1OSAA

Crystal structure of recombinant paramecium tetraurelia calmodulin at 1.68 angstroms resolution
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
148
structure length
148
Chain Sequence
AEQLTEEQIAEFKEAFALFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLSLMARKMKEQDSEEELIEAFKVFDRDGNGLISAAELRHVMTNLGEKLTDDEVDEMIREADIDGDGHINYEEFVRMMVSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CALMODULIN
publication title Structure of the recombinant Paramecium tetraurelia calmodulin at 1.68 A resolution.
pubmed doi rcsb
source organism Paramecium tetraurelia
molecule tags Calcium-binding protein
total genus 53
structure length 148
sequence length 148
ec nomenclature
pdb deposition date 1993-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1osaA01
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1osaA02
2OS8C 1DVIA 2GGMA 1J7PA 1OE9B 1KWOC 1YTZC 2JTTA 4YRUA 1S6JA 3GK2A 2HF5A 1DGVA 1AK8A 1LXFC 2GV5A 2MA2A 1GGWA 1S3PA 1HT9A 1F54A 1RTP1 2KI6C 1QATA 2AMIA 3KEVA 5CPVA 3A8RA 2JXLA 2L5XB 2L0PA 1XYDA 1L7ZA 1EG4A 3FIAA 1K96A 3I5GB 4N5XA 5I2LA 4NDBA 1XFYO 1NX1A 1NUBA 2BCBA 3O78A 1YX7A 1JWDA 2DOQA 2JT3A 4YI8A 1QIVA 4XYNA 1QVIY 5I2OA 1SPYA 1DJWA 4DCKA 1RROA 3I5IC 1OMVA 3O2PA 2F3ZA 3EVVA 4IL1A 2MBXA 1C7VA 1A4PA 1YURA 2JOJA 1M63B 5HKYA 5DKRA 1WRLA 4YGCB 4I5JA 1CLBA 1SNLA 2NXQA 4MZJA 1FF1A 4MVFA 1N65A 1XFXO 4E68A 2HQWA 1OOJA 2LUXA 2WOSA 1N2DA 1QV0A 2ZNDA 2A4JA 4ORBB 5D69A 4I5NB 2F2OA 4DS7A 3NSIA 3TDZA 1R2UA 3JTDC 3SG2A 1V1GA 2KBIA 5AFPA 5I2QA 2M97A 3KF9A 4AQIA 1EXRA 1AJ4A 1PULA 2WCBA 1IQ3A 2BKHB 2FCEA 3JVTC 4PCWA 1EH2A 4AQJA 5HLOA 1R6PA 2Y4QA 3F45A 5KSZA 4MLWA 1Y6WA 1B7TY 1A29A 1F4OA 2NZ0A 2I94A 1ZACA 1PVBA 1S6CA 2JC2A 2LM5A 4L9MA 1XVJA 2H61C 2ZKMX 2WNDA 1ZFSA 1BJFA 1F70A 1JF0A 2LC5A 1WLZA 3O6BA 1LINA 3TS5B 4PE1A 5KTYA 2K7BA 1TIZA 3EVRA 1CDMA 3FS7A 1W7JB 1NSHA 3KHEA 4HRHA 2LHIA 3I5HB 1KSOA 2LLSA 2BCAA 1EL4A 4OKHA 1V1FA 1K95A 2ZRTA 1WLMA 3DVMA 1CLLA 1Y1UA 2L4HA 3PN7C 1NWDA 1XA5A 1DF0B 3AAJA 1AVSA 3BOWB 3SIBA 2JULA 4BY5A 1AP4A 3CS1A 3CR4X 1NX2A 4P2YB 3EK8A 1TCFA 1IQ5A 1SRAA 1YUTA 2KYFA 1JC2A 2BE6A 1PSBA 2M1UA 5FYXA 4FTGA 1J1EA 1CB1A 1DJHA 1QX5B 1YUSA 2NCPA 2LNKA 2EHBA 1BMOA 1LKJA 4GAOA 2KQ6A 5AANA 3NSKA 1DMOA 1FI5A 1FW4A 1K9UA 5G08A 2HETA 3SG5A 3FWBA 4C0JA 1UHNA 1KK8C 2JWWA 2SCPA 3WXAA 5KU1A 2K2AA 1M31A 3OP0A 1YRTB 3PALA 2LVVA 1BT6A 1SK6D 1TCOB 2K61A 1A2XA 4GGNA 1MXLC 1M45A 1MQ1A 1WDCC 4PHKA 1XO5A 3LL8B 1BR1B 2LP2A 4XJKA 1QX7A 1NCXA 1IRJA 2JQ6A 4CFQA 2KI6D 1CMFA 3CLNA 2KFGA 1OQPA 2ZFDA 4YBHB 1CLMA 2LE9B 1HQVA 2LAPA 4QJ4B 1QIWA 2JT0A 4PHNA 2BECA 1SBJA 4JWQA 1NYAA 1S5GY 2L4IA 2LHLA 2MRDA 2LMVA 4MEWA 2F33A 2I7AA 2WORA 1CFFA 4GGFA 3VRNA 1H4BA 1M39A 1SYMA 3FWCA 4N1FA 3ZNIA 3GOFA 1CTRA 1UURA 2ISDA 1SCVA 4MSPA 5CSFA 2LVJA 5F6TA 2H2KA 1EJ3A 2CT9A 1TN4A 3SIAA 4CPVA 2VRGA 1B8LA 3OHMB 1A03A 1CDPA 2RGIA 1ODBA 1J7RA 3TUYC 1IKUA 1B8CA 1C07A 1GGZA 3QRXA 4ORAB 4AOMA 2JRFA 3BUXB 2M0RA 4PHJA 4ETOA 3O4YA 1UWOA 1SL7A 1UHIA 1SCMC 2COLB 2PALA 4JQ0D 1OZSA 1FPWA 1E8AA 4Q04A 3AKAA 3LLEA 5DKNA 5HKWA 1KK7Z 2WC8A 5K89A 1DTLA 1SMGA 2L2EA 3ICBA 1CM1A 2LVKA 1KQMB 2Y5IA 2KFHA 1IJ6A 1WRZA 2P6BB 2R2IA 1QTXA 2KI4B 3JVTB 2JPTA 1PK0D 3EVUA 1SR6B 4P5OE 4GGFC 4HSZA 5DKQA 4HRGA 3SG4A 4JPZB 4ORCB 4GBAA 3I5FC 5ER5A 1XFZO 1LVCD 2JTZA 2CBLA 4CIDA 3VROA 1ALWA 2MLFC 2I2RE 2M7NA 4QJ5B 3I5GC 2PVBA 1QVIZ 1ZMZA 3NXAA 2F2PA 1Y1XA 1J1DA 1TNPA 3A4UB 3DVJA 1NIWA 2LMTA 1Y1AA 1WY9A 3EK4A 3LK1A 4DUQA 4F0ZB 1W7IB 4PE7A 2CTNA 3PFVA 3PLFB 4ICBA 2F3YA 1FBVA 4N1GA 1B9AA 1PALA 2KHNA 5PALA 3IF7A 1UHKA 1OMRA 5ER4X 1DJZA 1UHJA 2Q4UA 1A75B 2LANA 1SL9A 2HPSA 2M8UA 2OTGB 3KPXA 2TN4A 1XK4A 2ZRSA 1TNQA 1BR4B 4CLNA 2KAVA 1J55A 2ZNEA 3PM8A 4C0KA 1DF0A 1OZOA 3BOWA 2NLNA 1TNWA 2BBNA 1KFUL 2PSRA 1JFJA 2M3WA 2Q91A 4DRWA 1Y0VH 3DF0B 4GUKA 1B7TZ 3VGOA 3DVKA 4R1EA 2LVIA 2O5GA 1X02A 5I8NA 1WRKA 2LLUA 2M1KB 4D1EA 1SY9A 2FOTA 1AJ5A 1MUXA 1B47A 1UP5A 2CXJA 2K2FA 4HREE 1CM4A 2Y1MA 4I5KA 1DJIA 1PVAA 4PDZA 4FQOA 3TS5C 3H4SE 2KOTA 2BL0B 2HQ8A 2L51A 3EKHA 1TOPA 3NSLA 3VRRA 3I5HC 1JF2A 1CDLA 3BUNB 5HYDA 2K8MB 3CGAA 1NX0A 2WCEA 2OS8B 4OV2A 2G2BA 1D1OA 1BF5A 1CDNA 1YUUA 4OVNF 1KWOB 1EG3A 1G33A 1XFVO 3BQ3A 1S1EA 3MSEB 5B8IB 1YVLA 1MR8A 3TDUA 3VRPA 1RECA 4YGDB 2GGZA 2KGBC 1SL8A 1M46A 1QS7A 2O60A 2CNPA 1PRWA 2BBMA 1IJ5A 2V53A 5HKZA 1Q80A 2EC6C 2KYCA 2FCDA 1QV1A 1ZOTB 4NDDA 2LMUA 1MHOA 1L2OC 2MLEC 4MN0A 4YGAA 1K8UA 2KQYA 4MRYA 1S26D 4ZCVA 3BUOB 2BCXA 3I5IB 2Y1NA 2L50A 3D0YB 1SW8A 4PE0A 5AERA 1SKTA 3GK1A 2MHHA 1CFPA 3WHTB 1KK7Y 2JU0A 2KNEA 2L98A 1YRUB 2G9BA 1OSAA 2K7OA 4M2PA 1UHHA 2AAOA 1IWQA 1S5GZ 3OB1B 2M49B 4PHMA 5D7FA 2D8NA 1TNXA 3JTDB 1DJYA 1CFCA 3I5FB 3VRQA 1KCYA 4YGBB 1KFXL 3CR2A 1F8HA 2OPOA 1KSMA 2LUCA 3EK7A 1U5IA 2K7DA 2AUCA 3OB2B 3BXKA 1U5IB 3DD4A 3KO0A 1TRFA 2H61A 1BU3A 3LCPC 1G4YR 4QJ3B 3IQOA 1S6IA 1NX3A 4OR9B 2I18A 4YGEB 4A4BA 5GQQC 1F55A 1RWYA 1QLKA 1QXPA 2NCOA 1YR5A 2IS9A 1K9KA 1K9PA 5CSIA 2KGRA 3HX4A 5AXIA 5BPJA 4WRIA 1IGVA 1NP8A 2KDHA 2K0JA 3BYAA 2B1UA 1F4QA 1KFUS 1DT7B 3CTNA 1DJXA 3CR5X 4OCIA 2F8PA 1CFDA 1JSAA 1QLSA 5CSNA 3SG6A 1JBAA 3OX5A 4C0LA 4MZKA 4YI9A 5JJGA 2BE4A 1QJTA 1IH0A 5JOLA 3PN7B 1KQMC 2JT8A 4M2OA 2MJWB 1J7QA 3RM1A 1IG5A 1A75A 2CCMA 2LLTA 2ZN8A 1RJVA 1JFKA 2KI4C 2JNXA 1CMGA 1RK9A 2LCPA 1CNPA 5IBWA 1SR6C 1BG1A 2JXCA 3TDIA 3CZTX 2JNFA 1YX8A 3PATA 3DF0A 1NCYA 1CKKA 3NSOA 2LV7A 1N0YA 2KSPA 4GPLB 2QACA 5TNCA 1KQVA 1KK8B 1YVHA 1NCZA 2M7LA 1XFWO 4M2QA 1C7WA 3BUMB 1MXEA 3CWGA 1S36A 2KBMA 1AHRA 2KAYA 3M0WA 4U8DA 1LA0A 3SJSA 3D10A 4DIRA 2M29A 1WDCB 4I5LB 3AKBA 1PSRA 3C1VA 3K21A 3OX6A 3PSRA 5CSJA 1K90D 1AUIB 1QASA 3BUWB 4USLA 3SG7A 3SG3A 1B1GA 1H8BA 1GQMA 4NDCA 1ZUZA 2JZIA 1B8RA 1RFJA 4ZCUA 4TNCA 1J7OA 1FI6A 1K2HA 1OMDA 4MRXA 1BLQA 4PALA 1B4CA 1F71A 1G8IA 1VRKA 3WNXB 2M9GA 2OTGC 1GJYA 2ZN9A 1BODA 2PMYA 1DJGA 1XK4C 2E30A 2QPTA 5J3XA 1LA3A 1ALVA 2EGDA 3ZWHA 1UUSA 4GFTA 2PRUA 2WCFA 1MF8B 2LP3A 2EC6B 4GNKB 1NPQA 2FJUB 3DVEA 3EKJA 2BKIB 1QX2A 4CFRA 1L2OB 4WQ3A 1DGUA 3LK0A 1MWNA 2KFFA 2PASA 3IQQA 1TTXA 4PE4A 2SASA 2KAXA 1K93D 1XFUO 2E6WA 3RLZA 4MZLA 3TUYB 4BY4A 2BL0C 3WHUB 2MAZA 1JUOA 4XJKB 1BOCA 4NQGA 2K7CA 4UPGA 3E3RA 1KFXS 1K94A 1SCMB 4WQ2A 3AAKA 3D0YA 3GK4X 4A4CA 5AEQA 3TZ1A 5HLVA 3HCMA 4MBEA
