1OSAA

Crystal structure of recombinant paramecium tetraurelia calmodulin at 1.68 angstroms resolution
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
148
structure length
148
Chain Sequence
AEQLTEEQIAEFKEAFALFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLSLMARKMKEQDSEEELIEAFKVFDRDGNGLISAAELRHVMTNLGEKLTDDEVDEMIREADIDGDGHINYEEFVRMMVSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the recombinant Paramecium tetraurelia calmodulin at 1.68 A resolution.
pubmed doi rcsb
source organism Paramecium tetraurelia
molecule tags Calcium-binding protein
molecule keywords CALMODULIN
total genus 53
structure length 148
sequence length 148
ec nomenclature
pdb deposition date 1993-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1osaA01
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1osaA02
1XA5A 3A4UB 2JT0A 3NSIA 4NQGA 1BF5A 3ZNIA 1DVIA 3FIAA 3RLZA 2H2KA 1IJ5A 2LMUA 1C07A 1K93D 3D0YB 2QPTA 4CIDA 1L2OC 4MSPA 1NCXA 2B1UA 1F54A 1NSHA 1XFVO 2KAYA 1PVBA 3BXKA 2LUCA 3GK4X 3VROA 4C0LA 1BODA 1Y0VH 2JNXA 2V53A 2I7AA 3WNXB 3IQOA 1SCMB 4MBEA 1XVJA 1DGUA 1QIWA 4JQ0D 1G8IA 2KI6C 3DVEA 1B8RA 3BOWB 2H61C 1R2UA 4M2OA 2L50A 1SL7A 1KWOC 3CR5X 1QXPA 5F6TA 4AQJA 1QATA 2L5XB 5I8NA 1SKTA 1UURA 3HX4A 2LLTA 2MBXA 3VRQA 2BBMA 2JTZA 1UHIA 3TS5B 1WRLA 2FJUB 2KYCA 1RJVA 1TNXA 1SK6D 3PATA 2HF5A 1KSOA 3KO0A 1ZACA 4YGAA 1RWYA 1NX2A 4WQ3A 2ZN9A 1MWNA 2E30A 4GGNA 2AAOA 3JVTC 2NLNA 2WOSA 2M1KB 3I5HC 4MRYA 2JT8A 3GOFA 1JUOA 1AHRA 1NX3A 1BJFA 2JC2A 1HT9A 2BKIB 2LMVA 2MJWB 3VRPA 1BLQA 3HCMA 1DJGA 4GGFA 1Y1AA 2M7NA 1AVSA 1EH2A 1B47A 1FF1A 4MZJA 3OB2B 2L51A 2LVVA 3K21A 1IWQA 4OR9B 1C7VA 1H4BA 1SL8A 3BYAA 3D10A 4NDDA 4YRUA 4UPGA 2PSRA 2JWWA 2KSPA 4DIRA 2GV5A 5D7FA 1LINA 1KFXL 1NWDA 3EK7A 3C1VA 1FI6A 4P5OE 1BR1B 1LKJA 1YRUB 1ZFSA 1LVCD 2F3YA 3PM8A 2KGBC 2IS9A 4N1FA 1QASA 2WC8A 4CFRA 2JXCA 5HKYA 1NCZA 1W7IB 3GK1A 4PE0A 4GNKB 4D1EA 1FBVA 3OP0A 2I2RE 3D0YA 5GQQC 1WDCB 1V1GA 5HLOA 3CWGA 4IL1A 1AK8A 1JC2A 2GGMA 1SRAA 3WHUB 1K9UA 3LL8B 1DGVA 1RECA 3EK8A 4OVNF 1OMRA 1R6PA 4JWQA 4HRHA 1N2DA 1WY9A 4MN0A 4HSZA 1CDLA 2CCMA 3AAKA 1NCYA 3GK2A 1CDMA 1M45A 2K0JA 4L9MA 3CR4X 3NSKA 4QJ5B 1M63B 1DJIA 5AEQA 1C7WA 1ZMZA 2HETA 1J7OA 2KI6D 1QV0A 2L2EA 2M9GA 1KK8C 3CGAA 1N65A 1GJYA 1S1EA 1B9AA 2BL0C 2LHIA 2PVBA 2LHLA 3M0WA 1EG4A 1QVIY 1CDPA 3O6BA 5DKNA 1U5IB 2NXQA 4PHKA 3AKAA 1NIWA 2KYFA 2OTGC 3BOWA 2HQWA 1Q80A 1X02A 4PALA 2VRGA 3PFVA 1DMOA 4CLNA 1IJ6A 4I5JA 1IRJA 2LVJA 2MAZA 2Y1NA 1QX5B 1A29A 3OX6A 2BL0B 1JSAA 2I94A 2A4JA 4F0ZB 4I5NB 1AJ4A 4NDBA 1JFJA 1OOJA 2E6WA 1PULA 2JZIA 3EVVA 4GUKA 1A2XA 4C0JA 1J1DA 1WRZA 4MZKA 2O5GA 1B1GA 3SG7A 4M2QA 1WRKA 1KFUS 5D69A 4I5LB 2FCEA 3JTDB 3LK0A 1KCYA 1GQMA 1SPYA 4YI8A 1AP4A 2Y5IA 1QS7A 1S5GZ 2MRDA 1RROA 4PHNA 4I5KA 1CLBA 4GPLB 3PSRA 4FTGA 3BUNB 1MQ1A 2JU0A 2Q4UA 2AMIA 3TUYB 1LXFC 1NX1A 1F71A 3SG3A 1A75A 1MHOA 2L0PA 3VRRA 1YX8A 1CLLA 1CMGA 1OZSA 2KGRA 3DVJA 3E3RA 4MEWA 3TDIA 3CR2A 2D8NA 2KFGA 1H8BA 2QACA 1F4QA 1G33A 3IQQA 4Q04A 1HQVA 1SW8A 4ICBA 4E68A 2MLFC 5KU1A 3LCPC 1YVHA 4YBHB 3VGOA 1KWOB 2SASA 3DVKA 1DTLA 1S26D 1TRFA 2FCDA 4N5XA 1CMFA 2LVKA 5JJGA 3DF0B 4TNCA 1NUBA 3LK1A 5I2LA 4USLA 3I5IC 2PALA 2JULA 4A4CA 1S6JA 4XJKB 1B8LA 1K94A 2PMYA 2LCPA 1QLKA 3F45A 1GGWA 1K9PA 1CFDA 1CM4A 1KQMB 1NX0A 1WLZA 2NCPA 1CKKA 1YUTA 1B7TZ 1XFZO 2M7LA 2EC6C 1M39A 1DT7B 2F33A 2O60A 5CSNA 2M97A 2LE9B 4DS7A 1JWDA 5HYDA 2ZNDA 2KFFA 3CZTX 1YUSA 1PVAA 1S36A 2LUXA 3SG5A 2PRUA 3O78A 4ETOA 4M2PA 4ORCB 2LVIA 3NXAA 1F70A 1UHKA 1EJ3A 1CNPA 1UHNA 1OSAA 2BE6A 3SG4A 2LP2A 1CB1A 2CBLA 5ER4X 1F8HA 5AFPA 3SJSA 1PRWA 2R2IA 1XFUO 2KAVA 2KAXA 1TTXA 4PDZA 1RTP1 3KHEA 3DD4A 5JOLA 3TDUA 1ZOTB 3H4SE 4YGDB 2MLEC 2KFHA 2M0RA 4PHMA 1Y1XA 1IQ3A 4C0KA 2LLUA 2LM5A 3LLEA 1CFPA 1J7QA 1YURA 4PE1A 3TDZA 4MRXA 1B7TY 1MR8A 2K61A 4A4BA 1IQ5A 1QVIZ 2SCPA 4N1GA 4OKHA 4ORAB 3I5FB 5CPVA 3RM1A 1OZOA 5KSZA 1XYDA 2JT3A 1B8CA 1JBAA 3WXAA 3BUMB 1CFCA 5DKRA 5B8IB 1QLSA 4MVFA 1DJZA 2M1UA 1ODBA 2ISDA 2KHNA 1QIVA 3MSEB 5CSIA 2G2BA 2JOJA 1QJTA 1V1FA 4GGFC 2NCOA 4P2YB 2BCAA 4XYNA 1WLMA 2WCEA 2ZKMX 3PN7B 4HRGA 2LLSA 1IGVA 3TS5C 1N0YA 2BKHB 1TCFA 1FW4A 2JPTA 2LP3A 1EXRA 3BUWB 2EC6B 2WORA 3A8RA 2KI4C 1ZUZA 1ALVA 3EKJA 1JFKA 2TN4A 3I5GC 4MLWA 1S6IA 4JPZB 1BT6A 1TCOB 5FYXA 1DF0B 5PALA 4YGBB 2ZRSA 3AAJA 4YI9A 2BECA 1A03A 2HQ8A 1S5GY 2K7CA 3OHMB 1WDCC 4OCIA 1KK8B 2HPSA 2WCBA 1SY9A 3JTDC 5HKWA 1SMGA 5CSJA 4PE4A 1YTZC 1TNWA 5DKQA 1DF0A 1DJWA 1XK4A 3SIBA 5AANA 1BMOA 1L7ZA 1SR6C 1YVLA 1LA0A 2LAPA 5IBWA 3OX5A 2Y4QA 5HLVA 2LNKA 1BU3A 2BCBA 5HKZA 5K89A 1K8UA 1KK7Z 1CM1A 1MUXA 1UWOA 3BUXB 4DUQA 1K90D 1BG1A 1EG3A 1SBJA 1OQPA 2LMTA 5BPJA 1KSMA 1SL9A 1K95A 4CFQA 2H61A 2GGZA 1U5IA 4OV2A 4GAOA 1NYAA 2DOQA 1K9KA 2K7DA 2WNDA 2Y1MA 4AOMA 1FI5A 2CT9A 4ZCVA 1SNLA 1CLMA 1PSRA 2OTGB 2MA2A 1RFJA 1SCVA 3EVUA 4QJ3B 1KQMC 2M3WA 4MZLA 1IG5A 1PSBA 1NPQA 3NSLA 2JRFA 3KF9A 2K8MB 2L4IA 2LC5A 4HREE 4R1EA 2KQ6A 5I2OA 1Y1UA 4PHJA 3JVTB 1J7RA 3CS1A 1A75B 1QV1A 1PK0D 3I5HB 3O2PA 4CPVA 1TNPA 2KDHA 1B4CA 3PALA 1FPWA 2JTTA 2LANA 1XK4C 2ZFDA 4PCWA 2F8PA 2JNFA 1DJHA 1J1EA 2KNEA 3FWCA 3SG6A 4BY4A 3SIAA 2F2PA 1XFYO 1L2OB 1MXLC 1KK7Y 4QJ4B 3QRXA 3CTNA 1G4YR 1J7PA 1A4PA 2OS8B 2L98A 3TZ1A 1OMVA 1K96A 1S6CA 1BR4B 3EK4A 1UP5A 4ZCUA 2ZNEA 1S3PA 2K7BA 3BQ3A 1XFXO 2RGIA 5AXIA 1MXEA 2PASA 1AJ5A 2KBIA 4FQOA 4YGCB 1QX7A 4AQIA 5J3XA 1K2HA 2K7OA 1JF0A 1IH0A 4WQ2A 4YGEB 1IKUA 2JXLA 2OS8C 3IF7A 2M49B 5KTYA 1YR5A 3ICBA 2KQYA 2ZN8A 2M29A 5AERA 1TN4A 1QX2A 3I5GB 4GBAA 1LA3A 1PALA 3NSOA 1NP8A 1CDNA 4NDCA 1ALWA 2G9BA 2M8UA 3EKHA 1W7JB 3WHTB 4BY5A 1CFFA 1KFXS 3DF0A 2Q91A 4DRWA 1UHHA 3FWBA 4U8DA 2AUCA 2K2FA 2OPOA 1MF8B 4DCKA 2L4HA 1RK9A 1SCMC 2BE4A 2LV7A 1E8AA 1AUIB 1OMDA 4XJKA 1EL4A 1TIZA 1Y6WA 1YUUA 2K2AA 1BOCA 3I5IB 3FS7A 1M31A 1XO5A 1YRTB 5G08A 2JQ6A 1KFUL 1KQVA 1M46A 3BUOB 3PLFB 1XFWO 2KI4B 1QTXA 2F2OA 2BCXA 3DVMA 5I2QA 3CLNA 1F4OA 2CXJA 3KPXA 2KOTA 1UHJA 4WRIA 1DJYA 3O4YA 1DJXA 3AKBA 5ER5A 2MHHA 2I18A 1UUSA 3TUYC 1GGZA 2FOTA 1J55A 5CSFA 3SG2A 3VRNA 1D1OA 1SYMA 3PN7C 3OB1B 1F55A 1YX7A 3KEVA 1SR6B 3ZWHA 1VRKA 2F3ZA 5TNCA 2EHBA 2KBMA 2P6BB 2WCFA 2BBNA 2NZ0A 1CTRA 4ORBB 4PE7A 2CNPA 1OE9B 2ZRTA 2COLB 4GFTA 2CTNA 3I5FC 2EGDA 1TNQA 3EVRA 1TOPA 1JF2A
