1OSAA

Crystal structure of recombinant paramecium tetraurelia calmodulin at 1.68 angstroms resolution
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
148
structure length
148
Chain Sequence
AEQLTEEQIAEFKEAFALFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLSLMARKMKEQDSEEELIEAFKVFDRDGNGLISAAELRHVMTNLGEKLTDDEVDEMIREADIDGDGHINYEEFVRMMVSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Calcium-binding protein
molecule keywords CALMODULIN
publication title Structure of the recombinant Paramecium tetraurelia calmodulin at 1.68 A resolution.
pubmed doi rcsb
source organism Paramecium tetraurelia
total genus 53
structure length 148
sequence length 148
ec nomenclature
pdb deposition date 1993-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1osaA01
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1osaA02
1J55A 2LAPA 4YI8A 3DF0A 4MZLA 3AKAA 2BE6A 2KAVA 1OZOA 3I5FB 1FI5A 3PSRA 1XFVO 3JVTC 1CM4A 3C1VA 1KFXL 2PSRA 5CSNA 2KGRA 3KPXA 2JC2A 4PHJA 1C7WA 1BJFA 1ZACA 4DRWA 1XYDA 2AAOA 1TCFA 4NQGA 1QASA 1BF5A 1IKUA 2I18A 1J7RA 1SKTA 2DOQA 2JXLA 4C0KA 1D1OA 5F6TA 1S5GY 3LLEA 2BCXA 1YX8A 2JRFA 1IRJA 2JU0A 2KFGA 2LVVA 2WCFA 1DJGA 1RJVA 2Y1NA 1PALA 3FWBA 2LMTA 2ISDA 1YRUB 1CB1A 2M97A 3CTNA 1M45A 2JULA 2KI4B 3FIAA 2LVKA 1DJXA 1G4YR 4ICBA 1N0YA 1BT6A 1SR6C 4YBHB 5KSZA 2M7NA 1HQVA 5KU1A 2WC8A 3BUXB 1ALWA 5I8NA 1B47A 1IJ6A 1SYMA 1W7JB 1EH2A 2KYFA 3I5GC 1IWQA 2M1KB 3IF7A 4CFRA 2Y1MA 4ORAB 1GJYA 1DF0B 4ETOA 1NWDA 3CR2A 1KFXS 1NIWA 1BOCA 1ZFSA 4GNKB 4YI9A 4M2QA 2V53A 3BQ3A 1RTP1 4ORBB 2MHHA 1QATA 2F2OA 4L9MA 1S6JA 1JC2A 1PK0D 2E6WA 2JWWA 1AUIB 1WLZA 5I2LA 2TN4A 1TOPA 1CFPA 1DTLA 4C0JA 1S3PA 2K61A 5CPVA 1M39A 1FW4A 1BR4B 1KK7Y 2E30A 1YUUA 3KHEA 2GGMA 1OMRA 4MBEA 4NDBA 3WHUB 4AQIA 3TS5C 2K2FA 4GPLB 4I5NB 4HSZA 2GGZA 2RGIA 2MRDA 3VRPA 2F8PA 1DVIA 1ALVA 2JT8A 1IG5A 3SJSA 4YGCB 2M8UA 1C7VA 1FF1A 2CCMA 2HQWA 1LVCD 1TRFA 1ZMZA 2JTZA 1TNQA 2KFHA 1AJ5A 1QJTA 4WRIA 2BECA 2H61C 1WRKA 3O6BA 1DJIA 4I5LB 5DKQA 5KTYA 1QIWA 1B8RA 2KBMA 2I2RE 1L2OC 2R2IA 1A4PA 1L7ZA 2G2BA 1SCVA 2FCDA 2JXCA 2LE9B 3OX6A 1K2HA 1KK7Z 1NCXA 2HQ8A 3CR4X 3NSKA 4I5KA 3TDUA 3JTDC 3O4YA 2BKHB 1UUSA 3OHMB 5IBWA 1SK6D 1B1GA 2WCBA 2WOSA 2D8NA 2LC5A 4P5OE 1YR5A 1EG4A 2L4HA 1XFWO 1NX1A 1ZUZA 2LHIA 1NCZA 2BCBA 1A29A 3BXKA 1RWYA 3H4SE 4PCWA 4PHKA 1JSAA 1JWDA 1XFZO 3CGAA 3OP0A 2LP3A 2K2AA 1IGVA 1SCMB 2BKIB 3ICBA 2O60A 3PFVA 3NSIA 2KSPA 3PN7C 4M2OA 5HKYA 3GK2A 2JPTA 3IQQA 1A2XA 1YRTB 1KFUL 1RFJA 1DJWA 1WLMA 3JVTB 1CMFA 1JBAA 2K0JA 1SY9A 2KGBC 1SPYA 4GGFA 1Q80A 1A75A 1OOJA 1MHOA 2MA2A 2NCOA 1E8AA 1IH0A 1S6IA 1SNLA 3CR5X 5CSFA 3SG5A 3LK1A 2JNFA 3BYAA 1S1EA 4AOMA 4DS7A 5HLVA 1CLBA 1NX2A 2BL0C 1R2UA 1F71A 1NCYA 2KAYA 3D10A 3CS1A 4A4BA 4N1GA 1NX0A 2KQ6A 2BBMA 1KK8C 1GGZA 1DJYA 1UWOA 2M9GA 2LLSA 2WCEA 3OB2B 5PALA 4GGNA 1K93D 1U5IA 2M1UA 2H61A 1SL8A 2JTTA 2OS8C 1CTRA 1LXFC 3QRXA 4MRYA 1J7PA 3ZNIA 1SR6B 1TN4A 2B1UA 3BUOB 2CTNA 4USLA 1MF8B 2F3YA 2MLEC 1KCYA 5D69A 1OMDA 2KAXA 2PALA 1QX2A 2AMIA 4A4CA 3MSEB 3I5GB 4WQ2A 3LL8B 1B9AA 3TZ1A 3PATA 4YRUA 2ZFDA 2O5GA 2LV7A 3O78A 3PLFB 3VRNA 1MXEA 1MUXA 4YGBB 1KFUS 4MN0A 1CKKA 3NSLA 1R6PA 3WHTB 1BU3A 1XFXO 2CNPA 1RECA 1RK9A 1A03A 2ZN9A 1NP8A 1DGVA 1AJ4A 1N65A 1XFYO 1Y0VH 3PALA 1K96A 4N1FA 4PE1A 1MXLC 2L4IA 1A75B 4MEWA 4QJ3B 1JF2A 5DKRA 1CDLA 1CLMA 1TCOB 4YGDB 4E68A 1Y1XA 2JQ6A 3IQOA 2M3WA 3E3RA 3TS5B 4AQJA 1WDCC 2WORA 2HF5A 1Y6WA 3DF0B 3O2PA 1CMGA 2ZNDA 5HLOA 5I2QA 1F55A 3BUNB 1SW8A 3VRRA 1OZSA 2K8MB 1CDMA 3FS7A 3HCMA 2Y5IA 4GGFC 1PVAA 5AANA 1CFFA 4PE7A 4MRXA 1KSMA 4HRHA 1U5IB 4Q04A 2JT3A 1Y1UA 1JF0A 2CXJA 1YVLA 2JZIA 2BBNA 1BR1B 3BUWB 4MVFA 1OMVA 2LVIA 1AP4A 1EXRA 1M46A 4GAOA 2JT0A 2VRGA 1BODA 1L2OB 1YURA 1K9PA 3LK0A 1B8CA 1S26D 1TIZA 3CZTX 4M2PA 1F54A 1QIVA 1NUBA 3TDIA 5JJGA 1B8LA 1JUOA 1LKJA 1QX7A 2KHNA 3JTDB 3EK8A 2LCPA 2LMVA 1UP5A 3OX5A 1CFDA 2ZNEA 1BG1A 1K90D 2KDHA 1GQMA 2OTGC 1ODBA 5ER5A 1KQMC 1AHRA 3M0WA 1JFKA 2OPOA 2M49B 1N2DA 1KSOA 1RROA 1UHHA 3SG7A 1G8IA 2I7AA 1CDPA 2WNDA 4TNCA 4HRGA 1J7QA 1QTXA 3GK1A 1QVIZ 3TUYC 3BUMB 3DD4A 1J1DA 3PN7B 1TNXA 1DJHA 1PSRA 2ZRSA 5CSIA 3VGOA 1M31A 1OE9B 1OSAA 5GQQC 1F8HA 1UHKA 1UHNA 4D1EA 2LLUA 