chains in the Genus database with same CATH superfamily
2OS8C 1DVIA 2GGMA 1J7PA 1OE9B 1KWOC 2QEVA 1YTZC 3VB1A 2JTTA 4YRUA 1DELA 1S6JA 3GK2A 2HF5A 3D73A 1DGVA 1AK8A 1LXFC 2GV5A 2MA2A 1GGWA 1S3PA 1HT9A 1F54A 1RTP1 2KI6C 1QATA 2AMIA 3KEVA 5DICA 5CPVA 3A8RA 2JXLA 2L5XB 2L0PA 2PYQA 2WCJA 1XYDA 1L7ZA 1EH2A 1EG4A 3FIAA 1K96A 3I5GB 4N5XA 5I2LA 4NDBA 1XFYO 1NX1A 1NUBA 2BCBA 3O78A 1YX7A 1JWDA 2DOQA 2JT3A 4YI8A 1QIVA 4XYNA 1QVIY 5I2OA 1SPYA 1DJWA 3DZTA 4DCKA 1RROA 3I5IC 1OMVA 3O2PA 1LS8A 2F3ZA 3EVVA 4IL1A 2MBXA 1C7VA 1A4PA 1YURA 1P28A 2JOJA 3EG5B 1M63B 5HKYA 5DKRA 1WRLA 4YGCB 4I5JA 1CLBA 1SNLA 2NXQA 3D75A 4MZJA 3NGVA 1FF1A 4MVFA 1N65A 1XFXO 4E68A 2HQWA 1OOJA 2LUXA 2WOSA 1N2DA 1QV0A 2ZNDA 2A4JA 4ORBB 5D69A 4I5NB 2F2OA 4DS7A 3NSIA 3TDZA 1R2UA 3JTDC 3SG2A 1V1GA 2KBIA 5AFPA 5I2QA 2M97A 3KF9A 4AQIA 1EXRA 1AJ4A 1PULA 2WCBA 1IQ3A 2BKHB 2FCEA 3JVTC 3N7HA 4PCWA 3B6XA 1DQEA 5HLOA 1R6PA 2Y4QA 3F45A 3S0GA 4MLWA 3CZ1A 1Y6WA 4AQJA 5KSZA 1B7TY 1A29A 1F4OA 2NZ0A 2I94A 1ZACA 1PVBA 1S6CA 3UNWA 2JC2A 2LM5A 4L9MA 1XVJA 2H61C 2ZKMX 1TWOA 1ZFSA 1BJFA 2WNDA 1JF0A 1F70A 5FI6A 2LC5A 1WLZA 3O6BA 1LINA 3R1VA 3TS5B 4PE1A 5KTYA 1DC1A 3L4LA 2K7BA 1TIZA 3EVRA 3B87A 1CDMA 3FS7A 1W7JB 1NSHA 3KHEA 4HRHA 2LHIA 3I5HB 2JPOA 3CABA 1KSOA 2LLSA 2BCAA 1EL4A 4OKHA 1V1FA 1K95A 2ZRTA 1WLMA 3DVMA 1CLLA 1Y1UA 2L4HA 3PN7C 1NWDA 1XA5A 1DF0B 3AAJA 1AVSA 3BOWB 3SIBA 2BAPA 2JULA 4BY5A 1AP4A 3CS1A 3CR4X 1NX2A 4P2YB 1Z4HA 3EK8A 1TCFA 1IQ5A 1SRAA 1YUTA 2KYFA 1OOGA 1JC2A 2BE6A 1PSBA 3S0DA 3S0BA 2M1UA 5FYXA 2WCHA 4FTGA 1J1EA 1CB1A 1DJHA 1QX5B 1YUSA 2K60A 2NCPA 2LNKA 2EHBA 1BMOA 1LKJA 4GAOA 2KQ6A 3S0AA 5AANA 3NSKA 1DMOA 1FI5A 1FW4A 1K9UA 5G08A 2H8VA 2HETA 3SG5A 3FWBA 4C0JA 1UHNA 1KK8C 2JWWA 1TUJA 2SCPA 3WXAA 5KU1A 2K2AA 1M31A 3OP0A 1YRTB 3PALA 2LVVA 1BT6A 1SK6D 2KLEA 1TCOB 2K61A 1A2XA 4GGNA 3UO9A 1MXLC 1M45A 1MQ1A 1WDCC 2QEHA 4PHKA 1XO5A 2QDIA 3LL8B 1BR1B 2LP2A 4XJKA 1QX7A 1NCXA 1IRJA 2JQ6A 3BFBA 4CFQA 2KI6D 3R1OA 1CMFA 3CLNA 2KFGA 1OQPA 2ZFDA 4YBHB 1CLMA 2LE9B 1HQVA 2LAPA 4QJ4B 1QIWA 2JT0A 4PHNA 2BECA 1SBJA 1ORGA 4JWQA 1NYAA 1S5GY 2L4IA 2LHLA 2MRDA 4OZDA 2LMVA 4MEWA 2BNXA 2F33A 2I7AA 2WORA 1CFFA 4GGFA 3VRNA 1H4BA 1M39A 1SYMA 3FWCA 4N1FA 3ZNIA 3GOFA 1CTRA 5EL2A 1UURA 2ISDA 1SCVA 4MSPA 5CSFA 2WCMA 2LVJA 5F6TA 2H2KA 1EJ3A 2CT9A 2KLDA 1OOHA 1TN4A 3SIAA 4CPVA 2VRGA 1B8LA 3OHMB 1A03A 1CDPA 2RGIA 1ODBA 1J7RA 3TUYC 1IKUA 1B8CA 1C07A 1GGZA 3QRXA 3BFHA 4ORAB 2JRFA 3BUXB 4AOMA 2M0RA 4PHJA 4ETOA 3O4YA 1UWOA 1SL7A 1UHIA 1SCMC 3NHIA 2COLB 2PALA 4JQ0D 1OZSA 1FPWA 1E8AA 4Q04A 3AKAA 3LLEA 5DKNA 5HKWA 1KK7Z 2WC8A 5K89A 1DTLA 1SMGA 2L2EA 3ICBA 1CM1A 2LVKA 1KQMB 2Y5IA 2KFHA 1IJ6A 1WRZA 2P6BB 2R2IA 1QTXA 2KI4B 3JVTB 2JPTA 1PK0D 3EVUA 1SR6B 4P5OE 4GGFC 4HSZA 5DKQA 3DXLA 4HRGA 3SG4A 4JPZB 4ORCB 4GBAA 3I5FC 5ER5A 1XFZO 1LVCD 2JTZA 2CBLA 4CIDA 3VROA 1ALWA 2MLFC 2I2RE 2M7NA 4QJ5B 3I5GC 2PVBA 1QVIZ 1ZMZA 3NXAA 4KYNA 2F2PA 1Y1XA 5D3OA 2WC5A 1J1DA 1TNPA 3A4UB 3DVJA 1NIWA 2LMTA 1Y1AA 1WY9A 3EK4A 3LK1A 4PT1A 2GTEA 3SS5A 4DUQA 1W7IB 4PE7A 2CTNA 4F0ZB 3CZ0A 2P71A 3PFVA 3PLFB 1OOFA 4ICBA 2F3YA 1FBVA 1W9ZA 1B9AA 4N1GA 1PALA 2KHNA 3K1EA 5PALA 3IF7A 1UHKA 1OMRA 5ER4X 1DJZA 1UHJA 1C3ZA 2KPHA 2Q4UA 1A75B 2LANA 1SL9A 2HPSA 2M8UA 2OTGB 3KPXA 2TN4A 1XK4A 2ZRSA 3L4AA 1TNQA 1BR4B 4CLNA 2KAVA 1J55A 3FE6A 2ZNEA 3PM8A 4C0KA 1DF0A 1OZOA 3BOWA 2NLNA 4F7FA 1TNWA 2BBNA 1KFUL 2PSRA 1JFJA 2M3WA 2Q91A 4IJ7A 4DRWA 1Y0VH 3DF0B 4GUKA 1B7TZ 3VGOA 3DVKA 4R1EA 2LVIA 2O5GA 1X02A 5I8NA 1WRKA 2LLUA 2M1KB 4D1EA 1SY9A 2FOTA 1AJ5A 1MUXA 3CDNA 1B47A 1UP5A 2CXJA 2K2FA 4HREE 1CM4A 2Y1MA 4I5KA 1DJIA 1PVAA 2PQLA 4PDZA 4FQOA 4JKTA 3TS5C 3H4SE 3PJIA 2KOTA 2BL0B 2HQ8A 2L51A 3EKHA 1TOPA 3NSLA 3VRRA 3I5HC 1JF2A 1CDLA 3RZSA 3BUNB 5HYDA 2K8MB 2QEBA 3DYEA 3CGAA 1NX0A 3CZ2A 2WCEA 2OS8B 4OV2A 2G2BA 1D1OA 1Z2CB 1BF5A 1CDNA 1YUUA 4OVNF 1KWOB 1EG3A 1G33A 1XFVO 2QEOA 1S1EA 3BQ3A 3MSEB 5B8IB 5I94A 1YVLA 1MR8A 3NHTA 3TDUA 3VRPA 1RECA 3OGNA 4YGDB 1C3YA 2GGZA 2KGBC 4INWA 4JD9A 1SL8A 3BFAA 1M46A 1QS7A 2O60A 3PM2A 2CNPA 1PRWA 2BBMA 1IJ5A 2V53A 5HKZA 1Q80A 3FE8A 2EC6C 2KYCA 2FCDA 1QV1A 1ZOTB 4NDDA 2LMUA 1MHOA 3S0EA 1L2OC 2MLEC 4MN0A 4YGAA 1K8UA 2KQYA 4MRYA 1S26D 4ZCVA 3BUOB 2BCXA 3I5IB 3O4XA 2Y1NA 2L50A 4FQTA 3D0YB 3D77A 1SW8A 4PE0A 5AERA 1SKTA 1DEKA 3GK1A 2MHHA 1CFPA 3OBVA 3WHTB 1KK7Y 2JU0A 2KNEA 2L98A 1YRUB 2G9BA 1OSAA 2K7OA 4M2PA 1UHHA 2AAOA 1IWQA 1S5GZ 3D78A 3OB1B 2M49B 4PHMA 1QWVA 5D7FA 2D8NA 1TNXA 3JTDB 1DJYA 1CFCA 3I5FB 3VRQA 1KCYA 4YGBB 1KFXL 3CR2A 1F8HA 2OPOA 1KSMA 2LUCA 3EK7A 1U5IA 2K7DA 2AUCA 3OB2B 3BXKA 1U5IB 3D74A 3DD4A 3KO0A 1TRFA 2H61A 1BU3A 3B7AA 3LCPC 1G4YR 3R72A 4QJ3B 3IQOA 1S6IA 1NX3A 