2H2KA

Crystal structure analysis of human s100a13
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
93
structure length
93
Chain Sequence
SLMAAEPLTELEESIETVVTTFFTFARQEGRKDSLSVNEFKELVTQQLPHLLKDVGSLDEKMKSLDVNQDSELKFNEYWRLIGELAKEIRKKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords Protein S100-A13
publication title Crystal structure study on human S100A13 at 2.0 A resolution
pubmed doi rcsb
source organism Homo sapiens
total genus 36
structure length 93
sequence length 93
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2h2kA00
1TNQA 3SG7A 4DS7A 4NQGA 1HT9A 4CFQA 4DIRA 1OMVA 1WY9A 2V53A 4ORCB 3FS7A 2M1KB 4P2YB 3TDUA 1V1GA 1JFJA 1KK8C 1PULA 2KFFA 2BECA 3WNXB 1JF2A 1CFFA 2LNKA 2GGZA 4HREE 3NSKA 3SIBA 1CTRA 1QJTA 1YUSA 3GK2A 1DT7B 1D1OA 1F71A 1F55A 1JSAA 1OMRA 2NXQA 1NSHA 1NCYA 1VRKA 4NDBA 3VGOA 1DJZA 2JZIA 3O6BA 4AQIA 3EVUA 1TOPA 1A03A 1QX7A 1QLSA 1YTZC 1AJ5A 4MRXA 3CWGA 1S6CA 2MAZA 5B8IB 5JOLA 5F6TA 3CLNA 1IRJA 1N0YA 3I5GC 4MVFA 1EXRA 3DVJA 3PALA 2LMUA 4P5OE 2LAPA 3OP0A 1WLZA 2ZFDA 2F33A 1KQMB 1IG5A 4OV2A 4GGFC 2OTGB 3FWCA 2HQ8A 4YGBB 1Q80A 2SCPA 2R2IA 1IKUA 1YVLA 1CM4A 4JWQA 4MZJA 1ZUZA 3WXAA 4N5XA 4ZCUA 3I5IC 2L0PA 2NCOA 2ZRTA 3TDZA 3EK7A 1TRFA 2LP2A 1IJ6A 1F8HA 2CBLA 3LK0A 4I5JA 4DCKA 3VRRA 1U5IA 3ZNIA 3PN7C 1F70A 2KSPA 2NZ0A 2WCBA 3D10A 1SPYA 5K89A 2LUXA 2M1UA 1MXLC 3WHTB 1DVIA 5CSIA 4NDCA 4NDDA 2CTNA 1K9UA 2JTZA 1Y6WA 4C0KA 1M39A 1ZOTB 5DKQA 1J55A 3EK8A 3OB1B 2BBMA 1BODA 1KFXL 3KHEA 2ZRSA 3BUOB 4U8DA 2L4IA 2NLNA 3NSIA 1SMGA 2KQYA 4GFTA 3AKAA 1IGVA 2H61A 4GNKB 1S3PA 1XYDA 3WHUB 1AHRA 3BOWB 2JU0A 3I5FB 5CPVA 1J1DA 1XFWO 3K21A 2KQ6A 2ZKMX 2L5XB 3HX4A 5I2QA 4HSZA 1LKJA 1UHNA 2BE4A 1KSOA 2BBNA 1RTP1 1MQ1A 1SKTA 1GGZA 2MLFC 1OE9B 4QJ5B 2K0JA 5KU1A 1KSMA 3NSLA 3JTDC 4QJ3B 4GBAA 1JUOA 4PHMA 1PSRA 2B1UA 2JNFA 1KK7Z 1F54A 3SJSA 1DMOA 1S5GZ 1PK0D 2M97A 2OS8B 1ODBA 1TCFA 1Y1UA 2I18A 4C0JA 1CDLA 1KFUL 3E3RA 1MF8B 4OR9B 1ALWA 2BKHB 4HRGA 2ZN9A 1CB1A 4OCIA 1A75B 1SYMA 2LC5A 2JT8A 1JFKA 2OPOA 3IF7A 3PFVA 4MSPA 3I5HB 4ORAB 2F8PA 1B1GA 3BQ3A 4IL1A 2JNXA 2WC8A 2ISDA 1BG1A 1SRAA 1UHIA 1B8LA 3LL8B 1L7ZA 1DJXA 5I2LA 1KQVA 1BMOA 3KPXA 4CLNA 3LCPC 2E30A 1LINA 1C07A 1NWDA 3DF0A 2Q91A 5HYDA 4WQ3A 1BF5A 1Y1AA 1SCMB 2F3ZA 3D0YB 1NX2A 1V1FA 1ZMZA 4YBHB 1AK8A 2I2RE 2JPTA 3IQQA 2FCEA 2P6BB 1QASA 4MEWA 1ALVA 2BL0C 1K93D 2O5GA 4I5NB 4D1EA 1C7WA 1UHKA 4XJKB 2E6WA 2EHBA 1MWNA 1KQMC 3EVRA 2LMTA 1Y0VH 2LVVA 2JXCA 2OTGC 1RFJA 2KFGA 2M0RA 3CR5X 1RWYA 5HKWA 3TUYB 1TNWA 2KI6D 1M31A 1AUIB 2KYFA 2BCAA 2EGDA 1C7VA 1NX3A 4YRUA 4YGCB 1EJ3A 1SL7A 2KGBC 1K94A 2ZN8A 4XYNA 4PALA 2PRUA 5KTYA 1GGWA 2BCXA 4OKHA 2WCFA 4PHJA 2K8MB 1N2DA 1QVIZ 2LVJA 2KAYA 3EK4A 3O4YA 4AOMA 1QIVA 2Y1NA 1SR6B 3SIAA 1SCVA 3ZWHA 2KAVA 1B47A 2A4JA 3FWBA 1A29A 2GV5A 3RLZA 1QVIY 1FF1A 2ZNDA 4GUKA 2Y1MA 2MBXA 2H61C 1JBAA 1QXPA 4ICBA 1UHHA 3BXKA 3CTNA 1TCOB 1IJ5A 1TTXA 2LV7A 1CFDA 1XK4A 1KWOC 1NUBA 1OOJA 1OZSA 1UUSA 4PE1A 4PDZA 3A4UB 1AVSA 1KK8B 4F0ZB 1TNXA 3AKBA 4GAOA 3PLFB 1DF0B 1MXEA 1BR4B 1CLBA 1NYAA 1NIWA 2AAOA 4MZLA 4ORBB 1IQ3A 1CDNA 2LE9B 1XFZO 2HQWA 3SG6A 1DF0A 1XA5A 1XFUO 2FJUB 3QRXA 2FOTA 4DRWA 1CFCA 1WDCB 2F2PA 2QPTA 4ETOA 1EG4A 2LCPA 2Q4UA 3ICBA 2LUCA 3OX6A 1BJFA 1SBJA 3JVTC 3DVMA 3TS5B 2SASA 1XFYO 1MUXA 3I5HC 2JTTA 4E68A 2MJWB 1QX2A 2LVIA 3CZTX 1OQPA 3BOWA 4UPGA 4R1EA 4AQJA 1OZOA 1UWOA 2EC6C 2IS9A 5AFPA 2LLUA 1OSAA 5JJGA 1JC2A 2LM5A 1QV0A 2ZNEA 2KAXA 2MRDA 2KFHA 1DGVA 1EG3A 1BR1B 3I5IB 2G9BA 1R2UA 4PE0A 5D7FA 2M7NA 1K95A 5PALA 1B8CA 5TNCA 3AAKA 4I5KA 5ER4X 1W7IB 1JWDA 2AUCA 2LHIA 2BE6A 3BUXB 2LLTA 4Q04A 1FI5A 2F3YA 1S6IA 5HLOA 3O78A 4MRYA 2F2OA 2KNEA 1A4PA 1MR8A 2Y4QA 3SG3A 1CNPA 1M46A 1LXFC 1SW8A 1KK7Y 2LHLA 3O2PA 1S5GY 2I94A 1CLMA 1BU3A 3GOFA 1DJGA 4PE7A 1K9PA 1A75A 3TZ1A 3A8RA 2L98A 2WOSA 2KI4B 3GK1A 2D8NA 1W7JB 5BPJA 2L4HA 2PSRA 1PVBA 1GJYA 2CCMA 1QX5B 2KOTA 1ZFSA 4YGDB 4CFRA 4GGNA 4FTGA 4YI8A 2M3WA 1K96A 2NCPA 1K9KA 2KHNA 2WNDA 3D0YA 1SR6C 1BOCA 1K2HA 2K61A 2KDHA 1FPWA 4PE4A 1J7PA 5ER5A 1QV1A 1DJIA 1B7TZ 1TNPA 3DD4A 4WRIA 4JQ0D 4XJKA 4HRHA 1N65A 1SK6D 1XK4C 2FCDA 3BUMB 5J3XA 3MSEB 3BUNB 3PM8A 1CM1A 1YUTA 2JULA 2KGRA 2K2AA 2PALA 4YGAA 5I8NA 1LA3A 1NPQA 5AEQA 3KO0A 2CXJA 1B7TY 3VROA 1X02A 5I2OA 1SNLA 4MN0A 1SY9A 1RECA 5CSJA 1XFXO 1DJYA 2PVBA 5KSZA 4BY4A 4FQOA 4A4CA 1IWQA 1CDPA 1CDMA 4I5LB 1XO5A 4BY5A 1YRUB 1E8AA 2CNPA 2COLB 2KI6C 3KEVA 1QS7A 3EVVA 2LMVA 5DKRA 2M7LA 1J7RA 2JOJA 1AP4A 5HLVA 2QACA 1L2OB 1R6PA 1EL4A 1RK9A 1F4OA 3HCMA 5AANA 1NP8A 1FI6A 1WDCC 1QATA 2CT9A 1MHOA 1TIZA 2K7OA 2M29A 1H8BA 3F45A 1HQVA 1YURA 3CR4X 2I7AA 1IH0A 2GGMA 1PVAA 1NX1A 3I5FC 1RJVA 2O60A 5HKYA 2BL0B 3TS5C 1G8IA 4M2QA 1M63B 1DTLA 1DGUA 5G08A 1NX0A 1G4YR 2DOQA 2M8UA 3H4SE 1WRLA 4QJ4B 2G2BA 1NCXA 1WRKA 2L50A 1BLQA 3RM1A 2MHHA 4M2PA 3FIAA 3LK1A 2K2FA 1B4CA 1YRTB 2K7CA 3CS1A 1CMGA 1K90D 2VRGA 2JT3A 3SG2A 5IBWA 1CLLA 4USLA 1U5IB 3LLEA 2JC2A 3CR2A 1AJ4A 1XVJA 1CKKA 2OS8C 4YGEB 1YX7A 4PCWA 2KBMA 1WLMA 4TNCA 2HF5A 1PSBA 2WCEA 3EKHA 1GQMA 1QTXA 3I5GB 1SL9A 2LANA 3OHMB 4ZCVA 2WORA 3BYAA 3BUWB 4PHNA 1SL8A 1M45A 3DVKA 1J7QA 3AAJA 3CGAA 2PASA 3NSOA 1UP5A 4L9MA 2JQ6A 2LLSA 2KI4C 2L51A 2PMYA 1KFXS 3EKJA 1EH2A 4MZKA 1QIWA 3DVEA 1YX8A 3TDIA 3IQOA 1WRZA 4GGFA 4N1GA 5CSFA 3VRQA 2LVKA 4C0LA 1NCZA 2H2KA 1SCMC 2Y5IA 1KWOB 2MA2A 5D69A 4N1FA 1DJHA 1H4BA 4M2OA 4MBEA 1TN4A 1IQ5A 3OX5A 1YR5A 4PHKA 1B9AA 3OB2B 2K7BA 3NXAA 5HKZA 3PN7B 1PRWA 1Y1XA 1CMFA 2L2EA 1UHJA 1CFPA 1S26D 1OMDA 2BCBA 1BT6A 2KBIA 4DUQA 1K8UA 1J1EA 1B8RA 2MLEC 1FW4A 1KCYA 2JXLA 3TUYC 1ZACA 1YUUA 2JWWA 5AXIA 5CSNA 1UURA 2JT0A 1A2XA 1QLKA 4A4BA 1S36A 2AMIA 1F4QA 5AERA 2RGIA 3M0WA 1S1EA 1PALA 2BKIB 1G33A 4WQ2A 2TN4A 2HPSA 1KFUS 2M49B 1YVHA 3GK4X 3PATA 1XFVO 2HETA 5GQQC 3KF9A 1LA0A 3VRNA 1RROA 1JF0A 2M9GA 3C1VA 3JVTB 4CPVA 1FBVA 5FYXA 5DKNA 4OVNF 4YI9A 3VRPA 2JRFA 4MLWA 3DF0B 1S6JA 3PSRA 2EC6B 4GPLB 2K7DA 2KYCA 1DJWA 4JPZB 2LP3A 1J7OA 1L2OC 3SG4A 3SG5A 4CIDA 1LVCD 3JTDB