3SG3A 5D7FA 1K8UA 2M29A 2NXQA 1UHIA 1WY9A 3I5IC 2LUCA 2PASA 1IQ3A 5J3XA 1K94A 3PM8A 4CPVA 2BL0B 1MWNA 1F4OA 3KF9A 4ZCVA 1EJ3A 3KEVA 4CIDA 1DJZA 2KNEA 4UPGA 1NYAA 1KK8B 3DVKA 3F45A 1B7TY 3SG6A 2JNXA 1CLLA 1NSHA 1FPWA 1SL9A 1YUSA 2LLTA 1AVSA 3KO0A 4PALA 2K7OA 4YGAA 4XYNA 4JPZB 2HPSA 2LM5A 1J1EA 4P2YB 4GFTA 1YUTA 3DVMA 2L2EA 2Q91A 2LANA 1YVHA 2EC6C 2LUXA 2LMUA 1KQVA 1QX5B 2F33A 3LCPC 1FBVA 3SIAA 1K95A 4CLNA 5CSJA 5G08A 3EVUA 3RLZA 2L0PA 2KOTA 1C07A 4PE0A 4ORCB 5TNCA 2CBLA 5HYDA 1QS7A 1CFCA 1B7TZ 4JWQA 5K89A 2ZRTA 4ZCUA 4C0LA 2KYCA 4U8DA 4GBAA 1S6CA 1KWOC 3EVVA 1QV1A 3K21A 3I5HC 1WDCB 4QJ4B 1BLQA 1WRZA 2BE4A 2Q4UA 2IS9A 2L98A 3I5FC 2EGDA 2I94A 4N5XA 4OR9B 4OVNF 2AUCA 5BPJA 3GOFA 2LVJA 4OV2A 2L51A 2SASA 3EKHA 1CDNA 5HKZA 1XFUO 1TNPA 4MLWA 2JOJA 2F3ZA 1QLKA 1UHJA 4YGEB 2HETA 1NPQA 1TTXA 1QXPA 4F0ZB 4JQ0D 4NDDA 2LP2A 1XK4C 4FQOA 2M7LA 2NCPA 2QACA 3WNXB 1EL4A 3BOWA 4QJ5B 3NSOA 3D0YA 1MQ1A 1SRAA 2FJUB 2M0RA 2KQYA 1H4BA 2KI4C 2K7DA 1AK8A 2PMYA 3DVJA 2EHBA 3HX4A 4DIRA 1F70A 5AERA 1QVIY 2FCEA 5AXIA 1LA0A 3EKJA 2K7BA 3AKBA 5ER4X 3A8RA 1S5GZ 2OTGB 2PRUA 4GUKA 1KQMB 1PVBA 4HREE 5AEQA 4WQ3A 1SL7A 5DKNA 1W7IB 3EK4A 4MSPA 1JFJA 4NDCA 1HT9A 3CWGA 4XJKA 1X02A 3TUYB 1K9KA 1CNPA 3AAKA 2KFFA 4BY5A 3SG2A 1CM1A 5I2OA 2GV5A 1M63B 2H2KA 3TDZA 1B4CA 4MZKA 3VROA 2KI6C 2ZKMX 3ZWHA 3OB1B 1YX7A 4FTGA 2LNKA 4PDZA 3I5IB 3SG4A 3WXAA 1DGUA 1XO5A 1SMGA 3DVEA 1J7OA 1G33A 1VRKA 3VRQA 2L5XB 3EK7A 3CLNA 2L50A 2NZ0A 2KI6D 1XVJA 1V1GA 4OCIA 3BOWB 2A4JA 3AAJA 3EVRA 3D0YB 1DMOA 2MLFC 1EG3A 2F2PA 1UURA 1S36A 1DT7B 3FWCA 1YTZC 4IL1A 1K9UA 1IJ5A 1Y1AA 4R1EA 1LA3A 4BY4A 5B8IB 4PHMA 1PSBA 1XK4A 1F4QA 1QV0A 3SIBA 1SBJA 4PE4A 1ZOTB 1NX3A 2COLB 1TNWA 4PHNA 2KBIA 3NXAA 2MBXA 1LINA 2MAZA 1WRLA 2EC6B 2MJWB 2OS8B 4MZJA 4OKHA 1MR8A 1PULA 2ZN8A 2PVBA 5FYXA 4XJKB 4I5JA 1XA5A 3GK4X 1BMOA 2K7CA 5AFPA 1IQ5A 2CT9A 4CFQA 1OQPA 3A4UB 1GGWA 1FI6A 1H8BA 2P6BB 2G9BA 2SCPA 2Y4QA 2NLNA 5JOLA 3RM1A 1DF0A 2LHLA 5HKWA 4DCKA 2QPTA 1V1FA 1QLSA 1KWOB 1PRWA 2BCAA 1SCMC 4DUQA 2FOTA 3I5HB
chains in the Genus database with same CATH superfamily
1J55A 3BFBA 2LAPA 4YI8A 3DF0A 4MZLA 3AKAA 2BE6A 2KAVA 1OZOA 3I5FB 1FI5A 3PSRA 1XFVO 3JVTC 1CM4A 3C1VA 1KFXL 2PSRA 5CSNA 2KGRA 3KPXA 2JC2A 4PHJA 1TUJA 1C7WA 1BJFA 1TUZA 1ZACA 4DRWA 1XYDA 2AAOA 1TCFA 4NQGA 1QASA 3UNWA 1BF5A 3NGVA 1IKUA 2I18A 1J7RA 1IIOA 1SKTA 2DOQA 2JXLA 4C0KA 1D1OA 5F6TA 1S5GY 3LLEA 1OOFA 2BCXA 1YX8A 2JRFA 1IRJA 2JU0A 2KFGA 2LVVA 2WCFA 1DJGA 1RJVA 2Y1NA 1PALA 3FWBA 2LMTA 2ISDA 1YRUB 1CB1A 2M97A 3CTNA 3DY9A 1M45A 2JULA 2KI4B 3FIAA 2LVKA 1DJXA 1G4YR 4ICBA 1N0YA 1BT6A 1SR6C 2GTEA 4YBHB 5KSZA 2M7NA 1HQVA 5KU1A 2WC8A 3BUXB 1ALWA 5I8NA 1B47A 1IJ6A 1SYMA 1W7JB 1EH2A 2KYFA 3I5GC 1IWQA 2M1KB 3IF7A 5DICA 4CFRA 2Y1MA 4ORAB 3D77A 1GJYA 1DF0B 1C3ZA 4ETOA 4JD9A 1NWDA 3CR2A 1KFXS 1NIWA 2QEHA 1BOCA 1ZFSA 4GNKB 4OZDA 4YI9A 4M2QA 2V53A 3BQ3A 1RTP1 4ORBB 2MHHA 1QATA 2F2OA 4L9MA 1S6JA 1JC2A 1PK0D 2E6WA 2JWWA 1AUIB 1WLZA 5I2LA 2TN4A 1TOPA 1CFPA 1DTLA 4C0JA 1S3PA 2K61A 3DXLA 5CPVA 2KPHA 1M39A 1FW4A 1BR4B 1KK7Y 2E30A 1YUUA 3KHEA 2GGMA 1OMRA 4MBEA 3D76A 4NDBA 3WHUB 3TS5C 4AQIA 2K2FA 4GPLB 4I5NB 4HSZA 2GGZA 2RGIA 3BJHA 2MRDA 3VRPA 2F8PA 1DVIA 1ALVA 2JT8A 1IG5A 3SJSA 2BNXA 2M8UA 4YGCB 1C7VA 2CCMA 2HQWA 3D73A 1LVCD 1TRFA 1ZMZA 2JTZA 1TNQA 2KFHA 2PYQA 1AJ5A 1QJTA 4WRIA 2BECA 2H61C 2YGUA 1WRKA 3O6BA 1DJIA 2P70A 4I5LB 1T14A 5DKQA 5KTYA 1QIWA 1B8RA 2KBMA 2I2RE 1L2OC 2R2IA 3FE9A 1A4PA 5HL1A 1L7ZA 2G2BA 1SCVA 2FCDA 2JXCA 5D3OA 2LE9B 3OX6A 1K2HA 1KK7Z 1NCXA 2HQ8A 3D75A 3CR4X 3NSKA 4I5KA 3TDUA 2QDIA 3JTDC 3O4YA 2BKHB 3R1OA 1UUSA 3OHMB 5IBWA 1SK6D 1B1GA 2WCBA 2WOSA 2D8NA 2LC5A 4P5OE 1YR5A 1EG4A 2L4HA 2JPOA 1XFWO 1NX1A 1ZUZA 2LHIA 1NCZA 2BCBA 1A29A 2QEBA 3BXKA 1RWYA 3H4SE 4PCWA 4PHKA 1JSAA 1JWDA 1XFZO 3CGAA 3OP0A 2LP3A 2K2AA 1IGVA 1SCMB 2BKIB 3ICBA 2O60A 3PFVA 3NSIA 2KSPA 3PN7C 4M2OA 5HKYA 3GK2A 3D74A 2JPTA 3IQQA 1A2XA 1YRTB 1KFUL 1ORGA 1DJWA 1RFJA 1WLMA 3JVTB 3O4XA 1JBAA 2K0JA 1SY9A 2KGBC 1SPYA 3CDNA 4GGFA 1Q80A 1A75A 1OOJA 1MHOA 2MA2A 2NCOA 1E8AA 5FI2A 1IH0A 1S6IA 1SNLA 3VB1A 3CR5X 5CSFA 3SG5A 3LK1A 3PM2A 1LS8A 2JNFA 3BYAA 1S1EA 4AOMA 4DS7A 5HLVA 1CLBA 1NX2A 1SSEB 