4OR9B 2I18A 4YGEB 4A4BA 5GQQC 1F55A 1RWYA 1QLKA 3S0FA 5FI7A 1QXPA 1TUZA 2NCOA 1YR5A 2IS9A 3FE9A 1K9KA 1K9PA 5CSIA 2KGRA 3HX4A 3B86A 5AXIA 5BPJA 4WRIA 5FI2A 1IGVA 1NP8A 2KDHA 2K0JA 3BYAA 2L2CA 2B1UA 1F4QA 1KFUS 1DT7B 3CTNA 1DJXA 3SS4A 3CR5X 4OCIA 2F8PA 1CFDA 1JSAA 1QLSA 5CSNA 3SG6A 1JBAA 3OX5A 4C0LA 1SSEB 4MZKA 4YI9A 5JJGA 2BE4A 1QJTA 1IH0A 5JOLA 3PN7B 1KQMC 2JT8A 4M2OA 2FJYA 2MJWB 1J7QA 3RM1A 1IG5A 1A75A 2CCMA 2LLTA 2WCKA 1RJVA 2ZN8A 1JFKA 2KI4C 2JNXA 1CMGA 1RK9A 2LCPA 1CNPA 5IBWA 3Q8IA 1SR6C 1BG1A 2JXCA 2YGUA 3TDIA 3CZTX 2JNFA 1YX8A 3PATA 3DF0A 1NCYA 1CKKA 3NSOA 2LV7A 1N0YA 3BJHA 3SS3A 2KSPA 4GPLB 2QACA 5TNCA 1KQVA 1OOIX 1KK8B 1YVHA 1NCZA 1OW4A 2M7LA 1XFWO 3IVTA 4M2QA 1C7WA 3L47A 3BUMB 1MXEA 3CWGA 1S36A 2KBMA 1AHRA 2KAYA 3M0WA 4U8DA 1LA0A 3SJSA 3D10A 4DIRA 2M29A 1WDCB 2L5YA 4I5LB 3AKBA 1PSRA 3C1VA 3K21A 3OX6A 3PSRA 5CSJA 1T14A 2WC6A 1K90D 1AUIB 1QASA 3BUWB 4USLA 3SG7A 3SG3A 1B1GA 1H8BA 3B88A 1GQMA 4NDCA 1ZUZA 2JZIA 1B8RA 1RFJA 4ZCUA 4TNCA 1J7OA 1FI6A 1K2HA 1OMDA 4MRXA 1BLQA 4PALA 1B4CA 1F71A 2WCLA 1G8IA 1VRKA 3WNXB 2M9GA 2OTGC 1GM0A 1GJYA 2ZN9A 1BODA 3R1PA 2PMYA 1DJGA 3DY9A 1XK4C 2E30A 2QPTA 5J3XA 1LA3A 1ALVA 1XFRA 2EGDA 3ZWHA 1UUSA 4GFTA 2PRUA 2WCFA 1MF8B 2LP3A 2EC6B 4GNKB 1NPQA 2FJUB 3DVEA 3EKJA 2BKIB 1QX2A 4CFRA 1L2OB 4WQ3A 1DGUA 3LK0A 4INXA 3D76A 1MWNA 2KFFA 2PASA 3IQQA 1TTXA 4PE4A 2SASA 2KAXA 3V2LA 1K93D 1XFUO 2E6WA 3RLZA 4MZLA 3TUYB 4BY4A 2BL0C 3WHUB 2MAZA 1JUOA 4XJKB 5HL1A 1BOCA 3QMEA 3CYZA 4NQGA 2K7CA 4UPGA 2P70A 3E3RA 1KFXS 1K94A 1SCMB 4WQ2A 1IIOA 3AAKA 3D0YA 3GK4X 4A4CA 5AEQA 2ERBA 5HLVA 3HCMA 4MBEA 3TZ1A
chains in the Genus database with same CATH topology
2OS8C 1DVIA 2GGMA 1J7PA 1OE9B 1KWOC 1YTZC 2JTTA 4YRUA 1S6JA 3GK2A 2HF5A 1DGVA 1AK8A 1LXFC 2GV5A 2MA2A 1GGWA 1S3PA 1HT9A 1F54A 1RTP1 2KI6C 1QATA 2AMIA 3KEVA 5CPVA 3A8RA 2JXLA 2L5XB 2L0PA 1XYDA 1L7ZA 1EG4A 3FIAA 1K96A 3I5GB 4N5XA 5I2LA 4NDBA 1XFYO 1NX1A 1NUBA 2BCBA 3O78A 1YX7A 1JWDA 2DOQA 2JT3A 4YI8A 1QIVA 4XYNA 1QVIY 5I2OA 1SPYA 1DJWA 4DCKA 1RROA 3I5IC 1OMVA 3O2PA 2F3ZA 3EVVA 4IL1A 2MBXA 1C7VA 1A4PA 1YURA 2JOJA 1M63B 5HKYA 5DKRA 1WRLA 4YGCB 4I5JA 1CLBA 1SNLA 2NXQA 4MZJA 1FF1A 4MVFA 1N65A 1XFXO 4E68A 2HQWA 1OOJA 2LUXA 2WOSA 1N2DA 1QV0A 2ZNDA 2A4JA 4ORBB 5D69A 4I5NB 2F2OA 4DS7A 3NSIA 3TDZA 1R2UA 3JTDC 3SG2A 1V1GA 2KBIA 5AFPA 5I2QA 2M97A 3KF9A 4AQIA 1EXRA 1AJ4A 1PULA 2WCBA 1IQ3A 2BKHB 2FCEA 3JVTC 4PCWA 1EH2A 4AQJA 5HLOA 1R6PA 2Y4QA 3F45A 5KSZA 4MLWA 1Y6WA 1B7TY 1A29A 1F4OA 2NZ0A 2I94A 1ZACA 1PVBA 1S6CA 2JC2A 2LM5A 4L9MA 1XVJA 2H61C 2ZKMX 2WNDA 1ZFSA 1BJFA 1F70A 1JF0A 2LC5A 1WLZA 3O6BA 1LINA 3TS5B 4PE1A 5KTYA 2K7BA 1TIZA 3EVRA 1CDMA 3FS7A 1W7JB 1NSHA 3KHEA 4HRHA 2LHIA 3I5HB 1KSOA 2LLSA 2BCAA 1EL4A 4OKHA 1V1FA 1K95A 2ZRTA 1WLMA 3DVMA 1CLLA 1Y1UA 2L4HA 3PN7C 1NWDA 1XA5A 1DF0B 3AAJA 1AVSA 3BOWB 3SIBA 2JULA 4BY5A 1AP4A 3CS1A 3CR4X 1NX2A 4P2YB 3EK8A 1TCFA 1IQ5A 1SRAA 1YUTA 2KYFA 1JC2A 2BE6A 1PSBA 2M1UA 5FYXA 4FTGA 1J1EA 1CB1A 1DJHA 1QX5B 1YUSA 2NCPA 2LNKA 2EHBA 1BMOA 1LKJA 4GAOA 2KQ6A 5AANA 3NSKA 1DMOA 1FI5A 1FW4A 1K9UA 5G08A 2HETA 3SG5A 3FWBA 4C0JA 1UHNA 1KK8C 2JWWA 2SCPA 3WXAA 5KU1A 2K2AA 1M31A 3OP0A 1YRTB 3PALA 2LVVA 1BT6A 1SK6D 1TCOB 2K61A 1A2XA 4GGNA 1MXLC 1M45A 1MQ1A 1WDCC 4PHKA 1XO5A 3LL8B 1BR1B 2LP2A 4XJKA 1QX7A 1NCXA 1IRJA 2JQ6A 4CFQA 2KI6D 1CMFA 3CLNA 2KFGA 1OQPA 2ZFDA 4YBHB 1CLMA 2LE9B 1HQVA 2LAPA 4QJ4B 1QIWA 2JT0A 4PHNA 2BECA 1SBJA 4JWQA 1NYAA 1S5GY 2L4IA 2LHLA 2MRDA 2LMVA 4MEWA 2F33A 2I7AA 2WORA 1CFFA 4GGFA 3VRNA 1H4BA 1M39A 1SYMA 3FWCA 4N1FA 3ZNIA 3GOFA 1CTRA 1UURA 2ISDA 1SCVA 4MSPA 5CSFA 2LVJA 5F6TA 2H2KA 1EJ3A 2CT9A 1TN4A 3SIAA 4CPVA 2VRGA 1B8LA 3OHMB 1A03A 1CDPA 2RGIA 1ODBA 1J7RA 3TUYC 1IKUA 1B8CA 1C07A 1GGZA 3QRXA 4ORAB 4AOMA 2JRFA 3BUXB 2M0RA 4PHJA 4ETOA 3O4YA 1UWOA 1SL7A 1UHIA 1SCMC 2COLB 2PALA 4JQ0D 1OZSA 1FPWA 1E8AA 4Q04A 3AKAA 3LLEA 5DKNA 5HKWA 1KK7Z 2WC8A 5K89A 1DTLA 1SMGA 2L2EA 3ICBA 1CM1A 2LVKA 1KQMB 2Y5IA 2KFHA 1IJ6A 1WRZA 2P6BB 2R2IA 1QTXA 2KI4B 3JVTB 2JPTA 1PK0D 3EVUA 1SR6B 4P5OE 4GGFC 4HSZA 5DKQA 4HRGA 3SG4A 4JPZB 4ORCB 4GBAA 3I5FC 5ER5A 1XFZO 1LVCD 2JTZA 2CBLA 4CIDA 3VROA 1ALWA 2MLFC 2I2RE 2M7NA 4QJ5B 3I5GC 2PVBA 1QVIZ 1ZMZA 3NXAA 2F2PA 1Y1XA 1J1DA 1TNPA 3A4UB 3DVJA 1NIWA 2LMTA 1Y1AA 1WY9A 3EK4A 3LK1A 4DUQA 4F0ZB 1W7IB 4PE7A 2CTNA 3PFVA 3PLFB 4ICBA 2F3YA 1FBVA 4N1GA 1B9AA 1PALA 2KHNA 5PALA 3IF7A 1UHKA 1OMRA 5ER4X 1DJZA 1UHJA 2Q4UA 1A75B 2LANA 1SL9A 2HPSA 2M8UA 2OTGB 3KPXA 2TN4A 1XK4A 2ZRSA 1TNQA 1BR4B 4CLNA 2KAVA 1J55A 2ZNEA 3PM8A 4C0KA 1DF0A 1OZOA 3BOWA 2NLNA 1TNWA 2BBNA 1KFUL 2PSRA 1JFJA 2M3WA 2Q91A 4DRWA 1Y0VH 3DF0B 4GUKA 1B7TZ 3VGOA 3DVKA 4R1EA 2LVIA 2O5GA 1X02A 5I8NA 1WRKA 2LLUA 2M1KB 4D1EA 1SY9A 2FOTA 1AJ5A 1MUXA 1B47A 1UP5A 2CXJA 2K2FA 4HREE 1CM4A 2Y1MA 4I5KA 1DJIA 1PVAA 4PDZA 4FQOA 3TS5C 3H4SE 2KOTA 2BL0B 2HQ8A 2L51A 3EKHA 1TOPA 3NSLA 3VRRA 3I5HC 1JF2A 1CDLA 3BUNB 5HYDA 2K8MB 3CGAA 1NX0A 2WCEA 2OS8B 4OV2A 2G2BA 1D1OA 1BF5A 1CDNA 1YUUA 4OVNF 1KWOB 1EG3A 1G33A 1XFVO 3BQ3A 1S1EA 3MSEB 5B8IB 1YVLA 1MR8A 3TDUA 3VRPA 1RECA 4YGDB 2GGZA 2KGBC 1SL8A 1M46A 1QS7A 2O60A 2CNPA 1PRWA 2BBMA 1IJ5A 2V53A 5HKZA 1Q80A 2EC6C 2KYCA 2FCDA 1QV1A 1ZOTB 4NDDA 2LMUA 1MHOA 1L2OC 2MLEC 4MN0A 4YGAA 1K8UA 2KQYA 4MRYA 1S26D 4ZCVA 3BUOB 2BCXA 3I5IB 2Y1NA 2L50A 3D0YB 1SW8A 4PE0A 5AERA 1SKTA 3GK1A 2MHHA 1CFPA 3WHTB 1KK7Y 2JU0A 2KNEA 2L98A 1YRUB 2G9BA 1OSAA 2K7OA 4M2PA 1UHHA 2AAOA 1IWQA 1S5GZ 3OB1B 2M49B 4PHMA 5D7FA 2D8NA 