chains in the Genus database with same CATH superfamily
1XA5A 3A4UB 2JT0A 3NSIA 4NQGA 1BF5A 3ZNIA 1DVIA 3FIAA 3RLZA 2H2KA 1IJ5A 2LMUA 1C07A 1K93D 3K1EA 3D0YB 2QPTA 4CIDA 1L2OC 4MSPA 1NCXA 2B1UA 1F54A 1NSHA 3L4LA 2QEHA 1XFVO 2KAYA 4INXA 1PVBA 3BXKA 2LUCA 1P28A 3GK4X 3VROA 4C0LA 1BODA 2BNXA 1Y0VH 2JNXA 2V53A 2I7AA 3WNXB 3IQOA 2KPHA 1SCMB 4MBEA 1XVJA 3BFBA 1DGUA 1QIWA 4JQ0D 1G8IA 2KI6C 3DVEA 1B8RA 3V2LA 3BOWB 2H61C 1R2UA 4M2OA 2L50A 1SL7A 1KWOC 3CR5X 1QXPA 5F6TA 4AQJA 1QATA 2L5XB 5I8NA 1SKTA 1UURA 3HX4A 2LLTA 2MBXA 3VRQA 2BBMA 2JTZA 1UHIA 3TS5B 1WRLA 2FJUB 3CZ1A 2KYCA 1RJVA 1TNXA 1SK6D 3PATA 2HF5A 1KSOA 3KO0A 1ZACA 4YGAA 1RWYA 1NX2A 4WQ3A 2ZN9A 1MWNA 2E30A 4GGNA 2AAOA 3JVTC 2NLNA 2WOSA 3Q8IA 2M1KB 3I5HC 4MRYA 2JT8A 3GOFA 1JUOA 1AHRA 1NX3A 1BJFA 2JC2A 1HT9A 2BKIB 2LMVA 2MJWB 3UNWA 3VRPA 3HCMA 1DJGA 1BLQA 4GGFA 1Y1AA 2M7NA 1AVSA 1EH2A 1B47A 1C3YA 1FF1A 4MZJA 3OB2B 2L51A 2LVVA 3K21A 1IWQA 4OR9B 1C7VA 1H4BA 1SL8A 2WCJA 3BYAA 3D10A 4NDDA 3L47A 4UPGA 2PSRA 4YRUA 2JWWA 4KYNA 2KSPA 4DIRA 2GV5A 5D7FA 1Z2CB 1LINA 1KFXL 1NWDA 1OOIX 3EK7A 3C1VA 1FI6A 4P5OE 1BR1B 1LKJA 1YRUB 1ZFSA 1LVCD 2F3YA 3PM8A 2KGBC 2IS9A 4N1FA 1QASA 2WC8A 4CFRA 2JXCA 5HKYA 1NCZA 1W7IB 3GK1A 2P70A 4PE0A 4GNKB 4D1EA 1FBVA 3OP0A 2I2RE 3D0YA 5GQQC 1WDCB 1OOFA 1V1GA 5HLOA 3CWGA 3PJIA 4IL1A 1AK8A 2GGMA 1JC2A 2L2CA 1SRAA 3WHUB 1K9UA 3LL8B 1DGVA 1RECA 3EK8A 4OVNF 1OMRA 1R6PA 4JWQA 4HRHA 1N2DA 1WY9A 4MN0A 4HSZA 1CDLA 2CCMA 3AAKA 1NCYA 3GK2A 1CDMA 3CABA 2QDIA 1M45A 2K0JA 4L9MA 3CR4X 3NSKA 4QJ5B 1M63B 1DJIA 3D76A 5AEQA 1C7WA 1T14A 1ZMZA 2HETA 1J7OA 1SSEB 2KI6D 1QV0A 2L2EA 2M9GA 5D3OA 1KK8C 2BAPA 3CGAA 1N65A 1GJYA 1S1EA 1B9AA 2BL0C 2LHIA 2PVBA 2LHLA 3M0WA 1EG4A 1QVIY 1CDPA 3O6BA 5DKNA 1U5IB 2NXQA 4PHKA 3AKAA 1NIWA 2KYFA 2OTGC 3N7HA 3BOWA 2HQWA 1Q80A 1X02A 4PALA 2VRGA 3PFVA 1DMOA 4CLNA 2WCKA 1Z4HA 1IJ6A 4I5JA 1IRJA 2LVJA 2MAZA 2Y1NA 1QX5B 1A29A 3OX6A 2BL0B 1JSAA 4FQTA 2I94A 2A4JA 4F0ZB 4I5NB 1AJ4A 3CDNA 4NDBA 1OOJA 2E6WA 1PULA 2JZIA 3EVVA 4GUKA 1A2XA 4C0JA 1JFJA 1J1DA 1WRZA 2GTEA 2O5GA 4MZKA 1B1GA 3SG7A 4M2QA 1WRKA 1KFUS 5D69A 2ERBA 2PYQA 4I5LB 2FCEA 3JTDB 3LK0A 1KCYA 1GQMA 1SPYA 4YI8A 1AP4A 2Y5IA 1QS7A 1S5GZ 2MRDA 1RROA 4PHNA 4I5KA 1CLBA 4GPLB 3PSRA 4FTGA 3NHIA 4IJ7A 3BUNB 3DXLA 1MQ1A 2JU0A 2Q4UA 2AMIA 3TUYB 2WC6A 1LXFC 3PM2A 1NX1A 1GGWA 1F71A 3SG3A 1A75A 1MHOA 2L0PA 3VRRA 1YX8A 1CLLA 1CMGA 1OZSA 2KGRA 3DVJA 3E3RA 3RZSA 4MEWA 3TDIA 3CR2A 2D8NA 2KFGA 2WCMA 2QACA 1H8BA 1F4QA 1G33A 2PQLA 3IQQA 4Q04A 1HQVA 1SW8A 4ICBA 1TUJA 2KLDA 4E68A 2MLFC 5KU1A 3LCPC 1YVHA 4YBHB 3D78A 3VGOA 1KWOB 2SASA 3B88A 3DVKA 1DTLA 1S26D 1TRFA 2FCDA 4N5XA 1CMFA 2LVKA 3DZTA 4F7FA 5JJGA 3DF0B 4TNCA 1NUBA 3LK1A 5I2LA 4USLA 3I5IC 2YGUA 2PALA 5EL2A 2JULA 4A4CA 1S6JA 4XJKB 1B8LA 1K94A 2PMYA 1LS8A 2LCPA 1C3ZA 1QLKA 3F45A 3B86A 1K9PA 1CFDA 1CM4A 1KQMB 1NX0A 1WLZA 2NCPA 3L4AA 1CKKA 1DEKA 1YUTA 1B7TZ 3S0DA 1XFZO 2M7LA 3B7AA 2EC6C 1M39A 3VB1A 1DT7B 2F33A 2O60A 5CSNA 2M97A 2LE9B 4DS7A 3B6XA 1JWDA 5HYDA 2ZNDA 3CZ0A 2KFFA 3CZTX 1YUSA 1PVAA 1S36A 2LUXA 3SG5A 2PRUA 2WC5A 3O78A 4ETOA 4M2PA 1ORGA 4ORCB 2LVIA 3UO9A 4JD9A 3NXAA 1F70A 1UHKA 1EJ3A 1CNPA 2P71A 1UHNA 1OSAA 2BE6A 3SG4A 2LP2A 1CB1A 2CBLA 5ER4X 1F8HA 5AFPA 3SJSA 1PRWA 2R2IA 1XFUO 2KAVA 2KAXA 1TTXA 4PDZA 1RTP1 3KHEA 3DD4A 5JOLA 3TDUA 1ZOTB 3H4SE 4YGDB 2MLEC 2KFHA 2M0RA 4PHMA 1Y1XA 1IQ3A 4C0KA 2LLUA 2LM5A 3LLEA 1CFPA 1J7QA 1YURA 4PE1A 3TDZA 4MRXA 1B7TY 1MR8A 2K61A 3R1PA 4A4BA 1IQ5A 1QVIZ 2SCPA 4N1GA 4OKHA 2L5YA 3I5FB 4ORAB 5CPVA 3RM1A 1OZOA 5KSZA 1XYDA 2JT3A 1B8CA 1JBAA 3WXAA 3BUMB 1CFCA 5DKRA 1W9ZA 5B8IB 1QLSA 4MVFA 1DJZA 2M1UA 1ODBA 1QWVA 2ISDA 3S0GA 2KHNA 1QIVA 3MSEB 5CSIA 2G2BA 2FJYA 2JOJA 1QJTA 1V1FA 4GGFC 2NCOA 4P2YB 2BCAA 4XYNA 1WLMA 2WCEA 2ZKMX 2H8VA 3PN7B 4HRGA 2LLSA 1IGVA 3TS5C 1N0YA 2BKHB 1TCFA 1FW4A 2JPTA 2LP3A 1EXRA 3BFAA 3BUWB 2EC6B 3NHTA 2WORA 3A8RA 2KI4C 1ZUZA 1ALVA 3EKJA 1JFKA 2TN4A 3I5GC 4MLWA 3OBVA 1S6IA 4INWA 1TWOA 4JPZB 1BT6A 1TCOB 5FYXA 1DF0B 5PALA 4YGBB 2ZRSA 3AAJA 4YI9A 2BECA 1A03A 1OOGA 2HQ8A 1S5GY 3FE6A 2K7CA 3OHMB 1WDCC 3S0EA 4OCIA 1KK8B 2HPSA 2WCBA 1SY9A 3JTDC 5HKWA 1SMGA 5CSJA 4PE4A 1YTZC 1TNWA 5DKQA 1DELA 1DF0A 1DJWA 2QEBA 1XK4A 3SIBA 5AANA 1BMOA 1L7ZA 1SR6C 1YVLA 1LA0A 2LAPA 5IBWA 3OX5A 2Y4QA 5HLVA 2LNKA 1BU3A 2BCBA 5HKZA 5K89A 1K8UA 1KK7Z 1CM1A 1MUXA 1UWOA 3BUXB 4DUQA 1K90D 1BG1A 1EG3A 1SBJA 1OQPA 2LMTA 1GM0A 1TUZA 5BPJA 1KSMA 1SL9A 1K95A 4CFQA 2GGZA 1U5IA 2H61A 4OV2A 4GAOA 1NYAA 2DOQA 1K9KA 2K7DA 2WNDA 2Y1MA 4PT1A 4AOMA 1FI5A 2CT9A 4OZDA 4ZCVA 1SNLA 1CLMA 1PSRA 2OTGB 2MA2A 1RFJA 1SCVA 3EVUA 4QJ3B 3SS5A 2K60A 1KQMC 2M3WA 4MZLA 1IG5A 1PSBA 1NPQA 3NSLA 2JRFA 3KF9A 2K8MB 2L4IA 