3NHTA 2BL0C 1R2UA 4PT1A 1F71A 3B7AA 1NCYA 2KAYA 3SS4A 3D10A 3CS1A 4A4BA 4N1GA 1NX0A 2KQ6A 2BBMA 1KK8C 1GGZA 1DJYA 1UWOA 2M9GA 2LLSA 2WCEA 3OB2B 5PALA 4GGNA 1K93D 1U5IA 2M1UA 2H61A 1SL8A 2JTTA 2OS8C 1CTRA 1LXFC 2P71A 3QRXA 4MRYA 1J7PA 3ZNIA 1SR6B 1TN4A 2B1UA 3BUOB 2CTNA 3QMEA 1MF8B 3BFAA 1W9ZA 4USLA 2F3YA 2MLEC 5FI7A 1KCYA 5D69A 1OMDA 2KAXA 2PALA 1QX2A 2AMIA 4A4CA 3MSEB 2BAPA 3I5GB 4FQTA 4WQ2A 3LL8B 1B9AA 3TZ1A 3PATA 4YRUA 2ZFDA 2O5GA 2LV7A 3O78A 3PLFB 3VRNA 1MXEA 1MUXA 1OOHA 4YGBB 1KFUS 4MN0A 1CKKA 3NSLA 1R6PA 1DQEA 3UO9A 3WHTB 1BU3A 1XFXO 2CNPA 3FE8A 2WCJA 1RECA 1RK9A 1A03A 2ZN9A 3NHIA 1Z4HA 1NP8A 1DGVA 1AJ4A 1N65A 1XFYO 1Y0VH 3PALA 1K96A 3D78A 4N1FA 4PE1A 1MXLC 2L4IA 1A75B 4MEWA 4QJ3B 1JF2A 5DKRA 1CDLA 3S0EA 1CLMA 1TCOB 4YGDB 3L4LA 4E68A 1Y1XA 2JQ6A 3IQOA 2M3WA 3E3RA 3TS5B 4AQJA 1WDCC 2WORA 1XFRA 2HF5A 1Y6WA 3DF0B 3O2PA 1CMGA 2ZNDA 5HLOA 5I2QA 1F55A 3BUNB 1SW8A 3CZ1A 1OZSA 3VRRA 2K8MB 1CDMA 3FS7A 4IJ7A 3HCMA 2PQLA 2Y5IA 4GGFC 1PVAA 5AANA 1CFFA 4PE7A 4MRXA 1KSMA 3CZ0A 4HRHA 1U5IB 4Q04A 2JT3A 1Y1UA 1JF0A 2CXJA 1YVLA 2JZIA 2BBNA 2WCLA 1BR1B 4F7FA 4INWA 3BUWB 4MVFA 1OMVA 3SS3A 2LVIA 1AP4A 1EXRA 1M46A 4GAOA 2JT0A 2VRGA 1BODA 1L2OB 1YURA 1K9PA 3LK0A 1B8CA 1S26D 1TIZA 3RZSA 3CZTX 4M2PA 1F54A 1QIVA 1NUBA 2QEVA 3TDIA 5JJGA 1B8LA 3K1EA 1JUOA 1LKJA 1QX7A 2KHNA 3JTDB 3EK8A 2LCPA 2LMVA 1UP5A 3OX5A 3V2LA 1CFDA 2ZNEA 1BG1A 3Q8IA 1K90D 2KDHA 1GQMA 2OTGC 1ODBA 5ER5A 1KQMC 1AHRA 3M0WA 1GM0A 1JFKA 3S0GA 2OPOA 2M49B 1N2DA 1KSOA 1RROA 1UHHA 3SG7A 1G8IA 2I7AA 2WC6A 3OBVA 1CDPA 2WNDA 4TNCA 4HRGA 1J7QA 1QTXA 3GK1A 1QVIZ 1DC1A 3TUYC 3BUMB 3DD4A 1J1DA 1Z2CB 2L2CA 3PN7B 1TNXA 1DJHA 1PSRA 2ZRSA 5CSIA 3VGOA 3SS5A 1M31A 1OE9B 1OSAA 5GQQC 1F8HA 1UHKA 1UHNA 4D1EA 2LLUA 3SG3A 5D7FA 1K8UA 3IVTA 2M29A 2NXQA 1UHIA 1WY9A 3I5IC 3N7HA 2LUCA 2PASA 1IQ3A 5J3XA 1K94A 3R72A 3PM8A 4CPVA 2BL0B 1MWNA 1F4OA 2KLDA 3KF9A 4ZCVA 1EJ3A 3KEVA 4CIDA 1DJZA 2KNEA 3EG5B 4UPGA 1NYAA 1KK8B 3DVKA 3F45A 1B7TY 3OGNA 3SG6A 2JNXA 1CLLA 1NSHA 1FPWA 1SL9A 1YUSA 2LLTA 1AVSA 1DELA 3KO0A 4PALA 2K7OA 4YGAA 4XYNA 4JPZB 2HPSA 2LM5A 3S0BA 1J1EA 4P2YB 2WCKA 2K60A 4GFTA 1YUTA 3DVMA 3S0FA 2L2EA 2Q91A 2LANA 1YVHA 2WC5A 2EC6C 2LUXA 2LMUA 1OW4A 3L4AA 1KQVA 1QX5B 2F33A 3LCPC 1FBVA 3SIAA 1K95A 4CLNA 5CSJA 2ERBA 5G08A 3EVUA 3RLZA 2L0PA 3CABA 2KOTA 1C07A 4PE0A 2KLEA 4ORCB 5TNCA 2CBLA 5HYDA 1QS7A 1CFCA 1B7TZ 4JWQA 5K89A 2ZRTA 4ZCUA 4C0LA 2KYCA 4U8DA 4GBAA 1S6CA 1P28A 1KWOC 3EVVA 1QV1A 3K21A 3S0DA 3I5HC 3L47A 1WDCB 4QJ4B 1BLQA 1WRZA 2BE4A 2Q4UA 2WCHA 2IS9A 2L98A 3I5FC 2EGDA 2I94A 4N5XA 4OR9B 4OVNF 2AUCA 3S0AA 5BPJA 3GOFA 2LVJA 4OV2A 2L51A 2SASA 3EKHA 1CDNA 5HKZA 1XFUO 1TNPA 4MLWA 5FI6A 2JOJA 2F3ZA 1QLKA 1UHJA 4YGEB 2HETA 1NPQA 1TTXA 1QWVA 1FF1A 2WCMA 3B88A 1QXPA 4F0ZB 4JQ0D 4NDDA 2LP2A 1XK4C 4FQOA 2M7LA 2NCPA 2QACA 3WNXB 1EL4A 3BOWA 4QJ5B 3NSOA 3D0YA 1MQ1A 1SRAA 2FJUB 2M0RA 2KQYA 2FJYA 1H4BA 2KI4C 2K7DA 1AK8A 2PMYA 3DVJA 2EHBA 3HX4A 4KYNA 4DIRA 5AERA 1F70A 1QVIY 2FCEA 5AXIA 1LA0A 3EKJA 2K7BA 3AKBA 3CZ2A 5ER4X 3A8RA 1S5GZ 2OTGB 2PRUA 4GUKA 1KQMB 1PVBA 4HREE 5AEQA 5EL2A 3FE6A 4WQ3A 1SL7A 5DKNA 1W7IB 3EK4A 4MSPA 5I94A 1JFJA 4NDCA 2QEOA 1HT9A 3CWGA 4XJKA 1X02A 3TUYB 1K9KA 1CNPA 3AAKA 2KFFA 4BY5A 3SG2A 1CM1A 1CMFA 5I2OA 2GV5A 1M63B 2H2KA 3TDZA 1B4CA 4MZKA 3PJIA 2KI6C 1DEKA 3VROA 2ZKMX 3ZWHA 3OB1B 1YX7A 4FTGA 2LNKA 4PDZA 3I5IB 3SG4A 3WXAA 1DGUA 1XO5A 1SMGA 3DVEA 1J7OA 1G33A 1VRKA 3VRQA 2L5XB 3EK7A 3CLNA 2L50A 3DZTA 2NZ0A 2H8VA 2KI6D 1XVJA 1V1GA 4OCIA 3BOWB 3R1VA 2A4JA 3AAJA 3EVRA 3D0YB 1DMOA 2MLFC 1EG3A 2F2PA 1UURA 1S36A 1DT7B 3FWCA 1YTZC 4IL1A 1K9UA 1IJ5A 1Y1AA 4R1EA 1LA3A 1TWOA 4BY4A 4PHMA 1PSBA 1XK4A 5B8IB 1F4QA 1QV0A 3SIBA 1SBJA 4PE4A 1ZOTB 1NX3A 2COLB 1TNWA 4PHNA 2KBIA 1OOGA 3DYEA 3NXAA 2MBXA 1LINA 2MAZA 1WRLA 2EC6B 2MJWB 2OS8B 4MZJA 4OKHA 1MR8A 1PULA 4JKTA 2L5YA 2ZN8A 2PVBA 3R1PA 5FYXA 4XJKB 3B87A 4I5JA 1XA5A 3GK4X 3B6XA 1BMOA 2K7CA 5AFPA 3BFHA 1IQ5A 1OOIX 3B86A 2CT9A 4CFQA 1OQPA 1C3YA 3A4UB 1GGWA 1FI6A 1H8BA 4INXA 2P6BB 2G9BA 2SCPA 2Y4QA 2NLNA 5JOLA 3RM1A 1DF0A 2LHLA 5HKWA 4DCKA 2QPTA 1V1FA 1QLSA 1KWOB 3CYZA 1PRWA 2BCAA 1SCMC 4DUQA 2FOTA 3I5HB
chains in the Genus database with same CATH topology