chains in the Genus database with same CATH superfamily
2P71A 1TNQA 3SG7A 4DS7A 2L2CA 5HL1A 4NQGA 3B6XA 2BNXA 1HT9A 4CFQA 1DC1A 4DIRA 1OMVA 1WY9A 2V53A 4ORCB 3FS7A 2M1KB 4P2YB 3TDUA 1V1GA 1JFJA 1KK8C 3BJHA 1PULA 2KFFA 2BECA 3WNXB 1JF2A 2FJYA 1CFFA 2LNKA 4JKTA 2GGZA 4HREE 3NSKA 3SIBA 1CTRA 1QJTA 1YUSA 3GK2A 1DT7B 1D1OA 2QEHA 1F71A 1F55A 1JSAA 1OMRA 2NXQA 1NSHA 1NCYA 1VRKA 3FE9A 3SS5A 4NDBA 5FI6A 3VGOA 1DJZA 2JZIA 3O6BA 4AQIA 3EVUA 1TOPA 1A03A 3DXLA 1QX7A 1QLSA 1YTZC 1AJ5A 4MRXA 3CWGA 1S6CA 2MAZA 5B8IB 5JOLA 5F6TA 3CLNA 1IRJA 1N0YA 3I5GC 4MVFA 1EXRA 3DVJA 3PALA 2LMUA 4P5OE 2LAPA 3OP0A 1OOIX 2P70A 1WLZA 2ZFDA 3SS3A 2BAPA 2F33A 1KQMB 1IG5A 3FE6A 4OV2A 4GGFC 2OTGB 3FWCA 2HQ8A 4YGBB 1Q80A 2H8VA 2SCPA 3BFHA 1OOHA 2R2IA 1YVLA 2WCMA 1CM4A 4JWQA 1IKUA 4MZJA 1ZUZA 3WXAA 4N5XA 4ZCUA 3I5IC 2WCHA 2L0PA 2NCOA 2ZRTA 3TDZA 3EK7A 1TRFA 2LP2A 2QDIA 1IJ6A 1F8HA 2CBLA 3LK0A 4I5JA 3S0BA 4DCKA 3VRRA 1U5IA 3ZNIA 3PN7C 3EG5B 1F70A 2KSPA 2NZ0A 2QEVA 2WCBA 3D10A 1SPYA 5K89A 2LUXA 2M1UA 1MXLC 3WHTB 1DVIA 5CSIA 1GM0A 4NDCA 4NDDA 2CTNA 1K9UA 2JTZA 3S0EA 1Y6WA 4C0KA 1M39A 1ZOTB 5DKQA 1J55A 3EK8A 3OB1B 2BBMA 1BODA 1KFXL 3KHEA 2ZRSA 3BUOB 4U8DA 2L4IA 3UO9A 2NLNA 3NSIA 1SMGA 2KQYA 4GFTA 3AKAA 3PM2A 1IGVA 3SS4A 3L4AA 2H61A 4GNKB 1S3PA 1XYDA 4INWA 3D75A 1AHRA 3BOWB 2JU0A 3I5FB 5CPVA 3WHUB 1J1DA 1XFWO 3K21A 2KQ6A 2ZKMX 2L5XB 3HX4A 5I2QA 1T14A 4HSZA 1LKJA 1UHNA 2BE4A 1KSOA 2BBNA 1RTP1 1MQ1A 1SKTA 1C3YA 1GGZA 2MLFC 3DY9A 1OE9B 4QJ5B 2K0JA 5KU1A 1KSMA 3NSLA 3JTDC 4QJ3B 3VB1A 4GBAA 1JUOA 4PHMA 1PSRA 2B1UA 2JNFA 1KK7Z 2QEOA 1F54A 3SJSA 3BFBA 1S5GZ 1DMOA 1PK0D 2M97A 2OS8B 1ODBA 1TCFA 1Y1UA 2I18A 4C0JA 1CDLA 1KFUL 3E3RA 1MF8B 2WC6A 4OR9B 1ALWA 2BKHB 4HRGA 2ZN9A 1CB1A 4OCIA 1A75B 1SYMA 2LC5A 1TUZA 3CDNA 2JT8A 1JFKA 2OPOA 3IF7A 3PFVA 4MSPA 3I5HB 4ORAB 2F8PA 3R72A 3BQ3A 4IL1A 1B1GA 2JNXA 2WC8A 3NHIA 3NHTA 2ISDA 1BG1A 1SRAA 1UHIA 1B8LA 3LL8B 1L7ZA 1DJXA 5I2LA 1KQVA 1BMOA 3KPXA 3Q8IA 4CLNA 3LCPC 2E30A 1LINA 1C07A 1NWDA 3DF0A 2Q91A 5HYDA 4WQ3A 1BF5A 1Y1AA 1QWVA 1SCMB 2F3ZA 3D0YB 1NX2A 1V1FA 1ZMZA 4YBHB 3L47A 1AK8A 2I2RE 2JPTA 3IQQA 2FCEA 2P6BB 1QASA 4MEWA 4PT1A 1ALVA 2BL0C 1K93D 2O5GA 4I5NB 4D1EA 1C7WA 1UHKA 4XJKB 2E6WA 2EHBA 1MWNA 1KQMC 3EVRA 2LMTA 3B88A 1Y0VH 2LVVA 2JXCA 2OTGC 1RFJA 2KFGA 3R1OA 5I94A 2M0RA 3CR5X 1RWYA 5HKWA 3TUYB 1TNWA 2KI6D 1M31A 1AUIB 2KYFA 2BCAA 2EGDA 1C7VA 1NX3A 4YRUA 4YGCB 1EJ3A 1SL7A 2KGBC 1K94A 2ZN8A 4XYNA 2WCJA 4PALA 3OBVA 1DELA 2PRUA 5KTYA 1ORGA 1GGWA 2BCXA 4OKHA 2WCFA 4PHJA 2K8MB 1N2DA 1QVIZ 2LVJA 2KAYA 3EK4A 3O4YA 3OGNA 4AOMA 4INXA 1QIVA 2Y1NA 1SR6B 3SIAA 2PQLA 4FQTA 4IJ7A 1SCVA 3BFAA 2KAVA 1B47A 3ZWHA 2A4JA 3FWBA 1A29A 2GV5A 3RLZA 1QVIY 1FF1A 1OOGA 2ZNDA 4GUKA 2Y1MA 2MBXA 2H61C 1JBAA 1QXPA 4ICBA 1UHHA 3BXKA 1TWOA 3CTNA 1TCOB 5FI7A 1IJ5A 1TTXA 2LV7A 1CFDA 1XK4A 1KWOC 1NUBA 1OOJA 1OZSA 1UUSA 4PE1A 4PDZA 3A4UB 1AVSA 1KK8B 3FE8A 1TNXA 4F0ZB 3AKBA 4GAOA 4OZDA 3D78A 3PLFB 1DF0B 1MXEA 1BR4B 1CLBA 1NYAA 1NIWA 2AAOA 4MZLA 2KLDA 4ORBB 1IQ3A 1CDNA 1W9ZA 2LE9B 1XFZO 2HQWA 3SG6A 1DF0A 1XA5A 1XFUO 2FJUB 3QRXA 2FOTA 4DRWA 1CFCA 3N7HA 1P28A 1WDCB 2F2PA 2QPTA 4ETOA 1EG4A 2LCPA 2Q4UA 3ICBA 2LUCA 2JPOA 3OX6A 1BJFA 1SBJA 2L5YA 2KLEA 3JVTC 3DVMA 3TS5B 2SASA 3DYEA 1XFYO 1MUXA 3I5HC 2JTTA 5FI2A 4E68A 2MJWB 1QX2A 2LVIA 3CZ1A 1OQPA 3CZTX 3BOWA 4UPGA 4R1EA 4AQJA 3S0DA 1OZOA 1UWOA 2EC6C 2IS9A 5AFPA 2LLUA 1OSAA 5JJGA 1JC2A 2LM5A 1QV0A 2ZNEA 2KAXA 1OW4A 2MRDA 2KFHA 1DGVA 1EG3A 1BR1B 3I5IB 2G9BA 1R2UA 2KPHA 4PE0A 5D7FA 2M7NA 1K95A 5PALA 1B8CA 5TNCA 3AAKA 4I5KA 5ER4X 1W7IB 1JWDA 1IIOA 2AUCA 2LHIA 2BE6A 3BUXB 2LLTA 4Q04A 5D3OA 1FI5A 2F3YA 1S6IA 5HLOA 3O78A 4MRYA 2F2OA 2KNEA 1A4PA 1MR8A 2Y4QA 3SG3A 1CNPA 1M46A 1LXFC 3R1VA 1SW8A 1KK7Y 2LHLA 3O2PA 1S5GY 2I94A 1CLMA 1BU3A 3GOFA 2YGUA 1DJGA 4PE7A 1K9PA 1A75A 3TZ1A 3D76A 3A8RA 2L98A 3CABA 1SSEB 2WOSA 2KI4B 3GK1A 2D8NA 1W7JB 5BPJA 2L4HA 1Z4HA 2PSRA 1PVBA 1GJYA 2WC5A 2CCMA 1C3ZA 1QX5B 3B7AA 2KOTA 3D73A 1ZFSA 4YGDB 4CFRA 4GGNA 4FTGA 4YI8A 2M3WA 3QMEA 1K96A 2NCPA 1K9KA 2KHNA 2WNDA 4JD9A 3D0YA 1SR6C 1BOCA 1K2HA 2K61A 2KDHA 3CYZA 1FPWA 4PE4A 1J7PA 5ER5A 1QV1A 1DJIA 1B7TZ 1TNPA 3DD4A 4WRIA 4JQ0D 3R1PA 4XJKA 4HRHA 1N65A 1SK6D 1XK4C 2FCDA 3BUMB 5J3XA 3MSEB 3BUNB 3PM8A 1CM1A 1YUTA 2JULA 2KGRA 2K2AA 2PALA 4YGAA 2WCKA 1LA3A 1NPQA 5AEQA 3KO0A 5I8NA 2CXJA 1B7TY 3VROA 1X02A 5I2OA 1SNLA 4MN0A 1SY9A 1XFRA 1RECA 5CSJA 1XFXO 1DJYA 2PVBA 5KSZA 4BY4A 4FQOA 4A4CA 3D77A 1IWQA 1CDPA 1CDMA 4I5LB 1XO5A 4BY5A 1YRUB 1E8AA 2CNPA 2COLB 2KI6C 3UNWA 3CZ0A 1Z2CB 3KEVA 1QS7A 3EVVA 3K1EA 2LMVA 5DKRA 2M7LA 1J7RA 2JOJA 1AP4A 5HLVA 2QACA 1L2OB 1R6PA 1EL4A 1RK9A 1F4OA 3HCMA 5AANA 1NP8A 3IVTA 1FI6A 1WDCC 3PJIA 1QATA 2CT9A 3CZ2A 1MHOA 1TIZA 2K7OA 2M29A 1H8BA 1TUJA 2ERBA 3F45A 1HQVA 1YURA 3CR4X 2I7AA 1IH0A 1DQEA 2GGMA 1PVAA 1NX1A 3I5FC 3O4XA 1RJVA 2O60A 5HKYA 2BL0B 3TS5C 1G8IA 4M2QA 1M63B 1DTLA 1DGUA 