1ZMZ A;  4FTG A;  1C7W A;  2WOR A;  2LP3 A;  4BY5 A;  1NIW A;  1EH2 A;  3H4S E;  4L9M A;  1FW4 A;  3EVR A;  1S6I A;  2LP2 A;  5I2Q A;  2A4J A;  2M49 B;  1K9P A;  2CCM A;  1RRO A;  2GV5 A;  4YGA A;  1CM1 A;  2ZND A;  3F45 A;  3SG7 A;  1KQM C;  2BKH B;  3LCP C;  1MQ1 A;  4PHJ A;  1YX8 A;  1OOJ A;  1J7O A;  2LVJ A;  3OB2 B;  4MBE A;  1PSR A;  1GJY A;  2LHL A;  1KFU S;  3JVT B;  3IF7 A;  4PE4 A;  5I8N A;  1MXE A;  1UUS A;  4GBA A;  1SW8 A;  1K95 A;  5CPV A;  1EL4 A;  1ZFS A;  2KYF A;  2JT0 A;  1SR6 C;  3VRQ A;  3TDZ A;  1TCF A;  3I5I C;  3DF0 A;  2K7D A;  2KNE A;  1QIV A;  1XFX O;  3AAK A;  1QVI Y;  4P2Y B;  5ER5 A;  5J3X A;  2NCO A;  3TZ1 A;  1SK6 D;  1AVS A;  2AMI A;  1TCO B;  2KFG A;  2LCP A;  2LLS A;  3VRP A;  1FI5 A;  1YUR A;  2FCD A;  1U5I B;  2EGD A;  4MN0 A;  4DCK A;  2BKI B;  1XYD A;  2LMU A;  5KSZ A;  1UHI A;  2LVK A;  2KQY A;  2NCP A;  4OCI A;  4D1E A;  1H4B A;  4A4C A;  2M8U A;  5FYX A;  3AKB A; 
#chains in the Genus database with same CATH topology
 1IJ5 A;  1KK7 Y;  3NSK A;  3M0W A;  3S0F A;  1S6C A;  1Y1X A;  1A03 A;  1CM4 A;  3PM8 A;  1OW4 A;  3BUX B;  1V1F A;  5JOL A;  3NHI A;  1IWQ A;  3DYE A;  1JF0 A;  1OMV A;  2EHB A;  3D76 A;  2K8M B;  5AER A;  1M39 A;  3FE6 A;  3GK2 A;  3O78 A;  1J7R A;  1Q80 A;  3QRX A;  3CGA A;  1SCM C;  4PAL A;  1WLM A;  1B7T Y;  1OZO A;  1EG4 A;  2LE9 B;  2M7N A;  3BYA A;  3FIA A;  3GK4 X;  1MWN A;  5IBW A;  4CFQ A;  2LUX A;  2D8N A;  2JPO A;  2KGB C;  1OOG A;  2TN4 A;  3CAB A;  3CYZ A;  5DKQ A;  1TNX A;  3IQQ A;  4NDC A;  1KK8 B;  1K9K A;  2K61 A;  1TUZ A;  1QX5 B;  2CXJ A;  1K2H A;  4MZK A;  3TUY C;  1ZAC A;  1B8L A;  1MF8 B;  1QXP A;  1XO5 A;  4M2Q A;  1J1D A;  4AQJ A;  3BUN B;  1TTX A;  1C07 A;  1CNP A;  4FQT A;  1PUL A;  3LK0 A;  5G08 A;  2K2F A;  1DVI A;  4GGF C;  2JXL A;  4N1F A;  3S0D A;  3DD4 A;  2M9G A;  2BEC A;  1PSB A;  4PE1 A;  2HET A;  2BBN A;  4CFR A;  1DJW A;  2H61 A;  3SG2 A;  4OV2 A;  1T14 A;  3PM2 A;  4DS7 A;  5JJG A;  1KWO B;  1KK7 Z;  4IJ7 A;  1VRK A;  1LKJ A;  2KI4 B;  1YUT A;  1E8A A;  1K96 A;  2CNP A;  1TNP A;  1XVJ A;  2F2P A;  3DVK A;  2WC5 A;  2MLF C;  1DTL A;  2L0P A;  1GM0 A;  2KI4 C;  2NLN A;  1CFD A;  1SYM A;  2F3Y A;  5FI2 A;  5HLV A;  2Q91 A;  2LVI A;  3CZ2 A;  4OKH A;  4WQ3 A;  1FF1 A;  