1J55A 2LAPA 4YI8A 3DF0A 4MZLA 3AKAA 2BE6A 2KAVA 1OZOA 3I5FB 1FI5A 3PSRA 1XFVO 3JVTC 1CM4A 3C1VA 1KFXL 2PSRA 5CSNA 2KGRA 3KPXA 2JC2A 4PHJA 1C7WA 1BJFA 1ZACA 4DRWA 1XYDA 2AAOA 1TCFA 4NQGA 1QASA 1BF5A 1IKUA 2I18A 1J7RA 1SKTA 2DOQA 2JXLA 4C0KA 1D1OA 5F6TA 1S5GY 3LLEA 2BCXA 1YX8A 2JRFA 1IRJA 2JU0A 2KFGA 2LVVA 2WCFA 1DJGA 1RJVA 2Y1NA 1PALA 3FWBA 2LMTA 2ISDA 1YRUB 1CB1A 2M97A 3CTNA 1M45A 2JULA 2KI4B 3FIAA 2LVKA 1DJXA 1G4YR 4ICBA 1N0YA 1BT6A 1SR6C 4YBHB 5KSZA 2M7NA 1HQVA 5KU1A 2WC8A 3BUXB 1ALWA 5I8NA 1B47A 1IJ6A 1SYMA 1W7JB 1EH2A 2KYFA 3I5GC 1IWQA 2M1KB 3IF7A 4CFRA 2Y1MA 4ORAB 1GJYA 1DF0B 4ETOA 1NWDA 3CR2A 1KFXS 1NIWA 1BOCA 1ZFSA 4GNKB 4YI9A 4M2QA 2V53A 3BQ3A 1RTP1 4ORBB 2MHHA 1QATA 2F2OA 4L9MA 1S6JA 1JC2A 1PK0D 2E6WA 2JWWA 1AUIB 1WLZA 5I2LA 2TN4A 1TOPA 1CFPA 1DTLA 4C0JA 1S3PA 2K61A 5CPVA 1M39A 1FW4A 1BR4B 1KK7Y 2E30A 1YUUA 3KHEA 2GGMA 1OMRA 4MBEA 4NDBA 3WHUB 4AQIA 3TS5C 2K2FA 4GPLB 4I5NB 4HSZA 2GGZA 2RGIA 2MRDA 3VRPA 2F8PA 1DVIA 1ALVA 2JT8A 1IG5A 3SJSA 4YGCB 2M8UA 1C7VA 1FF1A 2CCMA 2HQWA 1LVCD 1TRFA 1ZMZA 2JTZA 1TNQA 2KFHA 1AJ5A 1QJTA 4WRIA 2BECA 2H61C 1WRKA 3O6BA 1DJIA 4I5LB 5DKQA 5KTYA 1QIWA 1B8RA 2KBMA 2I2RE 1L2OC 2R2IA 1A4PA 1L7ZA 2G2BA 1SCVA 2FCDA 2JXCA 2LE9B 3OX6A 1K2HA 1KK7Z 1NCXA 2HQ8A 3CR4X 3NSKA 4I5KA 3TDUA 3JTDC 3O4YA 2BKHB 1UUSA 3OHMB 5IBWA 1SK6D 1B1GA 2WCBA 2WOSA 2D8NA 2LC5A 4P5OE 1YR5A 1EG4A 2L4HA 1XFWO 1NX1A 1ZUZA 2LHIA 1NCZA 2BCBA 1A29A 3BXKA 1RWYA 3H4SE 4PCWA 4PHKA 1JSAA 1JWDA 1XFZO 3CGAA 3OP0A 2LP3A 2K2AA 1IGVA 1SCMB 2BKIB 3ICBA 2O60A 3PFVA 3NSIA 2KSPA 3PN7C 4M2OA 5HKYA 3GK2A 2JPTA 3IQQA 1A2XA 1YRTB 1KFUL 1RFJA 1DJWA 1WLMA 3JVTB 1CMFA 1JBAA 2K0JA 1SY9A 2KGBC 1SPYA 4GGFA 1Q80A 1A75A 1OOJA 1MHOA 2MA2A 2NCOA 1E8AA 1IH0A 1S6IA 1SNLA 3CR5X 5CSFA 3SG5A 3LK1A 2JNFA 3BYAA 1S1EA 4AOMA 4DS7A 5HLVA 1CLBA 1NX2A 2BL0C 1R2UA 1F71A 1NCYA 2KAYA 3D10A 3CS1A 4A4BA 4N1GA 1NX0A 2KQ6A 2BBMA 1KK8C 1GGZA 1DJYA 1UWOA 2M9GA 2LLSA 2WCEA 3OB2B 5PALA 4GGNA 1K93D 1U5IA 2M1UA 2H61A 1SL8A 2JTTA 2OS8C 1CTRA 1LXFC 3QRXA 4MRYA 1J7PA 3ZNIA 1SR6B 1TN4A 2B1UA 3BUOB 2CTNA 4USLA 1MF8B 2F3YA 2MLEC 1KCYA 5D69A 1OMDA 2KAXA 2PALA 1QX2A 2AMIA 4A4CA 3MSEB 3I5GB 4WQ2A 3LL8B 1B9AA 3TZ1A 3PATA 4YRUA 2ZFDA 2O5GA 2LV7A 3O78A 3PLFB 3VRNA 1MXEA 1MUXA 4YGBB 1KFUS 4MN0A 1CKKA 3NSLA 1R6PA 3WHTB 1BU3A 1XFXO 2CNPA 1RECA 1RK9A 1A03A 2ZN9A 1NP8A 1DGVA 1AJ4A 1N65A 1XFYO 1Y0VH 3PALA 1K96A 4N1FA 4PE1A 1MXLC 2L4IA 1A75B 4MEWA 4QJ3B 1JF2A 5DKRA 1CDLA 1CLMA 1TCOB 4YGDB 4E68A 1Y1XA 2JQ6A 3IQOA 2M3WA 3E3RA 3TS5B 4AQJA 1WDCC 2WORA 2HF5A 1Y6WA 3DF0B 3O2PA 1CMGA 2ZNDA 5HLOA 5I2QA 1F55A 3BUNB 1SW8A 3VRRA 1OZSA 2K8MB 1CDMA 3FS7A 3HCMA 2Y5IA 4GGFC 1PVAA 5AANA 1CFFA 4PE7A 4MRXA 1KSMA 4HRHA 1U5IB 4Q04A 2JT3A 1Y1UA 1JF0A 2CXJA 1YVLA 2JZIA 2BBNA 1BR1B 3BUWB 4MVFA 1OMVA 2LVIA 1AP4A 1EXRA 1M46A 4GAOA 2JT0A 2VRGA 1BODA 1L2OB 1YURA 1K9PA 3LK0A 1B8CA 1S26D 1TIZA 3CZTX 4M2PA 1F54A 1QIVA 1NUBA 3TDIA 5JJGA 1B8LA 1JUOA 1LKJA 1QX7A 2KHNA 3JTDB 3EK8A 2LCPA 2LMVA 1UP5A 3OX5A 1CFDA 2ZNEA 1BG1A 1K90D 2KDHA 1GQMA 2OTGC 1ODBA 5ER5A 1KQMC 1AHRA 3M0WA 1JFKA 2OPOA 2M49B 1N2DA 1KSOA 1RROA 1UHHA 3SG7A 1G8IA 2I7AA 1CDPA 2WNDA 4TNCA 4HRGA 1J7QA 1QTXA 3GK1A 1QVIZ 3TUYC 3BUMB 3DD4A 1J1DA 3PN7B 1TNXA 1DJHA 1PSRA 2ZRSA 5CSIA 3VGOA 1M31A 1OE9B 1OSAA 5GQQC 1F8HA 1UHKA 1UHNA 4D1EA 2LLUA 3SG3A 5D7FA 1K8UA 2M29A 2NXQA 1UHIA 1WY9A 3I5IC 2LUCA 2PASA 1IQ3A 5J3XA 1K94A 3PM8A 4CPVA 2BL0B 1MWNA 1F4OA 3KF9A 4ZCVA 1EJ3A 3KEVA 4CIDA 1DJZA 2KNEA 4UPGA 1NYAA 1KK8B 3DVKA 3F45A 1B7TY 3SG6A 2JNXA 1CLLA 1NSHA 1FPWA 1SL9A 1YUSA 2LLTA 1AVSA 3KO0A 4PALA 2K7OA 4YGAA 4XYNA 4JPZB 2HPSA 2LM5A 1J1EA 4P2YB 4GFTA 1YUTA 3DVMA 2L2EA 2Q91A 2LANA 1YVHA 2EC6C 2LUXA 2LMUA 1KQVA 1QX5B 2F33A 3LCPC 1FBVA 3SIAA 1K95A 4CLNA 5CSJA 5G08A 3EVUA 3RLZA 2L0PA 2KOTA 1C07A 4PE0A 4ORCB 5TNCA 2CBLA 5HYDA 1QS7A 1CFCA 1B7TZ 4JWQA 5K89A 2ZRTA 4ZCUA 4C0LA 2KYCA 4U8DA 4GBAA 1S6CA 1KWOC 3EVVA 1QV1A 3K21A 3I5HC 1WDCB 4QJ4B 1BLQA 1WRZA 2BE4A 2Q4UA 2IS9A 2L98A 3I5FC 2EGDA 2I94A 4N5XA 4OR9B 4OVNF 2AUCA 5BPJA 3GOFA 2LVJA 4OV2A 2L51A 2SASA 3EKHA 1CDNA 5HKZA 1XFUO 1TNPA 4MLWA 2JOJA 2F3ZA 1QLKA 1UHJA 4YGEB 2HETA 1NPQA 1TTXA 1QXPA 4F0ZB 4JQ0D 4NDDA 2LP2A 