1OSAA

Crystal structure of recombinant paramecium tetraurelia calmodulin at 1.68 angstroms resolution
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
148
structure length
148
Chain Sequence
AEQLTEEQIAEFKEAFALFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLSLMARKMKEQDSEEELIEAFKVFDRDGNGLISAAELRHVMTNLGEKLTDDEVDEMIREADIDGDGHINYEEFVRMMVSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CALMODULIN
publication title Structure of the recombinant Paramecium tetraurelia calmodulin at 1.68 A resolution.
pubmed doi rcsb
source organism Paramecium tetraurelia
molecule tags Calcium-binding protein
total genus 53
structure length 148
sequence length 148
ec nomenclature
pdb deposition date 1993-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1osaA01
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1osaA02
1NPQA 1DF0A 4OR9B 1IH0A 2O60A 3JTDB 1SL9A 4HSZA 1CLBA 2FJUB 4E68A 1J55A 1MR8A 1TOPA 3BUWB 2NLNA 3I5IB 4XJKB 2MA2A 5HKYA 4GPLB 1CM4A 2KBIA 1OMVA 1K9UA 4MLWA 2JXLA 1RFJA 2CTNA 1PK0D 1UHHA 3DVMA 4GBAA 2I18A 2LP3A 2M49B 1MUXA 1PALA 3O4YA 3CR5X 2KFHA 3TUYB 1BLQA 5ER5A 4QJ3B 1IWQA 2JOJA 1BJFA 1DT7B 3FS7A 1QTXA 4MEWA 1TNQA 1GQMA 2Q91A 2EGDA 3CZTX 3VRQA 1Y6WA 1S36A 3A8RA 1TIZA 2LAPA 2OTGB 3CS1A 3H4SE 1F70A 2JQ6A 4Q04A 1QASA 1SR6B 1V1FA 4GGNA 4MRXA 1EXRA 1YX7A 4ZCUA 3SG6A 3WHTB 4MN0A 1SY9A 2KFFA 1SPYA 5IBWA 1WLMA 1HQVA 2BL0C 4PE4A 5CPVA 2JTZA 1F71A 1NX1A 5PALA 1JWDA 1QXPA 1OQPA 3LL8B 1FBVA 2P6BB 1C07A 4GNKB 2KI4C 1NCXA 2KDHA 2QACA 4N5XA 1K96A 1MF8B 1K8UA 1WLZA 3PLFB 1MHOA 1SCMC 1S5GY 1PULA 4YBHB 1S26D 5CSJA 1B9AA 4AQIA 1IQ5A 2F8PA 1B4CA 1MXLC 2BE4A 1TTXA 2ZFDA 2KI6D 3CR4X 4PHMA 4BY5A 1F54A 1L2OC 1AVSA 1G8IA 1A4PA 2E30A 1DMOA 1XK4A 1WRLA 3O78A 1BMOA 1B8LA 1CLMA 1JC2A 2KFGA 1WDCC 4I5KA 4PCWA 4C0JA 1CB1A 4GAOA 2KGBC 3ZNIA 4NQGA 2M7LA 1TNXA 1KFUL 2MAZA 1K93D 1C7WA 1XVJA 3M0WA 3BUMB 2MRDA 1G4YR 2MBXA 4YGCB 2WOSA 2A4JA 2OPOA 1CFCA 1SCVA 4GGFC 1G33A 1KQMC 4L9MA 2M29A 2WCFA 3CLNA 1KK8C 2OS8C 1XK4C 1LKJA 1B7TY 3I5HC 2LC5A 1FI6A 1TNPA 1OZOA 1RWYA 4HREE 5CSNA 5AERA 1ZFSA 3IF7A 4WQ3A 3CGAA 1CMFA 1TNWA 2KAXA 3AKAA 1IRJA 4ORAB 4DCKA 3KHEA 2V53A 1NUBA 1GJYA 1RROA 1KFUS 4PHKA 3AKBA 5J3XA 3EVUA 4MSPA 1TCFA 5DKNA 2LVIA 1MQ1A 3VGOA 1TCOB 1NYAA 2F2OA 4DRWA 3EKHA 1YVHA 4PE1A 1CNPA 2LNKA 3IQQA 3LK0A 1J1DA 1S6CA 4QJ5B 1IKUA 2JWWA 5DKRA 1B47A 1K90D 3D10A 5KTYA 2Y1NA 2MHHA 4FTGA 4MBEA 5HLVA 3RM1A 1KWOC 3GK2A 2LMTA 3CTNA 1DJGA 1DJWA 4C0LA 1B8RA 2LP2A 4QJ4B 1BR4B 1WRKA 4GFTA 4DIRA 1QV1A 1PSRA 1CM1A 3ZWHA 5CSFA 2KI4B 3OX5A 1XFZO 2BCBA 3PFVA 1FI5A 5ER4X 1KK7Y 2LLTA 1UHNA 3O6BA 1J7PA 1OE9B 1TN4A 1CDNA 1SCMB 5KSZA 2BKHB 3CWGA 2DOQA 3LCPC 1DJYA 1K9KA 1KSMA 1R2UA 3MSEB 1L2OB 2SASA 1MWNA 3GK1A 1BODA 4M2QA 1UUSA 1A2XA 1DTLA 2FCDA 1DJHA 2PASA 1EG3A 2MJWB 4YGBB 1F4QA 4A4BA 1NWDA 1BOCA 1OMDA 1QX7A 5JOLA 1HT9A 1N0YA 2WCBA 1A75A 2WNDA 3GOFA 2PSRA 1F55A 1H8BA 2LMUA 2M7NA 1NCYA 2AMIA 1WDCB 1QV0A 1XO5A 1ALVA 2QPTA 2M0RA 3NXAA 4WRIA 1RTP1 2L4HA 1SL8A 1SNLA 4MVFA 2HF5A 1AJ5A 4ORBB 1Y0VH 2G9BA 1KFXS 3OB2B 2GGMA 4OV2A 3DF0B 2I7AA 1OZSA 2CT9A 1F4OA 1KK8B 2OS8B 3LK1A 3SG4A 1JFKA 2LUXA 4U8DA 5HKWA 3I5HB 2BKIB 2K61A 3WXAA 2JTTA 3VRPA 1PRWA 1QS7A 2JT8A 1SK6D 2L4IA 2VRGA 3VRNA 4PE7A 3I5FC 1NIWA 2K7BA 4MZJA 1OMRA 3ICBA 2KSPA 2HQWA 1JBAA 1OOJA 2D8NA 2KI6C 4F0ZB 4UPGA 1NX3A 2CCMA 1PVBA 1EL4A 2M8UA 2K2AA 2CNPA 3I5GC 5F6TA 1ZOTB 2ZN9A 1XFXO 1UHIA 2EC6C 1IJ6A 1EJ3A 2LVJA 2JPTA 3DVJA 1IG5A 2KYCA 4N1FA 1A03A 3BQ3A 1RJVA 1SBJA 4JPZB 5I8NA 1M39A 1S6JA 1CTRA 2MLEC 1S5GZ 2Y4QA 1KQVA 3JVTB 4CLNA 1CFFA 1KWOB 2NXQA 1QLSA 1OSAA 4DS7A 3OB1B 1A29A 1LXFC 1ZUZA 3K21A 2OTGC 1YR5A 4HRHA 1SKTA 2LV7A 3NSIA 4TNCA 4XYNA 4D1EA 2SCPA 3PN7C 3TS5C 2R2IA 2ZNDA 1W7JB 1YX8A 2WCEA 1UP5A 1Q80A 1S6IA 1K2HA 4NDCA 1QX2A 1YRUB 1KSOA 5BPJA 4C0KA 3BOWB 2ZKMX 4CPVA 2F33A 4M2PA 4N1GA 1U5IA 1M31A 1V1GA 2KQYA 2PALA 2ZRTA 2AUCA 4AQJA 4PHNA 1EG4A 1QX5B 2BCXA 3SIBA 1FPWA 5JJGA 1BR1B 2LLUA 2L51A 3RLZA 4NDBA 3CR2A 4PALA 2FCEA 1DGVA 1MXEA 1DF0B 2JRFA 2ZNEA 1X02A 1PSBA 1Y1AA 1GGZA 1ZACA 1Y1XA 1RK9A 2LUCA 5CSIA 3SG3A 2BL0B 2JU0A 1W7IB 1IGVA 1AHRA 2KGRA 4YGEB 2LVKA 4M2OA 1JSAA 1DJXA 4OVNF 1J7QA 1UHJA 2LM5A 1Y1UA 3FIAA 1KFXL 1ALWA 2BE6A 2JXCA 2Y1MA 1N65A 3D0YA 3F45A 1CFDA 1B8CA 3TDIA 4JQ0D 1J1EA 2PVBA 2TN4A 1K9PA 1XFWO 1AJ4A 2LVVA 1DJZA 5DKQA 3NSOA 3I5FB 1XFUO 2NCPA 2PMYA 4P5OE 1M63B 3BXKA 1NX0A 3E3RA 3KF9A 1UHKA 3NSLA 1BF5A 2B1UA 2WC8A 3I5GB 3AAJA 2H61A 1AUIB 1LA0A 1XYDA 1S3PA 5KU1A 4USLA 2EC6B 1AP4A 3BUXB 1CLLA 1VRKA 3BUOB 4CFRA 1QVIZ 1SMGA 1FF1A 1XA5A 1LINA 2E6WA 1FW4A 2JC2A 5D7FA 1DVIA 1KK7Z 4R1EA 2MLFC 5AFPA 2BBNA 2KAVA 4PDZA 2ZRSA 1IJ5A 1JF2A 1KQMB 1EH2A 4MZLA 2K2FA 3FWBA 3SJSA 2F3ZA 2L50A 5D69A 4A4CA 1F8HA 1CDPA 2LHLA 2H61C 1SL7A 1UURA 2EHBA 2LANA 1KCYA 2K7OA 3QRXA 2HQ8A 2JULA 1AK8A 3KEVA 2LE9B 3OHMB 3FWCA 3SG5A 4XJKA 4CIDA 2F3YA 2K7DA 2LMVA 1NP8A 3PN7B 3TS5B 4ETOA 3SG7A 4YGDB 4OKHA 4CFQA 2KYFA 1CDMA 1J7RA 3EVRA 2HETA 3HX4A 1XFVO 1BU3A 3PALA 3TDUA 4YI8A 1QJTA 2M9GA 2KQ6A 2JNXA 4HRGA 2COLB 1YUUA 4I5NB 1E8AA 2CBLA 3KO0A 1GGWA 3IQOA 3JTDC 3PATA 3I5IC 4WQ2A 5FYXA 3EVVA 1WY9A 2I2RE 4IL1A 1C7VA 2L2EA 1S1EA 1JF0A 4PHJA 1SYMA 1CDLA 3EK7A 2JZIA 5I2OA 1QIVA 3VRRA 2K7CA 1M45A 3DF0A 1IQ3A 4GGFA 4YRUA 3TUYC 3A4UB 1CFPA 1JUOA 3OX6A 2BCAA 5HYDA 2KOTA 1U5IB 1CMGA 1QATA 2O5GA 4ORCB 1LVCD 3KPXA 3DVKA 1SRAA 1SR6C 2G2BA 1QIWA 2IS9A 4AOMA 3LLEA 2BECA 1WRZA 2AAOA 1YRTB 3TDZA 3GK4X 5TNCA 3WHUB 3WNXB 2ISDA 1BG1A 5G08A 3NSKA 1TRFA 2LCPA 5B8IB 2I94A 2BBMA 2F2PA 5HKZA 2JT0A 3O2PA 3EK8A 3BYAA 3DVEA 5I2QA 1JFJA 4YI9A 1ZMZA 2H2KA 2L98A 2CXJA 2KAYA 3HCMA 4NDDA 5GQQC 5AEQA 3OP0A 5AXIA 1R6PA 1N2DA 1YUTA 2ZN8A 2JT3A 1BT6A 1H4BA 2KHNA 3AAKA 1B7TZ 1J7OA 3D0YB 1K95A 4YGAA 2L0PA 5HLOA 3VROA 2M3WA 3EK4A 5K89A 3PSRA 4GUKA 3C1VA 2GV5A 1ODBA 1YTZC 2KBMA 2LHIA 1NSHA 2M1UA 2WORA 4I5JA 1NX2A 2JNFA 2NZ0A 4ZCVA 2GGZA 1UWOA 3BUNB 2M97A 1SW8A 1RECA 4PE0A 5AANA 4BY4A 4DUQA 1DJIA 4P2YB 2Y5IA 4FQOA 1CKKA 1A75B 1YURA 2PRUA 1XFYO 2Q4UA 2KNEA 1YVLA 3TZ1A 2RGIA 3PM8A 4OCIA 3SIAA 3EKJA 1K94A 2FOTA 2HPSA 3BOWA 2NCOA 4ICBA 2K8MB 1M46A 1NCZA 2LLSA 1D1OA 2M1KB 3JVTC 1YUSA 2K0JA 1LA3A 1QLKA 2L5XB 1DGUA 4MZKA 1L7ZA 1QVIY 4JWQA 5I2LA 1PVAA 4I5LB 3SG2A 3DD4A 4MRYA 1B1GA