1TNXA 3JTDB 1DJYA 1CFCA 3I5FB 3VRQA 1KCYA 4YGBB 1KFXL 3CR2A 1F8HA 2OPOA 1KSMA 2LUCA 3EK7A 1U5IA 2K7DA 2AUCA 3OB2B 3BXKA 1U5IB 3DD4A 3KO0A 1TRFA 2H61A 1BU3A 3LCPC 1G4YR 4QJ3B 3IQOA 1S6IA 1NX3A 4OR9B 2I18A 4YGEB 4A4BA 5GQQC 1F55A 1RWYA 1QLKA 1QXPA 2NCOA 1YR5A 2IS9A 1K9KA 1K9PA 5CSIA 2KGRA 3HX4A 5AXIA 5BPJA 4WRIA 1IGVA 1NP8A 2KDHA 2K0JA 3BYAA 2B1UA 1F4QA 1KFUS 1DT7B 3CTNA 1DJXA 3CR5X 4OCIA 2F8PA 1CFDA 1JSAA 1QLSA 5CSNA 3SG6A 1JBAA 3OX5A 4C0LA 4MZKA 4YI9A 5JJGA 2BE4A 1QJTA 1IH0A 5JOLA 3PN7B 1KQMC 2JT8A 4M2OA 2MJWB 1J7QA 3RM1A 1IG5A 1A75A 2CCMA 2LLTA 2ZN8A 1RJVA 1JFKA 2KI4C 2JNXA 1CMGA 1RK9A 2LCPA 1CNPA 5IBWA 1SR6C 1BG1A 2JXCA 3TDIA 3CZTX 2JNFA 1YX8A 3PATA 3DF0A 1NCYA 1CKKA 3NSOA 2LV7A 1N0YA 2KSPA 4GPLB 2QACA 5TNCA 1KQVA 1KK8B 1YVHA 1NCZA 2M7LA 1XFWO 4M2QA 1C7WA 3BUMB 1MXEA 3CWGA 1S36A 2KBMA 1AHRA 2KAYA 3M0WA 4U8DA 1LA0A 3SJSA 3D10A 4DIRA 2M29A 1WDCB 4I5LB 3AKBA 1PSRA 3C1VA 3K21A 3OX6A 3PSRA 5CSJA 1K90D 1AUIB 1QASA 3BUWB 4USLA 3SG7A 3SG3A 1B1GA 1H8BA 1GQMA 4NDCA 1ZUZA 2JZIA 1B8RA 1RFJA 4ZCUA 4TNCA 1J7OA 1FI6A 1K2HA 1OMDA 4MRXA 1BLQA 4PALA 1B4CA 1F71A 1G8IA 1VRKA 3WNXB 2M9GA 2OTGC 1GJYA 2ZN9A 1BODA 2PMYA 1DJGA 1XK4C 2E30A 2QPTA 5J3XA 1LA3A 1ALVA 2EGDA 3ZWHA 1UUSA 4GFTA 2PRUA 2WCFA 1MF8B 2LP3A 2EC6B 4GNKB 1NPQA 2FJUB 3DVEA 3EKJA 2BKIB 1QX2A 4CFRA 1L2OB 4WQ3A 1DGUA 3LK0A 1MWNA 2KFFA 2PASA 3IQQA 1TTXA 4PE4A 2SASA 2KAXA 1K93D 1XFUO 2E6WA 3RLZA 4MZLA 3TUYB 4BY4A 2BL0C 3WHUB 2MAZA 1JUOA 4XJKB 1BOCA 4NQGA 2K7CA 4UPGA 3E3RA 1KFXS 1K94A 1SCMB 4WQ2A 3AAKA 3D0YA 3GK4X 4A4CA 5AEQA 3TZ1A 5HLVA 3HCMA 4MBEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OS8 C;  1DVI A;  2GGM A;  1J7P A;  1OE9 B;  1KWO C;  1YTZ C;  2JTT A;  4YRU A;  1S6J A;  3GK2 A;  2HF5 A;  1DGV A;  1AK8 A;  1LXF C;  2GV5 A;  2MA2 A;  1GGW A;  1S3P A;  1HT9 A;  1F54 A;  1RTP 1;  2KI6 C;  1QAT A;  2AMI A;  3KEV A;  5CPV A;  3A8R A;  2JXL A;  2L5X B;  2L0P A;  1XYD A;  1L7Z A;  1EG4 A;  3FIA A;  1K96 A;  3I5G B;  4N5X A;  5I2L A;  4NDB A;  1XFY O;  1NX1 A;  1NUB A;  2BCB A;  3O78 A;  1YX7 A;  1JWD A;  2DOQ A;  2JT3 A;  4YI8 A;  1QIV A;  4XYN A;  1QVI Y;  5I2O A;  1SPY A;  1DJW A;  4DCK A;  1RRO A;  3I5I C;  1OMV A;  3O2P A;  2F3Z A;  3EVV A;  4IL1 A;  2MBX A;  1C7V A;  1A4P A;  1YUR A;  2JOJ A;  1M63 B;  5HKY A;  5DKR A;  1WRL A;  4YGC B;  4I5J A;  1CLB A;  1SNL A;  2NXQ A;  4MZJ A;  1FF1 A;  4MVF A;  1N65 A;  1XFX O;  4E68 A;  2HQW A;  1OOJ A;  2LUX A;  2WOS A;  1N2D A;  1QV0 A;  2ZND A;  2A4J A;  4ORB B;  5D69 A;  4I5N B;  2F2O A;  4DS7 A;  3NSI A;  3TDZ A;  1R2U A;  3JTD C;  3SG2 A;  1V1G A;  2KBI A;  5AFP A;  5I2Q A;  2M97 A;  3KF9 A;  4AQI A;  1EXR A;  1AJ4 A;  1PUL A;  2WCB A;  1IQ3 A;  2BKH B;  2FCE A;  3JVT C;  4PCW A;  1EH2 A;  4AQJ A;  5HLO A;  1R6P A;  2Y4Q A;  3F45 A;  5KSZ A;  4MLW A;  1Y6W A;  1B7T Y;  1A29 A;  1F4O A;  2NZ0 A;  2I94 A;  1ZAC A;  1PVB A;  1S6C A;  2JC2 A;  2LM5 A;  4L9M A;  1XVJ A;  2H61 C;  2ZKM X;  2WND A;  1ZFS A;  1BJF A;  1F70 A;  1JF0 A;  2LC5 A;  1WLZ A;  3O6B A;  1LIN A;  3TS5 B;  4PE1 A;  5KTY A;  2K7B A;  1TIZ A;  3EVR A;  1CDM A;  3FS7 A;  1W7J B;  1NSH A;  3KHE A;  4HRH A;  2LHI A;  3I5H B;  1KSO A;  2LLS A;  2BCA A;  1EL4 A;  4OKH A;  1V1F A;  1K95 A;  2ZRT A;  1WLM A;  3DVM A;  1CLL A;  1Y1U A;  2L4H A;  3PN7 C;  1NWD A;  1XA5 A;  1DF0 B;  3AAJ A;  1AVS A;  3BOW B;  3SIB A;  2JUL A;  4BY5 A;  1AP4 A;  3CS1 A;  3CR4 X;  1NX2 A;  4P2Y B;  3EK8 A;  1TCF A;  1IQ5 A;  1SRA A;  1YUT A;  2KYF A;  1JC2 A;  2BE6 A;  1PSB A;  2M1U A;  5FYX A;  4FTG A;  1J1E A;  1CB1 A;  1DJH A;  1QX5 B;  1YUS A;  2NCP A;  2LNK A;  2EHB A;  1BMO A;  1LKJ A;  4GAO A;  2KQ6 A;  5AAN A;  3NSK A;  1DMO A;  1FI5 A;  1FW4 A;  1K9U A;  5G08 A;  2HET A;  3SG5 A;  3FWB A;  4C0J A;  1UHN A;  1KK8 C;  2JWW A;  2SCP A;  3WXA A;  5KU1 A;  2K2A A;  1M31 A;  3OP0 A;  1YRT B;  3PAL A;  2LVV A;  1BT6 A;  1SK6 D;  1TCO B;  2K61 A;  1A2X A;  4GGN A;  1MXL C;  1M45 A;  1MQ1 A;  1WDC C;  4PHK A;  1XO5 A;  3LL8 B;  1BR1 B;  2LP2 A;  4XJK A;  1QX7 A;  1NCX A;  1IRJ A;  2JQ6 A;  4CFQ A;  2KI6 D;  1CMF A;  3CLN A;  2KFG A;  1OQP A;  2ZFD A;  4YBH B;  1CLM A;  2LE9 B;  1HQV A;  2LAP A;  4QJ4 B;  1QIW A;  2JT0 A;  4PHN A;  2BEC A;  1SBJ A;  4JWQ A;  1NYA A;  1S5G Y;  2L4I A;  2LHL A;  2MRD A;  2LMV A;  4MEW A;  2F33 A;  2I7A A;  2WOR A;  1CFF A;  4GGF A;  3VRN A;  1H4B A;  1M39 A;  1SYM A;  3FWC A;  4N1F A;  3ZNI A;  3GOF A;  1CTR A;  1UUR A;  2ISD A;  1SCV A;  4MSP A;  5CSF A;  2LVJ A;  5F6T A;  2H2K A;  1EJ3 A;  2CT9 A;  1TN4 A;  3SIA A;  4CPV A;  2VRG A;  1B8L A;  3OHM B;  1A03 A;  1CDP A;  2RGI A;  1ODB A;  1J7R A;  3TUY C;  1IKU A;  1B8C A;  1C07 A;  1GGZ A;  3QRX A;  4ORA B;  4AOM A;  2JRF A;  3BUX B;  2M0R A;  4PHJ A;  4ETO A;  3O4Y A;  1UWO A;  1SL7 A;  1UHI A;  1SCM C;  2COL B;  2PAL A;  4JQ0 D;  1OZS A;  1FPW A;  1E8A A;  4Q04 A;  3AKA A;  3LLE A;  5DKN A;  5HKW A;  1KK7 Z;  2WC8 A;  5K89 A;  1DTL A;  1SMG A;  2L2E A;  3ICB A;  1CM1 A;  2LVK A;  1KQM B;  2Y5I A;  2KFH A;  1IJ6 A;  1WRZ A;  2P6B B;  2R2I A;  1QTX A;  2KI4 B;  3JVT B;  2JPT A;  1PK0 D;  3EVU A;  1SR6 B;  4P5O E;  4GGF C;  4HSZ A;  5DKQ A;  4HRG A;  3SG4 A;  4JPZ B;  4ORC B;  4GBA A;  3I5F C;  5ER5 A;  1XFZ O;  1LVC D;  2JTZ A;  2CBL A;  4CID A;  3VRO A;  1ALW A;  2MLF C;  2I2R E;  2M7N A;  4QJ5 B;  3I5G C;  2PVB A;  1QVI Z;  1ZMZ A;  3NXA A;  2F2P A;  1Y1X A;  1J1D