1XK4C 4FQOA 2M7LA 2NCPA 2QACA 3WNXB 1EL4A 3BOWA 4QJ5B 3NSOA 3D0YA 1MQ1A 1SRAA 2FJUB 2M0RA 2KQYA 1H4BA 2KI4C 2K7DA 1AK8A 2PMYA 3DVJA 2EHBA 3HX4A 4DIRA 1F70A 5AERA 1QVIY 2FCEA 5AXIA 1LA0A 3EKJA 2K7BA 3AKBA 5ER4X 3A8RA 1S5GZ 2OTGB 2PRUA 4GUKA 1KQMB 1PVBA 4HREE 5AEQA 4WQ3A 1SL7A 5DKNA 1W7IB 3EK4A 4MSPA 1JFJA 4NDCA 1HT9A 3CWGA 4XJKA 1X02A 3TUYB 1K9KA 1CNPA 3AAKA 2KFFA 4BY5A 3SG2A 1CM1A 5I2OA 2GV5A 1M63B 2H2KA 3TDZA 1B4CA 4MZKA 3VROA 2KI6C 2ZKMX 3ZWHA 3OB1B 1YX7A 4FTGA 2LNKA 4PDZA 3I5IB 3SG4A 3WXAA 1DGUA 1XO5A 1SMGA 3DVEA 1J7OA 1G33A 1VRKA 3VRQA 2L5XB 3EK7A 3CLNA 2L50A 2NZ0A 2KI6D 1XVJA 1V1GA 4OCIA 3BOWB 2A4JA 3AAJA 3EVRA 3D0YB 1DMOA 2MLFC 1EG3A 2F2PA 1UURA 1S36A 1DT7B 3FWCA 1YTZC 4IL1A 1K9UA 1IJ5A 1Y1AA 4R1EA 1LA3A 4BY4A 5B8IB 4PHMA 1PSBA 1XK4A 1F4QA 1QV0A 3SIBA 1SBJA 4PE4A 1ZOTB 1NX3A 2COLB 1TNWA 4PHNA 2KBIA 3NXAA 2MBXA 1LINA 2MAZA 1WRLA 2EC6B 2MJWB 2OS8B 4MZJA 4OKHA 1MR8A 1PULA 2ZN8A 2PVBA 5FYXA 4XJKB 4I5JA 1XA5A 3GK4X 1BMOA 2K7CA 5AFPA 1IQ5A 2CT9A 4CFQA 1OQPA 3A4UB 1GGWA 1FI6A 1H8BA 2P6BB 2G9BA 2SCPA 2Y4QA 2NLNA 5JOLA 3RM1A 1DF0A 2LHLA 5HKWA 4DCKA 2QPTA 1V1FA 1QLSA 1KWOB 1PRWA 2BCAA 1SCMC 4DUQA 2FOTA 3I5HB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1J55 A;  2LAP A;  4YI8 A;  3DF0 A;  4MZL A;  3AKA A;  2BE6 A;  2KAV A;  1OZO A;  3I5F B;  1FI5 A;  3PSR A;  1XFV O;  3JVT C;  1CM4 A;  3C1V A;  1KFX L;  2PSR A;  5CSN A;  2KGR A;  3KPX A;  2JC2 A;  4PHJ A;  1C7W A;  1BJF A;  1ZAC A;  4DRW A;  1XYD A;  2AAO A;  1TCF A;  4NQG A;  1QAS A;  1BF5 A;  1IKU A;  2I18 A;  1J7R A;  1SKT A;  2DOQ A;  2JXL A;  4C0K A;  1D1O A;  5F6T A;  1S5G Y;  3LLE A;  2BCX A;  1YX8 A;  2JRF A;  1IRJ A;  2JU0 A;  2KFG A;  2LVV A;  2WCF A;  1DJG A;  1RJV A;  2Y1N A;  1PAL A;  3FWB A;  2LMT A;  2ISD A;  1YRU B;  1CB1 A;  2M97 A;  3CTN A;  1M45 A;  2JUL A;  2KI4 B;  3FIA A;  2LVK A;  1DJX A;  1G4Y R;  4ICB A;  1N0Y A;  1BT6 A;  1SR6 C;  4YBH B;  5KSZ A;  2M7N A;  1HQV A;  5KU1 A;  2WC8 A;  3BUX B;  1ALW A;  5I8N A;  1B47 A;  1IJ6 A;  1SYM A;  1W7J B;  1EH2 A;  2KYF A;  3I5G C;  1IWQ A;  2M1K B;  3IF7 A;  4CFR A;  2Y1M A;  4ORA B;  1GJY A;  1DF0 B;  4ETO A;  1NWD A;  3CR2 A;  1KFX S;  1NIW A;  1BOC A;  1ZFS A;  4GNK B;  4YI9 A;  4M2Q A;  2V53 A;  3BQ3 A;  1RTP 1;  4ORB B;  2MHH A;  1QAT A;  2F2O A;  4L9M A;  1S6J A;  1JC2 A;  1PK0 D;  2E6W A;  2JWW A;  1AUI B;  1WLZ A;  5I2L A;  2TN4 A;  1TOP A;  1CFP A;  1DTL A;  4C0J A;  1S3P A;  2K61 A;  5CPV A;  1M39 A;  1FW4 A;  1BR4 B;  1KK7 Y;  2E30 A;  1YUU A;  3KHE A;  2GGM A;  1OMR A;  4MBE A;  4NDB A;  3WHU B;  4AQI A;  3TS5 C;  2K2F A;  4GPL B;  4I5N B;  4HSZ A;  2GGZ A;  2RGI A;  2MRD A;  3VRP A;  2F8P A;  1DVI A;  1ALV A;  2JT8 A;  1IG5 A;  3SJS A;  4YGC B;  2M8U A;  1C7V A;  1FF1 A;  2CCM A;  2HQW A;  1LVC D;  1TRF A;  1ZMZ A;  2JTZ A;  1TNQ A;  2KFH A;  1AJ5 A;  1QJT A;  4WRI A;  2BEC A;  2H61 C;  1WRK A;  3O6B A;  1DJI A;  4I5L B;  5DKQ A;  5KTY A;  1QIW A;  1B8R A;  2KBM A;  2I2R E;  1L2O C;  2R2I A;  1A4P A;  1L7Z A;  2G2B A;  1SCV A;  2FCD A;  2JXC A;  2LE9 B;  3OX6 A;  1K2H A;  1KK7 Z;  1NCX A;  2HQ8 A;  3CR4 X;  3NSK A;  4I5K A;  3TDU A;  3JTD C;  3O4Y A;  2BKH B;  1UUS A;  3OHM B;  5IBW A;  1SK6 D;  1B1G A;  2WCB A;  2WOS A;  2D8N A;  2LC5 A;  4P5O E;  1YR5 A;  1EG4 A;  2L4H A;  1XFW O;  1NX1 A;  1ZUZ A;  2LHI A;  1NCZ A;  2BCB A;  1A29 A;  3BXK A;  1RWY A;  3H4S E;  4PCW A;  4PHK A;  1JSA A;  1JWD A;  1XFZ O;  3CGA A;  3OP0 A;  2LP3 A;  2K2A A;  1IGV A;  1SCM B;  2BKI B;  3ICB A;  2O60 A;  3PFV A;  3NSI A;  2KSP A;  3PN7 C;  4M2O A;  5HKY A;  3GK2 A;  2JPT A;  3IQQ A;  1A2X A;  1YRT B;  1KFU L;  1RFJ A;  1DJW A;  1WLM A;  3JVT B;  1CMF A;  1JBA A;  2K0J A;  1SY9 A;  2KGB C;  1SPY A;  4GGF A;  1Q80 A;  1A75 A;  1OOJ A;  1MHO A;  2MA2 A;  2NCO A;  1E8A A;  1IH0 A;  1S6I A;  1SNL A;  3CR5 X;  5CSF A;  3SG5 A;  3LK1 A;  2JNF A;  3BYA A;  1S1E A;  4AOM A;  4DS7 A;  5HLV A;  1CLB A;  1NX2 A;  2BL0 C;  1R2U A;  1F71 A;  1NCY A;  2KAY A;  3D10 A;  3CS1 A;  4A4B A;  4N1G A;  1NX0 A;  2KQ6 A;  2BBM A;  1KK8 C;  1GGZ A;  1DJY A;  1UWO A;  2M9G A;  2LLS A;  2WCE A;  3OB2 B;  5PAL A;  4GGN