chains in the Genus database with same CATH superfamily
1C3YA 1NPQA 3B7AA 1DF0A 3D78A 4OR9B 1IH0A 2O60A 3JTDB 1QWVA 1SL9A 4HSZA 1CLBA 2FJUB 4E68A 1J55A 1MR8A 1TOPA 3BUWB 2NLNA 3I5IB 4XJKB 2MA2A 5HKYA 1DELA 4GPLB 1CM4A 2WC6A 2KBIA 1OMVA 1K9UA 4MLWA 2JXLA 1RFJA 2CTNA 1PK0D 1UHHA 3S0DA 3DVMA 4GBAA 2I18A 2LP3A 2M49B 1MUXA 1PALA 2BAPA 3CR5X 2KFHA 3FE8A 3O4YA 5DICA 1BLQA 5ER5A 4QJ3B 1IWQA 2JOJA 1BJFA 1DT7B 3FS7A 1QTXA 2PYQA 4MEWA 1TNQA 1GQMA 2Q91A 2EGDA 3CZTX 4IJ7A 3VRQA 1Y6WA 1S36A 3A8RA 1TIZA 2LAPA 2OTGB 3CS1A 3CZ2A 3H4SE 1F70A 2JQ6A 4Q04A 1QASA 1SR6B 1V1FA 4GGNA 4MRXA 1EXRA 1YX7A 4ZCUA 3SG6A 3WHTB 4MN0A 1GM0A 1SY9A 2H8VA 2KFFA 1SPYA 5IBWA 1WLMA 1HQVA 2BL0C 2WCMA 4PE4A 5CPVA 2JTZA 1F71A 1NX1A 3PJIA 5PALA 1JWDA 1QXPA 1OQPA 3LL8B 1FBVA 2P6BB 1C07A 4GNKB 2KI4C 1NCXA 2KDHA 2QACA 4N5XA 1K96A 1MF8B 1K8UA 1WLZA 3PLFB 1MHOA 1SCMC 1S5GY 1PULA 3CZ0A 2QEOA 4JKTA 4YBHB 1S26D 3BFAA 5CSJA 1B9AA 4AQIA 3NHIA 1IQ5A 2F8PA 1B4CA 1MXLC 2BE4A 1TTXA 2ZFDA 2KI6D 3CR4X 4PHMA 4BY5A 1F54A 1L2OC 1AVSA 1G8IA 1A4PA 2E30A 1DMOA 2YGUA 3EG5B 1XK4A 1WRLA 3O78A 1BMOA 1B8LA 1CLMA 1JC2A 2KFGA 1WDCC 4I5KA 2FJYA 4PCWA 4C0JA 1CB1A 4GAOA 2KGBC 3ZNIA 1DQEA 4NQGA 2M7LA 1TNXA 1KFUL 2MAZA 1K93D 1C7WA 1XVJA 3M0WA 4INWA 3BUMB 2MRDA 1G4YR 2MBXA 4YGCB 2WOSA 2A4JA 2OPOA 1CFCA 1SCVA 4GGFC 1G33A 1KQMC 4L9MA 2M29A 1T14A 2WCFA 3CLNA 1KK8C 4PT1A 2OS8C 1DC1A 1XK4C 1LKJA 1B7TY 3I5HC 2LC5A 1FI6A 1TNPA 1OZOA 1RWYA 4HREE 5CSNA 3UNWA 5AERA 1ZFSA 3IF7A 4WQ3A 3CGAA 1CMFA 4F7FA 1TNWA 2KAXA 3AKAA 1IRJA 1OOIX 4ORAB 1DEKA 3D73A 4DCKA 2KLEA 3KHEA 2V53A 1NUBA 1GJYA 2K60A 1RROA 3K1EA 1KFUS 4PHKA 3AKBA 5J3XA 3EVUA 3B6XA 1TCFA 4MSPA 5DKNA 2GTEA 2LVIA 1MQ1A 3VGOA 1TCOB 1NYAA 2F2OA 4DRWA 3EKHA 1YVHA 4PE1A 1CNPA 2LNKA 3IQQA 3LK0A 3CDNA 1J1DA 1S6CA 4QJ5B 1IKUA 2JWWA 5DKRA 1B47A 1K90D 3D10A 5KTYA 2Y1NA 2MHHA 3OBVA 4FTGA 4MBEA 5HLVA 3RM1A 1KWOC 2L2CA 3S0BA 3S0FA 3GK2A 2LMTA 3CTNA 1DJGA 1DJWA 4C0LA 1B8RA 2LP2A 4QJ4B 1BR4B 1WRKA 4GFTA 4DIRA 1QV1A 1PSRA 1CM1A 3ZWHA 5CSFA 2KI4B 3OX5A 1XFZO 2BCBA 3PFVA 1FI5A 5ER4X 3S0GA 1KK7Y 2LLTA 1UHNA 3O6BA 1J7PA 1OE9B 1TN4A 1CDNA 1SCMB 5KSZA 5HL1A 3B88A 2BKHB 3CWGA 2DOQA 3LCPC 1DJYA 3B86A 1K9KA 1KSMA 1R2UA 2WCHA 3MSEB 1L2OB 2SASA 1MWNA 3GK1A 1BODA 4M2QA 1UUSA 1A2XA 1DTLA 2FCDA 1DJHA 1ORGA 1EG3A 2MJWB 2PASA 1F4QA 3NHTA 1NWDA 4A4BA 1OMDA 1BOCA 1QX7A 3NGVA 5JOLA 2P71A 1HT9A 1N0YA 2WCBA 1A75A 2WNDA 3GOFA 2PSRA 1F55A 1H8BA 2LMUA 2M7NA 1NCYA 2AMIA 1WDCB 1QV0A 1XO5A 2KPHA 1ALVA 2QPTA 2M0RA 3NXAA 4WRIA 3DXLA 1RTP1 2L4HA 1SL8A 1SNLA 4MVFA 2HF5A 1AJ5A 3R72A 4ORBB 1Y0VH 3V2LA 2G9BA 1KFXS 3OB2B 2GGMA 4OV2A 3DF0B 2I7AA 1OZSA 2CT9A 1F4OA 1KK8B 2OS8B 3LK1A 3SG4A 1JFKA 2LUXA 4U8DA 5HKWA 3I5HB 2BKIB 3R1VA 2K61A 3WXAA 2JTTA 3R1OA 3VRPA 1PRWA 1QS7A 2JT8A 1SK6D 2L4IA 2VRGA 3VRNA 4PE7A 3I5FC 1NIWA 2K7BA 4MZJA 1OMRA 3ICBA 2KSPA 2HQWA 1JBAA 1OOJA 2D8NA 2KI6C 4F0ZB 4UPGA 1NX3A 2CCMA 1PVBA 1EL4A 2M8UA 2K2AA 2CNPA 3I5GC 5F6TA 1ZOTB 2ZN9A 1XFXO 1UHIA 2EC6C 1IJ6A 1EJ3A 2LVJA 2JPTA 3DVJA 1IG5A 2KYCA 4N1FA 1A03A 3BQ3A 1RJVA 1SBJA 4JPZB 5FI7A 5I8NA 1M39A 1S6JA 1CTRA 2MLEC 1S5GZ 2Y4QA 1KQVA 3BFBA 3CZ1A 3JVTB 4CLNA 1CFFA 1KWOB 2NXQA 5I94A 1QLSA 1OSAA 4DS7A 3OB1B 1A29A 1LXFC 1ZUZA 3K21A 2OTGC 1YR5A 4HRHA 1SKTA 2LV7A 3NSIA 4TNCA 4XYNA 4D1EA 2SCPA 4FQTA 3PN7C 3TS5C 2R2IA 2ZNDA 1W7JB 1YX8A 2WCEA 1UP5A 1Q80A 1S6IA 1K2HA 4NDCA 1QX2A 1YRUB 1KSOA 5BPJA 1Z4HA 3VB1A 3O4XA 1XFRA 4C0KA 3BOWB 2ZKMX 4CPVA 1OOGA 2F33A 4M2PA 4N1GA 1U5IA 1M31A 3Q8IA 1V1GA 2KQYA 2PALA 2ZRTA 2AUCA 4AQJA 4PHNA 1EG4A 1QX5B 2BCXA 3D74A 3L47A 3SIBA 1FPWA 5JJGA 1BR1B 2LLUA 2L51A 3RLZA 4NDBA 1TUJA 3CR2A 4PALA 2FCEA 1DGVA 1MXEA 1DF0B 2JRFA 2ZNEA 1X02A 1PSBA 3DZTA 1Y1AA 1GGZA 1OOHA 1TUZA 1ZACA 1Y1XA 1RK9A 2LUCA 2QDIA 3QMEA 4JD9A 5CSIA 3SS5A 3SG3A 2BL0B 2JU0A 1W7IB 1IGVA 1AHRA 2KGRA 4MRYA 4YGEB 4AOMA 2LVKA 4M2OA 2WCLA 1JSAA 3D77A 1DJXA 4OVNF 1J7QA 1UHJA 2LM5A 1Y1UA 1SSEB 3FIAA 1KFXL 3CABA 1ALWA 2BE6A 2JXCA 2P70A 1N65A 2Y1MA 3D0YA 1CFDA 1B8CA 3F45A 4JQ0D 1J1EA 3SS4A 3TDIA 2PVBA 2TN4A 1K9PA 1XFWO 1AJ4A 2LVVA 1DJZA 5DKQA 3NSOA 3I5FB 3S0EA 1XFUO 2NCPA 2PMYA 4P5OE 1M63B 3BXKA 1NX0A 3E3RA 3KF9A 1UHKA 3NSLA 1BF5A 2B1UA 2WC8A 1OOFA 3I5GB 3PM2A 3AAJA 2H61A 1AUIB 1LA0A 1XYDA 1S3PA 5KU1A 4USLA 2EC6B 1AP4A 3BUXB 1CLLA 1VRKA 3BUOB 4CFRA 1QVIZ 1SMGA 1FF1A 1XA5A 1LINA 2E6WA 1FW4A 2JC2A 2QEBA 1DVIA 1KK7Z 4R1EA 5D7FA 2MLFC 5AFPA 2BBNA 2KAVA 4PDZA 4YGBB 5FI6A 5FI2A 2ZRSA 1IJ5A 1JF2A 1KQMB 1EH2A 4MZLA 2K2FA 3FWBA 3SJSA 2F3ZA 2L50A 5D69A 4A4CA 1F8HA 1CDPA 2LHLA 2H61C 1SL7A 1UURA 2EHBA 2LANA 1KCYA 2K7OA 3QRXA 2HQ8A 2JULA 2WC5A 1AK8A 3KEVA 2LE9B 3OHMB 3FWCA 3SG5A 4XJKA 4CIDA 2F3YA 2K7DA 2LMVA 