5G08A 1NX0A 1G4YR 2DOQA 2M8UA 3H4SE 1WRLA 4QJ4B 2G2BA 1NCXA 1WRKA 2L50A 1BLQA 3RM1A 2MHHA 1LS8A 4M2PA 3FIAA 3LK1A 2K2FA 1B4CA 1YRTB 2K7CA 3CS1A 3DZTA 1CMGA 1K90D 2VRGA 2JT3A 3SG2A 5IBWA 1CLLA 4USLA 1U5IB 3LLEA 2JC2A 2QEBA 1AJ4A 1XVJA 3CR2A 1CKKA 2OS8C 4YGEB 1YX7A 4PCWA 2KBMA 1WLMA 4TNCA 2HF5A 1PSBA 2WCEA 3EKHA 1GQMA 1QTXA 3I5GB 1SL9A 2LANA 3OHMB 4ZCVA 2WORA 3BYAA 4F7FA 3BUWB 3S0GA 4PHNA 1SL8A 1M45A 3DVKA 1J7QA 3AAJA 2GTEA 3CGAA 2PASA 3NSOA 5DICA 1UP5A 4L9MA 2JQ6A 2LLSA 5EL2A 2KI4C 2L51A 2PMYA 1KFXS 3EKJA 1EH2A 4MZKA 1QIWA 3DVEA 1YX8A 3TDIA 3IQOA 1WRZA 4GGFA 4N1GA 3V2LA 5CSFA 3VRQA 2LVKA 4C0LA 4KYNA 1NCZA 1DEKA 2H2KA 1SCMC 2Y5IA 1KWOB 2MA2A 5D69A 4N1FA 1DJHA 1H4BA 4M2OA 4MBEA 3RZSA 1TN4A 1IQ5A 3OX5A 1YR5A 4PHKA 1B9AA 2WCLA 2K7BA 3NXAA 3OB2B 5HKZA 3PN7B 1PRWA 1Y1XA 1CMFA 2L2EA 1UHJA 1CFPA 1S26D 1OMDA 2BCBA 1BT6A 2KBIA 3B86A 1K8UA 4DUQA 1J1EA 2K60A 1B8RA 1OOFA 1FW4A 2MLEC 1KCYA 2JXLA 3TUYC 1ZACA 1YUUA 2JWWA 5AXIA 5CSNA 1UURA 2JT0A 1A2XA 1QLKA 2PYQA 4A4BA 1S36A 2AMIA 1F4QA 5AERA 2RGIA 3M0WA 1S1EA 1PALA 2BKIB 1G33A 4WQ2A 2TN4A 2HPSA 1KFUS 2M49B 1YVHA 3GK4X 3PATA 3S0AA 1XFVO 2HETA 5GQQC 3KF9A 1LA0A 3VRNA 1RROA 1JF0A 2M9GA 3C1VA 3D74A 3L4LA 3NGVA 3JVTB 4CPVA 1FBVA 5FYXA 5DKNA 4OVNF 4YI9A 3VRPA 2JRFA 4MLWA 3DF0B 1S6JA 3PSRA 2EC6B 4GPLB 3S0FA 2K7DA 2KYCA 1DJWA 4JPZB 2LP3A 1J7OA 1L2OC 3SG4A 3SG5A 4CIDA 3B87A 1LVCD 3JTDB
chains in the Genus database with same CATH topology
1TNQA 3SG7A 4DS7A 4NQGA 1HT9A 4CFQA 4DIRA 1OMVA 1WY9A 2V53A 4ORCB 3FS7A 2M1KB 4P2YB 3TDUA 1V1GA 1JFJA 1KK8C 1PULA 2KFFA 2BECA 3WNXB 1JF2A 1CFFA 2LNKA 2GGZA 4HREE 3NSKA 3SIBA 1CTRA 1QJTA 1YUSA 3GK2A 1DT7B 1D1OA 1F71A 1F55A 1JSAA 1OMRA 2NXQA 1NSHA 1NCYA 1VRKA 4NDBA 3VGOA 1DJZA 2JZIA 3O6BA 4AQIA 3EVUA 1TOPA 1A03A 1QX7A 1QLSA 1YTZC 1AJ5A 4MRXA 3CWGA 1S6CA 2MAZA 5B8IB 5JOLA 5F6TA 3CLNA 1IRJA 1N0YA 3I5GC 4MVFA 1EXRA 3DVJA 3PALA 2LMUA 4P5OE 2LAPA 3OP0A 1WLZA 2ZFDA 2F33A 1KQMB 1IG5A 4OV2A 4GGFC 2OTGB 3FWCA 2HQ8A 4YGBB 1Q80A 2SCPA 2R2IA 1IKUA 1YVLA 1CM4A 4JWQA 4MZJA 1ZUZA 3WXAA 4N5XA 4ZCUA 3I5IC 2L0PA 2NCOA 2ZRTA 3TDZA 3EK7A 1TRFA 2LP2A 1IJ6A 1F8HA 2CBLA 3LK0A 4I5JA 4DCKA 3VRRA 1U5IA 3ZNIA 3PN7C 1F70A 2KSPA 2NZ0A 2WCBA 3D10A 1SPYA 5K89A 2LUXA 2M1UA 1MXLC 3WHTB 1DVIA 5CSIA 4NDCA 4NDDA 2CTNA 1K9UA 2JTZA 1Y6WA 4C0KA 1M39A 1ZOTB 5DKQA 1J55A 3EK8A 3OB1B 2BBMA 1BODA 1KFXL 3KHEA 2ZRSA 3BUOB 4U8DA 2L4IA 2NLNA 3NSIA 1SMGA 2KQYA 4GFTA 3AKAA 1IGVA 2H61A 4GNKB 1S3PA 1XYDA 3WHUB 1AHRA 3BOWB 2JU0A 3I5FB 5CPVA 1J1DA 1XFWO 3K21A 2KQ6A 2ZKMX 2L5XB 3HX4A 5I2QA 4HSZA 1LKJA 1UHNA 2BE4A 1KSOA 2BBNA 1RTP1 1MQ1A 1SKTA 1GGZA 2MLFC 1OE9B 4QJ5B 2K0JA 5KU1A 1KSMA 3NSLA 3JTDC 4QJ3B 4GBAA 1JUOA 4PHMA 1PSRA 2B1UA 2JNFA 1KK7Z 1F54A 3SJSA 1DMOA 1S5GZ 1PK0D 2M97A 2OS8B 1ODBA 1TCFA 1Y1UA 2I18A 4C0JA 1CDLA 1KFUL 3E3RA 1MF8B 4OR9B 1ALWA 2BKHB 4HRGA 2ZN9A 1CB1A 4OCIA 1A75B 1SYMA 2LC5A 2JT8A 1JFKA 2OPOA 3IF7A 3PFVA 4MSPA 3I5HB 4ORAB 2F8PA 1B1GA 3BQ3A 4IL1A 2JNXA 2WC8A 2ISDA 1BG1A 1SRAA 1UHIA 1B8LA 3LL8B 1L7ZA 1DJXA 5I2LA 1KQVA 1BMOA 3KPXA 4CLNA 3LCPC 2E30A 1LINA 1C07A 1NWDA 3DF0A 2Q91A 5HYDA 4WQ3A 1BF5A 1Y1AA 1SCMB 2F3ZA 3D0YB 1NX2A 1V1FA 1ZMZA 4YBHB 1AK8A 2I2RE 2JPTA 3IQQA 2FCEA 2P6BB 1QASA 4MEWA 1ALVA 2BL0C 1K93D 2O5GA 4I5NB 4D1EA 1C7WA 1UHKA 4XJKB 2E6WA 2EHBA 1MWNA 1KQMC 3EVRA 2LMTA 1Y0VH 2LVVA 2JXCA 2OTGC 1RFJA 2KFGA 2M0RA 3CR5X 1RWYA 5HKWA 3TUYB 1TNWA 2KI6D 1M31A 1AUIB 2KYFA 2BCAA 2EGDA 1C7VA 1NX3A 4YRUA 4YGCB 1EJ3A 1SL7A 2KGBC 1K94A 2ZN8A 4XYNA 4PALA 2PRUA 5KTYA 1GGWA 2BCXA 4OKHA 2WCFA 4PHJA 2K8MB 1N2DA 1QVIZ 2LVJA 2KAYA 3EK4A 3O4YA 4AOMA 1QIVA 2Y1NA 1SR6B 3SIAA 1SCVA 3ZWHA 2KAVA 1B47A 2A4JA 3FWBA 1A29A 2GV5A 3RLZA 1QVIY 1FF1A 2ZNDA 4GUKA 2Y1MA 2MBXA 2H61C 1JBAA 1QXPA 4ICBA 1UHHA 3BXKA 3CTNA 1TCOB 1IJ5A 1TTXA 2LV7A 1CFDA 1XK4A 1KWOC 1NUBA 1OOJA 1OZSA 1UUSA 4PE1A 4PDZA 3A4UB 1AVSA 1KK8B 4F0ZB 1TNXA 3AKBA 4GAOA 3PLFB 1DF0B 1MXEA 1BR4B 1CLBA 1NYAA 1NIWA 2AAOA 4MZLA 4ORBB 1IQ3A 1CDNA 2LE9B 1XFZO 2HQWA 3SG6A 1DF0A 1XA5A 1XFUO 2FJUB 3QRXA 2FOTA 4DRWA 1CFCA 1WDCB 2F2PA 2QPTA 4ETOA 1EG4A 2LCPA 2Q4UA 3ICBA 2LUCA 3OX6A 1BJFA 1SBJA 3JVTC 3DVMA 3TS5B 2SASA 1XFYO 1MUXA 3I5HC 2JTTA 4E68A 2MJWB 1QX2A 2LVIA 3CZTX 1OQPA 3BOWA 4UPGA 4R1EA 4AQJA 1OZOA 1UWOA 2EC6C 2IS9A 5AFPA 2LLUA 1OSAA 5JJGA 1JC2A 2LM5A 1QV0A 2ZNEA 2KAXA 2MRDA 2KFHA 1DGVA 1EG3A 1BR1B 3I5IB 2G9BA 1R2UA 4PE0A 5D7FA 2M7NA 1K95A 5PALA 1B8CA 5TNCA 3AAKA 4I5KA 5ER4X 1W7IB 1JWDA 2AUCA 2LHIA 2BE6A 3BUXB 2LLTA 4Q04A 1FI5A 2F3YA 1S6IA 5HLOA 3O78A 4MRYA 2F2OA 2KNEA 1A4PA 1MR8A 2Y4QA 3SG3A 1CNPA 1M46A 1LXFC 1SW8A 1KK7Y 2LHLA 3O2PA 1S5GY 2I94A 1CLMA 1BU3A 3GOFA 1DJGA 4PE7A 1K9PA 1A75A 3TZ1A 3A8RA 2L98A 2WOSA 2KI4B 3GK1A 2D8NA 1W7JB 5BPJA 2L4HA 2PSRA 1PVBA 1GJYA 2CCMA 1QX5B 2KOTA 1ZFSA 4YGDB 4CFRA 4GGNA 4FTGA 4YI8A 2M3WA 1K96A 2NCPA 1K9KA 2KHNA 2WNDA 3D0YA 1SR6C 1BOCA 1K2HA 2K61A 2KDHA 1FPWA 4PE4A 1J7PA 5ER5A 1QV1A 1DJIA 1B7TZ 1TNPA 3DD4A 4WRIA 4JQ0D 4XJKA 4HRHA 1N65A 1SK6D 1XK4C 2FCDA 3BUMB 5J3XA 3MSEB 3BUNB 3PM8A 1CM1A 1YUTA 2JULA 2KGRA 2K2AA 2PALA 4YGAA 5I8NA 1LA3A 1NPQA 5AEQA 3KO0A 2CXJA 1B7TY 3VROA 1X02A 5I2OA 1SNLA 4MN0A 1SY9A 1RECA 5CSJA 1XFXO 1DJYA 2PVBA 5KSZA 4BY4A 4FQOA 4A4CA 1IWQA 1CDPA 1CDMA 4I5LB 1XO5A 4BY5A 1YRUB 1E8AA 2CNPA 2COLB 2KI6C 3KEVA 1QS7A 3EVVA 2LMVA 5DKRA 2M7LA 1J7RA 2JOJA 1AP4A 5HLVA 2QACA 1L2OB 1R6PA 1EL4A 1RK9A 1F4OA 3HCMA 5AANA 1NP8A 1FI6A 1WDCC 1QATA 2CT9A 1MHOA 1TIZA 2K7OA 2M29A 1H8BA 3F45A 1HQVA 1YURA 3CR4X 2I7AA 1IH0A 2GGMA 1PVAA 1NX1A 3I5FC 1RJVA 2O60A 5HKYA 2BL0B 3TS5C 1G8IA 4M2QA 1M63B 1DTLA 1DGUA 5G08A 1NX0A 1G4YR 2DOQA 2M8UA 3H4SE 1WRLA 4QJ4B 2G2BA 1NCXA 1WRKA 2L50A 1BLQA 3RM1A 2MHHA 4M2PA 3FIAA 3LK1A 2K2FA 1B4CA 1YRTB 2K7CA 3CS1A 1CMGA 1K90D 2VRGA 2JT3A 3SG2A 5IBWA 1CLLA 4USLA 1U5IB 3LLEA 2JC2A 3CR2A 1AJ4A 1XVJA 1CKKA 2OS8C 4YGEB 1YX7A 4PCWA 2KBMA 1WLMA 4TNCA 2HF5A 1PSBA 2WCEA 3EKHA 1GQMA 1QTXA 3I5GB 1SL9A 2LANA 3OHMB 4ZCVA 2WORA 3BYAA 3BUWB 4PHNA 1SL8A 1M45A 3DVKA 1J7QA 3AAJA 3CGAA 2PASA 3NSOA 1UP5A 4L9MA 2JQ6A 2LLSA 2KI4C 2L51A 2PMYA 1KFXS 3EKJA 1EH2A 4MZKA 1QIWA 3DVEA 1YX8A 3TDIA 3IQOA 1WRZA 4GGFA 4N1GA 5CSFA 3VRQA 2LVKA 4C0LA 1NCZA 2H2KA 1SCMC 2Y5IA 1KWOB 2MA2A 5D69A 4N1FA 1DJHA 1H4BA 4M2OA 4MBEA 1TN4A 1IQ5A 3OX5A 1YR5A 4PHKA 1B9AA 3OB2B 2K7BA 3NXAA 5HKZA 3PN7B 1PRWA 1Y1XA 1CMFA 2L2EA 1UHJA 1CFPA 1S26D 1OMDA 2BCBA 1BT6A 2KBIA 4DUQA 1K8UA 1J1EA 1B8RA 2MLEC 1FW4A 1KCYA 2JXLA 3TUYC 1ZACA 1YUUA 2JWWA 5AXIA 5CSNA 1UURA 2JT0A 1A2XA 1QLKA 4A4BA 1S36A 2AMIA 1F4QA 5AERA 2RGIA 3M0WA 1S1EA 1PALA 2BKIB 1G33A 4WQ2A 2TN4A 2HPSA 1KFUS 2M49B 1YVHA 3GK4X 3PATA 1XFVO 2HETA 5GQQC 3KF9A 1LA0A 3VRNA 1RROA 1JF0A 2M9GA 3C1VA 3JVTB 4CPVA 1FBVA 5FYXA 5DKNA 4OVNF 4YI9A 3VRPA 2JRFA 4MLWA 3DF0B 1S6JA 3PSRA 2EC6B 4GPLB 2K7DA 2KYCA 1DJWA 4JPZB 2LP3A 1J7OA 1L2OC 3SG4A 3SG5A 4CIDA 1LVCD 3JTDB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TNQ A;  3SG7 A;  4DS7 A;  4NQG A;  1HT9 A;  4CFQ A;  4DIR A;  1OMV A;  1WY9 A;  2V53 A;  4ORC B;  3FS7 A;  2M1K B;  4P2Y B;  3TDU A;  1V1G A;  1JFJ A;  1KK8 C;  1PUL A;  2KFF A;  2BEC A;  3WNX B;  1JF2 A;  1CFF A;  2LNK A;  2GGZ A;  4HRE E;  3NSK A;  3SIB A;  1CTR A;  1QJT A;  1YUS A;  3GK2 A;  1DT7 B;  1D1O A;  1F71 A;  1F55 A;  1JSA A;  1OMR A;  2NXQ A;  1NSH A;  1NCY A;  1VRK A;  4NDB A;  3VGO A;  1DJZ A;  2JZI A;  3O6B A;  4AQI A;  3EVU A;  1TOP A;  1A03 A;  1QX7 A;  1QLS A;  1YTZ C;  1AJ5 A;  4MRX A;  3CWG A;  1S6C A;  2MAZ A;  5B8I B;  5JOL A;  5F6T A;  3CLN A;  1IRJ A;  1N0Y A;  3I5G C;  4MVF A;  1EXR A;  3DVJ A;  3PAL A;  2LMU A;  4P5O E;  2LAP A;  3OP0 A;  1WLZ A;  2ZFD A;  2F33 A;  1KQM B;  1IG5 A;  4OV2 A;  4GGF C;  2OTG B;  3FWC A;  2HQ8 A;  4YGB B;  1Q80 A;  2SCP A;  2R2I A;  1IKU A;  1YVL A;  1CM4 A;  4JWQ A;  4MZJ A;  1ZUZ A;  3WXA A;  4N5X A;  4ZCU A;  3I5I C;  2L0P A;  2NCO A;  2ZRT A;  3TDZ A;  3EK7 A;  1TRF A;  2LP2 A;  1IJ6 A;  1F8H A;  2CBL A;  3LK0 A;  4I5J A;  4DCK A;  3VRR A;  1U5I A;  3ZNI A;  3PN7 C;  1F70 A;  2KSP A;  2NZ0 A;  2WCB A;  3D10 A;  1SPY A;  5K89 A;  2LUX A;  2M1U A;  1MXL C;  3WHT B;  1DVI A;  5CSI A;  4NDC A;  4NDD A;  2CTN A;  1K9U A;  2JTZ A;  1Y6W A;  4C0K A;  1M39 A;  1ZOT B;  5DKQ A;  1J55 A;  3EK8 A;  3OB1 B;  2BBM A;  1BOD A;  1KFX L;  3KHE A;  2ZRS A;  3BUO B;  4U8D A;  2L4I A;  2NLN A;  3NSI A;  1SMG A;  2KQY A;  4GFT A;  3AKA A;  1IGV A;  2H61 A;  4GNK B;  1S3P A;  1XYD A;  3WHU B;  1AHR A;  3BOW B;  2JU0 A;  3I5F B;  5CPV A;  1J1D A;  1XFW O;  3K21 A;  2KQ6 A;  2ZKM X;  2L5X B;  3HX4 A;  5I2Q A;  4HSZ A;  1LKJ A;  1UHN A;  2BE4 A;  1KSO A;  2BBN A;  1RTP 1;  1MQ1 A;  1SKT A;  1GGZ A;  2MLF C;  1OE9 B;  4QJ5 B;  2K0J A;  5KU1 A;  1KSM A;  3NSL A;  3JTD C;  4QJ3 B;  4GBA A;  1JUO A;  4PHM A;  1PSR A;  2B1U A;  2JNF A;  1KK7 Z;  1F54 A;  3SJS A;  1DMO A;  1S5G Z;  1PK0 D;  2M97 A;  2OS8 B;  1ODB A;  1TCF A;  1Y1U A;  2I18 A;  4C0J A;  1CDL A;  1KFU L;  3E3R A;  1MF8 B;  4OR9 B;  1ALW A;  2BKH B;  4HRG A;  2ZN9 A;  1CB1 A;  4OCI A;  1A75 B;  1SYM A;  2LC5 A;  2JT8 A;  1JFK A;  2OPO A;  3IF7 A;  3PFV A;  4MSP A;  3I5H B;  4ORA B;  2F8P A;  1B1G A;  3BQ3 A;  4IL1 A;  2JNX A;  2WC8 A;  2ISD A;  1BG1 A;  1SRA A;  1UHI A;  1B8L A;  3LL8 B;  1L7Z A;  1DJX A;  5I2L A;  1KQV A;  1BMO A;  3KPX A;  4CLN A;  3LCP C;  2E30 A;  1LIN A;  1C07 A;  1NWD A;  3DF0 A;  2Q91 A;  5HYD A;  4WQ3 A;  1BF5 A;  1Y1A A;  1SCM B;  2F3Z A;  3D0Y B;  1NX2 A;  1V1F A;  1ZMZ A;  4YBH B;  1AK8 A;  2I2R E;  2JPT A;  3IQQ A;  2FCE A;  2P6B B;  1QAS A;  4MEW A;  1ALV A;  2BL0 C;  1K93 D;  2O5G A;  4I5N B;  4D1E A;  1C7W A;  1UHK A;  4XJK B;  2E6W A;  2EHB A;  1MWN A;  1KQM C;  3EVR A;  2LMT A;  1Y0V H;  2LVV A;  2JXC A;  2OTG C;  1RFJ A;  2KFG A;  2M0R A;  3CR5 X;  1RWY A;  5HKW A;  3TUY B;  1TNW A;  2KI6 D;  1M31 A;  1AUI B;  2KYF A;  2BCA A;  2EGD A;  1C7V A;  1NX3 A;  4YRU A;  4YGC B;  1EJ3 A;  1SL7 A;  2KGB C;  1K94 A;  2ZN8 A;  4XYN A;  4PAL A;  2PRU A;  5KTY A;  1GGW A;  2BCX A;  4OKH A;  2WCF A;  4PHJ A;  2K8M B;  1N2D A;  1QVI Z;  2LVJ A;  2KAY A;  3EK4 A;  3O4Y A;  4AOM A;  1QIV A;  2Y1N A;  1SR6 B;  3SIA A;  1SCV A;  3ZWH A;  2KAV A;  1B47 A;  2A4J A;  3FWB A;  1A29 A;  2GV5 A;  3RLZ A;  1QVI Y;  1FF1 A;  2ZND A;  4GUK A;  2Y1M A;  2MBX A;  2H61 C;  1JBA A;  1QXP A;  4ICB A;  1UHH A;  3BXK A;  3CTN A;  1TCO B;  1IJ5 A;  1TTX A;  2LV7 A;  1CFD A;  1XK4 A;  1KWO C;  1NUB A;  1OOJ A;  1OZS A;  1UUS A;  4PE1 A;  4PDZ A;  3A4U B;  1AVS A;  1KK8 B;  4F0Z B;  1TNX A;  3AKB A;  4GAO A;  3PLF B;  1DF0 B;  1MXE A;  1BR4 B;  1CLB A;  1NYA A;  1NIW A;  2AAO A;  4MZL A;  4ORB B;  1IQ3 A;  1CDN A;  2LE9 B;  1XFZ O;  2HQW A;  3SG6 A;  1DF0 A;  1XA5 A;  1XFU O;  2FJU B;  3QRX A;  2FOT A;  4DRW A;  1CFC A;  1WDC B;  2F2P A;  2QPT A;  4ETO A;  1EG4 A;  2LCP A;  2Q4U A;  3ICB A;  2LUC A;  3OX6 A;  1BJF A;  1SBJ A;  3JVT C;  3DVM A;  3TS5 B;  2SAS A;  1XFY O;  1MUX A;  3I5H C;  2JTT A;  4E68 A;  2MJW B;  1QX2 A;  2LVI A;  3CZT X;  1OQP A;  3BOW A;  4UPG A;  4R1E A;  4AQJ A;  1OZO A;  1UWO A;  2EC6 C;  2IS9 A;  5AFP A;  2LLU A;  1OSA A;  5JJG A;  1JC2 A;  2LM5 A;  1QV0 A;  2ZNE A;  2KAX A;  2MRD A;  2KFH A;  1DGV A;  1EG3 A;  1BR1 B;  3I5I B;  2G9B A;  1R2U A;  4PE0 A;  5D7F A;  2M7N A;  1K95 A;  5PAL A;  1B8C A;  5TNC A;  3AAK A;  4I5K A;  5ER4 X;  1W7I B;  1JWD A;  2AUC A;  2LHI A;  2BE6 A;  3BUX B;  2LLT A;  4Q04 A;  1FI5 A;  2F3Y A;  1S6I A;  5HLO A;  3O78 A;  4MRY A;  2F2O A;  2KNE A;  1A4P A;  1MR8 A;  2Y4Q A;  3SG3 A;  1CNP A;  1M46 A;  1LXF C;  1SW8 A;  1KK7 Y;  2LHL A;  3O2P A;  1S5G Y;  2I94 A;  1CLM A;  1BU3 A;  3GOF A;  1DJG A;  4PE7 A;  1K9P A;  1A75 A;  3TZ1 A;  3A8R A;  2L98 A;  2WOS A;  2KI4 B;  3GK1 A;  2D8N A;  1W7J B;  5BPJ A;  2L4H A;  2PSR A;  1PVB A;  1GJY A;  2CCM A;  1QX5 B;  2KOT A;  1ZFS A;  4YGD B;  4CFR A;  4GGN A;  4FTG A;  4YI8 A;  2M3W A;  1K96 A;  2NCP A;  1K9K A;  2KHN A;  2WND A;  3D0Y A;  1SR6 C;  1BOC A;  1K2H A;  2K61 A;  2KDH A;  1FPW A;  4PE4 A;  1J7P A;  5ER5 A;  1QV1 A;  1DJI A;  1B7T Z;  1TNP A;  3DD4 A;  4WRI A;  4JQ0 D;  4XJK A;  4HRH A;  1N65 A;  1SK6 D;  1XK4 C;  2FCD A;  3BUM B;  5J3X A;  3MSE B;  3BUN B;  3PM8 A;  1CM1 A;  1YUT A;  2JUL A;  2KGR A;  2K2A A;  2PAL A;  4YGA A;  5I8N A;  1LA3 A;  1NPQ A;  5AEQ A;  3KO0 A;  2CXJ A;  1B7T Y;  3VRO A;  1X02 A;  5I2O A;  1SNL A;  4MN0 A;  1SY9 A;  1REC A;  5CSJ A;  1XFX O;  1DJY A;  2PVB A;  5KSZ A;  4BY4 A;  4FQO A;  4A4C A;  1IWQ A;  1CDP A;  1CDM A;  4I5L B;  1XO5 A;  4BY5 A;  1YRU B;  1E8A A;  2CNP A;  2COL B;  2KI6 C;  3KEV A;  1QS7 A;  3EVV A;  2LMV A;  5DKR A;  2M7L A;  1J7R A;  2JOJ A;  1AP4 A;  5HLV A;  2QAC A;  1L2O B;  1R6P A;  1EL4 A;  1RK9 A;  1F4O A;  3HCM A;  5AAN A;  1NP8 A;  1FI6 A;  1WDC C;  1QAT A;  2CT9 A;  1MHO A;  1TIZ A;  2K7O A;  2M29 A;  1H8B A;  3F45 A;  1HQV A;  1YUR A;  3CR4 X;  2I7A A;  1IH0 A;  2GGM A;  1PVA A;  1NX1 A;  3I5F C;  1RJV A;  2O60 A;  5HKY A;  2BL0 B;  3TS5 C;  1G8I A;  4M2Q A;  1M63 B;  1DTL A;  1DGU A;  5G08 A;  1NX0 A;  1G4Y R;  2DOQ A;  2M8U A;  3H4S E;  1WRL A;  4QJ4 B;  2G2B A;  1NCX A;  1WRK A;  2L50 A;  1BLQ A;  3RM1 A;  2MHH A;  4M2P A;  3FIA A;  3LK1 A;  2K2F A;  1B4C A;  1YRT B;  2K7C A;  3CS1 A;  1CMG A;  1K90 D;  2VRG A;  2JT3 A;  3SG2 A;  5IBW A;  1CLL A;  4USL A;  1U5I B;  3LLE A;  2JC2 A;  3CR2 A;  1AJ4 A;  1XVJ A;  1CKK A;  2OS8 C;  4YGE B;  1YX7 A;  4PCW A;  2KBM A;  1WLM A;  4TNC A;  2HF5 A;  1PSB A;  2WCE A;  3EKH A;  1GQM A;  1QTX A;  3I5G B;  1SL9 A;  2LAN A;  3OHM B;  4ZCV A;  2WOR A;  3BYA A;  3BUW B;  4PHN A;  1SL8 A;  1M45 A;  3DVK A;  1J7Q A;  3AAJ A;  3CGA A;  2PAS A;  3NSO A;  1UP5 A;  4L9M A;  2JQ6 A;  2LLS A;  2KI4 C;  2L51 A;  2PMY A;  1KFX S;  3EKJ A;  1EH2 A;  4MZK A;  1QIW A;  3DVE A;  1YX8 A;  3TDI A;  3IQO A;  1WRZ A;  4GGF A;  4N1G A;  5CSF A;  3VRQ A;  2LVK A;  4C0L A;  1NCZ A;  2H2K A;  1SCM C;  2Y5I A;  1KWO B;  2MA2 A;  5D69 A;  4N1F A;  1DJH A;  1H4B A;  4M2O A;  4MBE A;  1TN4 A;  1IQ5 A;  3OX5 A;  1YR5 A;  4PHK A;  1B9A A;  3OB2 B;  2K7B A;  3NXA A;  5HKZ A;  3PN7 B;  1PRW A;  1Y1X A;  1CMF A;  2L2E A;  1UHJ A;  1CFP A;  1S26 D;  1OMD A;  2BCB A;  1BT6 A;  2KBI A;  4DUQ A;  1K8U A;  1J1E A;  1B8R A;  2MLE C;  1FW4 A;  1KCY A;  2JXL A;  3TUY C;  1ZAC A;  1YUU A;  2JWW A;  5AXI A;  5CSN A;  1UUR A;  2JT0 A;  1A2X A;  1QLK A;  4A4B A;  1S36 A;  2AMI A;  1F4Q A;  5AER A;  2RGI A;  3M0W A;  1S1E A;  1PAL A;  2BKI B;  1G33 A;  4WQ2 A;  2TN4 A;  2HPS A;  1KFU S;  2M49 B;  1YVH A;  3GK4 X;  3PAT A;  1XFV O;  2HET A;  5GQQ C;  3KF9 A;  1LA0 A;  3VRN A;  1RRO A;  1JF0 A;  2M9G A;  3C1V A;  3JVT B;  4CPV A;  1FBV A;  5FYX A;  5DKN A;  4OVN F;  4YI9 A;  3VRP A;  2JRF A;  4MLW A;  3DF0 B;  1S6J A;  3PSR A;  2EC6 B;  4GPL B;  2K7D A;  2KYC A;  1DJW A;  4JPZ B;  2LP3 A;  1J7O A;  1L2O C;  3SG4 A;  3SG5 A;  4CID A;  1LVC D;  3JTD B; 
#chains in the Genus database with same CATH topology
 2P71 A;  1TNQ A;  3SG7 A;  4DS7 A;  2L2C A;  5HL1 A;  4NQG A;  3B6X A;  2BNX A;  1HT9 A;  4CFQ A;  1DC1 A;  4DIR A;  1OMV A;  1WY9 A;  2V53 A;  4ORC B;  3FS7 A;  2M1K B;  4P2Y B;  3TDU A;  1V1G A;  1JFJ A;  1KK8 C;  3BJH A;  1PUL A;  2KFF A;  2BEC A;  3WNX B;  1JF2 A;  2FJY A;  1CFF A;  2LNK A;  4JKT A;  2GGZ A;  4HRE E;  3NSK A;  3SIB A;  1CTR A;  1QJT A;  1YUS A;  3GK2 A;  1DT7 B;  1D1O A;  2QEH A;  1F71 A;  1F55 A;  1JSA A;  1OMR A;  2NXQ A;  1NSH A;  1NCY A;  1VRK A;  3FE9 A;  3SS5 A;  4NDB A;  5FI6 A;  3VGO A;  1DJZ A;  2JZI A;  3O6B A;  4AQI A;  3EVU A;  1TOP A;  1A03 A;  3DXL A;  1QX7 A;  1QLS A;  1YTZ C;  1AJ5 A;  4MRX A;  3CWG A;  1S6C A;  2MAZ A;  5B8I B;  5JOL A;  5F6T A;  3CLN A;  1IRJ A;  1N0Y A;  3I5G C;  4MVF A;  1EXR A;  3DVJ A;  3PAL A;  2LMU A;  4P5O E;  2LAP A;  3OP0 A;  1OOI X;  2P70 A;  1WLZ A;  2ZFD A;  3SS3 A;  2BAP A;  2F33 A;  1KQM B;  1IG5 A;  3FE6 A;  4OV2 A;  4GGF C;  2OTG B;  3FWC A;  2HQ8 A;  4YGB B;  1Q80 A;  2H8V A;  2SCP A;  3BFH A;  1OOH A;  2R2I A;  1YVL A;  2WCM A;  1CM4 A;  4JWQ A;  1IKU A;  4MZJ A;  1ZUZ A;  3WXA A;  4N5X A;  4ZCU A;  3I5I C;  2WCH A;  2L0P A;  2NCO A;  2ZRT A;  3TDZ A;  3EK7 A;  1TRF A;  2LP2 A;  2QDI A;  1IJ6 A;  1F8H A;  