3D10 A;  1ALV A;  1A2X A;  2LHI A;  3D78 A;  1BJF A;  3EKJ A;  4FQO A;  4YI8 A;  5HKY A;  1Y1U A;  3S0G A;  1SMG A;  1K8U A;  1DMO A;  1UHH A;  4GUK A;  4NDB A;  3O4Y A;  3BUO B;  4QJ5 B;  1C3Y A;  4Q04 A;  1NX1 A;  4HRH A;  1M63 B;  1MUX A;  2L4H A;  1ZOT B;  1YX7 A;  4MVF A;  4USL A;  4A4B A;  2KDH A;  1CDN A;  1JWD A;  1XFY O;  1Y6W A;  2PVB A;  1QX7 A;  5KTY A;  5CSJ A;  2WCL A;  1QX2 A;  2M97 A;  3SG4 A;  3HX4 A;  2LLU A;  4MRX A;  3SG5 A;  1QIW A;  1SL7 A;  2F8P A;  4M2O A;  1MHO A;  2H2K A;  4MRY A;  2NXQ A;  3OHM B;  4U8D A;  2Y1N A;  3CR5 X;  2L5Y A;  3JTD B;  3KEV A;  2EC6 B;  1DJI A;  2PAL A;  1DJG A;  1NX0 A;  2SAS A;  1Y0V H;  4PHN A;  1NPQ A;  1PAL A;  2L51 A;  2NZ0 A;  1XFZ O;  1CTR A;  3OP0 A;  5HL1 A;  3EK8 A;  1YR5 A;  3KHE A;  2KBI A;  2I18 A;  3PN7 B;  2F2O A;  4XJK B;  1CLB A;  1M46 A;  1Y1A A;  3NSO A;  1IRJ A;  2WND A;  4UPG A;  2MA2 A;  1CKK A;  1CB1 A;  1DF0 B;  2HQ8 A;  2R2I A;  4WQ2 A;  3PLF B;  1J55 A;  1DJH A;  2KPH A;  1W7J B;  1F8H A;  4OVN F;  3I5H C;  1IG5 A;  1C3Z A;  1WLZ A;  2KSP A;  4YGD B;  1OMD A;  1QAS A;  1J1E A;  4GGF A;  2BNX A;  4MZL A;  2G2B A;  3EVV A;  2JRF A;  3I5H B;  1TN4 A;  4I5K A;  4ORB B;  1QJT A;  1F55 A;  1NX2 A;  3KPX A;  2PQL A;  2KFH A;  3DXL A;  3R1V A;  1ODB A;  1QAT A;  1SY9 A;  1K94 A;  2KOT A;  5FI7 A;  2VRG A;  5HKW A;  3B87 A;  3V2L A;  1SL9 A;  3TS5 B;  1V1G A;  1XFU O;  5DKR A;  1LS8 A;  1QS7 A;  1NUB A;  4JKT A;  1S5G Z;  4PHM A;  2LAN A;  5DKN A;  2SCP A;  3ZNI A;  2G9B A;  3ZWH A;  2JUL A;  4CLN A;  1L2O B;  3C1V A;  2BL0 C;  4DIR A;  1JC2 A;  3S0A A;  2WOS A;  1IGV A;  3NGV A;  2MBX A;  3SJS A;  2P70 A;  1RTP 1;  1RJV A;  2K7B A;  1BR1 B;  1Z4H A;  1OQP A;  4QJ3 B;  2OPO A;  1B47 A;  1S3P A;  3PJI A;  4JQ0 D;  3EK4 A;  4MZJ A;  1NX3 A;  1EJ3 A;  1EXR A;  5CSF A;  2V53 A;  3VGO A;  1NCX A;  1Z2C B;  4GAO A;  2L98 A;  4AQI A;  1BF5 A;  2Y4Q A;  3NSL A;  1DQE A;  2CT9 A;  1F71 A;  3CDN A;  3D77 A;  3WHT B;  3S0E A;  1AUI B;  2L2E A;  1S36 A;  2GGM A;  2LV7 A;  3BQ3 A;  1DF0 A;  2RGI A;  1IIO A;  1YVH A;  2I2R E;  2WC6 A;  1KWO C;  2JU0 A;  3GK1 A;  2KGR A;  5HKZ A;  1F4Q A;  1B7T Z;  1A4P A;  1OOH A;  4QJ4 B;  1CMG A;  4ZCV A;  1BMO A;  3B7A A;  4M2P A;  2M7L A;  2JQ6 A;  3D74 A;  3CS1 A;  1SRA