2LC5A 4HREE 3CZ2A 4R1EA 2KQ6A 5I2OA 1Y1UA 4PHJA 3JVTB 1J7RA 3CS1A 1A75B 1QV1A 3IVTA 1PK0D 3I5HB 3O2PA 4CPVA 1TNPA 2KDHA 1B4CA 3PALA 1FPWA 3D75A 2JTTA 2LANA 1XK4C 2ZFDA 4PCWA 3S0BA 2F8PA 2JNFA 1DJHA 1J1EA 2KNEA 3FWCA 5DICA 5FI7A 3SG6A 3SIAA 4BY4A 2F2PA 3DYEA 1XFYO 1L2OB 1MXLC 1KK7Y 4QJ4B 3QRXA 3BJHA 3CTNA 1G4YR 1J7PA 1DC1A 1A4PA 2OS8B 2L98A 3QMEA 3TZ1A 1OMVA 3OGNA 1K96A 1S6CA 1BR4B 3EK4A 3D77A 3SS4A 1UP5A 4ZCUA 2ZNEA 1S3PA 2K7BA 3BQ3A 3CYZA 1XFXO 2RGIA 5AXIA 1MXEA 2PASA 1AJ5A 2KBIA 4FQOA 4YGCB 1QX7A 2WCLA 4AQIA 5J3XA 1K2HA 1IIOA 2K7OA 1JF0A 1IH0A 5FI2A 4WQ2A 4YGEB 1IKUA 2JXLA 2OS8C 3IF7A 2M49B 5KTYA 3FE8A 1YR5A 3ICBA 2KQYA 2ZN8A 2M29A 3D73A 1TN4A 5AERA 1QX2A 3I5GB 4GBAA 1LA3A 1PALA 3NSOA 3SS3A 1NP8A 1CDNA 4NDCA 1ALWA 3D74A 2G9BA 2M8UA 3EKHA 1W7JB 3WHTB 4BY5A 1CFFA 1KFXS 3DF0A 2Q91A 3B87A 3S0FA 3DY9A 4DRWA 1UHHA 3R1VA 3FWBA 4U8DA 2AUCA 2K2FA 2OPOA 1MF8B 4DCKA 2L4HA 1RK9A 1SCMC 2BE4A 2LV7A 1E8AA 1AUIB 1OMDA 4XJKA 1EL4A 1TIZA 3EG5B 1Y6WA 1YUUA 2K2AA 1BOCA 3NGVA 3I5IB 3FS7A 1M31A 1XO5A 1YRTB 3S0AA 5G08A 2JQ6A 5FI6A 1DQEA 1KFUL 1KQVA 1M46A 3BUOB 3PLFB 1OW4A 1XFWO 2KI4B 1QTXA 2F2OA 2BCXA 3DVMA 5I2QA 1XFRA 3CLNA 1F4OA 2CXJA 2WCHA 3KPXA 3R1OA 4JKTA 2KOTA 1UHJA 2QEOA 4WRIA 1DJYA 1OOHA 3O4YA 1DJXA 3AKBA 5ER5A 2MHHA 2QEVA 3O4XA 2I18A 1UUSA 3R72A 1GGZA 3TUYC 2FOTA 1J55A 5CSFA 3SG2A 3VRNA 1D1OA 1SYMA 3FE9A 3PN7C 5HL1A 3OB1B 1F55A 1YX7A 3KEVA 1SR6B 3ZWHA 1VRKA 2KLEA 2F3ZA 5TNCA 2EHBA 2KBMA 2P6BB 2WCFA 2BBNA 2NZ0A 1CTRA 2JPOA 4ORBB 2CNPA 4PE7A 1OE9B 2ZRTA 2COLB 4GFTA 2CTNA 5I94A 3I5FC 2EGDA 3BFHA 1TNQA 3EVRA 1TOPA 1JF2A
chains in the Genus database with same CATH topology
1XA5A 3A4UB 2JT0A 3NSIA 4NQGA 1BF5A 3ZNIA 1DVIA 3FIAA 3RLZA 2H2KA 1IJ5A 2LMUA 1C07A 1K93D 3D0YB 2QPTA 4CIDA 1L2OC 4MSPA 1NCXA 2B1UA 1F54A 1NSHA 1XFVO 2KAYA 1PVBA 3BXKA 2LUCA 3GK4X 3VROA 4C0LA 1BODA 1Y0VH 2JNXA 2V53A 2I7AA 3WNXB 3IQOA 1SCMB 4MBEA 1XVJA 1DGUA 1QIWA 4JQ0D 1G8IA 2KI6C 3DVEA 1B8RA 3BOWB 2H61C 1R2UA 4M2OA 2L50A 1SL7A 1KWOC 3CR5X 1QXPA 5F6TA 4AQJA 1QATA 2L5XB 5I8NA 1SKTA 1UURA 3HX4A 2LLTA 2MBXA 3VRQA 2BBMA 2JTZA 1UHIA 3TS5B 1WRLA 2FJUB 2KYCA 1RJVA 1TNXA 1SK6D 3PATA 2HF5A 1KSOA 3KO0A 1ZACA 4YGAA 1RWYA 1NX2A 4WQ3A 2ZN9A 1MWNA 2E30A 4GGNA 2AAOA 3JVTC 2NLNA 2WOSA 2M1KB 3I5HC 4MRYA 2JT8A 3GOFA 1JUOA 1AHRA 1NX3A 1BJFA 2JC2A 1HT9A 2BKIB 2LMVA 2MJWB 3VRPA 1BLQA 3HCMA 1DJGA 4GGFA 1Y1AA 2M7NA 1AVSA 1EH2A 1B47A 1FF1A 4MZJA 3OB2B 2L51A 2LVVA 3K21A 1IWQA 4OR9B 1C7VA 1H4BA 1SL8A 3BYAA 3D10A 4NDDA 4YRUA 4UPGA 2PSRA 2JWWA 2KSPA 4DIRA 2GV5A 5D7FA 1LINA 1KFXL 1NWDA 3EK7A 3C1VA 1FI6A 4P5OE 1BR1B 1LKJA 1YRUB 1ZFSA 1LVCD 2F3YA 3PM8A 2KGBC 2IS9A 4N1FA 1QASA 2WC8A 4CFRA 2JXCA 5HKYA 1NCZA 1W7IB 3GK1A 4PE0A 4GNKB 4D1EA 1FBVA 3OP0A 2I2RE 3D0YA 5GQQC 1WDCB 1V1GA 5HLOA 3CWGA 4IL1A 1AK8A 1JC2A 2GGMA 1SRAA 3WHUB 1K9UA 3LL8B 1DGVA 1RECA 3EK8A 4OVNF 1OMRA 1R6PA 4JWQA 4HRHA 1N2DA 1WY9A 4MN0A 4HSZA 1CDLA 2CCMA 3AAKA 1NCYA 3GK2A 1CDMA 1M45A 2K0JA 4L9MA 3CR4X 3NSKA 4QJ5B 1M63B 1DJIA 5AEQA 1C7WA 1ZMZA 2HETA 1J7OA 2KI6D 1QV0A 2L2EA 2M9GA 1KK8C 3CGAA 1N65A 1GJYA 1S1EA 1B9AA 2BL0C 2LHIA 2PVBA 2LHLA 3M0WA 1EG4A 1QVIY 1CDPA 3O6BA 5DKNA 1U5IB 2NXQA 4PHKA 3AKAA 1NIWA 2KYFA 2OTGC 3BOWA 2HQWA 1Q80A 1X02A 4PALA 2VRGA 3PFVA 1DMOA 4CLNA 1IJ6A 4I5JA 1IRJA 2LVJA 2MAZA 2Y1NA 1QX5B 1A29A 3OX6A 2BL0B 1JSAA 2I94A 2A4JA 4F0ZB 4I5NB 1AJ4A 4NDBA 1JFJA 1OOJA 2E6WA 1PULA 2JZIA 3EVVA 4GUKA 1A2XA 4C0JA 1J1DA 1WRZA 4MZKA 2O5GA 1B1GA 3SG7A 4M2QA 1WRKA 1KFUS 5D69A 4I5LB 2FCEA 3JTDB 3LK0A 1KCYA 1GQMA 1SPYA 4YI8A 1AP4A 2Y5IA 1QS7A 1S5GZ 2MRDA 1RROA 4PHNA 4I5KA 1CLBA 4GPLB 3PSRA 4FTGA 3BUNB 1MQ1A 2JU0A 2Q4UA 2AMIA 3TUYB 1LXFC 1NX1A 1F71A 3SG3A 1A75A 1MHOA 2L0PA 3VRRA 1YX8A 1CLLA 1CMGA 1OZSA 2KGRA 3DVJA 3E3RA 4MEWA 3TDIA 3CR2A 2D8NA 2KFGA 1H8BA 2QACA 1F4QA 1G33A 3IQQA 4Q04A 1HQVA 1SW8A 4ICBA 4E68A 2MLFC 5KU1A 3LCPC 1YVHA 4YBHB 3VGOA 1KWOB 2SASA 3DVKA 1DTLA 1S26D 1TRFA 2FCDA 4N5XA 1CMFA 2LVKA 5JJGA 3DF0B 4TNCA 1NUBA 3LK1A 5I2LA 4USLA 3I5IC 2PALA 2JULA 4A4CA 1S6JA 4XJKB 1B8LA 1K94A 2PMYA 2LCPA 1QLKA 3F45A 1GGWA 1K9PA 1CFDA 1CM4A 1KQMB 1NX0A 1WLZA 2NCPA 1CKKA 1YUTA 1B7TZ 1XFZO 2M7LA 2EC6C 1M39A 1DT7B 2F33A 2O60A 5CSNA 2M97A 2LE9B 4DS7A 1JWDA 5HYDA 2ZNDA 2KFFA 3CZTX 1YUSA 1PVAA 1S36A 2LUXA 3SG5A 2PRUA 3O78A 4ETOA 4M2PA 4ORCB 2LVIA 3NXAA 1F70A 1UHKA 1EJ3A 1CNPA 1UHNA 1OSAA 2BE6A 3SG4A 2LP2A 1CB1A 2CBLA 5ER4X 1F8HA 5AFPA 3SJSA 1PRWA 2R2IA 1XFUO 2KAVA 2KAXA 1TTXA 4PDZA 1RTP1 3KHEA 3DD4A 5JOLA 3TDUA 1ZOTB 3H4SE 4YGDB 2MLEC 2KFHA 2M0RA 4PHMA 1Y1XA 1IQ3A 4C0KA 2LLUA 2LM5A 3LLEA 1CFPA 1J7QA 1YURA 4PE1A 3TDZA 4MRXA 1B7TY 1MR8A 2K61A 4A4BA 1IQ5A 1QVIZ 2SCPA 4N1GA 4OKHA 4ORAB 3I5FB 5CPVA 3RM1A 1OZOA 5KSZA 1XYDA 2JT3A 1B8CA 1JBAA 3WXAA 3BUMB 1CFCA 5DKRA 5B8IB 1QLSA 4MVFA 1DJZA 2M1UA 1ODBA 2ISDA 2KHNA 1QIVA 3MSEB 5CSIA 2G2BA 2JOJA 1QJTA 1V1FA 4GGFC 2NCOA 4P2YB 2BCAA 4XYNA 1WLMA 2WCEA 2ZKMX 3PN7B 4HRGA 2LLSA 1IGVA 3TS5C 1N0YA 2BKHB 1TCFA 1FW4A 2JPTA 2LP3A 1EXRA 3BUWB 2EC6B 2WORA 3A8RA 2KI4C 1ZUZA 1ALVA 3EKJA 1JFKA 2TN4A 3I5GC 4MLWA 1S6IA 4JPZB 1BT6A 1TCOB 5FYXA 1DF0B 5PALA 4YGBB 2ZRSA 3AAJA 4YI9A 2BECA 1A03A 2HQ8A 1S5GY 2K7CA 3OHMB 1WDCC 4OCIA 1KK8B 2HPSA 2WCBA 1SY9A 3JTDC 5HKWA 1SMGA 5CSJA 4PE4A 1YTZC 1TNWA 5DKQA 1DF0A 1DJWA 1XK4A 3SIBA 5AANA 1BMOA 1L7ZA 1SR6C 1YVLA 1LA0A 2LAPA 5IBWA 3OX5A 2Y4QA 5HLVA 2LNKA 1BU3A 2BCBA 5HKZA 5K89A 1K8UA 1KK7Z 1CM1A 1MUXA 1UWOA 3BUXB 4DUQA 1K90D 1BG1A 1EG3A 1SBJA 