2CBL A;  3LK0 A;  4I5J A;  3S0B A;  4DCK A;  3VRR A;  1U5I A;  3ZNI A;  3PN7 C;  3EG5 B;  1F70 A;  2KSP A;  2NZ0 A;  2QEV A;  2WCB A;  3D10 A;  1SPY A;  5K89 A;  2LUX A;  2M1U A;  1MXL C;  3WHT B;  1DVI A;  5CSI A;  1GM0 A;  4NDC A;  4NDD A;  2CTN A;  1K9U A;  2JTZ A;  3S0E A;  1Y6W A;  4C0K A;  1M39 A;  1ZOT B;  5DKQ A;  1J55 A;  3EK8 A;  3OB1 B;  2BBM A;  1BOD A;  1KFX L;  3KHE A;  2ZRS A;  3BUO B;  4U8D A;  2L4I A;  3UO9 A;  2NLN A;  3NSI A;  1SMG A;  2KQY A;  4GFT A;  3AKA A;  3PM2 A;  1IGV A;  3SS4 A;  3L4A A;  2H61 A;  4GNK B;  1S3P A;  1XYD A;  4INW A;  3D75 A;  1AHR A;  3BOW B;  2JU0 A;  3I5F B;  5CPV A;  3WHU B;  1J1D A;  1XFW O;  3K21 A;  2KQ6 A;  2ZKM X;  2L5X B;  3HX4 A;  5I2Q A;  1T14 A;  4HSZ A;  1LKJ A;  1UHN A;  2BE4 A;  1KSO A;  2BBN A;  1RTP 1;  1MQ1 A;  1SKT A;  1C3Y A;  1GGZ A;  2MLF C;  3DY9 A;  1OE9 B;  4QJ5 B;  2K0J A;  5KU1 A;  1KSM A;  3NSL A;  3JTD C;  4QJ3 B;  3VB1 A;  4GBA A;  1JUO A;  4PHM A;  1PSR A;  2B1U A;  2JNF A;  1KK7 Z;  2QEO A;  1F54 A;  3SJS A;  3BFB A;  1S5G Z;  1DMO A;  1PK0 D;  2M97 A;  2OS8 B;  1ODB A;  1TCF A;  1Y1U A;  2I18 A;  4C0J A;  1CDL A;  1KFU L;  3E3R A;  1MF8 B;  2WC6 A;  4OR9 B;  1ALW A;  2BKH B;  4HRG A;  2ZN9 A;  1CB1 A;  4OCI A;  1A75 B;  1SYM A;  2LC5 A;  1TUZ A;  3CDN A;  2JT8 A;  1JFK A;  2OPO A;  3IF7 A;  3PFV A;  4MSP A;  3I5H B;  4ORA B;  2F8P A;  3R72 A;  3BQ3 A;  4IL1 A;  1B1G A;  2JNX A;  2WC8 A;  3NHI A;  3NHT A;  2ISD A;  1BG1 A;  1SRA A;  1UHI A;  1B8L A;  3LL8 B;  1L7Z A;  1DJX A;  5I2L A;  1KQV A;  1BMO A;  3KPX A;  3Q8I A;  4CLN A;  3LCP C;  2E30 A;  1LIN A;  1C07 A;  1NWD A;  3DF0 A;  2Q91 A;  5HYD A;  4WQ3 A;  1BF5 A;  1Y1A A;  1QWV A;  1SCM B;  2F3Z A;  3D0Y B;  1NX2 A;  1V1F A;  1ZMZ A;  4YBH B;  3L47 A;  1AK8 A;  2I2R E;  2JPT A;  3IQQ A;  2FCE A;  2P6B B;  1QAS A;  4MEW A;  4PT1 A;  1ALV A;  2BL0 C;  1K93 D;  2O5G A;  4I5N B;  4D1E A;  1C7W A;  1UHK A;  4XJK B;  2E6W A;  2EHB A;  1MWN A;  1KQM C;  3EVR A;  2LMT A;  3B88 A;  1Y0V H;  2LVV A;  2JXC A;  2OTG C;  1RFJ A;  2KFG A;  3R1O A;  5I94 A;  2M0R A;  3CR5 X;  1RWY A;  5HKW A;  3TUY B;  1TNW A;  2KI6 D;  1M31 A;  1AUI B;  2KYF A;  2BCA A;  2EGD A;  1C7V A;  1NX3 A;  4YRU A;  4YGC B;  1EJ3 A;  1SL7 A;  2KGB C;  1K94 A;  2ZN8 A;  4XYN A;  2WCJ A;  4PAL A;  3OBV A;  1DEL A;  2PRU A;  5KTY A;  1ORG A;  1GGW A;  2BCX A;  4OKH A;  2WCF A;  4PHJ A;  2K8M B;  1N2D A;  1QVI Z;  2LVJ A;  2KAY A;  3EK4 A;  3O4Y A;  3OGN A;  4AOM A;  4INX A;  1QIV A;  2Y1N A;  1SR6 B;  3SIA A;  2PQL A;  4FQT A;  4IJ7 A;  1SCV A;  3BFA A;  2KAV A;  1B47 A;  3ZWH A;  2A4J A;  3FWB A;  1A29 A;  2GV5 A;  3RLZ A;  1QVI Y;  1FF1 A;  1OOG A;  2ZND A;  4GUK A;  2Y1M A;  2MBX A;  2H61 C;  1JBA A;  1QXP A;  4ICB A;  1UHH A;  3BXK A;  1TWO A;  3CTN A;  1TCO B;  5FI7 A;  1IJ5 A;  1TTX A;  2LV7 A;  1CFD A;  1XK4 A;  1KWO C;  1NUB A;  1OOJ A;  1OZS A;  1UUS A;  4PE1 A;  4PDZ A;  3A4U B;  1AVS A;  1KK8 B;  3FE8 A;  1TNX A;  4F0Z B;  3AKB A;  4GAO A;  4OZD A;  3D78 A;  3PLF B;  1DF0 B;  1MXE A;  1BR4 B;  1CLB A;  1NYA A;  1NIW A;  2AAO A;  4MZL A;  2KLD A;  4ORB B;  1IQ3 A;  1CDN A;  1W9Z A;  2LE9 B;  1XFZ O;  2HQW A;  3SG6 A;  1DF0 A;  1XA5 A;  1XFU O;  2FJU B;  3QRX A;  2FOT A;  4DRW A;  1CFC A;  3N7H A;  1P28 A;  1WDC B;  2F2P A;  2QPT A;  4ETO A;  1EG4 A;  2LCP A;  2Q4U A;  3ICB A;  2LUC A;  2JPO A;  3OX6 A;  1BJF A;  1SBJ A;  2L5Y A;  2KLE A;  3JVT C;  3DVM A;  3TS5 B;  2SAS A;  3DYE A;  1XFY O;  1MUX A;  3I5H C;  2JTT A;  5FI2 A;  4E68 A;  2MJW B;  1QX2 A;  2LVI A;  3CZ1 A;  1OQP A;  3CZT X;  3BOW A;  4UPG A;  4R1E A;  4AQJ A;  3S0D A;  1OZO A;  1UWO A;  2EC6 C;  2IS9 A;  5AFP A;  2LLU A;  1OSA A;  5JJG A;  1JC2 A;  2LM5 A;  1QV0 A;  2ZNE A;  2KAX A;  1OW4 A;  2MRD A;  2KFH A;  1DGV A;  1EG3 A;  1BR1 B;  3I5I B;  2G9B A;  1R2U A;  2KPH A;  4PE0 A;  5D7F A;  2M7N A;  1K95 A;  5PAL A;  1B8C A;  5TNC A;  3AAK A;  4I5K A;  5ER4 X;  1W7I B;  1JWD A;  1IIO A;  2AUC A;  2LHI A;  2BE6 A;  3BUX B;  2LLT A;  4Q04 A;  5D3O A;  1FI5 A;  2F3Y A;  1S6I A;  5HLO A;  3O78 A;  4MRY A;  2F2O A;  2KNE A;  1A4P A;  1MR8 A;  2Y4Q A;  3SG3 A;  1CNP A;  1M46 A;  1LXF C;  3R1V A;  1SW8 A;  1KK7 Y;  2LHL A;  3O2P A;  1S5G Y;  2I94 A;  1CLM A;  1BU3 A;  3GOF A;  2YGU A;  1DJG A;  4PE7 A;  1K9P A;  1A75 A;  3TZ1 A;  3D76 A;  3A8R A;  2L98 A;  3CAB A;  1SSE B;  2WOS A;  2KI4 B;  3GK1 A;  2D8N A;  1W7J B;  5BPJ A;  2L4H A;  1Z4H A;  2PSR A;  1PVB A;  1GJY A;  2WC5 A;  2CCM A;  1C3Z A;  1QX5 B;  3B7A A;  2KOT A;  3D73 A;  1ZFS A;  4YGD B;  4CFR A;  4GGN A;  4FTG A;  4YI8 A;  2M3W A;  3QME A;  1K96 A;  2NCP A;  1K9K A;  2KHN A;  2WND A;  4JD9 A;  3D0Y A;  1SR6 C;  1BOC A;  1K2H A;  2K61 A;  2KDH A;  3CYZ A;  1FPW A;  4PE4 A;  1J7P A;  5ER5 A;  1QV1 A;  1DJI A;  1B7T Z;  1TNP A;  3DD4 A;  4WRI A;  4JQ0 D;  3R1P A;  4XJK A;  4HRH A;  1N65 A;  1SK6 D;  1XK4 C;  2FCD A;  3BUM B;  5J3X A;  3MSE B;  3BUN B;  3PM8 A;  1CM1 A;  1YUT A;  2JUL A;  2KGR A;  2K2A A;  2PAL A;  4YGA A;  2WCK A;  1LA3 A;  1NPQ A;  5AEQ A;  3KO0 A;  5I8N A;  2CXJ A;  1B7T Y;  3VRO A;  1X02 A;  5I2O A;  1SNL A;  4MN0 A;  1SY9 A;  1XFR A;  1REC A;  5CSJ A;  1XFX O;  1DJY A;  2PVB A;  5KSZ A;  4BY4 A;  4FQO A;  4A4C A;  3D77 A;  1IWQ A;  1CDP A;  1CDM A;  4I5L B;  1XO5 A;  4BY5 A;  1YRU B;  1E8A A;  2CNP A;  2COL B;  2KI6 