A;  1K93 D;  1XA5 A;  2QAC A;  4INW A;  3L4L A;  1KFX S;  3BOW B;  1OOI X;  1ORG A;  1MXL C;  1GGW A;  1HT9 A;  4I5N B;  5K89 A;  2BE4 A;  3SIB A;  4XYN A;  3VRR A;  3CZ0 A;  2OTG B;  3EVU A;  1LA0 A;  1OSA A;  1U5I A;  2ZKM X;  3DZT A;  1KFX L;  4NDD A;  2EC6 C;  4XJK A;  1JSA A;  2BCX A;  4YGB B;  5PAL A;  3BFB A;  1OOF A;  3BUW B;  3CWG A;  1A75 B;  1AJ4 A;  2JTZ A;  1X02 A;  1SPY A;  1W7I B;  3FS7 A;  4N1G A;  2WCJ A;  2MLE C;  5FI6 A;  3PFV A;  1KSO A;  1YUU A;  3PN7 C;  2KYC A;  2PMY A;  4JWQ A;  1J7Q A;  2JNF A;  3FE8 A;  1QVI Z;  3TDU A;  1N0Y A;  1YUS A;  4JD9 A;  3LL8 B;  2L4I A;  4CPV A;  3FWB A;  1DEL A;  3CLN A;  5BPJ A;  3TDI A;  1HQV A;  2JTT A;  1YTZ C;  3JTD C;  3UNW A;  1DJY A;  2HPS A;  2JT3 A;  4YRU A;  2MJW B;  1KQM B;  1DJZ A;  4CID A;  4C0K A;  5CSI A;  1B1G A;  1SBJ A;  3I5I B;  1LXF C;  4WRI A;  4YBH B;  1CLL A;  2WC8 A;  4ORA B;  1BG1 A;  3DVE A;  3NSI A;  2PYQ A;  5B8I B;  2BCB A;  2I94 A;  1DJX A;  5I2L A;  4MEW A;  1KQV A;  1BLQ A;  1FBV A;  1RK9 A;  1UWO A;  1XFW O;  2JNX A;  4HSZ A;  4I5L B;  3NXA A;  4YGC B;  2E6W A;  3AKA A;  5ER4 X;  2PSR A;  1CDP A;  3R1O A;  3KO0 A;  1NCZ A;  3QME A;  4ETO A;  3CZT X;  3OX5 A;  1DGV A;  2HQW A;  2ZRT A;  2M1K B;  2K7C A;  3DF0 B;  4YGE B;  3WHU B;  1S26 D;  3DVM A;  1LVC D;  1G33 A;  1SSE B;  1XFV O;  4AOM A;  1BOD A;  3SS3 A;  2M3W A;  1B9A A;  2WCE A;  2OS8 C;  1H8B A;  2Y1M A;  1UP5 A;  5AXI A;  3VB1 A;  1BT6 A;  1C7V A;  2BL0 B;  5KU1 A;  2WCF A;  4ICB A;  3D75 A;  3O6B A;  3D0Y B;  4OR9 B;  1CMF A;  1B8R A;  1GQM A;  1OMR A;  4ZCU A;  2AUC A;  3L47 A;  1MR8 A;  2ZN8 A;  1TNW A;  5TNC A;  4ORC B;  4C0J A;  1BOC A;  1KFU L;  1EG3 A;  1K9U A;  3B86 A;  3BXK A;  3I5F C;  3BUM B;  4HRE E;  2JWW A;  2KAY A;  3A8R A;  2LM5 A;  1CLM A;  3CR2 A;  3IQO A;  4GGN A;  1DGU A;  1R2U A;  1JUO A;  3D0Y A;  2LMV A;  4GNK B;  1IQ5 A;  5DIC A;  1R6P A;  2KAV A;  3UO9 A;  1UHK A;  1NP8 A;  2WCB A;  3BOW A;  4N5X A;  3VRN A;  1TOP A;  1QTX A;  2AAO A;  4DUQ A;  5HLO A;  3BFA A;  3RM1 A;  3L4A A;  1CDM A;  1QLK A;  1DC1 A;  3BJH A;  1QV1 A;  3OB1 B;  1FI6 A;  2QEV A;  1WDC C;  3ICB A;  5EL2 A;  1XK4 A;  5D7F A;  1ZUZ A;  1J7P A;  1SCV A;  1G4Y R;  1PVA A;  2H61 C;  2JZI A;  2LNK A;  4GPL B;  1A75 A;  1QWV A;  