1OQPA 2LMTA 5BPJA 1KSMA 1SL9A 1K95A 4CFQA 2H61A 2GGZA 1U5IA 4OV2A 4GAOA 1NYAA 2DOQA 1K9KA 2K7DA 2WNDA 2Y1MA 4AOMA 1FI5A 2CT9A 4ZCVA 1SNLA 1CLMA 1PSRA 2OTGB 2MA2A 1RFJA 1SCVA 3EVUA 4QJ3B 1KQMC 2M3WA 4MZLA 1IG5A 1PSBA 1NPQA 3NSLA 2JRFA 3KF9A 2K8MB 2L4IA 2LC5A 4HREE 4R1EA 2KQ6A 5I2OA 1Y1UA 4PHJA 3JVTB 1J7RA 3CS1A 1A75B 1QV1A 1PK0D 3I5HB 3O2PA 4CPVA 1TNPA 2KDHA 1B4CA 3PALA 1FPWA 2JTTA 2LANA 1XK4C 2ZFDA 4PCWA 2F8PA 2JNFA 1DJHA 1J1EA 2KNEA 3FWCA 3SG6A 4BY4A 3SIAA 2F2PA 1XFYO 1L2OB 1MXLC 1KK7Y 4QJ4B 3QRXA 3CTNA 1G4YR 1J7PA 1A4PA 2OS8B 2L98A 3TZ1A 1OMVA 1K96A 1S6CA 1BR4B 3EK4A 1UP5A 4ZCUA 2ZNEA 1S3PA 2K7BA 3BQ3A 1XFXO 2RGIA 5AXIA 1MXEA 2PASA 1AJ5A 2KBIA 4FQOA 4YGCB 1QX7A 4AQIA 5J3XA 1K2HA 2K7OA 1JF0A 1IH0A 4WQ2A 4YGEB 1IKUA 2JXLA 2OS8C 3IF7A 2M49B 5KTYA 1YR5A 3ICBA 2KQYA 2ZN8A 2M29A 5AERA 1TN4A 1QX2A 3I5GB 4GBAA 1LA3A 1PALA 3NSOA 1NP8A 1CDNA 4NDCA 1ALWA 2G9BA 2M8UA 3EKHA 1W7JB 3WHTB 4BY5A 1CFFA 1KFXS 3DF0A 2Q91A 4DRWA 1UHHA 3FWBA 4U8DA 2AUCA 2K2FA 2OPOA 1MF8B 4DCKA 2L4HA 1RK9A 1SCMC 2BE4A 2LV7A 1E8AA 1AUIB 1OMDA 4XJKA 1EL4A 1TIZA 1Y6WA 1YUUA 2K2AA 1BOCA 3I5IB 3FS7A 1M31A 1XO5A 1YRTB 5G08A 2JQ6A 1KFUL 1KQVA 1M46A 3BUOB 3PLFB 1XFWO 2KI4B 1QTXA 2F2OA 2BCXA 3DVMA 5I2QA 3CLNA 1F4OA 2CXJA 3KPXA 2KOTA 1UHJA 4WRIA 1DJYA 3O4YA 1DJXA 3AKBA 5ER5A 2MHHA 2I18A 1UUSA 3TUYC 1GGZA 2FOTA 1J55A 5CSFA 3SG2A 3VRNA 1D1OA 1SYMA 3PN7C 3OB1B 1F55A 1YX7A 3KEVA 1SR6B 3ZWHA 1VRKA 2F3ZA 5TNCA 2EHBA 2KBMA 2P6BB 2WCFA 2BBNA 2NZ0A 1CTRA 4ORBB 4PE7A 2CNPA 1OE9B 2ZRTA 2COLB 4GFTA 2CTNA 3I5FC 2EGDA 1TNQA 3EVRA 1TOPA 1JF2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XA5 A;  3A4U B;  2JT0 A;  3NSI A;  4NQG A;  1BF5 A;  3ZNI A;  1DVI A;  3FIA A;  3RLZ A;  2H2K A;  1IJ5 A;  2LMU A;  1C07 A;  1K93 D;  3D0Y B;  2QPT A;  4CID A;  1L2O C;  4MSP A;  1NCX A;  2B1U A;  1F54 A;  1NSH A;  1XFV O;  2KAY A;  1PVB A;  3BXK A;  2LUC A;  3GK4 X;  3VRO A;  4C0L A;  1BOD A;  1Y0V H;  2JNX A;  2V53 A;  2I7A A;  3WNX B;  3IQO A;  1SCM B;  4MBE A;  1XVJ A;  1DGU A;  1QIW A;  4JQ0 D;  1G8I A;  2KI6 C;  3DVE A;  1B8R A;  3BOW B;  2H61 C;  1R2U A;  4M2O A;  2L50 A;  1SL7 A;  1KWO C;  3CR5 X;  1QXP A;  5F6T A;  4AQJ A;  1QAT A;  2L5X B;  5I8N A;  1SKT A;  1UUR A;  3HX4 A;  2LLT A;  2MBX A;  3VRQ A;  2BBM A;  2JTZ A;  1UHI A;  3TS5 B;  1WRL A;  2FJU B;  2KYC A;  1RJV A;  1TNX A;  1SK6 D;  3PAT A;  2HF5 A;  1KSO A;  3KO0 A;  1ZAC A;  4YGA A;  1RWY A;  1NX2 A;  4WQ3 A;  2ZN9 A;  1MWN A;  2E30 A;  4GGN A;  2AAO A;  3JVT C;  2NLN A;  2WOS A;  2M1K B;  3I5H C;  4MRY A;  2JT8 A;  3GOF A;  1JUO A;  1AHR A;  1NX3 A;  1BJF A;  2JC2 A;  1HT9 A;  2BKI B;  2LMV A;  2MJW B;  3VRP A;  1BLQ A;  3HCM A;  1DJG A;  4GGF A;  1Y1A A;  2M7N A;  1AVS A;  1EH2 A;  1B47 A;  1FF1 A;  4MZJ A;  3OB2 B;  2L51 A;  2LVV A;  3K21 A;  1IWQ A;  4OR9 B;  1C7V A;  1H4B A;  1SL8 A;  3BYA A;  3D10 A;  4NDD A;  4YRU A;  4UPG A;  2PSR A;  2JWW A;  2KSP A;  4DIR A;  2GV5 A;  5D7F A;  1LIN A;  1KFX L;  1NWD A;  3EK7 A;  3C1V A;  1FI6 A;  4P5O E;  1BR1 B;  1LKJ A;  1YRU B;  1ZFS A;  1LVC D;  2F3Y A;  3PM8 A;  2KGB C;  2IS9 A;  4N1F A;  1QAS A;  2WC8 A;  4CFR A;  2JXC A;  5HKY A;  1NCZ A;  1W7I B;  3GK1 A;  4PE0 A;  4GNK B;  4D1E A;  1FBV A;  3OP0 A;  2I2R E;  3D0Y A;  5GQQ C;  1WDC B;  1V1G A;  5HLO A;  3CWG A;  4IL1 A;  1AK8 A;  1JC2 A;  2GGM A;  1SRA A;  3WHU B;  1K9U A;  3LL8 B;  1DGV A;  1REC A;  3EK8 A;  4OVN F;  1OMR A;  1R6P A;  4JWQ A;  4HRH A;  1N2D A;  1WY9 A;  4MN0 A;  4HSZ A;  1CDL A;  2CCM A;  3AAK A;  1NCY A;  3GK2 A;  1CDM A;  1M45 A;  2K0J A;  4L9M A;  3CR4 X;  3NSK A;  4QJ5 B;  1M63 B;  1DJI A;  5AEQ A;  1C7W A;  1ZMZ A;  2HET A;  1J7O A;  2KI6 D;  1QV0 A;  2L2E A;  2M9G A;  1KK8 C;  3CGA A;  1N65 A;  1GJY A;  1S1E A;  1B9A A;  2BL0 C;  2LHI A;  2PVB A;  2LHL A;  3M0W A;  1EG4 A;  1QVI Y;  1CDP A;  3O6B A;  5DKN A;  1U5I B;  2NXQ A;  4PHK A;  3AKA A;  1NIW A;  2KYF A;  2OTG C;  3BOW A;  2HQW A;  1Q80 A;  1X02 A;  4PAL A;  2VRG A;  3PFV A;  1DMO A;  4CLN A;  1IJ6 A;  4I5J A;  1IRJ A;  2LVJ A;  2MAZ A;  2Y1N A;  1QX5 B;  1A29 A;  3OX6 A;  2BL0 B;  1JSA A;  2I94 A;  2A4J A;  4F0Z B;  4I5N B;  1AJ4 A;  4NDB A;  1JFJ A;  1OOJ A;  2E6W A;  1PUL A;  2JZI A;  3EVV A;  4GUK A;  1A2X A;  4C0J A;  1J1D A;  1WRZ A;  4MZK A;  2O5G A;  1B1G A;  3SG7 A;  4M2Q A;  1WRK A;  1KFU S;  5D69 A;  4I5L B;  2FCE A;  3JTD B;  3LK0 A;  1KCY A;  1GQM A;  1SPY A;  4YI8 A;  1AP4 A;  2Y5I A;  1QS7 A;  1S5G Z;  2MRD A;  1RRO A;  4PHN A;  4I5K A;  1CLB A;  4GPL B;  3PSR A;  4FTG A;  3BUN B;  1MQ1 A;  2JU0 A;  2Q4U A;  2AMI A;  3TUY B;  1LXF C;  1NX1 A;  1F71 A;  3SG3 A;  1A75 A;  1MHO A;  2L0P A;  3VRR A;  1YX8 A;  1CLL A;  1CMG A;  1OZS A;  2KGR A;  3DVJ A;  3E3R A;  4MEW A;  3TDI A;  3CR2 A;  2D8N A;  2KFG A;  1H8B A;  2QAC A;  1F4Q A;  1G33 A;  3IQQ A;  4Q04 A;  1HQV A;  1SW8 A;  4ICB A;  4E68 A;  2MLF C;  5KU1 A;  3LCP C;  1YVH A;  4YBH B;  3VGO A;  1KWO B;  2SAS A;  3DVK A;  1DTL A;  1S26 D;  1TRF A;  2FCD A;  4N5X A;  1CMF A;  2LVK A;  5JJG A;  3DF0 B;  4TNC A;  1NUB A;  3LK1 A;  5I2L A;  4USL A;  3I5I C;  2PAL A;  2JUL A;  4A4C A;  1S6J A;  4XJK B;  1B8L A;  1K94 A;  2PMY A;  2LCP A;  1QLK A;  3F45 A;  1GGW A;  1K9P A;  1CFD A;  1CM4 A;  1KQM B;  1NX0 A;  1WLZ A;  2NCP A;  1CKK A;  1YUT A;  1B7T Z;  1XFZ O;  2M7L A;  2EC6 C;  1M39 A;  1DT7 B;  2F33 A;  2O60 A;  5CSN A;  2M97 A;  2LE9 B;  