A;  1TNP A;  3A4U B;  3DVJ A;  1NIW A;  2LMT A;  1Y1A A;  1WY9 A;  3EK4 A;  3LK1 A;  4DUQ A;  4F0Z B;  1W7I B;  4PE7 A;  2CTN A;  3PFV A;  3PLF B;  4ICB A;  2F3Y A;  1FBV A;  4N1G A;  1B9A A;  1PAL A;  2KHN A;  5PAL A;  3IF7 A;  1UHK A;  1OMR A;  5ER4 X;  1DJZ A;  1UHJ A;  2Q4U A;  1A75 B;  2LAN A;  1SL9 A;  2HPS A;  2M8U A;  2OTG B;  3KPX A;  2TN4 A;  1XK4 A;  2ZRS A;  1TNQ A;  1BR4 B;  4CLN A;  2KAV A;  1J55 A;  2ZNE A;  3PM8 A;  4C0K A;  1DF0 A;  1OZO A;  3BOW A;  2NLN A;  1TNW A;  2BBN A;  1KFU L;  2PSR A;  1JFJ A;  2M3W A;  2Q91 A;  4DRW A;  1Y0V H;  3DF0 B;  4GUK A;  1B7T Z;  3VGO A;  3DVK A;  4R1E A;  2LVI A;  2O5G A;  1X02 A;  5I8N A;  1WRK A;  2LLU A;  2M1K B;  4D1E A;  1SY9 A;  2FOT A;  1AJ5 A;  1MUX A;  1B47 A;  1UP5 A;  2CXJ A;  2K2F A;  4HRE E;  1CM4 A;  2Y1M A;  4I5K A;  1DJI A;  1PVA A;  4PDZ A;  4FQO A;  3TS5 C;  3H4S E;  2KOT A;  2BL0 B;  2HQ8 A;  2L51 A;  3EKH A;  1TOP A;  3NSL A;  3VRR A;  3I5H C;  1JF2 A;  1CDL A;  3BUN B;  5HYD A;  2K8M B;  3CGA A;  1NX0 A;  2WCE A;  2OS8 B;  4OV2 A;  2G2B A;  1D1O A;  1BF5 A;  1CDN A;  1YUU A;  4OVN F;  1KWO B;  1EG3 A;  1G33 A;  1XFV O;  3BQ3 A;  1S1E A;  3MSE B;  5B8I B;  1YVL A;  1MR8 A;  3TDU A;  3VRP A;  1REC A;  4YGD B;  2GGZ A;  2KGB C;  1SL8 A;  1M46 A;  1QS7 A;  2O60 A;  2CNP A;  1PRW A;  2BBM A;  1IJ5 A;  2V53 A;  5HKZ A;  1Q80 A;  2EC6 C;  2KYC A;  2FCD A;  1QV1 A;  1ZOT B;  4NDD A;  2LMU A;  1MHO A;  1L2O C;  2MLE C;  4MN0 A;  4YGA A;  1K8U A;  2KQY A;  4MRY A;  1S26 D;  4ZCV A;  3BUO B;  2BCX A;  3I5I B;  2Y1N A;  2L50 A;  3D0Y B;  1SW8 A;  4PE0 A;  5AER A;  1SKT A;  3GK1 A;  2MHH A;  1CFP A;  3WHT B;  1KK7 Y;  2JU0 A;  2KNE A;  2L98 A;  1YRU B;  2G9B A;  1OSA A;  2K7O A;  4M2P A;  1UHH A;  2AAO A;  1IWQ A;  1S5G Z;  3OB1 B;  2M49 B;  4PHM A;  5D7F A;  2D8N A;  1TNX A;  3JTD B;  1DJY A;  1CFC A;  3I5F B;  3VRQ A;  1KCY A;  4YGB B;  1KFX L;  3CR2 A;  1F8H A;  2OPO A;  1KSM A;  2LUC A;  3EK7 A;  1U5I A;  2K7D A;  2AUC A;  3OB2 B;  3BXK A;  1U5I B;  3DD4 A;  3KO0 A;  1TRF A;  2H61 A;  1BU3 A;  3LCP C;  1G4Y R;  4QJ3 B;  3IQO A;  1S6I A;  1NX3 A;  4OR9 B;  2I18 A;  4YGE B;  4A4B A;  5GQQ C;  1F55 A;  1RWY A;  1QLK A;  1QXP A;  2NCO A;  1YR5 A;  2IS9 A;  1K9K A;  1K9P A;  5CSI A;  2KGR A;  3HX4 A;  5AXI A;  5BPJ A;  4WRI A;  1IGV A;  1NP8 A;  2KDH A;  2K0J A;  3BYA A;  2B1U A;  1F4Q A;  1KFU S;  1DT7 B;  3CTN A;  1DJX A;  3CR5 X;  4OCI A;  2F8P A;  1CFD A;  1JSA A;  1QLS A;  5CSN A;  3SG6 A;  1JBA A;  3OX5 A;  4C0L A;  4MZK A;  4YI9 A;  5JJG A;  2BE4 A;  1QJT A;  1IH0 A;  5JOL A;  3PN7 B;  1KQM C;  2JT8 A;  4M2O A;  2MJW B;  1J7Q A;  3RM1 A;  1IG5 A;  1A75 A;  2CCM A;  2LLT A;  2ZN8 A;  1RJV A;  1JFK A;  2KI4 C;  2JNX A;  1CMG A;  1RK9 A;  2LCP A;  1CNP A;  5IBW A;  1SR6 C;  1BG1 A;  2JXC A;  3TDI A;  3CZT X;  2JNF A;  1YX8 A;  3PAT A;  3DF0 A;  1NCY A;  1CKK A;  3NSO A;  2LV7 A;  1N0Y A;  2KSP A;  4GPL B;  2QAC A;  5TNC A;  1KQV A;  1KK8 B;  1YVH A;  1NCZ A;  2M7L A;  1XFW O;  4M2Q A;  1C7W A;  3BUM B;  1MXE A;  3CWG A;  1S36 A;  2KBM A;  1AHR A;  2KAY A;  3M0W A;  4U8D A;  1LA0 A;  3SJS A;  3D10 A;  4DIR A;  2M29 A;  1WDC B;  4I5L B;  3AKB A;  1PSR A;  3C1V A;  3K21 A;  3OX6 A;  3PSR A;  5CSJ A;  1K90 D;  1AUI B;  1QAS A;  3BUW B;  4USL A;  3SG7 A;  3SG3 A;  1B1G A;  1H8B A;  1GQM A;  4NDC A;  1ZUZ A;  2JZI A;  1B8R A;  1RFJ A;  4ZCU A;  4TNC A;  1J7O A;  1FI6 A;  1K2H A;  1OMD A;  4MRX A;  1BLQ A;  4PAL A;  1B4C A;  1F71 A;  1G8I A;  1VRK A;  3WNX B;  2M9G A;  2OTG C;  1GJY A;  2ZN9 A;  1BOD A;  2PMY A;  1DJG A;  1XK4 C;  2E30 A;  2QPT A;  5J3X A;  1LA3 A;  1ALV A;  2EGD A;  3ZWH A;  1UUS A;  4GFT A;  2PRU A;  2WCF A;  1MF8 B;  2LP3 A;  2EC6 B;  4GNK B;  1NPQ A;  2FJU B;  3DVE A;  3EKJ A;  2BKI B;  1QX2 A;  4CFR A;  1L2O B;  4WQ3 A;  1DGU A;  3LK0 A;  1MWN A;  2KFF A;  2PAS A;  3IQQ A;  1TTX A;  4PE4 A;  2SAS A;  2KAX A;  1K93 D;  1XFU O;  2E6W A;  3RLZ A;  4MZL A;  3TUY B;  4BY4 A;  2BL0 C;  3WHU B;  2MAZ A;  1JUO A;  4XJK B;  1BOC A;  4NQG A;  2K7C A;  4UPG A;  3E3R A;  1KFX S;  1K94 A;  1SCM B;  4WQ2 A;  3AAK A;  3D0Y A;  3GK4 X;  4A4C A;  5AEQ A;  3TZ1 A;  5HLV A;  3HCM A;  4MBE A; 
#chains in the Genus database with same CATH topology
 2OS8 C;  1DVI A;  2GGM A;  1J7P A;  1OE9 B;  1KWO C;  2QEV A;  1YTZ C;  3VB1 A;  2JTT A;  4YRU A;  1DEL A;  1S6J A;  3GK2 A;  2HF5 A;  3D73 A;  1DGV A;  1AK8 A;  1LXF C;  2GV5 A;  2MA2 A;  1GGW A;  1S3P A;  1HT9 A;  1F54 A;  1RTP 1;  2KI6 C;  1QAT A;  2AMI A;  3KEV A;  5DIC A;  5CPV A;  3A8R A;  2JXL A;  2L5X B;  2L0P A;  2PYQ A;  2WCJ A;  1XYD A;  1L7Z A;  1EH2 A;  1EG4 A;  3FIA A;  1K96 A;  3I5G B;  4N5X A;  5I2L A;  4NDB A;  1XFY O;  1NX1 A;  1NUB A;  2BCB A;  3O78 A;  1YX7 A;  1JWD A;  2DOQ A;  2JT3 A;  4YI8 A;  1QIV A;  4XYN A;  1QVI Y;  5I2O A;  1SPY A;  1DJW A;  3DZT A;  4DCK A;  1RRO A;  3I5I C;  1OMV A;  3O2P A;  1LS8 A;  2F3Z A;  3EVV A;  4IL1 A;  2MBX A;  1C7V A;  1A4P A;  1YUR A;  1P28 A;  2JOJ A;  3EG5 B;  1M63 B;  5HKY A;  5DKR A;  1WRL A;  4YGC B;  4I5J A;  1CLB A;  1SNL A;  2NXQ A;  3D75 A;  4MZJ A;  3NGV A;  1FF1 A;  4MVF A;  1N65 A;  1XFX O;  4E68 A;  2HQW A;  1OOJ A;  2LUX A;  2WOS A;  1N2D A;  1QV0 A;  2ZND A;  2A4J A;  4ORB B;  5D69 A;  4I5N B;  2F2O A;  4DS7 A;  3NSI A;  3TDZ A;  1R2U A;  3JTD C;  3SG2 A;  1V1G A;  2KBI A;  5AFP A;  5I2Q A;  2M97 A;  3KF9 