4DRW A;  1XK4 C;  2KI6 D;  3TUY B;  1PRW A;  1RFJ A;  4R1E A;  3I5G B;  1G8I A;  3FWC A;  3MSE B;  1B8C A;  3JVT C;  3IVT A;  2LMT A;  5D69 A;  2K2A A;  3E3R A;  2M0R A;  3I5G C;  3LK1 A;  1TIZ A;  2JC2 A;  2ZNE A;  2WCH A;  1M31 A;  2Y5I A;  1W9Z A;  2ZRS A;  4IL1 A;  4MSP A;  1F54 A;  2PRU A;  2K0J A;  5AAN A;  1IQ3 A;  1OZS A;  1RWY A;  2YGU A;  3EKH A;  2MRD A;  2B1U A;  3OGN A;  2K60 A;  4F0Z B;  2K7O A;  3SG6 A;  3KF9 A;  2BBM A;  2O5G A;  1DEK A;  1LIN A;  2MHH A;  3SS4 A;  2JT8 A;  4GFT A;  2PAS A;  3OBV A;  1UUR A;  2ZFD A;  2LLT A;  2JOJ A;  3A4U B;  1PK0 D;  2LC5 A;  2OTG C;  2L50 A;  1NCY A;  4E68 A;  1JBA A;  1DT7 B;  2P6B B;  1PVB A;  2Q4U A;  1YRU B;  1L7Z A;  2KBM A;  1S1E A;  3FE9 A;  5I94 A;  5CSN A;  4HRG A;  2KLD A;  2WCK A;  3S0B A;  1P28 A;  3WNX B;  2LVV A;  1K90 D;  3K21 A;  1CDL A;  1BU3 A;  3CR4 X;  4NQG A;  1QV0 A;  1XFR A;  2P71 A;  1IH0 A;  1WRK A;  4C0L A;  1YRT B;  2LAP A;  2ERB A;  1LA3 A;  3K1E A;  1CFP A;  1A29 A;  2KLE A;  3PAL A;  1L2O C;  2BCA A;  1SL8 A;  2F33 A;  1ALW A;  2QEO A;  4PCW A;  1KCY A;  5AEQ A;  3PAT A;  1SR6 B;  1CFF A;  5I2O A;  2HF5 A;  4F7F A;  1SNL A;  2L2C A;  4MLW A;  2BE6 A;  2I7A A;  1OE9 B;  2FCE A;  4BY4 A;  1IJ6 A;  1F4O A;  5AFP A;  3RZS A;  1CFC A;  2GGZ A;  1KSM A;  2KFF A;  2WCM A;  4I5J A;  1TRF A;  2L5X B;  4PDZ A;  1M45 A;  2M1U A;  3LLE A;  4YI9 A;  2M29 A;  1JFJ A;  1SKT A;  2DOQ A;  3O2P A;  5HYD A;  2KI6 C;  1AHR A;  1NSH A;  3PSR A;  1AJ5 A;  4PHK A;  2BAP A;  2MAZ A;  5GQQ C;  2IS9 A;  2OS8 B;  2CTN A;  3DVJ A;  1TNQ A;  1AK8 A;  1FPW A;  5F6T A;  1S6J A;  1D1O A;  3B6X A;  1SCM B;  4KYN A;  1UHJ A;  2ISD A;  1JF2 A;  2E30 A;  1JFK A;  2F3Z A;  2JXC A;  4JPZ B;  1WRL A;  2O60 A;  2QDI A;  2FJU B;  2QEB A;  1S5G Y;  1YVL A;  3CTN A;  2ZN9 A;  1QLS A;  1WY9 A;  2KAX A;  2GTE A;  2KQ6 A;  2LUC A;  4OZD A;  3BFH A;  2JPT A;  1GGZ A;  3SIA A;  3OX6 A;  2QPT A;  1AP4 A;  1UHN A;  2FOT A;  1BR4 B;  1B4C A;  3AAJ A;  1NYA A;  3HCM A;  2COL B;  1WRZ A;  3GOF A;  1N2D A;  2KHN A;  1TWO A;  4PE0 A;  3R72 A;  3WXA A;  3TS5 C;  1KK8 C;  1N65 A;  3B88 A;  3SG3 A;  3VRO A;  1NWD A;  4TNC A;  3EK7 A;  3O4X A;  1F70 A;  3I5F B;  1REC A;  1IKU A;  4P5O E;  4INX A;  3RLZ A;  2CBL A;  4PE7 A;  1WDC B;  1ZMZ A;  1TUJ A;  4FTG A;  1C7W A;  3D73 A;  2WOR A;  2FJY A;  2LP3 A;  4BY5 A;  1NIW A;  1EH2 A;  3H4S E;  4L9M A;  1FW4 A;  3EVR A;  2H8V A;  4PT1 A;  1S6I A;  2LP2 A;  5I2Q A;  2A4J A;  2M49 B;  1K9P A;  3Q8I A;  2CCM A;  1RRO A;  2GV5 A;  4YGA A;  1CM1 A;  2ZND A;  3F45 A;  3SG7 A;  1KQM C;  2BKH B;  2QEH A;  3LCP C;  1MQ1 A;  4PHJ A;  1YX8 A;  1OOJ A;  1J7O A;  2LVJ A;  3OB2 B;  4MBE A;  3CZ1 A;  1PSR A;  1GJY A;  2LHL A;  3R1P A;  1KFU S;  3JVT B;  3IF7 A;  4PE4 A;  5I8N A;  3NHT A;  1MXE A;  3DY9 A;  1UUS A;  4GBA A;  1SW8 A;  1K95 A;  5CPV A;  1EL4 A;  1ZFS A;  2KYF A;  5D3O A;  2JT0 A;  1SR6 C;  3VRQ A;  3TDZ A;  1TCF A;  3I5I C;  3DF0 A;  2K7D A;  2KNE A;  1QIV A;  1XFX O;  3AAK A;  1QVI Y;  4P2Y B;  5ER5 A;  5J3X A;  2NCO A;  3TZ1 A;  1SK6 D;  1AVS A;  2AMI A;  1TCO B;  2KFG A;  2LCP A;  2LLS A;  3VRP A;  1FI5 A;  1YUR A;  2FCD A;  1U5I B;  2EGD A;  4MN0 A;  4DCK A;  2BKI B;  1XYD A;  2LMU A;  5KSZ A;  1UHI A;  2LVK A;  2KQY A;  2NCP A;  3EG5 B;  3N7H A;  4OCI A;  3SS5 A;  4D1E A;  1H4B A;  4A4C A;  2M8U A;  5FYX A;  3AKB A; 
#chains in the Genus database with same CATH homology
 1IJ5 A;  1KK7 Y;  3NSK A;  3M0W A;  1S6C A;  1Y1X A;  1A03 A;  1CM4 A;  3PM8 A;  3BUX B;  1V1F A;  5JOL A;  1IWQ A;  1JF0 A;  1OMV A;  2EHB A;  2K8M B;  5AER A;  1M39 A;  3GK2 A;  3O78 A;  1J7R A;  1Q80 A;  3QRX A;  3CGA A;  1SCM C;  4PAL A;  1WLM A;  1B7T Y;  1OZO A;  1EG4 A;  2LE9 B;  2M7N A;  3BYA A;  3FIA A;  3GK4 X;  1MWN A;  5IBW A;  4CFQ A;  2LUX A;  2D8N A;  2KGB C;  2TN4 A;  5DKQ A;  1TNX A;  3IQQ A;  4NDC A;  1KK8 B;  1K9K A;  2K61 A;  1QX5 B;  2CXJ A;  1K2H A;  4MZK A;  3TUY C;  1ZAC A;  1B8L A;  1MF8 B;  1QXP A;  1XO5 A;  4M2Q A;  1J1D A;  4AQJ A;  3BUN B;  1TTX A;  1C07 A;  1CNP A;  1PUL A;  3LK0 A;  5G08 A;  2K2F A;  1DVI A;  4GGF C;  2JXL A;  4N1F A;  3DD4 A;  2M9G A;  2BEC A;  1PSB A;  4PE1 A;  2HET A;  2BBN A;  4CFR A;  1DJW A;  2H61 A;  3SG2 A;  4OV2 A;  4DS7 A;  5JJG A;  1KWO B;  1KK7 Z;  1VRK A;  1LKJ A;  2KI4 B;  1YUT A;  1E8A A;  1K96 A;  2CNP A;  1TNP A;  1XVJ A;  2F2P A;  3DVK A;  2MLF C;  1DTL A;  2L0P A;  2KI4 C;  2NLN A;  1CFD A;  1SYM A;  2F3Y A;  5HLV A;  2Q91 A;  2LVI A;  4OKH A;  4WQ3 A;  1FF1 A;  3D10 A;  1ALV A;  1A2X A;  2LHI A;  1BJF A;  3EKJ A;  4FQO A;  4YI8 A;  5HKY A;  1Y1U A;  1SMG A;  1K8U A;  1DMO A;  1UHH A;  4GUK A;  4NDB A;  3O4Y A;  3BUO B;  4QJ5 B;  4Q04 A;  1NX1 A;  4HRH A;  1M63 B;  1MUX A;  2L4H A;  1ZOT B;  1YX7 A;  4MVF A;  4USL A;  4A4B A;  2KDH A;  1CDN A;  1JWD A;  1XFY O;  1Y6W A;  2PVB A;  1QX7 A;  5KTY A;  5CSJ A;  1QX2 A;  2M97 A;  3SG4 A;  3HX4 A;  2LLU A;  4MRX A;  3SG5 A;  1QIW A;  1SL7 A;  2F8P A;  4M2O A;  1MHO A;  2H2K A;  4MRY A;  2NXQ A;  3OHM B;  4U8D A;  2Y1N A;  3CR5 X;  3JTD B;  3KEV A;  2EC6 B;  1DJI A;  2PAL A;  1DJG A;  1NX0 A;  2SAS A;  1Y0V H;  4PHN A;  1NPQ A;  1PAL A;  2L51 A;  2NZ0 A;  1XFZ O;  1CTR A;  3OP0 A;  3EK8 A;  1YR5 A;  3KHE A;  2KBI A;  2I18 A;  3PN7 B;  2F2O A;  4XJK B;  1CLB A;  1M46 A;  1Y1A A;  3NSO A;  1IRJ A;  2WND A;  4UPG A;  2MA2 A;  1CKK A;  1CB1 A;  1DF0 B;  2HQ8 A;  2R2I A;  4WQ2 A;  3PLF B;  1J55 A;  1DJH A;  1W7J B;  1F8H A;  4OVN F;  3I5H C;  1IG5 A;  1WLZ A;  2KSP A;  4YGD B;  1OMD A;  1QAS A;  1J1E A;  4GGF A;  4MZL A;  2G2B A;  3EVV A;  2JRF A;  3I5H B;  1TN4 A;  4I5K A;  4ORB B;  1QJT A;  1F55 A;  1NX2 A;  3KPX A;  2KFH A;  1ODB A;  1QAT A;  1SY9 A;  1K94 A;  2KOT A;  5HKW A;  2VRG A;  1SL9 A;  3TS5 B;  1V1G A;  1XFU O;  5DKR A;  1QS7 A;  1NUB A;  1S5G Z;  4PHM A;  2LAN A;  5DKN A;  2SCP A;  3ZNI A;  2G9B A;  3ZWH A;  2JUL A;  4CLN A;  1L2O B;  3C1V A;  2BL0 C;  4DIR A;  1JC2 A;  2WOS A;  1IGV A;  2MBX A;  3SJS A;  1RTP 1;  1RJV A;  2K7B A;  1BR1 B;  1OQP A;  4QJ3 B;  2OPO A;  1B47 A;  1S3P A;  4JQ0 D;  4MZJ A;  3EK4 A;  1NX3 A;  1EJ3 A;  1EXR A;  5CSF A;  2V53 A;  3VGO A;  1NCX A;  4GAO A;  2L98 A;  4AQI A;  1BF5 A;  2Y4Q A;  3NSL A;  2CT9 A;  1F71 A;  3WHT B;  1AUI B;  2L2E A;  1S36 A;  2GGM A;  2LV7 A;  3BQ3 A;  1DF0 A;  2RGI A;  1YVH A;  2I2R E;  1KWO C;  2JU0 A;  3GK1 A;  2KGR A;  5HKZ A;  1F4Q A;  1B7T Z;  1A4P A;  4QJ4 B;  1CMG A;  4ZCV A;  1BMO A;  4M2P A;  2M7L A;  2JQ6 A;  3CS1 A;  1SRA A;  1K93 D;  1XA5 A;  2QAC A;  1KFX S;  3BOW B;  1GGW A;  1MXL C;  1HT9 A;  4I5N B;  5K89 A;  2BE4 A;  3SIB A;  4XYN A;  3VRR A;  2OTG B;  3EVU A;  1LA0 A;  1OSA A;  1U5I A;  2ZKM X;  1KFX L;  4NDD A;  2EC6 C;  4XJK A;  1JSA A;  2BCX A;  4YGB B;  5PAL A;  3BUW B;  3CWG A;  1A75 B;  1AJ4 A;  2JTZ A;  1X02 A;  1SPY A;  1W7I B;  3FS7 A;  