4DS7 A;  1JWD A;  5HYD A;  2ZND A;  2KFF A;  3CZT X;  1YUS A;  1PVA A;  1S36 A;  2LUX A;  3SG5 A;  2PRU A;  3O78 A;  4ETO A;  4M2P A;  4ORC B;  2LVI A;  3NXA A;  1F70 A;  1UHK A;  1EJ3 A;  1CNP A;  1UHN A;  1OSA A;  2BE6 A;  3SG4 A;  2LP2 A;  1CB1 A;  2CBL A;  5ER4 X;  1F8H A;  5AFP A;  3SJS A;  1PRW A;  2R2I A;  1XFU O;  2KAV A;  2KAX A;  1TTX A;  4PDZ A;  1RTP 1;  3KHE A;  3DD4 A;  5JOL A;  3TDU A;  1ZOT B;  3H4S E;  4YGD B;  2MLE C;  2KFH A;  2M0R A;  4PHM A;  1Y1X A;  1IQ3 A;  4C0K A;  2LLU A;  2LM5 A;  3LLE A;  1CFP A;  1J7Q A;  1YUR A;  4PE1 A;  3TDZ A;  4MRX A;  1B7T Y;  1MR8 A;  2K61 A;  4A4B A;  1IQ5 A;  1QVI Z;  2SCP A;  4N1G A;  4OKH A;  4ORA B;  3I5F B;  5CPV A;  3RM1 A;  1OZO A;  5KSZ A;  1XYD A;  2JT3 A;  1B8C A;  1JBA A;  3WXA A;  3BUM B;  1CFC A;  5DKR A;  5B8I B;  1QLS A;  4MVF A;  1DJZ A;  2M1U A;  1ODB A;  2ISD A;  2KHN A;  1QIV A;  3MSE B;  5CSI A;  2G2B A;  2JOJ A;  1QJT A;  1V1F A;  4GGF C;  2NCO A;  4P2Y B;  2BCA A;  4XYN A;  1WLM A;  2WCE A;  2ZKM X;  3PN7 B;  4HRG A;  2LLS A;  1IGV A;  3TS5 C;  1N0Y A;  2BKH B;  1TCF A;  1FW4 A;  2JPT A;  2LP3 A;  1EXR A;  3BUW B;  2EC6 B;  2WOR A;  3A8R A;  2KI4 C;  1ZUZ A;  1ALV A;  3EKJ A;  1JFK A;  2TN4 A;  3I5G C;  4MLW A;  1S6I A;  4JPZ B;  1BT6 A;  1TCO B;  5FYX A;  1DF0 B;  5PAL A;  4YGB B;  2ZRS A;  3AAJ A;  4YI9 A;  2BEC A;  1A03 A;  2HQ8 A;  1S5G Y;  2K7C A;  3OHM B;  1WDC C;  4OCI A;  1KK8 B;  2HPS A;  2WCB A;  1SY9 A;  3JTD C;  5HKW A;  1SMG A;  5CSJ A;  4PE4 A;  1YTZ C;  1TNW A;  5DKQ A;  1DF0 A;  1DJW A;  1XK4 A;  3SIB A;  5AAN A;  1BMO A;  1L7Z A;  1SR6 C;  1YVL A;  1LA0 A;  2LAP A;  5IBW A;  3OX5 A;  2Y4Q A;  5HLV A;  2LNK A;  1BU3 A;  2BCB A;  5HKZ A;  5K89 A;  1K8U A;  1KK7 Z;  1CM1 A;  1MUX A;  1UWO A;  3BUX B;  4DUQ A;  1K90 D;  1BG1 A;  1EG3 A;  1SBJ A;  1OQP A;  2LMT A;  5BPJ A;  1KSM A;  1SL9 A;  1K95 A;  4CFQ A;  2H61 A;  2GGZ A;  1U5I A;  4OV2 A;  4GAO A;  1NYA A;  2DOQ A;  1K9K A;  2K7D A;  2WND A;  2Y1M A;  4AOM A;  1FI5 A;  2CT9 A;  4ZCV A;  1SNL A;  1CLM A;  1PSR A;  2OTG B;  2MA2 A;  1RFJ A;  1SCV A;  3EVU A;  4QJ3 B;  1KQM C;  2M3W A;  4MZL A;  1IG5 A;  1PSB A;  1NPQ A;  3NSL A;  2JRF A;  3KF9 A;  2K8M B;  2L4I A;  2LC5 A;  4HRE E;  4R1E A;  2KQ6 A;  5I2O A;  1Y1U A;  4PHJ A;  3JVT B;  1J7R A;  3CS1 A;  1A75 B;  1QV1 A;  1PK0 D;  3I5H B;  3O2P A;  4CPV A;  1TNP A;  2KDH A;  1B4C A;  3PAL A;  1FPW A;  2JTT A;  2LAN A;  1XK4 C;  2ZFD A;  4PCW A;  2F8P A;  2JNF A;  1DJH A;  1J1E A;  2KNE A;  3FWC A;  3SG6 A;  4BY4 A;  3SIA A;  2F2P A;  1XFY O;  1L2O B;  1MXL C;  1KK7 Y;  4QJ4 B;  3QRX A;  3CTN A;  1G4Y R;  1J7P A;  1A4P A;  2OS8 B;  2L98 A;  3TZ1 A;  1OMV A;  1K96 A;  1S6C A;  1BR4 B;  3EK4 A;  1UP5 A;  4ZCU A;  2ZNE A;  1S3P A;  2K7B A;  3BQ3 A;  1XFX O;  2RGI A;  5AXI A;  1MXE A;  2PAS A;  1AJ5 A;  2KBI A;  4FQO A;  4YGC B;  1QX7 A;  4AQI A;  5J3X A;  1K2H A;  2K7O A;  1JF0 A;  1IH0 A;  4WQ2 A;  4YGE B;  1IKU A;  2JXL A;  2OS8 C;  3IF7 A;  2M49 B;  5KTY A;  1YR5 A;  3ICB A;  2KQY A;  2ZN8 A;  2M29 A;  5AER A;  1TN4 A;  1QX2 A;  3I5G B;  4GBA A;  1LA3 A;  1PAL A;  3NSO A;  1NP8 A;  1CDN A;  4NDC A;  1ALW A;  2G9B A;  2M8U A;  3EKH A;  1W7J B;  3WHT B;  4BY5 A;  1CFF A;  1KFX S;  3DF0 A;  2Q91 A;  4DRW A;  1UHH A;  3FWB A;  4U8D A;  2AUC A;  2K2F A;  2OPO A;  1MF8 B;  4DCK A;  2L4H A;  1RK9 A;  1SCM C;  2BE4 A;  2LV7 A;  1E8A A;  1AUI B;  1OMD A;  4XJK A;  1EL4 A;  1TIZ A;  1Y6W A;  1YUU A;  2K2A A;  1BOC A;  3I5I B;  3FS7 A;  1M31 A;  1XO5 A;  1YRT B;  5G08 A;  2JQ6 A;  1KFU L;  1KQV A;  1M46 A;  3BUO B;  3PLF B;  1XFW O;  2KI4 B;  1QTX A;  2F2O A;  2BCX A;  3DVM A;  5I2Q A;  3CLN A;  1F4O A;  2CXJ A;  3KPX A;  2KOT A;  1UHJ A;  4WRI A;  1DJY A;  3O4Y A;  1DJX A;  3AKB A;  5ER5 A;  2MHH A;  2I18 A;  1UUS A;  3TUY C;  1GGZ A;  2FOT A;  1J55 A;  5CSF A;  3SG2 A;  3VRN A;  1D1O A;  1SYM A;  3PN7 C;  3OB1 B;  1F55 A;  1YX7 A;  3KEV A;  1SR6 B;  3ZWH A;  1VRK A;  2F3Z A;  5TNC A;  2EHB A;  2KBM A;  2P6B B;  2WCF A;  2BBN A;  2NZ0 A;  1CTR A;  4ORB B;  4PE7 A;  2CNP A;  1OE9 B;  2ZRT A;  2COL B;  4GFT A;  2CTN A;  3I5F C;  2EGD A;  1TNQ A;  3EVR A;  1TOP A;  1JF2 A; 
#chains in the Genus database with same CATH topology
 1XA5 A;  3A4U B;  2JT0 A;  3NSI A;  4NQG A;  1BF5 A;  3ZNI A;  1DVI A;  3FIA A;  3RLZ A;  2H2K A;  1IJ5 A;  2LMU A;  1C07 A;  1K93 D;  3K1E A;  3D0Y B;  2QPT A;  4CID A;  1L2O C;  4MSP A;  1NCX A;  2B1U A;  1F54 A;  1NSH A;  3L4L A;  2QEH A;  1XFV O;  2KAY A;  4INX A;  1PVB A;  3BXK A;  2LUC A;  1P28 A;  3GK4 X;  3VRO A;  4C0L A;  1BOD A;  2BNX A;  1Y0V H;  2JNX A;  2V53 A;  2I7A A;  3WNX B;  3IQO A;  2KPH A;  1SCM B;  4MBE A;  1XVJ A;  3BFB A;  1DGU A;  1QIW A;  4JQ0 D;  1G8I A;  2KI6 C;  3DVE A;  1B8R A;  3V2L A;  3BOW B;  2H61 C;  1R2U A;  4M2O A;  2L50 A;  1SL7 A;  1KWO C;  3CR5 X;  1QXP A;  5F6T A;  4AQJ A;  1QAT A;  2L5X B;  5I8N A;  1SKT A;  1UUR A;  3HX4 A;  2LLT A;  2MBX A;  3VRQ A;  2BBM A;  2JTZ A;  1UHI A;  3TS5 B;  1WRL A;  2FJU B;  3CZ1 A;  2KYC A;  1RJV A;  1TNX A;  1SK6 D;  3PAT A;  2HF5 A;  1KSO A;  3KO0 A;  1ZAC A;  4YGA A;  1RWY A;  1NX2 A;  4WQ3 A;  2ZN9 A;  1MWN A;  2E30 A;  4GGN A;  2AAO A;  3JVT C;  2NLN A;  2WOS A;  3Q8I A;  2M1K B;  3I5H C;  4MRY A;  2JT8 A;  3GOF A;  1JUO A;  1AHR A;  1NX3 A;  1BJF A;  2JC2 A;  1HT9 A;  2BKI B;  2LMV A;  2MJW B;  3UNW A;  