1NP8A 2PQLA 3PN7B 3TS5B 4ETOA 3SG7A 4YGDB 2KLDA 4OKHA 4CFQA 2KYFA 1CDMA 3R1PA 1J7RA 3EVRA 2HETA 3HX4A 1TWOA 3DY9A 4INXA 1XFVO 3L4AA 1BU3A 3PALA 2QEHA 4YI8A 1QJTA 3TDUA 2M9GA 2KQ6A 2JNXA 4HRGA 4KYNA 2COLB 1YUUA 3S0AA 4I5NB 1E8AA 2CBLA 3KO0A 3CYZA 1GGWA 3IQOA 3JTDC 3PATA 2WCJA 3I5IC 3L4LA 4WQ2A 3EVVA 1WY9A 5FYXA 1W9ZA 2I2RE 4IL1A 1C7VA 2L2EA 1S1EA 1JF0A 4PHJA 5D3OA 3B87A 1SYMA 1CDLA 3EK7A 2JZIA 5I2OA 1QIVA 3VRRA 2K7CA 1M45A 3DF0A 1IQ3A 4GGFA 4YRUA 3TUYC 3A4UB 1CFPA 1JUOA 3OX6A 2BCAA 5HYDA 2KOTA 1U5IB 1CMGA 2JPOA 1QATA 2O5GA 4ORCB 1LVCD 3IVTA 3SS3A 3KPXA 3DVKA 1SRAA 1SR6C 2G2BA 3RZSA 1QIWA 2IS9A 3OGNA 1Z2CB 2BECA 3LLEA 1WRZA 1YRTB 2AAOA 4OZDA 3GK4X 5EL2A 5TNCA 3TDZA 3WHUB 3WNXB 2ISDA 1BG1A 5G08A 3NSKA 1TRFA 3BFHA 2LCPA 5B8IB 2I94A 2BBMA 2F2PA 5HKZA 2JT0A 3O2PA 3EK8A 3BYAA 3DVEA 2WCKA 5I2QA 1JFJA 4YI9A 1C3ZA 1ZMZA 2H2KA 2L98A 2CXJA 2KAYA 3BJHA 3HCMA 4NDDA 5GQQC 5AEQA 3OP0A 5AXIA 1R6PA 1N2DA 1YUTA 2ZN8A 2JT3A 1LS8A 1BT6A 1H4BA 2KHNA 3AAKA 1B7TZ 1J7OA 3D0YB 3DYEA 3D76A 1K95A 2BNXA 4YGAA 3D75A 2L0PA 5HLOA 3VROA 2M3WA 3EK4A 5K89A 3PSRA 4GUKA 3C1VA 2GV5A 1ODBA 1YTZC 2KBMA 2LHIA 1NSHA 2M1UA 2WORA 3UO9A 1IIOA 4I5JA 1NX2A 2JNFA 2NZ0A 4ZCVA 2GGZA 1UWOA 3BUNB 2M97A 1SW8A 1RECA 4PE0A 5AANA 4BY4A 4DUQA 1DJIA 4P2YB 2Y5IA 4FQOA 1CKKA 3TUYB 1A75B 1YURA 2PRUA 1XFYO 2Q4UA 2KNEA 1YVLA 3FE9A 3TZ1A 2RGIA 3PM8A 4OCIA 3SIAA 1P28A 3EKJA 1K94A 2FOTA 2HPSA 3BOWA 2NCOA 4ICBA 2ERBA 2K8MB 3N7HA 1M46A 1NCZA 2LLSA 1D1OA 2M1KB 3JVTC 3FE6A 1YUSA 2K0JA 1LA3A 1QLKA 2L5XB 1DGUA 4MZKA 1L7ZA 1OW4A 1QVIY 4JWQA 5I2LA 1PVAA 2L5YA 4I5LB 3SG2A 3DD4A 2QEVA 1B1GA
chains in the Genus database with same CATH topology
1NPQA 1DF0A 4OR9B 1IH0A 2O60A 3JTDB 1SL9A 4HSZA 1CLBA 2FJUB 4E68A 1J55A 1MR8A 1TOPA 3BUWB 2NLNA 3I5IB 4XJKB 2MA2A 5HKYA 4GPLB 1CM4A 2KBIA 1OMVA 1K9UA 4MLWA 2JXLA 1RFJA 2CTNA 1PK0D 1UHHA 3DVMA 4GBAA 2I18A 2LP3A 2M49B 1MUXA 1PALA 3O4YA 3CR5X 2KFHA 3TUYB 1BLQA 5ER5A 4QJ3B 1IWQA 2JOJA 1BJFA 1DT7B 3FS7A 1QTXA 4MEWA 1TNQA 1GQMA 2Q91A 2EGDA 3CZTX 3VRQA 1Y6WA 1S36A 3A8RA 1TIZA 2LAPA 2OTGB 3CS1A 3H4SE 1F70A 2JQ6A 4Q04A 1QASA 1SR6B 1V1FA 4GGNA 4MRXA 1EXRA 1YX7A 4ZCUA 3SG6A 3WHTB 4MN0A 1SY9A 2KFFA 1SPYA 5IBWA 1WLMA 1HQVA 2BL0C 4PE4A 5CPVA 2JTZA 1F71A 1NX1A 5PALA 1JWDA 1QXPA 1OQPA 3LL8B 1FBVA 2P6BB 1C07A 4GNKB 2KI4C 1NCXA 2KDHA 2QACA 4N5XA 1K96A 1MF8B 1K8UA 1WLZA 3PLFB 1MHOA 1SCMC 1S5GY 1PULA 4YBHB 1S26D 5CSJA 1B9AA 4AQIA 1IQ5A 2F8PA 1B4CA 1MXLC 2BE4A 1TTXA 2ZFDA 2KI6D 3CR4X 4PHMA 4BY5A 1F54A 1L2OC 1AVSA 1G8IA 1A4PA 2E30A 1DMOA 1XK4A 1WRLA 3O78A 1BMOA 1B8LA 1CLMA 1JC2A 2KFGA 1WDCC 4I5KA 4PCWA 4C0JA 1CB1A 4GAOA 2KGBC 3ZNIA 4NQGA 2M7LA 1TNXA 1KFUL 2MAZA 1K93D 1C7WA 1XVJA 3M0WA 3BUMB 2MRDA 1G4YR 2MBXA 4YGCB 2WOSA 2A4JA 2OPOA 1CFCA 1SCVA 4GGFC 1G33A 1KQMC 4L9MA 2M29A 2WCFA 3CLNA 1KK8C 2OS8C 1XK4C 1LKJA 1B7TY 3I5HC 2LC5A 1FI6A 1TNPA 1OZOA 1RWYA 4HREE 5CSNA 5AERA 1ZFSA 3IF7A 4WQ3A 3CGAA 1CMFA 1TNWA 2KAXA 3AKAA 1IRJA 4ORAB 4DCKA 3KHEA 2V53A 1NUBA 1GJYA 1RROA 1KFUS 4PHKA 3AKBA 5J3XA 3EVUA 4MSPA 1TCFA 5DKNA 2LVIA 1MQ1A 3VGOA 1TCOB 1NYAA 2F2OA 4DRWA 3EKHA 1YVHA 4PE1A 1CNPA 2LNKA 3IQQA 3LK0A 1J1DA 1S6CA 4QJ5B 1IKUA 2JWWA 5DKRA 1B47A 1K90D 3D10A 5KTYA 2Y1NA 2MHHA 4FTGA 4MBEA 5HLVA 3RM1A 1KWOC 3GK2A 2LMTA 3CTNA 1DJGA 1DJWA 4C0LA 1B8RA 2LP2A 4QJ4B 1BR4B 1WRKA 4GFTA 4DIRA 1QV1A 1PSRA 1CM1A 3ZWHA 5CSFA 2KI4B 3OX5A 1XFZO 2BCBA 3PFVA 1FI5A 5ER4X 1KK7Y 2LLTA 1UHNA 3O6BA 1J7PA 1OE9B 1TN4A 1CDNA 1SCMB 5KSZA 2BKHB 3CWGA 2DOQA 3LCPC 1DJYA 1K9KA 1KSMA 1R2UA 3MSEB 1L2OB 2SASA 1MWNA 3GK1A 1BODA 4M2QA 1UUSA 1A2XA 1DTLA 2FCDA 1DJHA 2PASA 1EG3A 2MJWB 4YGBB 1F4QA 4A4BA 1NWDA 1BOCA 1OMDA 1QX7A 5JOLA 1HT9A 1N0YA 2WCBA 1A75A 2WNDA 3GOFA 2PSRA 1F55A 1H8BA 2LMUA 2M7NA 1NCYA 2AMIA 1WDCB 1QV0A 1XO5A 1ALVA 2QPTA 2M0RA 3NXAA 4WRIA 1RTP1 2L4HA 1SL8A 1SNLA 4MVFA 2HF5A 1AJ5A 4ORBB 1Y0VH 2G9BA 1KFXS 3OB2B 2GGMA 4OV2A 3DF0B 2I7AA 1OZSA 2CT9A 1F4OA 1KK8B 2OS8B 3LK1A 3SG4A 1JFKA 2LUXA 4U8DA 5HKWA 3I5HB 2BKIB 2K61A 3WXAA 2JTTA 3VRPA 1PRWA 1QS7A 2JT8A 1SK6D 2L4IA 2VRGA 3VRNA 4PE7A 3I5FC 1NIWA 2K7BA 4MZJA 1OMRA 3ICBA 2KSPA 2HQWA 1JBAA 1OOJA 2D8NA 2KI6C 4F0ZB 4UPGA 1NX3A 2CCMA 1PVBA 1EL4A 2M8UA 2K2AA 2CNPA 3I5GC 5F6TA 1ZOTB 2ZN9A 1XFXO 1UHIA 2EC6C 1IJ6A 1EJ3A 2LVJA 2JPTA 3DVJA 1IG5A 2KYCA 4N1FA 1A03A 3BQ3A 1RJVA 1SBJA 4JPZB 5I8NA 1M39A 1S6JA 1CTRA 2MLEC 1S5GZ 2Y4QA 1KQVA 3JVTB 4CLNA 1CFFA 1KWOB 2NXQA 1QLSA 1OSAA 4DS7A 3OB1B 1A29A 1LXFC 1ZUZA 3K21A 2OTGC 1YR5A 4HRHA 1SKTA 2LV7A 3NSIA 4TNCA 4XYNA 4D1EA 2SCPA 3PN7C 3TS5C 2R2IA 2ZNDA 1W7JB 1YX8A 2WCEA 1UP5A 1Q80A 1S6IA 1K2HA 4NDCA 1QX2A 1YRUB 1KSOA 5BPJA 4C0KA 3BOWB 2ZKMX 4CPVA 2F33A 4M2PA 4N1GA 1U5IA 1M31A 1V1GA 2KQYA 2PALA 2ZRTA 2AUCA 4AQJA 4PHNA 1EG4A 1QX5B 2BCXA 3SIBA 1FPWA 5JJGA 1BR1B 2LLUA 2L51A 3RLZA 4NDBA 3CR2A 4PALA 2FCEA 1DGVA 1MXEA 1DF0B 2JRFA 2ZNEA 1X02A 1PSBA 1Y1AA 1GGZA 1ZACA 1Y1XA 1RK9A 2LUCA 5CSIA 3SG3A 2BL0B 2JU0A 1W7IB 1IGVA 1AHRA 2KGRA 4YGEB 2LVKA 4M2OA 1JSAA 1DJXA 4OVNF 1J7QA 1UHJA 2LM5A 1Y1UA 3FIAA 1KFXL 1ALWA 2BE6A 2JXCA 2Y1MA 1N65A 3D0YA 3F45A 1CFDA 1B8CA 3TDIA 4JQ0D 1J1EA 2PVBA 2TN4A 1K9PA 1XFWO 1AJ4A 2LVVA 1DJZA 5DKQA 3NSOA 3I5FB 1XFUO 2NCPA 2PMYA 4P5OE 1M63B 3BXKA 1NX0A 3E3RA 3KF9A 1UHKA 3NSLA 1BF5A 2B1UA 2WC8A 3I5GB 3AAJA 2H61A 1AUIB 1LA0A 1XYDA 1S3PA 5KU1A 4USLA 2EC6B 1AP4A 3BUXB 1CLLA 1VRKA 3BUOB 4CFRA 1QVIZ 1SMGA 1FF1A 1XA5A 1LINA 2E6WA 1FW4A 2JC2A 5D7FA 1DVIA 1KK7Z 4R1EA 2MLFC 5AFPA 2BBNA 2KAVA 4PDZA 