A;  1K93 D;  1U5I A;  2M1U A;  2H61 A;  1SL8 A;  2JTT A;  2OS8 C;  1CTR A;  1LXF C;  3QRX A;  4MRY A;  1J7P A;  3ZNI A;  1SR6 B;  1TN4 A;  2B1U A;  3BUO B;  2CTN A;  4USL A;  1MF8 B;  2F3Y A;  2MLE C;  1KCY A;  5D69 A;  1OMD A;  2KAX A;  2PAL A;  1QX2 A;  2AMI A;  4A4C A;  3MSE B;  3I5G B;  4WQ2 A;  3LL8 B;  1B9A A;  3TZ1 A;  3PAT A;  4YRU A;  2ZFD A;  2O5G A;  2LV7 A;  3O78 A;  3PLF B;  3VRN A;  1MXE A;  1MUX A;  4YGB B;  1KFU S;  4MN0 A;  1CKK A;  3NSL A;  1R6P A;  3WHT B;  1BU3 A;  1XFX O;  2CNP A;  1REC A;  1RK9 A;  1A03 A;  2ZN9 A;  1NP8 A;  1DGV A;  1AJ4 A;  1N65 A;  1XFY O;  1Y0V H;  3PAL A;  1K96 A;  4N1F A;  4PE1 A;  1MXL C;  2L4I A;  1A75 B;  4MEW A;  4QJ3 B;  1JF2 A;  5DKR A;  1CDL A;  1CLM A;  1TCO B;  4YGD B;  4E68 A;  1Y1X A;  2JQ6 A;  3IQO A;  2M3W A;  3E3R A;  3TS5 B;  4AQJ A;  1WDC C;  2WOR A;  2HF5 A;  1Y6W A;  3DF0 B;  3O2P A;  1CMG A;  2ZND A;  5HLO A;  5I2Q A;  1F55 A;  3BUN B;  1SW8 A;  3VRR A;  1OZS A;  2K8M B;  1CDM A;  3FS7 A;  3HCM A;  2Y5I A;  4GGF C;  1PVA A;  5AAN A;  1CFF A;  4PE7 A;  4MRX A;  1KSM A;  4HRH A;  1U5I B;  4Q04 A;  2JT3 A;  1Y1U A;  1JF0 A;  2CXJ A;  1YVL A;  2JZI A;  2BBN A;  1BR1 B;  3BUW B;  4MVF A;  1OMV A;  2LVI A;  1AP4 A;  1EXR A;  1M46 A;  4GAO A;  2JT0 A;  2VRG A;  1BOD A;  1L2O B;  1YUR A;  1K9P A;  3LK0 A;  1B8C A;  1S26 D;  1TIZ A;  3CZT X;  4M2P A;  1F54 A;  1QIV A;  1NUB A;  3TDI A;  5JJG A;  1B8L A;  1JUO A;  1LKJ A;  1QX7 A;  2KHN A;  3JTD B;  3EK8 A;  2LCP A;  2LMV A;  1UP5 A;  3OX5 A;  1CFD A;  2ZNE A;  1BG1 A;  1K90 D;  2KDH A;  1GQM A;  2OTG C;  1ODB A;  5ER5 A;  1KQM C;  1AHR A;  3M0W A;  1JFK A;  2OPO A;  2M49 B;  1N2D A;  1KSO A;  1RRO A;  1UHH A;  3SG7 A;  1G8I A;  2I7A A;  1CDP A;  2WND A;  4TNC A;  4HRG A;  1J7Q A;  1QTX A;  3GK1 A;  1QVI Z;  3TUY C;  3BUM B;  3DD4 A;  1J1D A;  3PN7 B;  1TNX A;  1DJH A;  1PSR A;  2ZRS A;  5CSI A;  3VGO A;  1M31 A;  1OE9 B;  1OSA A;  5GQQ C;  1F8H A;  1UHK A;  1UHN A;  4D1E A;  2LLU A;  3SG3 A;  5D7F A;  1K8U A;  2M29 A;  2NXQ A;  1UHI A;  1WY9 A;  3I5I C;  2LUC A;  2PAS A;  1IQ3 A;  5J3X A;  1K94 A;  3PM8 A;  4CPV A;  2BL0 B;  1MWN A;  1F4O A;  3KF9 A;  4ZCV A;  1EJ3 A;  3KEV A;  4CID A;  1DJZ A;  2KNE A;  4UPG A;  1NYA A;  1KK8 B;  3DVK A;  3F45 A;  1B7T Y;  3SG6 A;  2JNX A;  1CLL A;  1NSH A;  1FPW A;  1SL9 A;  1YUS A;  2LLT A;  1AVS A;  3KO0 A;  4PAL A;  2K7O A;  4YGA A;  4XYN A;  4JPZ B;  2HPS A;  2LM5 A;  1J1E A;  4P2Y B;  4GFT A;  1YUT A;  3DVM A;  2L2E A;  2Q91 A;  2LAN A;  1YVH A;  2EC6 C;  2LUX A;  2LMU A;  1KQV A;  1QX5 B;  2F33 A;  3LCP C;  1FBV A;  3SIA A;  1K95 A;  4CLN A;  5CSJ A;  5G08 A;  3EVU A;  3RLZ A;  2L0P A;  2KOT A;  1C07 A;  4PE0 A;  4ORC B;  5TNC A;  2CBL A;  5HYD A;  1QS7 A;  1CFC A;  1B7T Z;  4JWQ A;  5K89 A;  2ZRT A;  4ZCU A;  4C0L A;  2KYC A;  4U8D A;  4GBA A;  1S6C A;  1KWO C;  3EVV A;  1QV1 A;  3K21 A;  3I5H C;  1WDC B;  4QJ4 B;  1BLQ A;  1WRZ A;  2BE4 A;  2Q4U A;  2IS9 A;  2L98 A;  3I5F C;  2EGD A;  2I94 A;  4N5X A;  4OR9 B;  4OVN F;  2AUC A;  5BPJ A;  3GOF A;  2LVJ A;  4OV2 A;  2L51 A;  2SAS A;  3EKH A;  1CDN A;  5HKZ A;  1XFU O;  1TNP A;  4MLW A;  2JOJ A;  2F3Z A;  1QLK A;  1UHJ A;  4YGE B;  2HET A;  1NPQ A;  1TTX A;  1QXP A;  4F0Z B;  4JQ0 D;  4NDD A;  2LP2 A;  1XK4 C;  4FQO A;  2M7L A;  2NCP A;  2QAC A;  3WNX B;  1EL4 A;  3BOW A;  4QJ5 B;  3NSO A;  3D0Y A;  1MQ1 A;  1SRA A;  2FJU B;  2M0R A;  2KQY A;  1H4B A;  2KI4 C;  2K7D A;  1AK8 A;  2PMY A;  3DVJ A;  2EHB A;  3HX4 A;  4DIR A;  1F70 A;  5AER A;  1QVI Y;  2FCE A;  5AXI A;  1LA0 A;  3EKJ A;  2K7B A;  3AKB A;  5ER4 X;  3A8R A;  1S5G Z;  2OTG B;  2PRU A;  4GUK A;  1KQM B;  1PVB A;  4HRE E;  5AEQ A;  4WQ3 A;  1SL7 A;  5DKN A;  1W7I B;  3EK4 A;  4MSP A;  1JFJ A;  4NDC A;  1HT9 A;  3CWG A;  4XJK A;  1X02 A;  3TUY B;  1K9K A;  1CNP A;  3AAK A;  2KFF A;  4BY5 A;  3SG2 A;  1CM1 A;  5I2O A;  2GV5 A;  1M63 B;  2H2K A;  3TDZ A;  1B4C A;  4MZK A;  3VRO A;  2KI6 C;  2ZKM X;  3ZWH A;  3OB1 B;  1YX7 A;  4FTG A;  2LNK A;  4PDZ A;  3I5I B;  3SG4 A;  3WXA A;  1DGU A;  1XO5 A;  1SMG A;  3DVE A;  1J7O A;  1G33 A;  1VRK A;  3VRQ A;  2L5X B;  