C;  3UNW A;  3CZ0 A;  1Z2C B;  3KEV A;  1QS7 A;  3EVV A;  3K1E A;  2LMV A;  5DKR A;  2M7L A;  1J7R A;  2JOJ A;  1AP4 A;  5HLV A;  2QAC A;  1L2O B;  1R6P A;  1EL4 A;  1RK9 A;  1F4O A;  3HCM A;  5AAN A;  1NP8 A;  3IVT A;  1FI6 A;  1WDC C;  3PJI A;  1QAT A;  2CT9 A;  3CZ2 A;  1MHO A;  1TIZ A;  2K7O A;  2M29 A;  1H8B A;  1TUJ A;  2ERB A;  3F45 A;  1HQV A;  1YUR A;  3CR4 X;  2I7A A;  1IH0 A;  1DQE A;  2GGM A;  1PVA A;  1NX1 A;  3I5F C;  3O4X A;  1RJV A;  2O60 A;  5HKY A;  2BL0 B;  3TS5 C;  1G8I A;  4M2Q A;  1M63 B;  1DTL A;  1DGU A;  5G08 A;  1NX0 A;  1G4Y R;  2DOQ A;  2M8U A;  3H4S E;  1WRL A;  4QJ4 B;  2G2B A;  1NCX A;  1WRK A;  2L50 A;  1BLQ A;  3RM1 A;  2MHH A;  1LS8 A;  4M2P A;  3FIA A;  3LK1 A;  2K2F A;  1B4C A;  1YRT B;  2K7C A;  3CS1 A;  3DZT A;  1CMG A;  1K90 D;  2VRG A;  2JT3 A;  3SG2 A;  5IBW A;  1CLL A;  4USL A;  1U5I B;  3LLE A;  2JC2 A;  2QEB A;  1AJ4 A;  1XVJ A;  3CR2 A;  1CKK A;  2OS8 C;  4YGE B;  1YX7 A;  4PCW A;  2KBM A;  1WLM A;  4TNC A;  2HF5 A;  1PSB A;  2WCE A;  3EKH A;  1GQM A;  1QTX A;  3I5G B;  1SL9 A;  2LAN A;  3OHM B;  4ZCV A;  2WOR A;  3BYA A;  4F7F A;  3BUW B;  3S0G A;  4PHN A;  1SL8 A;  1M45 A;  3DVK A;  1J7Q A;  3AAJ A;  2GTE A;  3CGA A;  2PAS A;  3NSO A;  5DIC A;  1UP5 A;  4L9M A;  2JQ6 A;  2LLS A;  5EL2 A;  2KI4 C;  2L51 A;  2PMY A;  1KFX S;  3EKJ A;  1EH2 A;  4MZK A;  1QIW A;  3DVE A;  1YX8 A;  3TDI A;  3IQO A;  1WRZ A;  4GGF A;  4N1G A;  3V2L A;  5CSF A;  3VRQ A;  2LVK A;  4C0L A;  4KYN A;  1NCZ A;  1DEK A;  2H2K A;  1SCM C;  2Y5I A;  1KWO B;  2MA2 A;  5D69 A;  4N1F A;  1DJH A;  1H4B A;  4M2O A;  4MBE A;  3RZS A;  1TN4 A;  1IQ5 A;  3OX5 A;  1YR5 A;  4PHK A;  1B9A A;  2WCL A;  2K7B A;  3NXA A;  3OB2 B;  5HKZ A;  3PN7 B;  1PRW A;  1Y1X A;  1CMF A;  2L2E A;  1UHJ A;  1CFP A;  1S26 D;  1OMD A;  2BCB A;  1BT6 A;  2KBI A;  3B86 A;  1K8U A;  4DUQ A;  1J1E A;  2K60 A;  1B8R A;  1OOF A;  1FW4 A;  2MLE C;  1KCY A;  2JXL A;  3TUY C;  1ZAC A;  1YUU A;  2JWW A;  5AXI A;  5CSN A;  1UUR A;  2JT0 A;  1A2X A;  1QLK A;  2PYQ A;  4A4B A;  1S36 A;  2AMI A;  1F4Q A;  5AER A;  2RGI A;  3M0W A;  1S1E A;  1PAL A;  2BKI B;  1G33 A;  4WQ2 A;  2TN4 A;  2HPS A;  1KFU S;  2M49 B;  1YVH A;  3GK4 X;  3PAT A;  3S0A A;  1XFV O;  2HET A;  5GQQ C;  3KF9 A;  1LA0 A;  3VRN A;  1RRO A;  1JF0 A;  2M9G A;  3C1V A;  3D74 A;  3L4L A;  3NGV A;  3JVT B;  4CPV A;  1FBV A;  5FYX A;  5DKN A;  4OVN F;  4YI9 A;  3VRP A;  2JRF A;  4MLW A;  3DF0 B;  1S6J A;  3PSR A;  2EC6 B;  4GPL B;  3S0F A;  2K7D A;  2KYC A;  1DJW A;  4JPZ B;  2LP3 A;  1J7O A;  1L2O C;  3SG4 A;  3SG5 A;  4CID A;  3B87 A;  1LVC D;  3JTD B; 
#chains in the Genus database with same CATH homology
 1TNQ A;  3SG7 A;  4DS7 A;  4NQG A;  1HT9 A;  4CFQ A;  4DIR A;  1OMV A;  1WY9 A;  2V53 A;  4ORC B;  3FS7 A;  2M1K B;  4P2Y B;  3TDU A;  1V1G A;  1JFJ A;  1KK8 C;  1PUL A;  2KFF A;  2BEC A;  3WNX B;  1JF2 A;  1CFF A;  2LNK A;  2GGZ A;  4HRE E;  3NSK A;  3SIB A;  1CTR A;  1QJT A;  1YUS A;  3GK2 A;  1DT7 B;  1D1O A;  1F71 A;  1F55 A;  1JSA A;  1OMR A;  2NXQ A;  1NSH A;  1NCY A;  1VRK A;  4NDB A;  3VGO A;  1DJZ A;  2JZI A;  3O6B A;  4AQI A;  3EVU A;  1TOP A;  1A03 A;  1QX7 A;  1QLS A;  1YTZ C;  1AJ5 A;  4MRX A;  3CWG A;  1S6C A;  2MAZ A;  5B8I B;  5JOL A;  5F6T A;  3CLN A;  1IRJ A;  1N0Y A;  3I5G C;  4MVF A;  1EXR A;  3DVJ A;  3PAL A;  2LMU A;  4P5O E;  2LAP A;  3OP0 A;  1WLZ A;  2ZFD A;  2F33 A;  1KQM B;  1IG5 A;  4OV2 A;  4GGF C;  2OTG B;  3FWC A;  2HQ8 A;  4YGB B;  1Q80 A;  2SCP A;  2R2I A;  1IKU A;  1YVL A;  1CM4 A;  4JWQ A;  4MZJ A;  1ZUZ A;  3WXA A;  4N5X A;  4ZCU A;  3I5I C;  2L0P A;  2NCO A;  2ZRT A;  3TDZ A;  3EK7 A;  1TRF A;  2LP2 A;  1IJ6 A;  1F8H A;  2CBL A;  3LK0 A;  4I5J A;  4DCK A;  3VRR A;  1U5I A;  3ZNI A;  3PN7 C;  1F70 A;  2KSP A;  2NZ0 A;  2WCB A;  3D10 A;  1SPY A;  5K89 A;  2LUX A;  2M1U A;  1MXL C;  3WHT B;  1DVI A;  5CSI A;  4NDC A;  4NDD A;  2CTN A;  1K9U A;  2JTZ A;  1Y6W A;  4C0K A;  1M39 A;  1ZOT B;  5DKQ A;  1J55 A;  3EK8 A;  3OB1 B;  2BBM A;  1BOD A;  1KFX L;  3KHE A;  2ZRS A;  3BUO B;  4U8D A;  2L4I A;  2NLN A;  3NSI A;  1SMG A;  2KQY A;  4GFT A;  3AKA A;  1IGV A;  2H61 A;  4GNK B;  1S3P A;  1XYD A;  3WHU B;  1AHR A;  3BOW B;  2JU0 A;  3I5F B;  5CPV A;  1J1D A;  1XFW O;  3K21 A;  2KQ6 A;  2ZKM X;  2L5X B;  3HX4 A;  5I2Q A;  4HSZ A;  1LKJ A;  1UHN A;  2BE4 A;  1KSO A;  2BBN A;  1RTP 1;  1MQ1 A;  1SKT A;  1GGZ A;  2MLF C;  1OE9 B;  4QJ5 B;  2K0J A;  5KU1 A;  1KSM A;  3NSL A;  3JTD C;  4QJ3 B;  4GBA A;  1JUO A;  4PHM A;  1PSR A;  2B1U A;  2JNF A;  1KK7 Z;  1F54 A;  3SJS A;  1DMO A;  1S5G Z;  1PK0 D;  2M97 A;  2OS8 B;  1ODB A;  1TCF A;  1Y1U A;  2I18 A;  4C0J A;  1CDL A;  1KFU L;  3E3R A;  1MF8 B;  4OR9 B;  1ALW A;  2BKH B;  4HRG A;  2ZN9 A;  1CB1 A;  4OCI A;  1A75 B;  1SYM A;  2LC5 A;  2JT8 A;  1JFK A;  2OPO A;  3IF7 A;  3PFV A;  4MSP A;  3I5H B;  4ORA B;  2F8P A;  1B1G A;  3BQ3 A;  4IL1 A;  2JNX A;  2WC8 A;  2ISD A;  1BG1 A;  1SRA A;  1UHI A;  1B8L A;  3LL8 B;  1L7Z A;  1DJX A;  5I2L A;  1KQV A;  1BMO A;  3KPX A;  4CLN A;  3LCP C;  2E30 A;  1LIN A;  1C07 A;  1NWD A;  3DF0 A;  2Q91 A;  5HYD A;  4WQ3 A;  1BF5 A;  1Y1A A;  1SCM B;  2F3Z A;  3D0Y B;  1NX2 A;  1V1F A;  1ZMZ A;  4YBH B;  1AK8 A;  2I2R E;  2JPT A;  3IQQ A;  2FCE A;  2P6B B;  1QAS A;  4MEW A;  1ALV A;  2BL0 C;  1K93 D;  2O5G