2ZRSA 1IJ5A 1JF2A 1KQMB 1EH2A 4MZLA 2K2FA 3FWBA 3SJSA 2F3ZA 2L50A 5D69A 4A4CA 1F8HA 1CDPA 2LHLA 2H61C 1SL7A 1UURA 2EHBA 2LANA 1KCYA 2K7OA 3QRXA 2HQ8A 2JULA 1AK8A 3KEVA 2LE9B 3OHMB 3FWCA 3SG5A 4XJKA 4CIDA 2F3YA 2K7DA 2LMVA 1NP8A 3PN7B 3TS5B 4ETOA 3SG7A 4YGDB 4OKHA 4CFQA 2KYFA 1CDMA 1J7RA 3EVRA 2HETA 3HX4A 1XFVO 1BU3A 3PALA 3TDUA 4YI8A 1QJTA 2M9GA 2KQ6A 2JNXA 4HRGA 2COLB 1YUUA 4I5NB 1E8AA 2CBLA 3KO0A 1GGWA 3IQOA 3JTDC 3PATA 3I5IC 4WQ2A 5FYXA 3EVVA 1WY9A 2I2RE 4IL1A 1C7VA 2L2EA 1S1EA 1JF0A 4PHJA 1SYMA 1CDLA 3EK7A 2JZIA 5I2OA 1QIVA 3VRRA 2K7CA 1M45A 3DF0A 1IQ3A 4GGFA 4YRUA 3TUYC 3A4UB 1CFPA 1JUOA 3OX6A 2BCAA 5HYDA 2KOTA 1U5IB 1CMGA 1QATA 2O5GA 4ORCB 1LVCD 3KPXA 3DVKA 1SRAA 1SR6C 2G2BA 1QIWA 2IS9A 4AOMA 3LLEA 2BECA 1WRZA 2AAOA 1YRTB 3TDZA 3GK4X 5TNCA 3WHUB 3WNXB 2ISDA 1BG1A 5G08A 3NSKA 1TRFA 2LCPA 5B8IB 2I94A 2BBMA 2F2PA 5HKZA 2JT0A 3O2PA 3EK8A 3BYAA 3DVEA 5I2QA 1JFJA 4YI9A 1ZMZA 2H2KA 2L98A 2CXJA 2KAYA 3HCMA 4NDDA 5GQQC 5AEQA 3OP0A 5AXIA 1R6PA 1N2DA 1YUTA 2ZN8A 2JT3A 1BT6A 1H4BA 2KHNA 3AAKA 1B7TZ 1J7OA 3D0YB 1K95A 4YGAA 2L0PA 5HLOA 3VROA 2M3WA 3EK4A 5K89A 3PSRA 4GUKA 3C1VA 2GV5A 1ODBA 1YTZC 2KBMA 2LHIA 1NSHA 2M1UA 2WORA 4I5JA 1NX2A 2JNFA 2NZ0A 4ZCVA 2GGZA 1UWOA 3BUNB 2M97A 1SW8A 1RECA 4PE0A 5AANA 4BY4A 4DUQA 1DJIA 4P2YB 2Y5IA 4FQOA 1CKKA 1A75B 1YURA 2PRUA 1XFYO 2Q4UA 2KNEA 1YVLA 3TZ1A 2RGIA 3PM8A 4OCIA 3SIAA 3EKJA 1K94A 2FOTA 2HPSA 3BOWA 2NCOA 4ICBA 2K8MB 1M46A 1NCZA 2LLSA 1D1OA 2M1KB 3JVTC 1YUSA 2K0JA 1LA3A 1QLKA 2L5XB 1DGUA 4MZKA 1L7ZA 1QVIY 4JWQA 5I2LA 1PVAA 4I5LB 3SG2A 3DD4A 4MRYA 1B1GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NPQ A;  1DF0 A;  4OR9 B;  1IH0 A;  2O60 A;  3JTD B;  1SL9 A;  4HSZ A;  1CLB A;  2FJU B;  4E68 A;  1J55 A;  1MR8 A;  1TOP A;  3BUW B;  2NLN A;  3I5I B;  4XJK B;  2MA2 A;  5HKY A;  4GPL B;  1CM4 A;  2KBI A;  1OMV A;  1K9U A;  4MLW A;  2JXL A;  1RFJ A;  2CTN A;  1PK0 D;  1UHH A;  3DVM A;  4GBA A;  2I18 A;  2LP3 A;  2M49 B;  1MUX A;  1PAL A;  3O4Y A;  3CR5 X;  2KFH A;  3TUY B;  1BLQ A;  5ER5 A;  4QJ3 B;  1IWQ A;  2JOJ A;  1BJF A;  1DT7 B;  3FS7 A;  1QTX A;  4MEW A;  1TNQ A;  1GQM A;  2Q91 A;  2EGD A;  3CZT X;  3VRQ A;  1Y6W A;  1S36 A;  3A8R A;  1TIZ A;  2LAP A;  2OTG B;  3CS1 A;  3H4S E;  1F70 A;  2JQ6 A;  4Q04 A;  1QAS A;  1SR6 B;  1V1F A;  4GGN A;  4MRX A;  1EXR A;  1YX7 A;  4ZCU A;  3SG6 A;  3WHT B;  4MN0 A;  1SY9 A;  2KFF A;  1SPY A;  5IBW A;  1WLM A;  1HQV A;  2BL0 C;  4PE4 A;  5CPV A;  2JTZ A;  1F71 A;  1NX1 A;  5PAL A;  1JWD A;  1QXP A;  1OQP A;  3LL8 B;  1FBV A;  2P6B B;  1C07 A;  4GNK B;  2KI4 C;  1NCX A;  2KDH A;  2QAC A;  4N5X A;  1K96 A;  1MF8 B;  1K8U A;  1WLZ A;  3PLF B;  1MHO A;  1SCM C;  1S5G Y;  1PUL A;  4YBH B;  1S26 D;  5CSJ A;  1B9A A;  4AQI A;  1IQ5 A;  2F8P A;  1B4C A;  1MXL C;  2BE4 A;  1TTX A;  2ZFD A;  2KI6 D;  3CR4 X;  4PHM A;  4BY5 A;  1F54 A;  1L2O C;  1AVS A;  1G8I A;  1A4P A;  2E30 A;  1DMO A;  1XK4 A;  1WRL A;  3O78 A;  1BMO A;  1B8L A;  1CLM A;  1JC2 A;  2KFG A;  1WDC C;  4I5K A;  4PCW A;  4C0J A;  1CB1 A;  4GAO A;  2KGB C;  3ZNI A;  4NQG A;  2M7L A;  1TNX A;  1KFU L;  2MAZ A;  1K93 D;  1C7W A;  1XVJ A;  3M0W A;  3BUM B;  2MRD A;  1G4Y R;  2MBX A;  4YGC B;  2WOS A;  2A4J A;  2OPO A;  1CFC A;  1SCV A;  4GGF C;  1G33 A;  1KQM C;  4L9M A;  2M29 A;  2WCF A;  3CLN A;  1KK8 C;  2OS8 C;  1XK4 C;  1LKJ A;  1B7T Y;  3I5H C;  2LC5 A;  1FI6 A;  1TNP A;  1OZO A;  1RWY A;  4HRE E;  5CSN A;  5AER A;  1ZFS A;  3IF7 A;  4WQ3 A;  3CGA A;  1CMF A;  1TNW A;  2KAX A;  3AKA A;  1IRJ A;  4ORA B;  4DCK A;  3KHE A;  2V53 A;  1NUB A;  1GJY A;  1RRO A;  1KFU S;  4PHK A;  3AKB A;  5J3X A;  3EVU A;  4MSP A;  1TCF A;  5DKN A;  2LVI A;  1MQ1 A;  3VGO A;  1TCO B;  1NYA A;  2F2O A;  4DRW A;  3EKH A;  1YVH A;  4PE1 A;  1CNP A;  2LNK A;  3IQQ A;  3LK0 A;  1J1D A;  1S6C A;  4QJ5 B;  1IKU A;  2JWW A;  5DKR A;  1B47 A;  1K90 D;  3D10 A;  5KTY A;  2Y1N A;  2MHH A;  4FTG A;  4MBE A;  5HLV A;  3RM1 A;  1KWO C;  3GK2 A;  2LMT A;  3CTN A;  1DJG A;  1DJW A;  4C0L A;  1B8R A;  2LP2 A;  4QJ4 B;  1BR4 B;  1WRK A;  4GFT A;  4DIR A;  1QV1 A;  1PSR A;  1CM1 A;  3ZWH A;  5CSF A;  2KI4 B;  3OX5 A;  1XFZ O;  2BCB A;  3PFV A;  1FI5 A;  5ER4 X;  1KK7 Y;  2LLT A;  1UHN A;  3O6B A;  1J7P A;  1OE9 B;  1TN4 A;  1CDN A;  1SCM B;  5KSZ A;  2BKH B;  3CWG A;  2DOQ A;  3LCP C;  1DJY A;  1K9K A;  1KSM A;  1R2U A;  3MSE B;  1L2O B;  2SAS A;  1MWN A;  3GK1 A;  1BOD A;  4M2Q A;  1UUS A;  1A2X A;  1DTL A;  2FCD A;  1DJH A;  2PAS A;  1EG3 A;  2MJW B;  4YGB B;  1F4Q A;  4A4B A;  1NWD A;  1BOC A;  1OMD A;  1QX7 A;  5JOL A;  1HT9 A;  1N0Y A;  2WCB A;  1A75 A;  2WND A;  3GOF A;  2PSR A;  1F55 A;  1H8B A;  2LMU A;  2M7N A;  1NCY A;  2AMI A;  1WDC B;  1QV0 A;  1XO5 A;  1ALV A;  2QPT A;  2M0R A;  3NXA A;  4WRI A;  1RTP 1;  2L4H A;  1SL8 A;  1SNL A;  4MVF A;  2HF5 A;  1AJ5 A;  4ORB B;  1Y0V H;  2G9B A;  1KFX S;  3OB2 B;  2GGM A;  4OV2 A;  3DF0 B;  2I7A A;  1OZS A;  2CT9 A;  1F4O A;  1KK8 B;  2OS8 B;  3LK1 A;  3SG4 A;  1JFK A;  2LUX A;  4U8D A;  5HKW A;  3I5H B;  2BKI B;  2K61 A;  3WXA A;  2JTT A;  3VRP A;  1PRW A;  1QS7 A;  2JT8 A;  1SK6 D;  2L4I A;  2VRG A;  3VRN A;  4PE7 A;  3I5F C;  1NIW A;  2K7B A;  4MZJ A;  1OMR A;  3ICB A;  2KSP A;  2HQW A;  1JBA A;  1OOJ A;  2D8N A;  2KI6 C;  4F0Z B;  4UPG A;  1NX3 A;  2CCM A;  1PVB A;  1EL4 A;  2M8U A;  2K2A A;  2CNP A;  3I5G C;  5F6T A;  1ZOT B;  2ZN9 