A;  4AQI A;  1EXR A;  1AJ4 A;  1PUL A;  2WCB A;  1IQ3 A;  2BKH B;  2FCE A;  3JVT C;  3N7H A;  4PCW A;  3B6X A;  1DQE A;  5HLO A;  1R6P A;  2Y4Q A;  3F45 A;  3S0G A;  4MLW A;  3CZ1 A;  1Y6W A;  4AQJ A;  5KSZ A;  1B7T Y;  1A29 A;  1F4O A;  2NZ0 A;  2I94 A;  1ZAC A;  1PVB A;  1S6C A;  3UNW A;  2JC2 A;  2LM5 A;  4L9M A;  1XVJ A;  2H61 C;  2ZKM X;  1TWO A;  1ZFS A;  1BJF A;  2WND A;  1JF0 A;  1F70 A;  5FI6 A;  2LC5 A;  1WLZ A;  3O6B A;  1LIN A;  3R1V A;  3TS5 B;  4PE1 A;  5KTY A;  1DC1 A;  3L4L A;  2K7B A;  1TIZ A;  3EVR A;  3B87 A;  1CDM A;  3FS7 A;  1W7J B;  1NSH A;  3KHE A;  4HRH A;  2LHI A;  3I5H B;  2JPO A;  3CAB A;  1KSO A;  2LLS A;  2BCA A;  1EL4 A;  4OKH A;  1V1F A;  1K95 A;  2ZRT A;  1WLM A;  3DVM A;  1CLL A;  1Y1U A;  2L4H A;  3PN7 C;  1NWD A;  1XA5 A;  1DF0 B;  3AAJ A;  1AVS A;  3BOW B;  3SIB A;  2BAP A;  2JUL A;  4BY5 A;  1AP4 A;  3CS1 A;  3CR4 X;  1NX2 A;  4P2Y B;  1Z4H A;  3EK8 A;  1TCF A;  1IQ5 A;  1SRA A;  1YUT A;  2KYF A;  1OOG A;  1JC2 A;  2BE6 A;  1PSB A;  3S0D A;  3S0B A;  2M1U A;  5FYX A;  2WCH A;  4FTG A;  1J1E A;  1CB1 A;  1DJH A;  1QX5 B;  1YUS A;  2K60 A;  2NCP A;  2LNK A;  2EHB A;  1BMO A;  1LKJ A;  4GAO A;  2KQ6 A;  3S0A A;  5AAN A;  3NSK A;  1DMO A;  1FI5 A;  1FW4 A;  1K9U A;  5G08 A;  2H8V A;  2HET A;  3SG5 A;  3FWB A;  4C0J A;  1UHN A;  1KK8 C;  2JWW A;  1TUJ A;  2SCP A;  3WXA A;  5KU1 A;  2K2A A;  1M31 A;  3OP0 A;  1YRT B;  3PAL A;  2LVV A;  1BT6 A;  1SK6 D;  2KLE A;  1TCO B;  2K61 A;  1A2X A;  4GGN A;  3UO9 A;  1MXL C;  1M45 A;  1MQ1 A;  1WDC C;  2QEH A;  4PHK A;  1XO5 A;  2QDI A;  3LL8 B;  1BR1 B;  2LP2 A;  4XJK A;  1QX7 A;  1NCX A;  1IRJ A;  2JQ6 A;  3BFB A;  4CFQ A;  2KI6 D;  3R1O A;  1CMF A;  3CLN A;  2KFG A;  1OQP A;  2ZFD A;  4YBH B;  1CLM A;  2LE9 B;  1HQV A;  2LAP A;  4QJ4 B;  1QIW A;  2JT0 A;  4PHN A;  2BEC A;  1SBJ A;  1ORG A;  4JWQ A;  1NYA A;  1S5G Y;  2L4I A;  2LHL A;  2MRD A;  4OZD A;  2LMV A;  4MEW A;  2BNX A;  2F33 A;  2I7A A;  2WOR A;  1CFF A;  4GGF A;  3VRN A;  1H4B A;  1M39 A;  1SYM A;  3FWC A;  4N1F A;  3ZNI A;  3GOF A;  1CTR A;  5EL2 A;  1UUR A;  2ISD A;  1SCV A;  4MSP A;  5CSF A;  2WCM A;  2LVJ A;  5F6T A;  2H2K A;  1EJ3 A;  2CT9 A;  2KLD A;  1OOH A;  1TN4 A;  3SIA A;  4CPV A;  2VRG A;  1B8L A;  3OHM B;  1A03 A;  1CDP A;  2RGI A;  1ODB A;  1J7R A;  3TUY C;  1IKU A;  1B8C A;  1C07 A;  1GGZ A;  3QRX A;  3BFH A;  4ORA B;  2JRF A;  3BUX B;  4AOM A;  2M0R A;  4PHJ A;  4ETO A;  3O4Y A;  1UWO A;  1SL7 A;  1UHI A;  1SCM C;  3NHI A;  2COL B;  2PAL A;  4JQ0 D;  1OZS A;  1FPW A;  1E8A A;  4Q04 A;  3AKA A;  3LLE A;  5DKN A;  5HKW A;  1KK7 Z;  2WC8 A;  5K89 A;  1DTL A;  1SMG A;  2L2E A;  3ICB A;  1CM1 A;  2LVK A;  1KQM B;  2Y5I A;  2KFH A;  1IJ6 A;  1WRZ A;  2P6B B;  2R2I A;  1QTX A;  2KI4 B;  3JVT B;  2JPT A;  1PK0 D;  3EVU A;  1SR6 B;  4P5O E;  4GGF C;  4HSZ A;  5DKQ A;  3DXL A;  4HRG A;  3SG4 A;  4JPZ B;  4ORC B;  4GBA A;  3I5F C;  5ER5 A;  1XFZ O;  1LVC D;  2JTZ A;  2CBL A;  4CID A;  3VRO A;  1ALW A;  2MLF C;  2I2R E;  2M7N A;  4QJ5 B;  3I5G C;  2PVB A;  1QVI Z;  1ZMZ A;  3NXA A;  4KYN A;  2F2P A;  1Y1X A;  5D3O A;  2WC5 A;  1J1D A;  1TNP A;  3A4U B;  3DVJ A;  1NIW A;  2LMT A;  1Y1A A;  1WY9 A;  3EK4 A;  3LK1 A;  4PT1 A;  2GTE A;  3SS5 A;  4DUQ A;  1W7I B;  4PE7 A;  2CTN A;  4F0Z B;  3CZ0 A;  2P71 A;  3PFV A;  3PLF B;  1OOF A;  4ICB A;  2F3Y A;  1FBV A;  1W9Z A;  1B9A A;  4N1G A;  1PAL A;  2KHN A;  3K1E A;  5PAL A;  3IF7 A;  1UHK A;  1OMR A;  5ER4 X;  1DJZ A;  1UHJ A;  1C3Z A;  2KPH A;  2Q4U A;  1A75 B;  2LAN A;  1SL9 A;  2HPS A;  2M8U A;  2OTG B;  3KPX A;  2TN4 A;  1XK4 A;  2ZRS A;  3L4A A;  1TNQ A;  1BR4 B;  4CLN A;  2KAV A;  1J55 A;  3FE6 A;  2ZNE A;  3PM8 A;  4C0K A;  1DF0 A;  1OZO A;  3BOW A;  2NLN A;  4F7F A;  1TNW A;  2BBN A;  1KFU L;  2PSR A;  1JFJ A;  2M3W A;  2Q91 A;  4IJ7 A;  4DRW A;  1Y0V H;  3DF0 B;  4GUK A;  1B7T Z;  3VGO A;  3DVK A;  4R1E A;  2LVI A;  2O5G A;  1X02 A;  5I8N A;  1WRK A;  2LLU A;  2M1K B;  4D1E A;  1SY9 A;  2FOT A;  1AJ5 A;  1MUX A;  3CDN A;  1B47 A;  1UP5 A;  2CXJ A;  2K2F A;  4HRE E;  1CM4 A;  2Y1M A;  4I5K A;  1DJI A;  1PVA A;  2PQL A;  4PDZ A;  4FQO A;  4JKT A;  3TS5 C;  3H4S E;  3PJI A;  2KOT A;  2BL0 B;  2HQ8 A;  2L51 A;  3EKH A;  1TOP A;  3NSL A;  3VRR A;  3I5H C;  1JF2 A;  1CDL A;  3RZS A;  3BUN B;  5HYD A;  2K8M B;  2QEB A;  3DYE A;  3CGA A;  1NX0 A;  3CZ2 A;  2WCE A;  2OS8 B;  4OV2 A;  2G2B A;  1D1O A;  1Z2C B;  1BF5 A;  1CDN A;  1YUU A;  4OVN F;  1KWO B;  1EG3 A;  1G33 A;  1XFV O;  2QEO A;  1S1E A;  3BQ3 A;  3MSE B;  5B8I B;  5I94 A;  1YVL A;  1MR8 A;  3NHT A;  3TDU A;  3VRP A;  1REC A;  3OGN A;  4YGD B;  1C3Y A;  2GGZ A;  2KGB C;  4INW A;  4JD9 A;  1SL8 A;  3BFA A;  1M46 A;  1QS7 A;  2O60 A;  3PM2 A;  2CNP A;  1PRW A;  2BBM A;  1IJ5 A;  2V53 A;  5HKZ A;  1Q80 A;  3FE8 A;  2EC6 C;  2KYC A;  2FCD A;  1QV1 A;  1ZOT B;  4NDD A;  2LMU A;  1MHO A;  3S0E A;  1L2O C;  2MLE C;  4MN0 A;  4YGA A;  1K8U A;  2KQY A;  4MRY A;  1S26 D;  4ZCV A;  3BUO B;  2BCX A;  3I5I B;  3O4X A;  2Y1N A;  2L50 A;  4FQT A;  3D0Y B;  3D77 A;  1SW8 A;  4PE0 A;  5AER A;  1SKT A;  1DEK A;  3GK1 A;  2MHH A;  1CFP A;  3OBV A;  3WHT B;  1KK7 Y;  2JU0 A;  2KNE A;  2L98 A;  1YRU B;  2G9B A;  1OSA A;  2K7O A;  4M2P A;  1UHH A;  2AAO A;  1IWQ A;  1S5G Z;  3D78 A;  3OB1 B;  2M49 B;  4PHM A;  1QWV A;  5D7F A;  2D8N A;  1TNX A;  3JTD B;  1DJY