3EK7 A;  3CLN A;  2L50 A;  2NZ0 A;  2KI6 D;  1XVJ A;  1V1G A;  4OCI A;  3BOW B;  2A4J A;  3AAJ A;  3EVR A;  3D0Y B;  1DMO A;  2MLF C;  1EG3 A;  2F2P A;  1UUR A;  1S36 A;  1DT7 B;  3FWC A;  1YTZ C;  4IL1 A;  1K9U A;  1IJ5 A;  1Y1A A;  4R1E A;  1LA3 A;  4BY4 A;  5B8I B;  4PHM A;  1PSB A;  1XK4 A;  1F4Q A;  1QV0 A;  3SIB A;  1SBJ A;  4PE4 A;  1ZOT B;  1NX3 A;  2COL B;  1TNW A;  4PHN A;  2KBI A;  3NXA A;  2MBX A;  1LIN A;  2MAZ A;  1WRL A;  2EC6 B;  2MJW B;  2OS8 B;  4MZJ A;  4OKH A;  1MR8 A;  1PUL A;  2ZN8 A;  2PVB A;  5FYX A;  4XJK B;  4I5J A;  1XA5 A;  3GK4 X;  1BMO A;  2K7C A;  5AFP A;  1IQ5 A;  2CT9 A;  4CFQ A;  1OQP A;  3A4U B;  1GGW A;  1FI6 A;  1H8B A;  2P6B B;  2G9B A;  2SCP A;  2Y4Q A;  2NLN A;  5JOL A;  3RM1 A;  1DF0 A;  2LHL A;  5HKW A;  4DCK A;  2QPT A;  1V1F A;  1QLS A;  1KWO B;  1PRW A;  2BCA A;  1SCM C;  4DUQ A;  2FOT A;  3I5H B; 
#chains in the Genus database with same CATH topology
 1J55 A;  3BFB A;  2LAP A;  4YI8 A;  3DF0 A;  4MZL A;  3AKA A;  2BE6 A;  2KAV A;  1OZO A;  3I5F B;  1FI5 A;  3PSR A;  1XFV O;  3JVT C;  1CM4 A;  3C1V A;  1KFX L;  2PSR A;  5CSN A;  2KGR A;  3KPX A;  2JC2 A;  4PHJ A;  1TUJ A;  1C7W A;  1BJF A;  1TUZ A;  1ZAC A;  4DRW A;  1XYD A;  2AAO A;  1TCF A;  4NQG A;  1QAS A;  3UNW A;  1BF5 A;  3NGV A;  1IKU A;  2I18 A;  1J7R A;  1IIO A;  1SKT A;  2DOQ A;  2JXL A;  4C0K A;  1D1O A;  5F6T A;  1S5G Y;  3LLE A;  1OOF A;  2BCX A;  1YX8 A;  2JRF A;  1IRJ A;  2JU0 A;  2KFG A;  2LVV A;  2WCF A;  1DJG A;  1RJV A;  2Y1N A;  1PAL A;  3FWB A;  2LMT A;  2ISD A;  1YRU B;  1CB1 A;  2M97 A;  3CTN A;  3DY9 A;  1M45 A;  2JUL A;  2KI4 B;  3FIA A;  2LVK A;  1DJX A;  1G4Y R;  4ICB A;  1N0Y A;  1BT6 A;  1SR6 C;  2GTE A;  4YBH B;  5KSZ A;  2M7N A;  1HQV A;  5KU1 A;  2WC8 A;  3BUX B;  1ALW A;  5I8N A;  1B47 A;  1IJ6 A;  1SYM A;  1W7J B;  1EH2 A;  2KYF A;  3I5G C;  1IWQ A;  2M1K B;  3IF7 A;  5DIC A;  4CFR A;  2Y1M A;  4ORA B;  3D77 A;  1GJY A;  1DF0 B;  1C3Z A;  4ETO A;  4JD9 A;  1NWD A;  3CR2 A;  1KFX S;  1NIW A;  2QEH A;  1BOC A;  1ZFS A;  4GNK B;  4OZD A;  4YI9 A;  4M2Q A;  2V53 A;  3BQ3 A;  1RTP 1;  4ORB B;  2MHH A;  1QAT A;  2F2O A;  4L9M A;  1S6J A;  1JC2 A;  1PK0 D;  2E6W A;  2JWW A;  1AUI B;  1WLZ A;  5I2L A;  2TN4 A;  1TOP A;  1CFP A;  1DTL A;  4C0J A;  1S3P A;  2K61 A;  3DXL A;  5CPV A;  2KPH A;  1M39 A;  1FW4 A;  1BR4 B;  1KK7 Y;  2E30 A;  1YUU A;  3KHE A;  2GGM A;  1OMR A;  4MBE A;  3D76 A;  4NDB A;  3WHU B;  3TS5 C;  4AQI A;  2K2F A;  4GPL B;  4I5N B;  4HSZ A;  2GGZ A;  2RGI A;  3BJH A;  2MRD A;  3VRP A;  2F8P A;  1DVI A;  1ALV A;  2JT8 A;  1IG5 A;  3SJS A;  2BNX A;  2M8U A;  4YGC B;  1C7V A;  2CCM A;  2HQW A;  3D73 A;  1LVC D;  1TRF A;  1ZMZ A;  2JTZ A;  1TNQ A;  2KFH A;  2PYQ A;  1AJ5 A;  1QJT A;  4WRI A;  2BEC A;  2H61 C;  2YGU A;  1WRK A;  3O6B A;  1DJI A;  2P70 A;  4I5L B;  1T14 A;  5DKQ A;  5KTY A;  1QIW A;  1B8R A;  2KBM A;  2I2R E;  1L2O C;  2R2I A;  3FE9 A;  1A4P A;  5HL1 A;  1L7Z A;  2G2B A;  1SCV A;  2FCD A;  2JXC A;  5D3O A;  2LE9 B;  3OX6 A;  1K2H A;  1KK7 Z;  1NCX A;  2HQ8 A;  3D75 A;  3CR4 X;  3NSK A;  4I5K A;  3TDU A;  2QDI A;  3JTD C;  3O4Y A;  2BKH B;  3R1O A;  1UUS A;  3OHM B;  5IBW A;  1SK6 D;  1B1G A;  2WCB A;  2WOS A;  2D8N A;  2LC5 A;  4P5O E;  1YR5 A;  1EG4 A;  2L4H A;  2JPO A;  1XFW O;  1NX1 A;  1ZUZ A;  2LHI A;  1NCZ A;  2BCB A;  1A29 A;  2QEB A;  3BXK A;  1RWY A;  3H4S E;  4PCW A;  4PHK A;  1JSA A;  1JWD A;  1XFZ O;  3CGA A;  3OP0 A;  2LP3 A;  2K2A A;  1IGV A;  1SCM B;  2BKI B;  3ICB A;  2O60 A;  3PFV A;  3NSI A;  2KSP A;  3PN7 C;  4M2O A;  5HKY A;  3GK2 A;  3D74 A;  2JPT A;  3IQQ A;  1A2X A;  1YRT B;  1KFU L;  1ORG A;  1DJW A;  1RFJ A;  1WLM A;  3JVT B;  3O4X A;  1JBA A;  2K0J A;  1SY9 A;  2KGB C;  1SPY A;  3CDN A;  4GGF A;  1Q80 A;  1A75 A;  1OOJ A;  1MHO A;  2MA2 A;  2NCO A;  1E8A A;  5FI2 A;  1IH0 A;  1S6I A;  1SNL A;  3VB1 A;  3CR5 X;  5CSF A;  3SG5 A;  3LK1 A;  3PM2 A;  1LS8 A;  2JNF A;  3BYA A;  1S1E A;  4AOM A;  4DS7 A;  5HLV A;  1CLB A;  1NX2 A;  1SSE B;  3NHT A;  2BL0 C;  1R2U A;  4PT1 A;  1F71 A;  3B7A A;  1NCY A;  2KAY A;  3SS4 A;  3D10 A;  3CS1 A;  