A;  1XFX O;  1UHI A;  2EC6 C;  1IJ6 A;  1EJ3 A;  2LVJ A;  2JPT A;  3DVJ A;  1IG5 A;  2KYC A;  4N1F A;  1A03 A;  3BQ3 A;  1RJV A;  1SBJ A;  4JPZ B;  5I8N A;  1M39 A;  1S6J A;  1CTR A;  2MLE C;  1S5G Z;  2Y4Q A;  1KQV A;  3JVT B;  4CLN A;  1CFF A;  1KWO B;  2NXQ A;  1QLS A;  1OSA A;  4DS7 A;  3OB1 B;  1A29 A;  1LXF C;  1ZUZ A;  3K21 A;  2OTG C;  1YR5 A;  4HRH A;  1SKT A;  2LV7 A;  3NSI A;  4TNC A;  4XYN A;  4D1E A;  2SCP A;  3PN7 C;  3TS5 C;  2R2I A;  2ZND A;  1W7J B;  1YX8 A;  2WCE A;  1UP5 A;  1Q80 A;  1S6I A;  1K2H A;  4NDC A;  1QX2 A;  1YRU B;  1KSO A;  5BPJ A;  4C0K A;  3BOW B;  2ZKM X;  4CPV A;  2F33 A;  4M2P A;  4N1G A;  1U5I A;  1M31 A;  1V1G A;  2KQY A;  2PAL A;  2ZRT A;  2AUC A;  4AQJ A;  4PHN A;  1EG4 A;  1QX5 B;  2BCX A;  3SIB A;  1FPW A;  5JJG A;  1BR1 B;  2LLU A;  2L51 A;  3RLZ A;  4NDB A;  3CR2 A;  4PAL A;  2FCE A;  1DGV A;  1MXE A;  1DF0 B;  2JRF A;  2ZNE A;  1X02 A;  1PSB A;  1Y1A A;  1GGZ A;  1ZAC A;  1Y1X A;  1RK9 A;  2LUC A;  5CSI A;  3SG3 A;  2BL0 B;  2JU0 A;  1W7I B;  1IGV A;  1AHR A;  2KGR A;  4YGE B;  2LVK A;  4M2O A;  1JSA A;  1DJX A;  4OVN F;  1J7Q A;  1UHJ A;  2LM5 A;  1Y1U A;  3FIA A;  1KFX L;  1ALW A;  2BE6 A;  2JXC A;  2Y1M A;  1N65 A;  3D0Y A;  3F45 A;  1CFD A;  1B8C A;  3TDI A;  4JQ0 D;  1J1E A;  2PVB A;  2TN4 A;  1K9P A;  1XFW O;  1AJ4 A;  2LVV A;  1DJZ A;  5DKQ A;  3NSO A;  3I5F B;  1XFU O;  2NCP A;  2PMY A;  4P5O E;  1M63 B;  3BXK A;  1NX0 A;  3E3R A;  3KF9 A;  1UHK A;  3NSL A;  1BF5 A;  2B1U A;  2WC8 A;  3I5G B;  3AAJ A;  2H61 A;  1AUI B;  1LA0 A;  1XYD A;  1S3P A;  5KU1 A;  4USL A;  2EC6 B;  1AP4 A;  3BUX B;  1CLL A;  1VRK A;  3BUO B;  4CFR A;  1QVI Z;  1SMG A;  1FF1 A;  1XA5 A;  1LIN A;  2E6W A;  1FW4 A;  2JC2 A;  5D7F A;  1DVI A;  1KK7 Z;  4R1E A;  2MLF C;  5AFP A;  2BBN A;  2KAV A;  4PDZ A;  2ZRS A;  1IJ5 A;  1JF2 A;  1KQM B;  1EH2 A;  4MZL A;  2K2F A;  3FWB A;  3SJS A;  2F3Z A;  2L50 A;  5D69 A;  4A4C A;  1F8H A;  1CDP A;  2LHL A;  2H61 C;  1SL7 A;  1UUR A;  2EHB A;  2LAN A;  1KCY A;  2K7O A;  3QRX A;  2HQ8 A;  2JUL A;  1AK8 A;  3KEV A;  2LE9 B;  3OHM B;  3FWC A;  3SG5 A;  4XJK A;  4CID A;  2F3Y A;  2K7D A;  2LMV A;  1NP8 A;  3PN7 B;  3TS5 B;  4ETO A;  3SG7 A;  4YGD B;  4OKH A;  4CFQ A;  2KYF A;  1CDM A;  1J7R A;  3EVR A;  2HET A;  3HX4 A;  1XFV O;  1BU3 A;  3PAL A;  3TDU A;  4YI8 A;  1QJT A;  2M9G A;  2KQ6 A;  2JNX A;  4HRG A;  2COL B;  1YUU A;  4I5N B;  1E8A A;  2CBL A;  3KO0 A;  1GGW A;  3IQO A;  3JTD C;  3PAT A;  3I5I C;  4WQ2 A;  5FYX A;  3EVV A;  1WY9 A;  2I2R E;  4IL1 A;  1C7V A;  2L2E A;  1S1E A;  1JF0 A;  4PHJ A;  1SYM A;  1CDL A;  3EK7 A;  2JZI A;  5I2O A;  1QIV A;  3VRR A;  2K7C A;  1M45 A;  3DF0 A;  1IQ3 A;  4GGF A;  4YRU A;  3TUY C;  3A4U B;  1CFP A;  1JUO A;  3OX6 A;  2BCA A;  5HYD A;  2KOT A;  1U5I B;  1CMG A;  1QAT A;  2O5G A;  4ORC B;  1LVC D;  3KPX A;  3DVK A;  1SRA A;  1SR6 C;  2G2B A;  1QIW A;  2IS9 A;  4AOM A;  3LLE A;  2BEC A;  1WRZ A;  2AAO A;  1YRT B;  3TDZ A;  3GK4 X;  5TNC A;  3WHU B;  3WNX B;  2ISD A;  1BG1 A;  5G08 A;  3NSK A;  1TRF A;  2LCP A;  5B8I B;  2I94 A;  2BBM A;  2F2P A;  5HKZ A;  2JT0 A;  3O2P A;  3EK8 A;  3BYA A;  3DVE A;  5I2Q A;  1JFJ A;  4YI9 A;  1ZMZ A;  2H2K A;  2L98 A;  2CXJ A;  2KAY A;  3HCM A;  4NDD A;  5GQQ C;  5AEQ A;  3OP0 A;  5AXI A;  1R6P A;  1N2D A;  1YUT A;  2ZN8 A;  2JT3 A;  1BT6 A;  1H4B A;  2KHN A;  3AAK A;  1B7T Z;  1J7O A;  3D0Y B;  1K95 A;  4YGA A;  2L0P A;  5HLO A;  3VRO A;  2M3W A;  3EK4 A;  5K89 A;  3PSR A;  4GUK A;  3C1V A;  2GV5 A;  1ODB A;  1YTZ C;  2KBM A;  2LHI A;  1NSH A;  2M1U A;  2WOR A;  4I5J A;  1NX2 A;  2JNF A;  2NZ0 A;  4ZCV A;  2GGZ A;  1UWO A;  3BUN B;  2M97 A;  1SW8 A;  1REC A;  4PE0 A;  5AAN A;  4BY4 A;  4DUQ A;  1DJI A;  4P2Y B;  2Y5I A;  4FQO A;  1CKK A;  1A75 B;  1YUR A;  2PRU A;  1XFY O;  2Q4U A;  2KNE A;  1YVL A;  3TZ1 A;  2RGI A;  3PM8 A;  4OCI A;  3SIA A;  3EKJ A;  1K94 A;  2FOT A;  2HPS A;  3BOW A;  2NCO A;  4ICB A;  2K8M B;  1M46 A;  1NCZ A;  2LLS A;  1D1O A;  2M1K B;  3JVT C;  1YUS A;  2K0J A;  1LA3 A;  1QLK A;  2L5X B;  1DGU A;  4MZK A;  1L7Z A;  1QVI Y;  4JWQ A;  5I2L A;  1PVA A;  4I5L B;  3SG2 A;  3DD4 A;  4MRY A;  1B1G A; 
#chains in the Genus database with same CATH topology
 1C3Y A;  1NPQ A;  3B7A A;  1DF0 A;  3D78 A;  4OR9 B;  1IH0 A;  2O60 A;  3JTD B;  1QWV A;  1SL9 A;  4HSZ A;  1CLB A;  2FJU B;  4E68 A;  1J55 A;  1MR8 A;  1TOP A;  3BUW B;  2NLN A;  3I5I B;  4XJK B;  2MA2 A;  5HKY A;  1DEL A;  4GPL B;  1CM4 A;  2WC6 A;  2KBI A;  1OMV A;  1K9U A;  4MLW A;  2JXL A;  1RFJ A;  2CTN A;  1PK0 D;  1UHH A;  3S0D A;  3DVM A;  4GBA A;  2I18 A;  2LP3 A;  2M49 B;  1MUX A;  1PAL A;  2BAP A;  3CR5 X;  2KFH A;  3FE8 A;  3O4Y A;  5DIC A;  1BLQ A;  5ER5 A;  4QJ3 B;  1IWQ A;  2JOJ A;  1BJF A;  1DT7 B;  3FS7 A;  1QTX A;  2PYQ A;  4MEW A;  1TNQ A;  1GQM A;  2Q91 A;  2EGD A;  3CZT X;  4IJ7 A;  3VRQ A;  1Y6W A;  1S36 A;  3A8R A;  1TIZ A;  2LAP A;  2OTG B;  3CS1 A;  3CZ2 A;  3H4S E;  1F70 A;  2JQ6 A;  4Q04 A;  1QAS A;  1SR6 B;  1V1F A;  4GGN A;  4MRX A;  1EXR A;  1YX7 A;  4ZCU A;  3SG6 A;  3WHT B;  4MN0 A;  1GM0 A;  1SY9 A;  2H8V A;  2KFF A;  1SPY A;  5IBW A;  1WLM A;  1HQV A;  2BL0 C;  2WCM A;  4PE4 A;  5CPV A;  2JTZ A;  1F71 A;  1NX1 A;  3PJI A;  5PAL A;  1JWD A;  1QXP A;  1OQP A;  3LL8 B;  1FBV A;  2P6B B;  1C07 A;  4GNK B;  2KI4 C;  1NCX A;  2KDH A;  2QAC A;  4N5X