3VRP A;  3HCM A;  1DJG A;  1BLQ A;  4GGF A;  1Y1A A;  2M7N A;  1AVS A;  1EH2 A;  1B47 A;  1C3Y A;  1FF1 A;  4MZJ A;  3OB2 B;  2L51 A;  2LVV A;  3K21 A;  1IWQ A;  4OR9 B;  1C7V A;  1H4B A;  1SL8 A;  2WCJ A;  3BYA A;  3D10 A;  4NDD A;  3L47 A;  4UPG A;  2PSR A;  4YRU A;  2JWW A;  4KYN A;  2KSP A;  4DIR A;  2GV5 A;  5D7F A;  1Z2C B;  1LIN A;  1KFX L;  1NWD A;  1OOI X;  3EK7 A;  3C1V A;  1FI6 A;  4P5O E;  1BR1 B;  1LKJ A;  1YRU B;  1ZFS A;  1LVC D;  2F3Y A;  3PM8 A;  2KGB C;  2IS9 A;  4N1F A;  1QAS A;  2WC8 A;  4CFR A;  2JXC A;  5HKY A;  1NCZ A;  1W7I B;  3GK1 A;  2P70 A;  4PE0 A;  4GNK B;  4D1E A;  1FBV A;  3OP0 A;  2I2R E;  3D0Y A;  5GQQ C;  1WDC B;  1OOF A;  1V1G A;  5HLO A;  3CWG A;  3PJI A;  4IL1 A;  1AK8 A;  2GGM A;  1JC2 A;  2L2C A;  1SRA A;  3WHU B;  1K9U A;  3LL8 B;  1DGV A;  1REC A;  3EK8 A;  4OVN F;  1OMR A;  1R6P A;  4JWQ A;  4HRH A;  1N2D A;  1WY9 A;  4MN0 A;  4HSZ A;  1CDL A;  2CCM A;  3AAK A;  1NCY A;  3GK2 A;  1CDM A;  3CAB A;  2QDI A;  1M45 A;  2K0J A;  4L9M A;  3CR4 X;  3NSK A;  4QJ5 B;  1M63 B;  1DJI A;  3D76 A;  5AEQ A;  1C7W A;  1T14 A;  1ZMZ A;  2HET A;  1J7O A;  1SSE B;  2KI6 D;  1QV0 A;  2L2E A;  2M9G A;  5D3O A;  1KK8 C;  2BAP A;  3CGA A;  1N65 A;  1GJY A;  1S1E A;  1B9A A;  2BL0 C;  2LHI A;  2PVB A;  2LHL A;  3M0W A;  1EG4 A;  1QVI Y;  1CDP A;  3O6B A;  5DKN A;  1U5I B;  2NXQ A;  4PHK A;  3AKA A;  1NIW A;  2KYF A;  2OTG C;  3N7H A;  3BOW A;  2HQW A;  1Q80 A;  1X02 A;  4PAL A;  2VRG A;  3PFV A;  1DMO A;  4CLN A;  2WCK A;  1Z4H A;  1IJ6 A;  4I5J A;  1IRJ A;  2LVJ A;  2MAZ A;  2Y1N A;  1QX5 B;  1A29 A;  3OX6 A;  2BL0 B;  1JSA A;  4FQT A;  2I94 A;  2A4J A;  4F0Z B;  4I5N B;  1AJ4 A;  3CDN A;  4NDB A;  1OOJ A;  2E6W A;  1PUL A;  2JZI A;  3EVV A;  4GUK A;  1A2X A;  4C0J A;  1JFJ A;  1J1D A;  1WRZ A;  2GTE A;  2O5G A;  4MZK A;  1B1G A;  3SG7 A;  4M2Q A;  1WRK A;  1KFU S;  5D69 A;  2ERB A;  2PYQ A;  4I5L B;  2FCE A;  3JTD B;  3LK0 A;  1KCY A;  1GQM A;  1SPY A;  4YI8 A;  1AP4 A;  2Y5I A;  1QS7 A;  1S5G Z;  2MRD A;  1RRO A;  4PHN A;  4I5K A;  1CLB A;  4GPL B;  3PSR A;  4FTG A;  3NHI A;  4IJ7 A;  3BUN B;  3DXL A;  1MQ1 A;  2JU0 A;  2Q4U A;  2AMI A;  3TUY B;  2WC6 A;  1LXF C;  3PM2 A;  1NX1 A;  1GGW A;  1F71 A;  3SG3 A;  1A75 A;  1MHO A;  2L0P A;  3VRR A;  1YX8 A;  1CLL A;  1CMG A;  1OZS A;  2KGR A;  3DVJ A;  3E3R A;  3RZS A;  4MEW A;  3TDI A;  3CR2 A;  2D8N A;  2KFG A;  2WCM A;  2QAC A;  1H8B A;  1F4Q A;  1G33 A;  2PQL A;  3IQQ A;  4Q04 A;  1HQV A;  1SW8 A;  4ICB A;  1TUJ A;  2KLD A;  4E68 A;  2MLF C;  5KU1 A;  3LCP C;  1YVH A;  4YBH B;  3D78 A;  3VGO A;  1KWO B;  2SAS A;  3B88 A;  3DVK A;  1DTL A;  1S26 D;  1TRF A;  2FCD A;  4N5X A;  1CMF A;  2LVK A;  3DZT A;  4F7F A;  5JJG A;  3DF0 B;  4TNC A;  1NUB A;  3LK1 A;  5I2L A;  4USL A;  3I5I C;  2YGU A;  2PAL A;  5EL2 A;  2JUL A;  4A4C A;  1S6J A;  4XJK B;  1B8L A;  1K94 A;  2PMY A;  1LS8 A;  2LCP A;  1C3Z A;  1QLK A;  3F45 A;  3B86 A;  1K9P A;  1CFD A;  1CM4 A;  1KQM B;  1NX0 A;  1WLZ A;  2NCP A;  3L4A A;  1CKK A;  1DEK A;  1YUT A;  1B7T Z;  3S0D A;  1XFZ O;  2M7L A;  3B7A A;  2EC6 C;  1M39 A;  3VB1 A;  1DT7 B;  2F33 A;  2O60 A;  5CSN A;  2M97 A;  2LE9 B;  4DS7 A;  3B6X A;  1JWD A;  5HYD A;  2ZND A;  3CZ0 A;  2KFF A;  3CZT X;  1YUS A;  1PVA A;  1S36 A;  2LUX A;  3SG5 A;  2PRU A;  2WC5 A;  3O78 A;  4ETO A;  4M2P A;  1ORG A;  4ORC B;  2LVI A;  3UO9 A;  4JD9 A;  3NXA A;  1F70 A;  1UHK A;  1EJ3 A;  1CNP A;  2P71 A;  1UHN A;  1OSA A;  2BE6 A;  3SG4 A;  2LP2 A;  1CB1 A;  2CBL A;  5ER4 X;  1F8H A;  5AFP A;  3SJS A;  1PRW A;  2R2I A;  1XFU O;  2KAV A;  2KAX A;  1TTX A;  4PDZ A;  1RTP 1;  3KHE A;  3DD4 A;  5JOL A;  3TDU A;  1ZOT B;  3H4S E;  4YGD B;  2MLE C;  2KFH A;  2M0R A;  4PHM A;  1Y1X A;  1IQ3 A;  4C0K A;  2LLU A;  2LM5 A;  3LLE A;  1CFP A;  1J7Q A;  1YUR A;  4PE1 A;  3TDZ A;  4MRX A;  1B7T Y;  1MR8 A;  2K61 A;  3R1P A;  4A4B A;  1IQ5 A;  1QVI Z;  2SCP A;  4N1G A;  4OKH A;  2L5Y A;  3I5F B;  4ORA B;  5CPV A;  3RM1 A;  1OZO A;  5KSZ A;  1XYD A;  2JT3 A;  1B8C A;  1JBA A;  3WXA A;  3BUM B;  1CFC A;  5DKR A;  1W9Z A;  5B8I B;  1QLS A;  4MVF A;  1DJZ A;  2M1U A;  1ODB A;  1QWV A;  2ISD A;  3S0G A;  2KHN A;  1QIV A;  3MSE B;  5CSI A;  2G2B A;  2FJY A;  2JOJ A;  1QJT A;  1V1F A;  4GGF C;  2NCO A;  4P2Y B;  2BCA A;  4XYN A;  1WLM A;  2WCE A;  2ZKM X;  2H8V A;  3PN7 B;  4HRG A;  2LLS A;  1IGV A;  3TS5 C;  1N0Y A;  2BKH B;  1TCF A;  1FW4 A;  2JPT A;  2LP3 A;  1EXR A;  3BFA A;  3BUW B;  2EC6 B;  3NHT A;  2WOR A;  3A8R A;  2KI4 C;  1ZUZ A;  1ALV A;  3EKJ A;  1JFK A;  2TN4 A;  3I5G C;  4MLW A;  3OBV A;  1S6I A;  4INW A;  1TWO A;  4JPZ B;  1BT6 A;  1TCO B;  5FYX A;  1DF0 B;  5PAL A;  4YGB B;  2ZRS A;  3AAJ A;  4YI9 A;  2BEC A;  1A03 A;  1OOG A;  2HQ8 A;  1S5G Y;  3FE6 A;  2K7C A;  3OHM B;  1WDC C;  3S0E A;  4OCI A;  1KK8 B;  2HPS A;  2WCB A;  1SY9 A;  3JTD C;  5HKW A;  1SMG A;  5CSJ A;  4PE4 A;  1YTZ C;  1TNW A;  5DKQ A;  1DEL A;  1DF0 A;  1DJW A;  2QEB A;  1XK4 A;  3SIB A;  5AAN A;  1BMO A;  1L7Z A;  1SR6 C;  1YVL A;  1LA0 A;  2LAP A;  5IBW A;  3OX5 A;  2Y4Q A;  5HLV A;  2LNK A;  1BU3 A;  2BCB A;  5HKZ A;  5K89 A;  1K8U A;  1KK7 Z;  1CM1 A;  1MUX A;  1UWO A;  3BUX B;  4DUQ A;  1K90 D;  1BG1 A;  1EG3 A;  1SBJ A;  1OQP A;  2LMT A;  1GM0 A;  1TUZ A;  5BPJ A;  1KSM A;  1SL9 A;  1K95 A;  4CFQ A;  2GGZ A;  1U5I A;  2H61 A;  4OV2 A;  4GAO A;  