A;  1CFC A;  3I5F B;  3VRQ A;  1KCY A;  4YGB B;  1KFX L;  3CR2 A;  1F8H A;  2OPO A;  1KSM A;  2LUC A;  3EK7 A;  1U5I A;  2K7D A;  2AUC A;  3OB2 B;  3BXK A;  1U5I B;  3D74 A;  3DD4 A;  3KO0 A;  1TRF A;  2H61 A;  1BU3 A;  3B7A A;  3LCP C;  1G4Y R;  3R72 A;  4QJ3 B;  3IQO A;  1S6I A;  1NX3 A;  4OR9 B;  2I18 A;  4YGE B;  4A4B A;  5GQQ C;  1F55 A;  1RWY A;  1QLK A;  3S0F A;  5FI7 A;  1QXP A;  1TUZ A;  2NCO A;  1YR5 A;  2IS9 A;  3FE9 A;  1K9K A;  1K9P A;  5CSI A;  2KGR A;  3HX4 A;  3B86 A;  5AXI A;  5BPJ A;  4WRI A;  5FI2 A;  1IGV A;  1NP8 A;  2KDH A;  2K0J A;  3BYA A;  2L2C A;  2B1U A;  1F4Q A;  1KFU S;  1DT7 B;  3CTN A;  1DJX A;  3SS4 A;  3CR5 X;  4OCI A;  2F8P A;  1CFD A;  1JSA A;  1QLS A;  5CSN A;  3SG6 A;  1JBA A;  3OX5 A;  4C0L A;  1SSE B;  4MZK A;  4YI9 A;  5JJG A;  2BE4 A;  1QJT A;  1IH0 A;  5JOL A;  3PN7 B;  1KQM C;  2JT8 A;  4M2O A;  2FJY A;  2MJW B;  1J7Q A;  3RM1 A;  1IG5 A;  1A75 A;  2CCM A;  2LLT A;  2WCK A;  1RJV A;  2ZN8 A;  1JFK A;  2KI4 C;  2JNX A;  1CMG A;  1RK9 A;  2LCP A;  1CNP A;  5IBW A;  3Q8I A;  1SR6 C;  1BG1 A;  2JXC A;  2YGU A;  3TDI A;  3CZT X;  2JNF A;  1YX8 A;  3PAT A;  3DF0 A;  1NCY A;  1CKK A;  3NSO A;  2LV7 A;  1N0Y A;  3BJH A;  3SS3 A;  2KSP A;  4GPL B;  2QAC A;  5TNC A;  1KQV A;  1OOI X;  1KK8 B;  1YVH A;  1NCZ A;  1OW4 A;  2M7L A;  1XFW O;  3IVT A;  4M2Q A;  1C7W A;  3L47 A;  3BUM B;  1MXE A;  3CWG A;  1S36 A;  2KBM A;  1AHR A;  2KAY A;  3M0W A;  4U8D A;  1LA0 A;  3SJS A;  3D10 A;  4DIR A;  2M29 A;  1WDC B;  2L5Y A;  4I5L B;  3AKB A;  1PSR A;  3C1V A;  3K21 A;  3OX6 A;  3PSR A;  5CSJ A;  1T14 A;  2WC6 A;  1K90 D;  1AUI B;  1QAS A;  3BUW B;  4USL A;  3SG7 A;  3SG3 A;  1B1G A;  1H8B A;  3B88 A;  1GQM A;  4NDC A;  1ZUZ A;  2JZI A;  1B8R A;  1RFJ A;  4ZCU A;  4TNC A;  1J7O A;  1FI6 A;  1K2H A;  1OMD A;  4MRX A;  1BLQ A;  4PAL A;  1B4C A;  1F71 A;  2WCL A;  1G8I A;  1VRK A;  3WNX B;  2M9G A;  2OTG C;  1GM0 A;  1GJY A;  2ZN9 A;  1BOD A;  3R1P A;  2PMY A;  1DJG A;  3DY9 A;  1XK4 C;  2E30 A;  2QPT A;  5J3X A;  1LA3 A;  1ALV A;  1XFR A;  2EGD A;  3ZWH A;  1UUS A;  4GFT A;  2PRU A;  2WCF A;  1MF8 B;  2LP3 A;  2EC6 B;  4GNK B;  1NPQ A;  2FJU B;  3DVE A;  3EKJ A;  2BKI B;  1QX2 A;  4CFR A;  1L2O B;  4WQ3 A;  1DGU A;  3LK0 A;  4INX A;  3D76 A;  1MWN A;  2KFF A;  2PAS A;  3IQQ A;  1TTX A;  4PE4 A;  2SAS A;  2KAX A;  3V2L A;  1K93 D;  1XFU O;  2E6W A;  3RLZ A;  4MZL A;  3TUY B;  4BY4 A;  2BL0 C;  3WHU B;  2MAZ A;  1JUO A;  4XJK B;  5HL1 A;  1BOC A;  3QME A;  3CYZ A;  4NQG A;  2K7C A;  4UPG A;  2P70 A;  3E3R A;  1KFX S;  1K94 A;  1SCM B;  4WQ2 A;  1IIO A;  3AAK A;  3D0Y A;  3GK4 X;  4A4C A;  5AEQ A;  2ERB A;  5HLV A;  3HCM A;  4MBE A;  3TZ1 A; 
#chains in the Genus database with same CATH homology
 2OS8 C;  1DVI A;  2GGM A;  1J7P A;  1OE9 B;  1KWO C;  1YTZ C;  2JTT A;  4YRU A;  1S6J A;  3GK2 A;  2HF5 A;  1DGV A;  1AK8 A;  1LXF C;  2GV5 A;  2MA2 A;  1GGW A;  1S3P A;  1HT9 A;  1F54 A;  1RTP 1;  2KI6 C;  1QAT A;  2AMI A;  3KEV A;  5CPV A;  3A8R A;  2JXL A;  2L5X B;  2L0P A;  1XYD A;  1L7Z A;  1EG4 A;  3FIA A;  1K96 A;  3I5G B;  4N5X A;  5I2L A;  4NDB A;  1XFY O;  1NX1 A;  1NUB A;  2BCB A;  3O78 A;  1YX7 A;  1JWD A;  2DOQ A;  2JT3 A;  4YI8 A;  1QIV A;  4XYN A;  1QVI Y;  5I2O A;  1SPY A;  1DJW A;  4DCK A;  1RRO A;  3I5I C;  1OMV A;  3O2P A;  2F3Z A;  3EVV A;  4IL1 A;  2MBX A;  1C7V A;  1A4P A;  1YUR A;  2JOJ A;  1M63 B;  5HKY A;  5DKR A;  1WRL A;  4YGC B;  4I5J A;  1CLB A;  1SNL A;  2NXQ A;  4MZJ A;  1FF1 A;  4MVF A;  1N65 A;  1XFX O;  4E68 A;  2HQW A;  1OOJ A;  2LUX A;  2WOS A;  1N2D A;  1QV0 A;  2ZND A;  2A4J A;  4ORB B;  5D69 A;  4I5N B;  2F2O A;  4DS7 A;  3NSI A;  3TDZ A;  1R2U A;  3JTD C;  3SG2 A;  1V1G A;  2KBI A;  5AFP A;  5I2Q A;  2M97 A;  3KF9 A;  4AQI A;  1EXR A;  1AJ4 A;  1PUL A;  2WCB A;  1IQ3 A;  2BKH B;  2FCE A;  3JVT C;  4PCW A;  1EH2 A;  4AQJ A;  5HLO A;  1R6P A;  2Y4Q A;  3F45 A;  5KSZ A;  4MLW A;  1Y6W A;  1B7T Y;  1A29 A;  1F4O A;  2NZ0 A;  2I94 A;  1ZAC A;  1PVB A;  1S6C A;  2JC2 A;  2LM5 A;  4L9M A;  1XVJ A;  2H61 C;  2ZKM X;  2WND A;  1ZFS A;  1BJF A;  1F70 A;  1JF0 A;  2LC5 A;  1WLZ A;  3O6B A;  1LIN A;  3TS5 B;  4PE1 A;  5KTY A;  2K7B A;  1TIZ A;  3EVR A;  1CDM A;  3FS7 A;  1W7J B;  1NSH A;  3KHE A;  4HRH A;  2LHI A;  3I5H B;  1KSO A;  2LLS A;  2BCA A;  1EL4 A;  4OKH A;  1V1F A;  1K95 A;  2ZRT A;  1WLM A;  3DVM A;  1CLL A;  1Y1U A;  2L4H A;  3PN7 C;  1NWD A;  1XA5 A;  1DF0 B;  3AAJ A;  1AVS A;  3BOW B;  3SIB A;  2JUL A;  4BY5 A;  1AP4 A;  3CS1 A;  3CR4 X;  1NX2 A;  4P2Y B;  3EK8 A;  1TCF A;  1IQ5 A;  1SRA A;  1YUT A;  2KYF A;  1JC2 A;  2BE6 A;  1PSB A;  2M1U A;  5FYX A;  4FTG A;  1J1E A;  1CB1 A;  1DJH A;  1QX5 B;  1YUS A;  2NCP A;  2LNK A;  2EHB A;  1BMO A;  1LKJ A;  4GAO A;  2KQ6 A;  5AAN A;  3NSK A;  1DMO A;  1FI5 A;  1FW4 A;  1K9U A;  5G08 A;  2HET A;  3SG5 A;  3FWB A;  4C0J A;  1UHN A;  1KK8 C;  2JWW A;  2SCP A;  3WXA A;  5KU1 A;  2K2A A;  1M31 A;  3OP0 A;  1YRT B;  3PAL A;  2LVV A;  1BT6 A;  1SK6 D;  1TCO B;  2K61 A;  1A2X A;  4GGN A;  1MXL C;  1M45 A;  1MQ1 A;  1WDC C;  4PHK A;  1XO5 A;  3LL8 B;  1BR1 B;  2LP2 A;  4XJK A;  1QX7 A;  1NCX A;  1IRJ A;  2JQ6 A;  4CFQ A;  2KI6 D;  1CMF A;  3CLN A;  2KFG A;  1OQP A;  2ZFD A;  4YBH B;  1CLM A;  2LE9 B;  1HQV A;  2LAP A;  4QJ4 B;  1QIW A;  2JT0 A;  4PHN A;  2BEC A;  1SBJ A;  4JWQ A;  1NYA A;  1S5G