A;  1K96 A;  1MF8 B;  1K8U A;  1WLZ A;  3PLF B;  1MHO A;  1SCM C;  1S5G Y;  1PUL A;  3CZ0 A;  2QEO A;  4JKT A;  4YBH B;  1S26 D;  3BFA A;  5CSJ A;  1B9A A;  4AQI A;  3NHI A;  1IQ5 A;  2F8P A;  1B4C A;  1MXL C;  2BE4 A;  1TTX A;  2ZFD A;  2KI6 D;  3CR4 X;  4PHM A;  4BY5 A;  1F54 A;  1L2O C;  1AVS A;  1G8I A;  1A4P A;  2E30 A;  1DMO A;  2YGU A;  3EG5 B;  1XK4 A;  1WRL A;  3O78 A;  1BMO A;  1B8L A;  1CLM A;  1JC2 A;  2KFG A;  1WDC C;  4I5K A;  2FJY A;  4PCW A;  4C0J A;  1CB1 A;  4GAO A;  2KGB C;  3ZNI A;  1DQE A;  4NQG A;  2M7L A;  1TNX A;  1KFU L;  2MAZ A;  1K93 D;  1C7W A;  1XVJ A;  3M0W A;  4INW A;  3BUM B;  2MRD A;  1G4Y R;  2MBX A;  4YGC B;  2WOS A;  2A4J A;  2OPO A;  1CFC A;  1SCV A;  4GGF C;  1G33 A;  1KQM C;  4L9M A;  2M29 A;  1T14 A;  2WCF A;  3CLN A;  1KK8 C;  4PT1 A;  2OS8 C;  1DC1 A;  1XK4 C;  1LKJ A;  1B7T Y;  3I5H C;  2LC5 A;  1FI6 A;  1TNP A;  1OZO A;  1RWY A;  4HRE E;  5CSN A;  3UNW A;  5AER A;  1ZFS A;  3IF7 A;  4WQ3 A;  3CGA A;  1CMF A;  4F7F A;  1TNW A;  2KAX A;  3AKA A;  1IRJ A;  1OOI X;  4ORA B;  1DEK A;  3D73 A;  4DCK A;  2KLE A;  3KHE A;  2V53 A;  1NUB A;  1GJY A;  2K60 A;  1RRO A;  3K1E A;  1KFU S;  4PHK A;  3AKB A;  5J3X A;  3EVU A;  3B6X A;  1TCF A;  4MSP A;  5DKN A;  2GTE A;  2LVI A;  1MQ1 A;  3VGO A;  1TCO B;  1NYA A;  2F2O A;  4DRW A;  3EKH A;  1YVH A;  4PE1 A;  1CNP A;  2LNK A;  3IQQ A;  3LK0 A;  3CDN A;  1J1D A;  1S6C A;  4QJ5 B;  1IKU A;  2JWW A;  5DKR A;  1B47 A;  1K90 D;  3D10 A;  5KTY A;  2Y1N A;  2MHH A;  3OBV A;  4FTG A;  4MBE A;  5HLV A;  3RM1 A;  1KWO C;  2L2C A;  3S0B A;  3S0F A;  3GK2 A;  2LMT A;  3CTN A;  1DJG A;  1DJW A;  4C0L A;  1B8R A;  2LP2 A;  4QJ4 B;  1BR4 B;  1WRK A;  4GFT A;  4DIR A;  1QV1 A;  1PSR A;  1CM1 A;  3ZWH A;  5CSF A;  2KI4 B;  3OX5 A;  1XFZ O;  2BCB A;  3PFV A;  1FI5 A;  5ER4 X;  3S0G A;  1KK7 Y;  2LLT A;  1UHN A;  3O6B A;  1J7P A;  1OE9 B;  1TN4 A;  1CDN A;  1SCM B;  5KSZ A;  5HL1 A;  3B88 A;  2BKH B;  3CWG A;  2DOQ A;  3LCP C;  1DJY A;  3B86 A;  1K9K A;  1KSM A;  1R2U A;  2WCH A;  3MSE B;  1L2O B;  2SAS A;  1MWN A;  3GK1 A;  1BOD A;  4M2Q A;  1UUS A;  1A2X A;  1DTL A;  2FCD A;  1DJH A;  1ORG A;  1EG3 A;  2MJW B;  2PAS A;  1F4Q A;  3NHT A;  1NWD A;  4A4B A;  1OMD A;  1BOC A;  1QX7 A;  3NGV A;  5JOL A;  2P71 A;  1HT9 A;  1N0Y A;  2WCB A;  1A75 A;  2WND A;  3GOF A;  2PSR A;  1F55 A;  1H8B A;  2LMU A;  2M7N A;  1NCY A;  2AMI A;  1WDC B;  1QV0 A;  1XO5 A;  2KPH A;  1ALV A;  2QPT A;  2M0R A;  3NXA A;  4WRI A;  3DXL A;  1RTP 1;  2L4H A;  1SL8 A;  1SNL A;  4MVF A;  2HF5 A;  1AJ5 A;  3R72 A;  4ORB B;  1Y0V H;  3V2L A;  2G9B A;  1KFX S;  3OB2 B;  2GGM A;  4OV2 A;  3DF0 B;  2I7A A;  1OZS A;  2CT9 A;  1F4O A;  1KK8 B;  2OS8 B;  3LK1 A;  3SG4 A;  1JFK A;  2LUX A;  4U8D A;  5HKW A;  3I5H B;  2BKI B;  3R1V A;  2K61 A;  3WXA A;  2JTT A;  3R1O A;  3VRP A;  1PRW A;  1QS7 A;  2JT8 A;  1SK6 D;  2L4I A;  2VRG A;  3VRN A;  4PE7 A;  3I5F C;  1NIW A;  2K7B A;  4MZJ A;  1OMR A;  3ICB A;  2KSP A;  2HQW A;  1JBA A;  1OOJ A;  2D8N A;  2KI6 C;  4F0Z B;  4UPG A;  1NX3 A;  2CCM A;  1PVB A;  1EL4 A;  2M8U A;  2K2A A;  2CNP A;  3I5G C;  5F6T A;  1ZOT B;  2ZN9 A;  1XFX O;  1UHI A;  2EC6 C;  1IJ6 A;  1EJ3 A;  2LVJ A;  2JPT A;  3DVJ A;  1IG5 A;  2KYC A;  4N1F A;  1A03 A;  3BQ3 A;  1RJV A;  1SBJ A;  4JPZ B;  5FI7 A;  5I8N A;  1M39 A;  1S6J A;  1CTR A;  2MLE C;  1S5G Z;  2Y4Q A;  1KQV A;  3BFB A;  3CZ1 A;  3JVT B;  4CLN A;  1CFF A;  1KWO B;  2NXQ A;  5I94 A;  1QLS A;  1OSA A;  4DS7 A;  3OB1 B;  1A29 A;  1LXF C;  1ZUZ A;  3K21 A;  2OTG C;  1YR5 A;  4HRH A;  1SKT A;  2LV7 A;  3NSI A;  4TNC A;  4XYN A;  4D1E A;  2SCP A;  4FQT A;  3PN7 C;  3TS5 C;  2R2I A;  2ZND A;  1W7J B;  1YX8 A;  2WCE A;  1UP5 A;  1Q80 A;  1S6I A;  1K2H A;  4NDC A;  1QX2 A;  1YRU B;  1KSO A;  5BPJ A;  1Z4H A;  3VB1 A;  3O4X A;  1XFR A;  4C0K A;  3BOW B;  2ZKM X;  4CPV A;  1OOG A;  2F33 A;  4M2P A;  4N1G A;  1U5I A;  1M31 A;  3Q8I A;  1V1G A;  2KQY A;  2PAL A;  2ZRT A;  2AUC A;  4AQJ A;  4PHN A;  1EG4 A;  1QX5 B;  2BCX A;  3D74 A;  3L47 A;  3SIB A;  1FPW A;  5JJG A;  1BR1 B;  2LLU A;  2L51 A;  3RLZ A;  4NDB A;  1TUJ A;  3CR2 A;  4PAL A;  2FCE A;  1DGV A;  1MXE A;  1DF0 B;  2JRF A;  2ZNE A;  1X02 A;  1PSB A;  3DZT A;  1Y1A A;  1GGZ A;  1OOH A;  1TUZ A;  1ZAC A;  1Y1X A;  1RK9 A;  2LUC A;  2QDI A;  3QME A;  4JD9 A;  5CSI A;  3SS5 A;  3SG3 A;  2BL0 B;  2JU0 A;  1W7I B;  1IGV A;  1AHR A;  2KGR A;  4MRY A;  4YGE B;  4AOM A;  2LVK A;  4M2O A;  2WCL A;  1JSA A;  3D77 A;  1DJX A;  4OVN F;  1J7Q A;  1UHJ A;  2LM5 A;  1Y1U A;  1SSE B;  3FIA A;  1KFX L;  3CAB A;  1ALW A;  2BE6 A;  2JXC A;  2P70 A;  1N65 A;  2Y1M A;  3D0Y A;  1CFD A;  1B8C A;  3F45 A;  4JQ0 D;  1J1E A;  3SS4 A;  3TDI A;  2PVB A;  2TN4 A;  1K9P A;  1XFW O;  1AJ4 A;  2LVV A;  1DJZ A;  5DKQ A;  3NSO A;  3I5F B;  3S0E A;  1XFU O;  2NCP A;  2PMY A;  4P5O E;  1M63 B;  3BXK A;  1NX0 A;  3E3R A;  3KF9 A;  1UHK A;  3NSL A;  1BF5 A;  2B1U A;  2WC8 A;  1OOF A;  3I5G B;  3PM2 A;  3AAJ A;  2H61 A;  1AUI B;  1LA0 A;  1XYD A;  1S3P A;  5KU1 A;  4USL A;  2EC6 B;  1AP4 A;  3BUX B;  1CLL A;  1VRK A;  3BUO B;  4CFR A;  1QVI Z;  1SMG A;  1FF1 A;  1XA5 A;  1LIN A;  2E6W A;  1FW4 A;  2JC2 A;  2QEB A;  1DVI A;  1KK7 Z;  4R1E A;  5D7F A;  2MLF C;  5AFP A;  2BBN A;  2KAV A;  4PDZ A;  4YGB B;  5FI6 A;  5FI2 A;  2ZRS A;  1IJ5 A;  1JF2 A;  1KQM B;  1EH2 A;  4MZL