A;  4I5N B;  4D1E A;  1C7W A;  1UHK A;  4XJK B;  2E6W A;  2EHB A;  1MWN A;  1KQM C;  3EVR A;  2LMT A;  1Y0V H;  2LVV A;  2JXC A;  2OTG C;  1RFJ A;  2KFG A;  2M0R A;  3CR5 X;  1RWY A;  5HKW A;  3TUY B;  1TNW A;  2KI6 D;  1M31 A;  1AUI B;  2KYF A;  2BCA A;  2EGD A;  1C7V A;  1NX3 A;  4YRU A;  4YGC B;  1EJ3 A;  1SL7 A;  2KGB C;  1K94 A;  2ZN8 A;  4XYN A;  4PAL A;  2PRU A;  5KTY A;  1GGW A;  2BCX A;  4OKH A;  2WCF A;  4PHJ A;  2K8M B;  1N2D A;  1QVI Z;  2LVJ A;  2KAY A;  3EK4 A;  3O4Y A;  4AOM A;  1QIV A;  2Y1N A;  1SR6 B;  3SIA A;  1SCV A;  3ZWH A;  2KAV A;  1B47 A;  2A4J A;  3FWB A;  1A29 A;  2GV5 A;  3RLZ A;  1QVI Y;  1FF1 A;  2ZND A;  4GUK A;  2Y1M A;  2MBX A;  2H61 C;  1JBA A;  1QXP A;  4ICB A;  1UHH A;  3BXK A;  3CTN A;  1TCO B;  1IJ5 A;  1TTX A;  2LV7 A;  1CFD A;  1XK4 A;  1KWO C;  1NUB A;  1OOJ A;  1OZS A;  1UUS A;  4PE1 A;  4PDZ A;  3A4U B;  1AVS A;  1KK8 B;  4F0Z B;  1TNX A;  3AKB A;  4GAO A;  3PLF B;  1DF0 B;  1MXE A;  1BR4 B;  1CLB A;  1NYA A;  1NIW A;  2AAO A;  4MZL A;  4ORB B;  1IQ3 A;  1CDN A;  2LE9 B;  1XFZ O;  2HQW A;  3SG6 A;  1DF0 A;  1XA5 A;  1XFU O;  2FJU B;  3QRX A;  2FOT A;  4DRW A;  1CFC A;  1WDC B;  2F2P A;  2QPT A;  4ETO A;  1EG4 A;  2LCP A;  2Q4U A;  3ICB A;  2LUC A;  3OX6 A;  1BJF A;  1SBJ A;  3JVT C;  3DVM A;  3TS5 B;  2SAS A;  1XFY O;  1MUX A;  3I5H C;  2JTT A;  4E68 A;  2MJW B;  1QX2 A;  2LVI A;  3CZT X;  1OQP A;  3BOW A;  4UPG A;  4R1E A;  4AQJ A;  1OZO A;  1UWO A;  2EC6 C;  2IS9 A;  5AFP A;  2LLU A;  1OSA A;  5JJG A;  1JC2 A;  2LM5 A;  1QV0 A;  2ZNE A;  2KAX A;  2MRD A;  2KFH A;  1DGV A;  1EG3 A;  1BR1 B;  3I5I B;  2G9B A;  1R2U A;  4PE0 A;  5D7F A;  2M7N A;  1K95 A;  5PAL A;  1B8C A;  5TNC A;  3AAK A;  4I5K A;  5ER4 X;  1W7I B;  1JWD A;  2AUC A;  2LHI A;  2BE6 A;  3BUX B;  2LLT A;  4Q04 A;  1FI5 A;  2F3Y A;  1S6I A;  5HLO A;  3O78 A;  4MRY A;  2F2O A;  2KNE A;  1A4P A;  1MR8 A;  2Y4Q A;  3SG3 A;  1CNP A;  1M46 A;  1LXF C;  1SW8 A;  1KK7 Y;  2LHL A;  3O2P A;  1S5G Y;  2I94 A;  1CLM A;  1BU3 A;  3GOF A;  1DJG A;  4PE7 A;  1K9P A;  1A75 A;  3TZ1 A;  3A8R A;  2L98 A;  2WOS A;  2KI4 B;  3GK1 A;  2D8N A;  1W7J B;  5BPJ A;  2L4H A;  2PSR A;  1PVB A;  1GJY A;  2CCM A;  1QX5 B;  2KOT A;  1ZFS A;  4YGD B;  4CFR A;  4GGN A;  4FTG A;  4YI8 A;  2M3W A;  1K96 A;  2NCP A;  1K9K A;  2KHN A;  2WND A;  3D0Y A;  1SR6 C;  1BOC A;  1K2H A;  2K61 A;  2KDH A;  1FPW A;  4PE4 A;  1J7P A;  5ER5 A;  1QV1 A;  1DJI A;  1B7T Z;  1TNP A;  3DD4 A;  4WRI A;  4JQ0 D;  4XJK A;  4HRH A;  1N65 A;  1SK6 D;  1XK4 C;  2FCD A;  3BUM B;  5J3X A;  3MSE B;  3BUN B;  3PM8 A;  1CM1 A;  1YUT A;  2JUL A;  2KGR A;  2K2A A;  2PAL A;  4YGA A;  5I8N A;  1LA3 A;  1NPQ A;  5AEQ A;  3KO0 A;  2CXJ A;  1B7T Y;  3VRO A;  1X02 A;  5I2O A;  1SNL A;  4MN0 A;  1SY9 A;  1REC A;  5CSJ A;  1XFX O;  1DJY A;  2PVB A;  5KSZ A;  4BY4 A;  4FQO A;  4A4C A;  1IWQ A;  1CDP A;  1CDM A;  4I5L B;  1XO5 A;  4BY5 A;  1YRU B;  1E8A A;  2CNP A;  2COL B;  2KI6 C;  3KEV A;  1QS7 A;  3EVV A;  2LMV A;  5DKR A;  2M7L A;  1J7R A;  2JOJ A;  1AP4 A;  5HLV A;  2QAC A;  1L2O B;  1R6P A;  1EL4 A;  1RK9 A;  1F4O A;  3HCM A;  5AAN A;  1NP8 A;  1FI6 A;  1WDC C;  1QAT A;  2CT9 A;  1MHO A;  1TIZ A;  2K7O A;  2M29 A;  1H8B A;  3F45 A;  1HQV A;  1YUR A;  3CR4 X;  2I7A A;  1IH0 A;  2GGM A;  1PVA A;  1NX1 A;  3I5F C;  1RJV A;  2O60 A;  5HKY A;  2BL0 B;  3TS5 C;  1G8I A;  4M2Q A;  1M63 B;  1DTL A;  1DGU A;  5G08 A;  1NX0 A;  1G4Y R;  2DOQ A;  2M8U A;  3H4S E;  1WRL A;  4QJ4 B;  2G2B A;  1NCX A;  1WRK A;  2L50 A;  1BLQ A;  3RM1 A;  2MHH A;  4M2P A;  3FIA A;  3LK1 A;  2K2F A;  1B4C A;  1YRT B;  2K7C A;  3CS1 A;  1CMG A;  1K90 D;  2VRG A;  2JT3 A;  3SG2 A;  5IBW A;  1CLL A;  4USL A;  1U5I B;  3LLE A;  2JC2 A;  3CR2 A;  1AJ4 A;  1XVJ A;  1CKK A;  2OS8 C;  4YGE B;  1YX7 A;  4PCW A;  2KBM A;  1WLM A;  4TNC A;  2HF5 A;  1PSB A;  2WCE A;  3EKH A;  1GQM A;  1QTX A;  3I5G B;  1SL9 A;  2LAN A;  3OHM B;  4ZCV A;  2WOR A;  3BYA A;  3BUW B;  4PHN A;  1SL8 A;  1M45 A;  3DVK A;  1J7Q A;  3AAJ A;  3CGA A;  2PAS A;  3NSO A;  1UP5 A;  4L9M A;  2JQ6 A;  2LLS A;  2KI4 C;  2L51 A;  2PMY A;  1KFX S;  3EKJ A;  1EH2 A;  4MZK A;  1QIW A;  3DVE A;  1YX8 A;  3TDI A;  3IQO A;  1WRZ A;  4GGF A;  4N1G A;  5CSF A;  3VRQ A;  2LVK A;  4C0L A;  1NCZ A;  2H2K A;  1SCM C;  2Y5I A;  1KWO B;  2MA2 A;  5D69 A;  4N1F A;  1DJH A;  1H4B A;  4M2O A;  4MBE A;  1TN4 A;  1IQ5 A;  3OX5 A;  1YR5 A;  4PHK A;  1B9A A;  3OB2 B;  2K7B A;  3NXA A;  5HKZ A;  3PN7 B;  1PRW A;  1Y1X A;  1CMF A;  2L2E A;  1UHJ A;  1CFP A;  1S26 D;  1OMD A;  2BCB A;  1BT6 A;  2KBI A;  4DUQ A;  1K8U A;  1J1E A;  1B8R A;  2MLE C;  1FW4 A;  1KCY A;  2JXL A;  3TUY C;  1ZAC A;  1YUU A;  2JWW A;  5AXI A;  5CSN A;  1UUR A;  2JT0 A;  1A2X A;  1QLK A;  4A4B A;  1S36 A;  2AMI A;  1F4Q A;  5AER A;  2RGI A;  3M0W A;  1S1E A;  1PAL A;  2BKI B;  1G33 A;  4WQ2 A;  2TN4 A;  2HPS A;  1KFU S;  2M49 B;  1YVH A;  3GK4 X;  3PAT A;  1XFV O;  2HET A;  5GQQ C;  3KF9 A;  1LA0 A;  3VRN A;  1RRO A;  1JF0 A;  2M9G A;  3C1V A;  3JVT B;  4CPV A;  1FBV A;  5FYX A;  5DKN A;  4OVN F;  4YI9 A;  3VRP A;  2JRF A;  4MLW A;  3DF0 B;  1S6J A;  3PSR A;  2EC6 B;  4GPL B;  2K7D A;  2KYC A;  1DJW A;  4JPZ B;  2LP3 A;  1J7O A;  1L2O C;  3SG4 A;  3SG5 A;  4CID A;  1LVC D;  3JTD B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...