1NYA A;  2DOQ A;  1K9K A;  2K7D A;  2WND A;  2Y1M A;  4PT1 A;  4AOM A;  1FI5 A;  2CT9 A;  4OZD A;  4ZCV A;  1SNL A;  1CLM A;  1PSR A;  2OTG B;  2MA2 A;  1RFJ A;  1SCV A;  3EVU A;  4QJ3 B;  3SS5 A;  2K60 A;  1KQM C;  2M3W A;  4MZL A;  1IG5 A;  1PSB A;  1NPQ A;  3NSL A;  2JRF A;  3KF9 A;  2K8M B;  2L4I A;  2LC5 A;  4HRE E;  3CZ2 A;  4R1E A;  2KQ6 A;  5I2O A;  1Y1U A;  4PHJ A;  3JVT B;  1J7R A;  3CS1 A;  1A75 B;  1QV1 A;  3IVT A;  1PK0 D;  3I5H B;  3O2P A;  4CPV A;  1TNP A;  2KDH A;  1B4C A;  3PAL A;  1FPW A;  3D75 A;  2JTT A;  2LAN A;  1XK4 C;  2ZFD A;  4PCW A;  3S0B A;  2F8P A;  2JNF A;  1DJH A;  1J1E A;  2KNE A;  3FWC A;  5DIC A;  5FI7 A;  3SG6 A;  3SIA A;  4BY4 A;  2F2P A;  3DYE A;  1XFY O;  1L2O B;  1MXL C;  1KK7 Y;  4QJ4 B;  3QRX A;  3BJH A;  3CTN A;  1G4Y R;  1J7P A;  1DC1 A;  1A4P A;  2OS8 B;  2L98 A;  3QME A;  3TZ1 A;  1OMV A;  3OGN A;  1K96 A;  1S6C A;  1BR4 B;  3EK4 A;  3D77 A;  3SS4 A;  1UP5 A;  4ZCU A;  2ZNE A;  1S3P A;  2K7B A;  3BQ3 A;  3CYZ A;  1XFX O;  2RGI A;  5AXI A;  1MXE A;  2PAS A;  1AJ5 A;  2KBI A;  4FQO A;  4YGC B;  1QX7 A;  2WCL A;  4AQI A;  5J3X A;  1K2H A;  1IIO A;  2K7O A;  1JF0 A;  1IH0 A;  5FI2 A;  4WQ2 A;  4YGE B;  1IKU A;  2JXL A;  2OS8 C;  3IF7 A;  2M49 B;  5KTY A;  3FE8 A;  1YR5 A;  3ICB A;  2KQY A;  2ZN8 A;  2M29 A;  3D73 A;  1TN4 A;  5AER A;  1QX2 A;  3I5G B;  4GBA A;  1LA3 A;  1PAL A;  3NSO A;  3SS3 A;  1NP8 A;  1CDN A;  4NDC A;  1ALW A;  3D74 A;  2G9B A;  2M8U A;  3EKH A;  1W7J B;  3WHT B;  4BY5 A;  1CFF A;  1KFX S;  3DF0 A;  2Q91 A;  3B87 A;  3S0F A;  3DY9 A;  4DRW A;  1UHH A;  3R1V A;  3FWB A;  4U8D A;  2AUC A;  2K2F A;  2OPO A;  1MF8 B;  4DCK A;  2L4H A;  1RK9 A;  1SCM C;  2BE4 A;  2LV7 A;  1E8A A;  1AUI B;  1OMD A;  4XJK A;  1EL4 A;  1TIZ A;  3EG5 B;  1Y6W A;  1YUU A;  2K2A A;  1BOC A;  3NGV A;  3I5I B;  3FS7 A;  1M31 A;  1XO5 A;  1YRT B;  3S0A A;  5G08 A;  2JQ6 A;  5FI6 A;  1DQE A;  1KFU L;  1KQV A;  1M46 A;  3BUO B;  3PLF B;  1OW4 A;  1XFW O;  2KI4 B;  1QTX A;  2F2O A;  2BCX A;  3DVM A;  5I2Q A;  1XFR A;  3CLN A;  1F4O A;  2CXJ A;  2WCH A;  3KPX A;  3R1O A;  4JKT A;  2KOT A;  1UHJ A;  2QEO A;  4WRI A;  1DJY A;  1OOH A;  3O4Y A;  1DJX A;  3AKB A;  5ER5 A;  2MHH A;  2QEV A;  3O4X A;  2I18 A;  1UUS A;  3R72 A;  1GGZ A;  3TUY C;  2FOT A;  1J55 A;  5CSF A;  3SG2 A;  3VRN A;  1D1O A;  1SYM A;  3FE9 A;  3PN7 C;  5HL1 A;  3OB1 B;  1F55 A;  1YX7 A;  3KEV A;  1SR6 B;  3ZWH A;  1VRK A;  2KLE A;  2F3Z A;  5TNC A;  2EHB A;  2KBM A;  2P6B B;  2WCF A;  2BBN A;  2NZ0 A;  1CTR A;  2JPO A;  4ORB B;  2CNP A;  4PE7 A;  1OE9 B;  2ZRT A;  2COL B;  4GFT A;  2CTN A;  5I94 A;  3I5F C;  2EGD A;  3BFH A;  1TNQ A;  3EVR A;  1TOP A;  1JF2 A; 
#chains in the Genus database with same CATH homology
 1XA5 A;  3A4U B;  2JT0 A;  3NSI A;  4NQG A;  1BF5 A;  3ZNI A;  1DVI A;  3FIA A;  3RLZ A;  2H2K A;  1IJ5 A;  2LMU A;  1C07 A;  1K93 D;  3D0Y B;  2QPT A;  4CID A;  1L2O C;  4MSP A;  1NCX A;  2B1U A;  1F54 A;  1NSH A;  1XFV O;  2KAY A;  1PVB A;  3BXK A;  2LUC A;  3GK4 X;  3VRO A;  4C0L A;  1BOD A;  1Y0V H;  2JNX A;  2V53 A;  2I7A A;  3WNX B;  3IQO A;  1SCM B;  4MBE A;  1XVJ A;  1DGU A;  1QIW A;  4JQ0 D;  1G8I A;  2KI6 C;  3DVE A;  1B8R A;  3BOW B;  2H61 C;  1R2U A;  4M2O A;  2L50 A;  1SL7 A;  1KWO C;  3CR5 X;  1QXP A;  5F6T A;  4AQJ A;  1QAT A;  2L5X B;  5I8N A;  1SKT A;  1UUR A;  3HX4 A;  2LLT A;  2MBX A;  3VRQ A;  2BBM A;  2JTZ A;  1UHI A;  3TS5 B;  1WRL A;  2FJU B;  2KYC A;  1RJV A;  1TNX A;  1SK6 D;  3PAT A;  2HF5 A;  1KSO A;  3KO0 A;  1ZAC A;  4YGA A;  1RWY A;  1NX2 A;  4WQ3 A;  2ZN9 A;  1MWN A;  2E30 A;  4GGN A;  2AAO A;  3JVT C;  2NLN A;  2WOS A;  2M1K B;  3I5H C;  4MRY A;  2JT8 A;  3GOF A;  1JUO A;  1AHR A;  1NX3 A;  1BJF A;  2JC2 A;  1HT9 A;  2BKI B;  2LMV A;  2MJW B;  3VRP A;  1BLQ A;  3HCM A;  1DJG A;  4GGF A;  1Y1A A;  2M7N A;  1AVS A;  1EH2 A;  1B47 A;  1FF1 A;  4MZJ A;  3OB2 B;  2L51 A;  2LVV A;  3K21 A;  1IWQ A;  4OR9 B;  1C7V A;  1H4B A;  1SL8 A;  3BYA A;  3D10 A;  4NDD A;  4YRU A;  4UPG A;  2PSR A;  2JWW A;  2KSP A;  4DIR A;  2GV5 A;  5D7F A;  1LIN A;  1KFX L;  1NWD A;  3EK7 A;  3C1V A;  1FI6 A;  4P5O E;  1BR1 B;  1LKJ A;  1YRU B;  1ZFS A;  1LVC D;  2F3Y A;  3PM8 A;  2KGB C;  2IS9 A;  4N1F A;  1QAS A;  2WC8 A;  4CFR A;  2JXC A;  5HKY A;  1NCZ A;  1W7I B;  3GK1 A;  4PE0 A;  4GNK B;  4D1E A;  1FBV A;  3OP0 A;  2I2R E;  3D0Y A;  5GQQ C;  1WDC B;  1V1G A;  5HLO A;  3CWG A;  4IL1 A;  1AK8 A;  1JC2 A;  2GGM A;  1SRA A;  3WHU B;  1K9U A;  3LL8 B;  1DGV A;  1REC A;  3EK8 A;  4OVN F;  1OMR A;  1R6P A;  4JWQ A;  4HRH A;  1N2D A;  1WY9 A;  4MN0 A;  4HSZ A;  1CDL A;  2CCM A;  3AAK A;  1NCY A;  3GK2 A;  1CDM A;  1M45 A;  2K0J A;  4L9M A;  3CR4 X;  3NSK A;  4QJ5 B;  1M63 B;  1DJI A;  5AEQ A;  1C7W A;  1ZMZ A;  2HET A;  1J7O A;  2KI6 D;  1QV0 A;  2L2E A;  2M9G A;  1KK8 C;  3CGA A;  1N65 A;  1GJY A;  1S1E A;  1B9A A;  2BL0 C;  2LHI A;  2PVB A;  2LHL A;  3M0W A;  1EG4 A;  1QVI Y;  1CDP A;  3O6B A;  5DKN A;  1U5I B;  2NXQ A;  4PHK A;  3AKA A;  1NIW A;  2KYF A;  2OTG C;  3BOW A;  2HQW A;  1Q80 A;  1X02 A;  4PAL A;  2VRG A;  3PFV A;  1DMO A;  4CLN A;  1IJ6 A;  4I5J A;  1IRJ A;  2LVJ A;  2MAZ A;  2Y1N A;  1QX5 B;  1A29 A;  3OX6 A;  2BL0 B;  1JSA A;  2I94 A;  2A4J A;  4F0Z B;  4I5N B;  1AJ4 A;  4NDB A;  1JFJ A;  1OOJ A;  2E6W A;  1PUL A;  2JZI A;  3EVV A;  4GUK A;  1A2X A;  4C0J