A;  2K2F A;  3FWB A;  3SJS A;  2F3Z A;  2L50 A;  5D69 A;  4A4C A;  1F8H A;  1CDP A;  2LHL A;  2H61 C;  1SL7 A;  1UUR A;  2EHB A;  2LAN A;  1KCY A;  2K7O A;  3QRX A;  2HQ8 A;  2JUL A;  2WC5 A;  1AK8 A;  3KEV A;  2LE9 B;  3OHM B;  3FWC A;  3SG5 A;  4XJK A;  4CID A;  2F3Y A;  2K7D A;  2LMV A;  1NP8 A;  2PQL A;  3PN7 B;  3TS5 B;  4ETO A;  3SG7 A;  4YGD B;  2KLD A;  4OKH A;  4CFQ A;  2KYF A;  1CDM A;  3R1P A;  1J7R A;  3EVR A;  2HET A;  3HX4 A;  1TWO A;  3DY9 A;  4INX A;  1XFV O;  3L4A A;  1BU3 A;  3PAL A;  2QEH A;  4YI8 A;  1QJT A;  3TDU A;  2M9G A;  2KQ6 A;  2JNX A;  4HRG A;  4KYN A;  2COL B;  1YUU A;  3S0A A;  4I5N B;  1E8A A;  2CBL A;  3KO0 A;  3CYZ A;  1GGW A;  3IQO A;  3JTD C;  3PAT A;  2WCJ A;  3I5I C;  3L4L A;  4WQ2 A;  3EVV A;  1WY9 A;  5FYX A;  1W9Z A;  2I2R E;  4IL1 A;  1C7V A;  2L2E A;  1S1E A;  1JF0 A;  4PHJ A;  5D3O A;  3B87 A;  1SYM A;  1CDL A;  3EK7 A;  2JZI A;  5I2O A;  1QIV A;  3VRR A;  2K7C A;  1M45 A;  3DF0 A;  1IQ3 A;  4GGF A;  4YRU A;  3TUY C;  3A4U B;  1CFP A;  1JUO A;  3OX6 A;  2BCA A;  5HYD A;  2KOT A;  1U5I B;  1CMG A;  2JPO A;  1QAT A;  2O5G A;  4ORC B;  1LVC D;  3IVT A;  3SS3 A;  3KPX A;  3DVK A;  1SRA A;  1SR6 C;  2G2B A;  3RZS A;  1QIW A;  2IS9 A;  3OGN A;  1Z2C B;  2BEC A;  3LLE A;  1WRZ A;  1YRT B;  2AAO A;  4OZD A;  3GK4 X;  5EL2 A;  5TNC A;  3TDZ A;  3WHU B;  3WNX B;  2ISD A;  1BG1 A;  5G08 A;  3NSK A;  1TRF A;  3BFH A;  2LCP A;  5B8I B;  2I94 A;  2BBM A;  2F2P A;  5HKZ A;  2JT0 A;  3O2P A;  3EK8 A;  3BYA A;  3DVE A;  2WCK A;  5I2Q A;  1JFJ A;  4YI9 A;  1C3Z A;  1ZMZ A;  2H2K A;  2L98 A;  2CXJ A;  2KAY A;  3BJH A;  3HCM A;  4NDD A;  5GQQ C;  5AEQ A;  3OP0 A;  5AXI A;  1R6P A;  1N2D A;  1YUT A;  2ZN8 A;  2JT3 A;  1LS8 A;  1BT6 A;  1H4B A;  2KHN A;  3AAK A;  1B7T Z;  1J7O A;  3D0Y B;  3DYE A;  3D76 A;  1K95 A;  2BNX A;  4YGA A;  3D75 A;  2L0P A;  5HLO A;  3VRO A;  2M3W A;  3EK4 A;  5K89 A;  3PSR A;  4GUK A;  3C1V A;  2GV5 A;  1ODB A;  1YTZ C;  2KBM A;  2LHI A;  1NSH A;  2M1U A;  2WOR A;  3UO9 A;  1IIO A;  4I5J A;  1NX2 A;  2JNF A;  2NZ0 A;  4ZCV A;  2GGZ A;  1UWO A;  3BUN B;  2M97 A;  1SW8 A;  1REC A;  4PE0 A;  5AAN A;  4BY4 A;  4DUQ A;  1DJI A;  4P2Y B;  2Y5I A;  4FQO A;  1CKK A;  3TUY B;  1A75 B;  1YUR A;  2PRU A;  1XFY O;  2Q4U A;  2KNE A;  1YVL A;  3FE9 A;  3TZ1 A;  2RGI A;  3PM8 A;  4OCI A;  3SIA A;  1P28 A;  3EKJ A;  1K94 A;  2FOT A;  2HPS A;  3BOW A;  2NCO A;  4ICB A;  2ERB A;  2K8M B;  3N7H A;  1M46 A;  1NCZ A;  2LLS A;  1D1O A;  2M1K B;  3JVT C;  3FE6 A;  1YUS A;  2K0J A;  1LA3 A;  1QLK A;  2L5X B;  1DGU A;  4MZK A;  1L7Z A;  1OW4 A;  1QVI Y;  4JWQ A;  5I2L A;  1PVA A;  2L5Y A;  4I5L B;  3SG2 A;  3DD4 A;  2QEV A;  1B1G A; 
#chains in the Genus database with same CATH homology
 1NPQ A;  1DF0 A;  4OR9 B;  1IH0 A;  2O60 A;  3JTD B;  1SL9 A;  4HSZ A;  1CLB A;  2FJU B;  4E68 A;  1J55 A;  1MR8 A;  1TOP A;  3BUW B;  2NLN A;  3I5I B;  4XJK B;  2MA2 A;  5HKY A;  4GPL B;  1CM4 A;  2KBI A;  1OMV A;  1K9U A;  4MLW A;  2JXL A;  1RFJ A;  2CTN A;  1PK0 D;  1UHH A;  3DVM A;  4GBA A;  2I18 A;  2LP3 A;  2M49 B;  1MUX A;  1PAL A;  3O4Y A;  3CR5 X;  2KFH A;  3TUY B;  1BLQ A;  5ER5 A;  4QJ3 B;  1IWQ A;  2JOJ A;  1BJF A;  1DT7 B;  3FS7 A;  1QTX A;  4MEW A;  1TNQ A;  1GQM A;  2Q91 A;  2EGD A;  3CZT X;  3VRQ A;  1Y6W A;  1S36 A;  3A8R A;  1TIZ A;  2LAP A;  2OTG B;  3CS1 A;  3H4S E;  1F70 A;  2JQ6 A;  4Q04 A;  1QAS A;  1SR6 B;  1V1F A;  4GGN A;  4MRX A;  1EXR A;  1YX7 A;  4ZCU A;  3SG6 A;  3WHT B;  4MN0 A;  1SY9 A;  2KFF A;  1SPY A;  5IBW A;  1WLM A;  1HQV A;  2BL0 C;  4PE4 A;  5CPV A;  2JTZ A;  1F71 A;  1NX1 A;  5PAL A;  1JWD A;  1QXP A;  1OQP A;  3LL8 B;  1FBV A;  2P6B B;  1C07 A;  4GNK B;  2KI4 C;  1NCX A;  2KDH A;  2QAC A;  4N5X A;  1K96 A;  1MF8 B;  1K8U A;  1WLZ A;  3PLF B;  1MHO A;  1SCM C;  1S5G Y;  1PUL A;  4YBH B;  1S26 D;  5CSJ A;  1B9A A;  4AQI A;  1IQ5 A;  2F8P A;  1B4C A;  1MXL C;  2BE4 A;  1TTX A;  2ZFD A;  2KI6 D;  3CR4 X;  4PHM A;  4BY5 A;  1F54 A;  1L2O C;  1AVS A;  1G8I A;  1A4P A;  2E30 A;  1DMO A;  1XK4 A;  1WRL A;  3O78 A;  1BMO A;  1B8L A;  1CLM A;  1JC2 A;  2KFG A;  1WDC C;  4I5K A;  4PCW A;  4C0J A;  1CB1 A;  4GAO A;  2KGB C;  3ZNI A;  4NQG A;  2M7L A;  1TNX A;  1KFU L;  2MAZ A;  1K93 D;  1C7W A;  1XVJ A;  3M0W A;  3BUM B;  2MRD A;  1G4Y R;  2MBX A;  4YGC B;  2WOS A;  2A4J A;  2OPO A;  1CFC A;  1SCV A;  4GGF C;  1G33 A;  1KQM C;  4L9M A;  2M29 A;  2WCF A;  3CLN A;  1KK8 C;  2OS8 C;  1XK4 C;  1LKJ A;  1B7T Y;  3I5H C;  2LC5 A;  1FI6 A;  1TNP A;  1OZO A;  1RWY A;  4HRE E;  5CSN A;  5AER A;  1ZFS A;  3IF7 A;  4WQ3 A;  3CGA A;  1CMF A;  1TNW A;  2KAX A;  3AKA A;  1IRJ A;  4ORA B;  4DCK A;  3KHE A;  2V53 A;  1NUB A;  1GJY A;  1RRO A;  1KFU S;  4PHK A;  3AKB A;  5J3X A;  3EVU A;  4MSP A;  1TCF A;  5DKN A;  2LVI A;  1MQ1 A;  3VGO A;  1TCO B;  1NYA A;  2F2O A;  4DRW A;  3EKH A;  1YVH A;  4PE1 A;  1CNP A;  2LNK A;  3IQQ A;  3LK0 A;  1J1D A;  1S6C A;  4QJ5 B;  1IKU A;  2JWW A;  5DKR A;  1B47 A;  1K90 D;  3D10 A;  5KTY A;  2Y1N A;  2MHH A;  4FTG A;  4MBE A;  5HLV A;  3RM1 A;  1KWO C;  3GK2 A;  2LMT A;  3CTN A;  1DJG A;  1DJW A;  4C0L A;  1B8R A;  2LP2 A;  4QJ4 B;  1BR4 B;  1WRK A;  4GFT A;  4DIR A;  1QV1 A;  1PSR A;  1CM1 A;  3ZWH A;  5CSF A;  2KI4 B;  3OX5 A;  1XFZ O;  2BCB A;  3PFV A;  1FI5 A;  5ER4 X;  1KK7 Y;  2LLT A;  1UHN A;  3O6B A;  1J7P A;  1OE9 