4N1G A;  2MLE C;  3PFV A;  1KSO A;  1YUU A;  3PN7 C;  2KYC A;  2PMY A;  4JWQ A;  1J7Q A;  2JNF A;  1QVI Z;  3TDU A;  1N0Y A;  1YUS A;  3LL8 B;  2L4I A;  4CPV A;  3FWB A;  3CLN A;  5BPJ A;  3TDI A;  1HQV A;  2JTT A;  1YTZ C;  3JTD C;  1DJY A;  2HPS A;  2JT3 A;  4YRU A;  2MJW B;  1KQM B;  1DJZ A;  4CID A;  4C0K A;  5CSI A;  1B1G A;  1SBJ A;  3I5I B;  1LXF C;  4WRI A;  4YBH B;  1CLL A;  2WC8 A;  4ORA B;  1BG1 A;  3DVE A;  3NSI A;  5B8I B;  2BCB A;  2I94 A;  1DJX A;  5I2L A;  4MEW A;  1KQV A;  1BLQ A;  1FBV A;  1RK9 A;  1UWO A;  1XFW O;  2JNX A;  4HSZ A;  4I5L B;  3NXA A;  4YGC B;  2E6W A;  3AKA A;  5ER4 X;  2PSR A;  1CDP A;  3KO0 A;  1NCZ A;  4ETO A;  3CZT X;  3OX5 A;  1DGV A;  2HQW A;  2ZRT A;  2M1K B;  2K7C A;  3DF0 B;  4YGE B;  3WHU B;  1S26 D;  3DVM A;  1LVC D;  1G33 A;  1XFV O;  4AOM A;  1BOD A;  2M3W A;  1B9A A;  2WCE A;  2OS8 C;  1H8B A;  2Y1M A;  1UP5 A;  5AXI A;  1BT6 A;  1C7V A;  2BL0 B;  5KU1 A;  2WCF A;  4ICB A;  3O6B A;  3D0Y B;  4OR9 B;  1CMF A;  1B8R A;  1GQM A;  1OMR A;  4ZCU A;  2AUC A;  1MR8 A;  2ZN8 A;  1TNW A;  5TNC A;  4ORC B;  4C0J A;  1BOC A;  1KFU L;  1EG3 A;  1K9U A;  3BXK A;  3I5F C;  3BUM B;  4HRE E;  2JWW A;  2KAY A;  3A8R A;  2LM5 A;  1CLM A;  3CR2 A;  3IQO A;  4GGN A;  1DGU A;  1R2U A;  1JUO A;  3D0Y A;  2LMV A;  4GNK B;  1IQ5 A;  1R6P A;  2KAV A;  1UHK A;  1NP8 A;  2WCB A;  3BOW A;  4N5X A;  3VRN A;  1TOP A;  1QTX A;  2AAO A;  4DUQ A;  5HLO A;  3RM1 A;  1CDM A;  1QLK A;  1QV1 A;  3OB1 B;  1FI6 A;  1WDC C;  3ICB A;  1XK4 A;  5D7F A;  1ZUZ A;  1J7P A;  1SCV A;  1G4Y R;  1PVA A;  2H61 C;  2JZI A;  2LNK A;  4GPL B;  1A75 A;  4DRW A;  1XK4 C;  2KI6 D;  3TUY B;  1PRW A;  1RFJ A;  4R1E A;  3I5G B;  1G8I A;  3FWC A;  3MSE B;  1B8C A;  3JVT C;  2LMT A;  5D69 A;  2K2A A;  3E3R A;  2M0R A;  3I5G C;  3LK1 A;  1TIZ A;  2JC2 A;  2ZNE A;  1M31 A;  2Y5I A;  2ZRS A;  4IL1 A;  4MSP A;  1F54 A;  2PRU A;  2K0J A;  5AAN A;  1IQ3 A;  1OZS A;  1RWY A;  3EKH A;  2MRD A;  2B1U A;  4F0Z B;  2K7O A;  3SG6 A;  3KF9 A;  2BBM A;  2O5G A;  1LIN A;  2MHH A;  2JT8 A;  4GFT A;  2PAS A;  1UUR A;  2ZFD A;  2LLT A;  2JOJ A;  3A4U B;  1PK0 D;  2LC5 A;  2OTG C;  2L50 A;  1NCY A;  4E68 A;  1JBA A;  1DT7 B;  2P6B B;  1PVB A;  2Q4U A;  1YRU B;  1L7Z A;  2KBM A;  1S1E A;  5CSN