Y;  2L4I A;  2LHL A;  2MRD A;  2LMV A;  4MEW A;  2F33 A;  2I7A A;  2WOR A;  1CFF A;  4GGF A;  3VRN A;  1H4B A;  1M39 A;  1SYM A;  3FWC A;  4N1F A;  3ZNI A;  3GOF A;  1CTR A;  1UUR A;  2ISD A;  1SCV A;  4MSP A;  5CSF A;  2LVJ A;  5F6T A;  2H2K A;  1EJ3 A;  2CT9 A;  1TN4 A;  3SIA A;  4CPV A;  2VRG A;  1B8L A;  3OHM B;  1A03 A;  1CDP A;  2RGI A;  1ODB A;  1J7R A;  3TUY C;  1IKU A;  1B8C A;  1C07 A;  1GGZ A;  3QRX A;  4ORA B;  4AOM A;  2JRF A;  3BUX B;  2M0R A;  4PHJ A;  4ETO A;  3O4Y A;  1UWO A;  1SL7 A;  1UHI A;  1SCM C;  2COL B;  2PAL A;  4JQ0 D;  1OZS A;  1FPW A;  1E8A A;  4Q04 A;  3AKA A;  3LLE A;  5DKN A;  5HKW A;  1KK7 Z;  2WC8 A;  5K89 A;  1DTL A;  1SMG A;  2L2E A;  3ICB A;  1CM1 A;  2LVK A;  1KQM B;  2Y5I A;  2KFH A;  1IJ6 A;  1WRZ A;  2P6B B;  2R2I A;  1QTX A;  2KI4 B;  3JVT B;  2JPT A;  1PK0 D;  3EVU A;  1SR6 B;  4P5O E;  4GGF C;  4HSZ A;  5DKQ A;  4HRG A;  3SG4 A;  4JPZ B;  4ORC B;  4GBA A;  3I5F C;  5ER5 A;  1XFZ O;  1LVC D;  2JTZ A;  2CBL A;  4CID A;  3VRO A;  1ALW A;  2MLF C;  2I2R E;  2M7N A;  4QJ5 B;  3I5G C;  2PVB A;  1QVI Z;  1ZMZ A;  3NXA A;  2F2P A;  1Y1X A;  1J1D A;  1TNP A;  3A4U B;  3DVJ A;  1NIW A;  2LMT A;  1Y1A A;  1WY9 A;  3EK4 A;  3LK1 A;  4DUQ A;  4F0Z B;  1W7I B;  4PE7 A;  2CTN A;  3PFV A;  3PLF B;  4ICB A;  2F3Y A;  1FBV A;  4N1G A;  1B9A A;  1PAL A;  2KHN A;  5PAL A;  3IF7 A;  1UHK A;  1OMR A;  5ER4 X;  1DJZ A;  1UHJ A;  2Q4U A;  1A75 B;  2LAN A;  1SL9 A;  2HPS A;  2M8U A;  2OTG B;  3KPX A;  2TN4 A;  1XK4 A;  2ZRS A;  1TNQ A;  1BR4 B;  4CLN A;  2KAV A;  1J55 A;  2ZNE A;  3PM8 A;  4C0K A;  1DF0 A;  1OZO A;  3BOW A;  2NLN A;  1TNW A;  2BBN A;  1KFU L;  2PSR A;  1JFJ A;  2M3W A;  2Q91 A;  4DRW A;  1Y0V H;  3DF0 B;  4GUK A;  1B7T Z;  3VGO A;  3DVK A;  4R1E A;  2LVI A;  2O5G A;  1X02 A;  5I8N A;  1WRK A;  2LLU A;  2M1K B;  4D1E A;  1SY9 A;  2FOT A;  1AJ5 A;  1MUX A;  1B47 A;  1UP5 A;  2CXJ A;  2K2F A;  4HRE E;  1CM4 A;  2Y1M A;  4I5K A;  1DJI A;  1PVA A;  4PDZ A;  4FQO A;  3TS5 C;  3H4S E;  2KOT A;  2BL0 B;  2HQ8 A;  2L51 A;  3EKH A;  1TOP A;  3NSL A;  3VRR A;  3I5H C;  1JF2 A;  1CDL A;  3BUN B;  5HYD A;  2K8M B;  3CGA A;  1NX0 A;  2WCE A;  2OS8 B;  4OV2 A;  2G2B A;  1D1O A;  1BF5 A;  1CDN A;  1YUU A;  4OVN F;  1KWO B;  1EG3 A;  1G33 A;  1XFV O;  3BQ3 A;  1S1E A;  3MSE B;  5B8I B;  1YVL A;  1MR8 A;  3TDU A;  3VRP A;  1REC A;  4YGD B;  2GGZ A;  2KGB C;  1SL8 A;  1M46 A;  1QS7 A;  2O60 A;  2CNP A;  1PRW A;  2BBM A;  1IJ5 A;  2V53 A;  5HKZ A;  1Q80 A;  2EC6 C;  2KYC A;  2FCD A;  1QV1 A;  1ZOT B;  4NDD A;  2LMU A;  1MHO A;  1L2O C;  2MLE C;  4MN0 A;  4YGA A;  1K8U A;  2KQY A;  4MRY A;  1S26 D;  4ZCV A;  3BUO B;  2BCX A;  3I5I B;  2Y1N A;  2L50 A;  3D0Y B;  1SW8 A;  4PE0 A;  5AER A;  1SKT A;  3GK1 A;  2MHH A;  1CFP A;  3WHT B;  1KK7 Y;  2JU0 A;  2KNE A;  2L98 A;  1YRU B;  2G9B A;  1OSA A;  2K7O A;  4M2P A;  1UHH A;  2AAO A;  1IWQ A;  1S5G Z;  3OB1 B;  2M49 B;  4PHM A;  5D7F A;  2D8N A;  1TNX A;  3JTD B;  1DJY A;  1CFC A;  3I5F B;  3VRQ A;  1KCY A;  4YGB B;  1KFX L;  3CR2 A;  1F8H A;  2OPO A;  1KSM A;  2LUC A;  3EK7 A;  1U5I A;  2K7D A;  2AUC A;  3OB2 B;  3BXK A;  1U5I B;  3DD4 A;  3KO0 A;  1TRF A;  2H61 A;  1BU3 A;  3LCP C;  1G4Y R;  4QJ3 B;  3IQO A;  1S6I A;  1NX3 A;  4OR9 B;  2I18 A;  4YGE B;  4A4B A;  5GQQ C;  1F55 A;  1RWY A;  1QLK A;  1QXP A;  2NCO A;  1YR5 A;  2IS9 A;  1K9K A;  1K9P A;  5CSI A;  2KGR A;  3HX4 A;  5AXI A;  5BPJ A;  4WRI A;  1IGV A;  1NP8 A;  2KDH A;  2K0J A;  3BYA A;  2B1U A;  1F4Q A;  1KFU S;  1DT7 B;  3CTN A;  1DJX A;  3CR5 X;  4OCI A;  2F8P A;  1CFD A;  1JSA A;  1QLS A;  5CSN A;  3SG6 A;  1JBA A;  3OX5 A;  4C0L A;  4MZK A;  4YI9 A;  5JJG A;  2BE4 A;  1QJT A;  1IH0 A;  5JOL A;  3PN7 B;  1KQM C;  2JT8 A;  4M2O A;  2MJW B;  1J7Q A;  3RM1 A;  1IG5 A;  1A75 A;  2CCM A;  2LLT A;  2ZN8 A;  1RJV A;  1JFK A;  2KI4 C;  2JNX A;  1CMG A;  1RK9 A;  2LCP A;  1CNP A;  5IBW A;  1SR6 C;  1BG1 A;  2JXC A;  3TDI A;  3CZT X;  2JNF A;  1YX8 A;  3PAT A;  3DF0 A;  1NCY A;  1CKK A;  3NSO A;  2LV7 A;  1N0Y A;  2KSP A;  4GPL B;  2QAC A;  5TNC A;  1KQV A;  1KK8 B;  1YVH A;  1NCZ A;  2M7L A;  1XFW O;  4M2Q A;  1C7W A;  3BUM B;  1MXE A;  3CWG A;  1S36 A;  2KBM A;  1AHR A;  2KAY A;  3M0W A;  4U8D A;  1LA0 A;  3SJS A;  3D10 A;  4DIR A;  2M29 A;  1WDC B;  4I5L B;  3AKB A;  1PSR A;  3C1V A;  3K21 A;  3OX6 A;  3PSR A;  5CSJ A;  1K90 D;  1AUI B;  1QAS A;  3BUW B;  4USL A;  3SG7 A;  3SG3 A;  1B1G A;  1H8B A;  1GQM A;  4NDC A;  1ZUZ A;  2JZI A;  1B8R A;  1RFJ A;  4ZCU A;  4TNC A;  1J7O A;  1FI6 A;  1K2H A;  1OMD A;  4MRX A;  1BLQ A;  4PAL A;  1B4C A;  1F71 A;  1G8I A;  1VRK A;  3WNX B;  2M9G A;  2OTG C;  1GJY A;  2ZN9 A;  1BOD A;  2PMY A;  1DJG A;  1XK4 C;  2E30 A;  2QPT A;  5J3X A;  1LA3 A;  1ALV A;  2EGD A;  3ZWH A;  1UUS A;  4GFT A;  2PRU A;  2WCF A;  1MF8 B;  2LP3 A;  2EC6 B;  4GNK B;  1NPQ A;  2FJU B;  3DVE A;  3EKJ A;  2BKI B;  1QX2 A;  4CFR A;  1L2O B;  4WQ3 A;  1DGU A;  3LK0 A;  1MWN A;  2KFF A;  2PAS A;  3IQQ A;  1TTX A;  4PE4 A;  2SAS A;  2KAX A;  1K93 D;  1XFU O;  2E6W A;  3RLZ A;  4MZL A;  3TUY B;  4BY4 A;  2BL0 C;  3WHU B;  2MAZ A;  1JUO A;  4XJK B;  1BOC A;  4NQG A;  2K7C A;  4UPG A;  3E3R A;  1KFX S;  1K94 A;  1SCM B;  4WQ2 A;  3AAK A;  3D0Y A;  3GK4 X;  4A4C A;  5AEQ A;  3TZ1 A;  5HLV A;  3HCM A;  4MBE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...