B;  1TN4 A;  1CDN A;  1SCM B;  5KSZ A;  2BKH B;  3CWG A;  2DOQ A;  3LCP C;  1DJY A;  1K9K A;  1KSM A;  1R2U A;  3MSE B;  1L2O B;  2SAS A;  1MWN A;  3GK1 A;  1BOD A;  4M2Q A;  1UUS A;  1A2X A;  1DTL A;  2FCD A;  1DJH A;  2PAS A;  1EG3 A;  2MJW B;  4YGB B;  1F4Q A;  4A4B A;  1NWD A;  1BOC A;  1OMD A;  1QX7 A;  5JOL A;  1HT9 A;  1N0Y A;  2WCB A;  1A75 A;  2WND A;  3GOF A;  2PSR A;  1F55 A;  1H8B A;  2LMU A;  2M7N A;  1NCY A;  2AMI A;  1WDC B;  1QV0 A;  1XO5 A;  1ALV A;  2QPT A;  2M0R A;  3NXA A;  4WRI A;  1RTP 1;  2L4H A;  1SL8 A;  1SNL A;  4MVF A;  2HF5 A;  1AJ5 A;  4ORB B;  1Y0V H;  2G9B A;  1KFX S;  3OB2 B;  2GGM A;  4OV2 A;  3DF0 B;  2I7A A;  1OZS A;  2CT9 A;  1F4O A;  1KK8 B;  2OS8 B;  3LK1 A;  3SG4 A;  1JFK A;  2LUX A;  4U8D A;  5HKW A;  3I5H B;  2BKI B;  2K61 A;  3WXA A;  2JTT A;  3VRP A;  1PRW A;  1QS7 A;  2JT8 A;  1SK6 D;  2L4I A;  2VRG A;  3VRN A;  4PE7 A;  3I5F C;  1NIW A;  2K7B A;  4MZJ A;  1OMR A;  3ICB A;  2KSP A;  2HQW A;  1JBA A;  1OOJ A;  2D8N A;  2KI6 C;  4F0Z B;  4UPG A;  1NX3 A;  2CCM A;  1PVB A;  1EL4 A;  2M8U A;  2K2A A;  2CNP A;  3I5G C;  5F6T A;  1ZOT B;  2ZN9 A;  1XFX O;  1UHI A;  2EC6 C;  1IJ6 A;  1EJ3 A;  2LVJ A;  2JPT A;  3DVJ A;  1IG5 A;  2KYC A;  4N1F A;  1A03 A;  3BQ3 A;  1RJV A;  1SBJ A;  4JPZ B;  5I8N A;  1M39 A;  1S6J A;  1CTR A;  2MLE C;  1S5G Z;  2Y4Q A;  1KQV A;  3JVT B;  4CLN A;  1CFF A;  1KWO B;  2NXQ A;  1QLS A;  1OSA A;  4DS7 A;  3OB1 B;  1A29 A;  1LXF C;  1ZUZ A;  3K21 A;  2OTG C;  1YR5 A;  4HRH A;  1SKT A;  2LV7 A;  3NSI A;  4TNC A;  4XYN A;  4D1E A;  2SCP A;  3PN7 C;  3TS5 C;  2R2I A;  2ZND A;  1W7J B;  1YX8 A;  2WCE A;  1UP5 A;  1Q80 A;  1S6I A;  1K2H A;  4NDC A;  1QX2 A;  1YRU B;  1KSO A;  5BPJ A;  4C0K A;  3BOW B;  2ZKM X;  4CPV A;  2F33 A;  4M2P A;  4N1G A;  1U5I A;  1M31 A;  1V1G A;  2KQY A;  2PAL A;  2ZRT A;  2AUC A;  4AQJ A;  4PHN A;  1EG4 A;  1QX5 B;  2BCX A;  3SIB A;  1FPW A;  5JJG A;  1BR1 B;  2LLU A;  2L51 A;  3RLZ A;  4NDB A;  3CR2 A;  4PAL A;  2FCE A;  1DGV A;  1MXE A;  1DF0 B;  2JRF A;  2ZNE A;  1X02 A;  1PSB A;  1Y1A A;  1GGZ A;  1ZAC A;  1Y1X A;  1RK9 A;  2LUC A;  5CSI A;  3SG3 A;  2BL0 B;  2JU0 A;  1W7I B;  1IGV A;  1AHR A;  2KGR A;  4YGE B;  2LVK A;  4M2O A;  1JSA A;  1DJX A;  4OVN F;  1J7Q A;  1UHJ A;  2LM5 A;  1Y1U A;  3FIA A;  1KFX L;  1ALW A;  2BE6 A;  2JXC A;  2Y1M A;  1N65 A;  3D0Y A;  3F45 A;  1CFD A;  1B8C A;  3TDI A;  4JQ0 D;  1J1E A;  2PVB A;  2TN4 A;  1K9P A;  1XFW O;  1AJ4 A;  2LVV A;  1DJZ A;  5DKQ A;  3NSO A;  3I5F B;  1XFU O;  2NCP A;  2PMY A;  4P5O E;  1M63 B;  3BXK A;  1NX0 A;  3E3R A;  3KF9 A;  1UHK A;  3NSL A;  1BF5 A;  2B1U A;  2WC8 A;  3I5G B;  3AAJ A;  2H61 A;  1AUI B;  1LA0 A;  1XYD A;  1S3P A;  5KU1 A;  4USL A;  2EC6 B;  1AP4 A;  3BUX B;  1CLL A;  1VRK A;  3BUO B;  4CFR A;  1QVI Z;  1SMG A;  1FF1 A;  1XA5 A;  1LIN A;  2E6W A;  1FW4 A;  2JC2 A;  5D7F A;  1DVI A;  1KK7 Z;  4R1E A;  2MLF C;  5AFP A;  2BBN A;  2KAV A;  4PDZ A;  2ZRS A;  1IJ5 A;  1JF2 A;  1KQM B;  1EH2 A;  4MZL A;  2K2F A;  3FWB A;  3SJS A;  2F3Z A;  2L50 A;  5D69 A;  4A4C A;  1F8H A;  1CDP A;  2LHL A;  2H61 C;  1SL7 A;  1UUR A;  2EHB A;  2LAN A;  1KCY A;  2K7O A;  3QRX A;  2HQ8 A;  2JUL A;  1AK8 A;  3KEV A;  2LE9 B;  3OHM B;  3FWC A;  3SG5 A;  4XJK A;  4CID A;  2F3Y A;  2K7D A;  2LMV A;  1NP8 A;  3PN7 B;  3TS5 B;  4ETO A;  3SG7 A;  4YGD B;  4OKH A;  4CFQ A;  2KYF A;  1CDM A;  1J7R A;  3EVR A;  2HET A;  3HX4 A;  1XFV O;  1BU3 A;  3PAL A;  3TDU A;  4YI8 A;  1QJT A;  2M9G A;  2KQ6 A;  2JNX A;  4HRG A;  2COL B;  1YUU A;  4I5N B;  1E8A A;  2CBL A;  3KO0 A;  1GGW A;  3IQO A;  3JTD C;  3PAT A;  3I5I C;  4WQ2 A;  5FYX A;  3EVV A;  1WY9 A;  2I2R E;  4IL1 A;  1C7V A;  2L2E A;  1S1E A;  1JF0 A;  4PHJ A;  1SYM A;  1CDL A;  3EK7 A;  2JZI A;  5I2O A;  1QIV A;  3VRR A;  2K7C A;  1M45 A;  3DF0 A;  1IQ3 A;  4GGF A;  4YRU A;  3TUY C;  3A4U B;  1CFP A;  1JUO A;  3OX6 A;  2BCA A;  5HYD A;  2KOT A;  1U5I B;  1CMG A;  1QAT A;  2O5G A;  4ORC B;  1LVC D;  3KPX A;  3DVK A;  1SRA A;  1SR6 C;  2G2B A;  1QIW A;  2IS9 A;  4AOM A;  3LLE A;  2BEC A;  1WRZ A;  2AAO A;  1YRT B;  3TDZ A;  3GK4 X;  5TNC A;  3WHU B;  3WNX B;  2ISD A;  1BG1 A;  5G08 A;  3NSK A;  1TRF A;  2LCP A;  5B8I B;  2I94 A;  2BBM A;  2F2P A;  5HKZ A;  2JT0 A;  3O2P A;  3EK8 A;  3BYA A;  3DVE A;  5I2Q A;  1JFJ A;  4YI9 A;  1ZMZ A;  2H2K A;  2L98 A;  2CXJ A;  2KAY A;  3HCM A;  4NDD A;  5GQQ C;  5AEQ A;  3OP0 A;  5AXI A;  1R6P A;  1N2D A;  1YUT A;  2ZN8 A;  2JT3 A;  1BT6 A;  1H4B A;  2KHN A;  3AAK A;  1B7T Z;  1J7O A;  3D0Y B;  1K95 A;  4YGA A;  2L0P A;  5HLO A;  3VRO A;  2M3W A;  3EK4 A;  5K89 A;  3PSR A;  4GUK A;  3C1V A;  2GV5 A;  1ODB A;  1YTZ C;  2KBM A;  2LHI A;  1NSH A;  2M1U A;  2WOR A;  4I5J A;  1NX2 A;  2JNF A;  2NZ0 A;  4ZCV A;  2GGZ A;  1UWO A;  3BUN B;  2M97 A;  1SW8 A;  1REC A;  4PE0 A;  5AAN A;  4BY4 A;  4DUQ A;  1DJI A;  4P2Y B;  2Y5I A;  4FQO A;  1CKK A;  1A75 B;  1YUR A;  2PRU A;  1XFY O;  2Q4U A;  2KNE A;  1YVL A;  3TZ1 A;  2RGI A;  3PM8 A;  4OCI A;  3SIA A;  3EKJ A;  1K94 A;  2FOT A;  2HPS A;  3BOW A;  2NCO A;  4ICB A;  2K8M B;  1M46 A;  1NCZ A;  2LLS A;  1D1O A;  2M1K B;  3JVT C;  1YUS A;  2K0J A;  1LA3 A;  1QLK A;  2L5X B;  1DGU A;  4MZK A;  1L7Z A;  1QVI Y;  4JWQ A;  5I2L A;  1PVA A;  4I5L B;  3SG2 A;  3DD4 A;  4MRY A;  1B1G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...