A;  4HRG A;  3WNX B;  2LVV A;  1K90 D;  3K21 A;  1CDL A;  1BU3 A;  3CR4 X;  4NQG A;  1QV0 A;  1IH0 A;  1WRK A;  4C0L A;  1YRT B;  2LAP A;  1LA3 A;  1CFP A;  1A29 A;  3PAL A;  1L2O C;  2BCA A;  1SL8 A;  2F33 A;  1ALW A;  4PCW A;  1KCY A;  5AEQ A;  3PAT A;  1SR6 B;  1CFF A;  5I2O A;  2HF5 A;  1SNL A;  4MLW A;  2BE6 A;  2I7A A;  1OE9 B;  2FCE A;  4BY4 A;  1IJ6 A;  1F4O A;  5AFP A;  1CFC A;  2GGZ A;  1KSM A;  2KFF A;  4I5J A;  1TRF A;  2L5X B;  4PDZ A;  1M45 A;  2M1U A;  3LLE A;  4YI9 A;  2M29 A;  1JFJ A;  1SKT A;  2DOQ A;  3O2P A;  5HYD A;  2KI6 C;  1AHR A;  1NSH A;  3PSR A;  1AJ5 A;  4PHK A;  5GQQ C;  2MAZ A;  2IS9 A;  2OS8 B;  2CTN A;  3DVJ A;  1TNQ A;  1AK8 A;  1FPW A;  5F6T A;  1S6J A;  1D1O A;  2ISD A;  1SCM B;  1UHJ A;  1JF2 A;  2E30 A;  1JFK A;  2F3Z A;  2JXC A;  4JPZ B;  1WRL A;  2O60 A;  2FJU B;  1S5G Y;  1YVL A;  3CTN A;  2ZN9 A;  1QLS A;  1WY9 A;  2KAX A;  2KQ6 A;  2LUC A;  2JPT A;  1GGZ A;  3SIA A;  3OX6 A;  2QPT A;  1AP4 A;  1UHN A;  2FOT A;  1BR4 B;  1B4C A;  3AAJ A;  1NYA A;  3HCM A;  2COL B;  1WRZ A;  3GOF A;  1N2D A;  2KHN A;  4PE0 A;  3WXA A;  3TS5 C;  1KK8 C;  1N65 A;  3SG3 A;  3VRO A;  1NWD A;  4TNC A;  3EK7 A;  1F70 A;  3I5F B;  1REC A;  1IKU A;  4P5O E;  3RLZ A;  2CBL A;  4PE7 A;  1WDC B;  1ZMZ A;  4FTG A;  1C7W A;  2WOR A;  2LP3 A;  4BY5 A;  1NIW A;  1EH2 A;  3H4S E;  4L9M A;  1FW4 A;  3EVR A;  1S6I A;  2LP2 A;  5I2Q A;  2A4J A;  2M49 B;  1K9P A;  2CCM A;  1RRO A;  2GV5 A;  4YGA A;  1CM1 A;  2ZND A;  3F45 A;  3SG7 A;  1KQM C;  2BKH B;  3LCP C;  1MQ1 A;  4PHJ A;  1YX8 A;  1OOJ A;  1J7O A;  2LVJ A;  3OB2 B;  4MBE A;  1PSR A;  1GJY A;  2LHL A;  1KFU S;  3JVT B;  3IF7 A;  4PE4 A;  5I8N A;  1MXE A;  1UUS A;  4GBA A;  1SW8 A;  1K95 A;  5CPV A;  1EL4 A;  1ZFS A;  2KYF A;  2JT0 A;  1SR6 C;  3VRQ A;  3TDZ A;  1TCF A;  3I5I C;  3DF0 A;  2K7D A;  2KNE A;  1QIV A;  1XFX O;  3AAK A;  1QVI Y;  4P2Y B;  5ER5 A;  5J3X A;  2NCO A;  3TZ1 A;  1SK6 D;  1AVS A;  2AMI A;  1TCO B;  2KFG A;  2LCP A;  2LLS A;  3VRP A;  1FI5 A;  1YUR A;  2FCD A;  1U5I B;  2EGD A;  4MN0 A;  4DCK A;  2BKI B;  1XYD A;  2LMU A;  5KSZ A;  1UHI A;  2LVK A;  2KQY A;  2NCP A;  4OCI A;  4D1E A;  1H4B A;  4A4C A;  2M8U A;  5FYX A;  3AKB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...