A;  1J1D A;  1WRZ A;  4MZK A;  2O5G A;  1B1G A;  3SG7 A;  4M2Q A;  1WRK A;  1KFU S;  5D69 A;  4I5L B;  2FCE A;  3JTD B;  3LK0 A;  1KCY A;  1GQM A;  1SPY A;  4YI8 A;  1AP4 A;  2Y5I A;  1QS7 A;  1S5G Z;  2MRD A;  1RRO A;  4PHN A;  4I5K A;  1CLB A;  4GPL B;  3PSR A;  4FTG A;  3BUN B;  1MQ1 A;  2JU0 A;  2Q4U A;  2AMI A;  3TUY B;  1LXF C;  1NX1 A;  1F71 A;  3SG3 A;  1A75 A;  1MHO A;  2L0P A;  3VRR A;  1YX8 A;  1CLL A;  1CMG A;  1OZS A;  2KGR A;  3DVJ A;  3E3R A;  4MEW A;  3TDI A;  3CR2 A;  2D8N A;  2KFG A;  1H8B A;  2QAC A;  1F4Q A;  1G33 A;  3IQQ A;  4Q04 A;  1HQV A;  1SW8 A;  4ICB A;  4E68 A;  2MLF C;  5KU1 A;  3LCP C;  1YVH A;  4YBH B;  3VGO A;  1KWO B;  2SAS A;  3DVK A;  1DTL A;  1S26 D;  1TRF A;  2FCD A;  4N5X A;  1CMF A;  2LVK A;  5JJG A;  3DF0 B;  4TNC A;  1NUB A;  3LK1 A;  5I2L A;  4USL A;  3I5I C;  2PAL A;  2JUL A;  4A4C A;  1S6J A;  4XJK B;  1B8L A;  1K94 A;  2PMY A;  2LCP A;  1QLK A;  3F45 A;  1GGW A;  1K9P A;  1CFD A;  1CM4 A;  1KQM B;  1NX0 A;  1WLZ A;  2NCP A;  1CKK A;  1YUT A;  1B7T Z;  1XFZ O;  2M7L A;  2EC6 C;  1M39 A;  1DT7 B;  2F33 A;  2O60 A;  5CSN A;  2M97 A;  2LE9 B;  4DS7 A;  1JWD A;  5HYD A;  2ZND A;  2KFF A;  3CZT X;  1YUS A;  1PVA A;  1S36 A;  2LUX A;  3SG5 A;  2PRU A;  3O78 A;  4ETO A;  4M2P A;  4ORC B;  2LVI A;  3NXA A;  1F70 A;  1UHK A;  1EJ3 A;  1CNP A;  1UHN A;  1OSA A;  2BE6 A;  3SG4 A;  2LP2 A;  1CB1 A;  2CBL A;  5ER4 X;  1F8H A;  5AFP A;  3SJS A;  1PRW A;  2R2I A;  1XFU O;  2KAV A;  2KAX A;  1TTX A;  4PDZ A;  1RTP 1;  3KHE A;  3DD4 A;  5JOL A;  3TDU A;  1ZOT B;  3H4S E;  4YGD B;  2MLE C;  2KFH A;  2M0R A;  4PHM A;  1Y1X A;  1IQ3 A;  4C0K A;  2LLU A;  2LM5 A;  3LLE A;  1CFP A;  1J7Q A;  1YUR A;  4PE1 A;  3TDZ A;  4MRX A;  1B7T Y;  1MR8 A;  2K61 A;  4A4B A;  1IQ5 A;  1QVI Z;  2SCP A;  4N1G A;  4OKH A;  4ORA B;  3I5F B;  5CPV A;  3RM1 A;  1OZO A;  5KSZ A;  1XYD A;  2JT3 A;  1B8C A;  1JBA A;  3WXA A;  3BUM B;  1CFC A;  5DKR A;  5B8I B;  1QLS A;  4MVF A;  1DJZ A;  2M1U A;  1ODB A;  2ISD A;  2KHN A;  1QIV A;  3MSE B;  5CSI A;  2G2B A;  2JOJ A;  1QJT A;  1V1F A;  4GGF C;  2NCO A;  4P2Y B;  2BCA A;  4XYN A;  1WLM A;  2WCE A;  2ZKM X;  3PN7 B;  4HRG A;  2LLS A;  1IGV A;  3TS5 C;  1N0Y A;  2BKH B;  1TCF A;  1FW4 A;  2JPT A;  2LP3 A;  1EXR A;  3BUW B;  2EC6 B;  2WOR A;  3A8R A;  2KI4 C;  1ZUZ A;  1ALV A;  3EKJ A;  1JFK A;  2TN4 A;  3I5G C;  4MLW A;  1S6I A;  4JPZ B;  1BT6 A;  1TCO B;  5FYX A;  1DF0 B;  5PAL A;  4YGB B;  2ZRS A;  3AAJ A;  4YI9 A;  2BEC A;  1A03 A;  2HQ8 A;  1S5G Y;  2K7C A;  3OHM B;  1WDC C;  4OCI A;  1KK8 B;  2HPS A;  2WCB A;  1SY9 A;  3JTD C;  5HKW A;  1SMG A;  5CSJ A;  4PE4 A;  1YTZ C;  1TNW A;  5DKQ A;  1DF0 A;  1DJW A;  1XK4 A;  3SIB A;  5AAN A;  1BMO A;  1L7Z A;  1SR6 C;  1YVL A;  1LA0 A;  2LAP A;  5IBW A;  3OX5 A;  2Y4Q A;  5HLV A;  2LNK A;  1BU3 A;  2BCB A;  5HKZ A;  5K89 A;  1K8U A;  1KK7 Z;  1CM1 A;  1MUX A;  1UWO A;  3BUX B;  4DUQ A;  1K90 D;  1BG1 A;  1EG3 A;  1SBJ A;  1OQP A;  2LMT A;  5BPJ A;  1KSM A;  1SL9 A;  1K95 A;  4CFQ A;  2H61 A;  2GGZ A;  1U5I A;  4OV2 A;  4GAO A;  1NYA A;  2DOQ A;  1K9K A;  2K7D A;  2WND A;  2Y1M A;  4AOM A;  1FI5 A;  2CT9 A;  4ZCV A;  1SNL A;  1CLM A;  1PSR A;  2OTG B;  2MA2 A;  1RFJ A;  1SCV A;  3EVU A;  4QJ3 B;  1KQM C;  2M3W A;  4MZL A;  1IG5 A;  1PSB A;  1NPQ A;  3NSL A;  2JRF A;  3KF9 A;  2K8M B;  2L4I A;  2LC5 A;  4HRE E;  4R1E A;  2KQ6 A;  5I2O A;  1Y1U A;  4PHJ A;  3JVT B;  1J7R A;  3CS1 A;  1A75 B;  1QV1 A;  1PK0 D;  3I5H B;  3O2P A;  4CPV A;  1TNP A;  2KDH A;  1B4C A;  3PAL A;  1FPW A;  2JTT A;  2LAN A;  1XK4 C;  2ZFD A;  4PCW A;  2F8P A;  2JNF A;  1DJH A;  1J1E A;  2KNE A;  3FWC A;  3SG6 A;  4BY4 A;  3SIA A;  2F2P A;  1XFY O;  1L2O B;  1MXL C;  1KK7 Y;  4QJ4 B;  3QRX A;  3CTN A;  1G4Y R;  1J7P A;  1A4P A;  2OS8 B;  2L98 A;  3TZ1 A;  1OMV A;  1K96 A;  1S6C A;  1BR4 B;  3EK4 A;  1UP5 A;  4ZCU A;  2ZNE A;  1S3P A;  2K7B A;  3BQ3 A;  1XFX O;  2RGI A;  5AXI A;  1MXE A;  2PAS A;  1AJ5 A;  2KBI A;  4FQO A;  4YGC B;  1QX7 A;  4AQI A;  5J3X A;  1K2H A;  2K7O A;  1JF0 A;  1IH0 A;  4WQ2 A;  4YGE B;  1IKU A;  2JXL A;  2OS8 C;  3IF7 A;  2M49 B;  5KTY A;  1YR5 A;  3ICB A;  2KQY A;  2ZN8 A;  2M29 A;  5AER A;  1TN4 A;  1QX2 A;  3I5G B;  4GBA A;  1LA3 A;  1PAL A;  3NSO A;  1NP8 A;  1CDN A;  4NDC A;  1ALW A;  2G9B A;  2M8U A;  3EKH A;  1W7J B;  3WHT B;  4BY5 A;  1CFF A;  1KFX S;  3DF0 A;  2Q91 A;  4DRW A;  1UHH A;  3FWB A;  4U8D A;  2AUC A;  2K2F A;  2OPO A;  1MF8 B;  4DCK A;  2L4H A;  1RK9 A;  1SCM C;  2BE4 A;  2LV7 A;  1E8A A;  1AUI B;  1OMD A;  4XJK A;  1EL4 A;  1TIZ A;  1Y6W A;  1YUU A;  2K2A A;  1BOC A;  3I5I B;  3FS7 A;  1M31 A;  1XO5 A;  1YRT B;  5G08 A;  2JQ6 A;  1KFU L;  1KQV A;  1M46 A;  3BUO B;  3PLF B;  1XFW O;  2KI4 B;  1QTX A;  2F2O A;  2BCX A;  3DVM A;  5I2Q A;  3CLN A;  1F4O A;  2CXJ A;  3KPX A;  2KOT A;  1UHJ A;  4WRI A;  1DJY A;  3O4Y A;  1DJX A;  3AKB A;  5ER5 A;  2MHH A;  2I18 A;  1UUS A;  3TUY C;  1GGZ A;  2FOT A;  1J55 A;  5CSF A;  3SG2 A;  3VRN A;  1D1O A;  1SYM A;  3PN7 C;  3OB1 B;  1F55 A;  1YX7 A;  3KEV A;  1SR6 B;  3ZWH A;  1VRK A;  2F3Z A;  5TNC A;  2EHB A;  2KBM A;  2P6B B;  2WCF A;  2BBN A;  2NZ0 A;  1CTR A;  4ORB B;  4PE7 A;  2CNP A;  1OE9 B;  2ZRT A;  2COL B;  4GFT A;  2CTN A;  3I5F C;  2EGD A;  1TNQ A;  3EVR A;  1TOP A;  1JF2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...