4A4B A;  4N1G A;  1NX0 A;  2KQ6 A;  2BBM A;  1KK8 C;  1GGZ A;  1DJY A;  1UWO A;  2M9G A;  2LLS A;  2WCE A;  3OB2 B;  5PAL A;  4GGN A;  1K93 D;  1U5I A;  2M1U A;  2H61 A;  1SL8 A;  2JTT A;  2OS8 C;  1CTR A;  1LXF C;  2P71 A;  3QRX A;  4MRY A;  1J7P A;  3ZNI A;  1SR6 B;  1TN4 A;  2B1U A;  3BUO B;  2CTN A;  3QME A;  1MF8 B;  3BFA A;  1W9Z A;  4USL A;  2F3Y A;  2MLE C;  5FI7 A;  1KCY A;  5D69 A;  1OMD A;  2KAX A;  2PAL A;  1QX2 A;  2AMI A;  4A4C A;  3MSE B;  2BAP A;  3I5G B;  4FQT A;  4WQ2 A;  3LL8 B;  1B9A A;  3TZ1 A;  3PAT A;  4YRU A;  2ZFD A;  2O5G A;  2LV7 A;  3O78 A;  3PLF B;  3VRN A;  1MXE A;  1MUX A;  1OOH A;  4YGB B;  1KFU S;  4MN0 A;  1CKK A;  3NSL A;  1R6P A;  1DQE A;  3UO9 A;  3WHT B;  1BU3 A;  1XFX O;  2CNP A;  3FE8 A;  2WCJ A;  1REC A;  1RK9 A;  1A03 A;  2ZN9 A;  3NHI A;  1Z4H A;  1NP8 A;  1DGV A;  1AJ4 A;  1N65 A;  1XFY O;  1Y0V H;  3PAL A;  1K96 A;  3D78 A;  4N1F A;  4PE1 A;  1MXL C;  2L4I A;  1A75 B;  4MEW A;  4QJ3 B;  1JF2 A;  5DKR A;  1CDL A;  3S0E A;  1CLM A;  1TCO B;  4YGD B;  3L4L A;  4E68 A;  1Y1X A;  2JQ6 A;  3IQO A;  2M3W A;  3E3R A;  3TS5 B;  4AQJ A;  1WDC C;  2WOR A;  1XFR A;  2HF5 A;  1Y6W A;  3DF0 B;  3O2P A;  1CMG A;  2ZND A;  5HLO A;  5I2Q A;  1F55 A;  3BUN B;  1SW8 A;  3CZ1 A;  1OZS A;  3VRR A;  2K8M B;  1CDM A;  3FS7 A;  4IJ7 A;  3HCM A;  2PQL A;  2Y5I A;  4GGF C;  1PVA A;  5AAN A;  1CFF A;  4PE7 A;  4MRX A;  1KSM A;  3CZ0 A;  4HRH A;  1U5I B;  4Q04 A;  2JT3 A;  1Y1U A;  1JF0 A;  2CXJ A;  1YVL A;  2JZI A;  2BBN A;  2WCL A;  1BR1 B;  4F7F A;  4INW A;  3BUW B;  4MVF A;  1OMV A;  3SS3 A;  2LVI A;  1AP4 A;  1EXR A;  1M46 A;  4GAO A;  2JT0 A;  2VRG A;  1BOD A;  1L2O B;  1YUR A;  1K9P A;  3LK0 A;  1B8C A;  1S26 D;  1TIZ A;  3RZS A;  3CZT X;  4M2P A;  1F54 A;  1QIV A;  1NUB A;  2QEV A;  3TDI A;  5JJG A;  1B8L A;  3K1E A;  1JUO A;  1LKJ A;  1QX7 A;  2KHN A;  3JTD B;  3EK8 A;  2LCP A;  2LMV A;  1UP5 A;  3OX5 A;  3V2L A;  1CFD A;  2ZNE A;  1BG1 A;  3Q8I A;  1K90 D;  2KDH A;  1GQM A;  2OTG C;  1ODB A;  5ER5 A;  1KQM C;  1AHR A;  3M0W A;  1GM0 A;  1JFK A;  3S0G A;  2OPO A;  2M49 B;  1N2D A;  1KSO A;  1RRO A;  1UHH A;  3SG7 A;  1G8I A;  2I7A A;  2WC6 A;  3OBV A;  1CDP A;  2WND A;  4TNC A;  4HRG A;  1J7Q A;  1QTX A;  3GK1 A;  1QVI Z;  1DC1 A;  3TUY C;  3BUM B;  3DD4 A;  1J1D A;  1Z2C B;  2L2C A;  3PN7 B;  1TNX A;  1DJH A;  1PSR A;  2ZRS A;  5CSI A;  3VGO A;  3SS5 A;  1M31 A;  1OE9 B;  1OSA A;  5GQQ C;  1F8H A;  1UHK A;  1UHN A;  4D1E A;  2LLU A;  3SG3 A;  5D7F A;  1K8U A;  3IVT A;  2M29 A;  2NXQ A;  1UHI A;  1WY9 A;  3I5I C;  3N7H A;  2LUC A;  2PAS A;  1IQ3 A;  5J3X A;  1K94 A;  3R72 A;  3PM8 A;  4CPV A;  2BL0 B;  1MWN A;  1F4O A;  2KLD A;  3KF9 A;  4ZCV A;  1EJ3 A;  3KEV A;  4CID A;  1DJZ A;  2KNE A;  3EG5 B;  4UPG A;  1NYA A;  1KK8 B;  3DVK A;  3F45 A;  1B7T Y;  3OGN A;  3SG6 A;  2JNX A;  1CLL A;  1NSH A;  1FPW A;  1SL9 A;  1YUS A;  2LLT A;  1AVS A;  1DEL A;  3KO0 A;  4PAL A;  2K7O A;  4YGA A;  4XYN A;  4JPZ B;  2HPS A;  2LM5 A;  3S0B A;  1J1E A;  4P2Y B;  2WCK A;  2K60 A;  4GFT A;  1YUT A;  3DVM A;  3S0F A;  2L2E A;  2Q91 A;  2LAN A;  1YVH A;  2WC5 A;  2EC6 C;  2LUX A;  2LMU A;  1OW4 A;  3L4A A;  1KQV A;  1QX5 B;  2F33 A;  3LCP C;  1FBV A;  3SIA A;  1K95 A;  4CLN A;  5CSJ A;  2ERB A;  5G08 A;  3EVU A;  3RLZ A;  2L0P A;  3CAB A;  2KOT A;  1C07 A;  4PE0 A;  2KLE A;  4ORC B;  5TNC A;  2CBL A;  5HYD A;  1QS7 A;  1CFC A;  1B7T Z;  4JWQ A;  5K89 A;  2ZRT A;  4ZCU A;  4C0L A;  2KYC A;  4U8D A;  4GBA A;  1S6C A;  1P28 A;  1KWO C;  3EVV A;  1QV1 A;  3K21 A;  3S0D A;  3I5H C;  3L47 A;  1WDC B;  4QJ4 B;  1BLQ A;  1WRZ A;  2BE4 A;  2Q4U A;  2WCH A;  2IS9 A;  2L98 A;  3I5F C;  2EGD A;  2I94 A;  4N5X A;  4OR9 B;  4OVN F;  2AUC A;  3S0A A;  5BPJ A;  3GOF A;  2LVJ A;  4OV2 A;  2L51 A;  2SAS A;  3EKH A;  1CDN A;  5HKZ A;  1XFU O;  1TNP A;  4MLW A;  5FI6 A;  2JOJ A;  2F3Z A;  1QLK A;  1UHJ A;  4YGE B;  2HET A;  1NPQ A;  1TTX A;  1QWV A;  1FF1 A;  2WCM A;  3B88 A;  1QXP A;  4F0Z B;  4JQ0 D;  4NDD A;  2LP2 A;  1XK4 C;  4FQO A;  2M7L A;  2NCP A;  2QAC A;  3WNX B;  1EL4 A;  3BOW A;  4QJ5 B;  3NSO A;  3D0Y A;  1MQ1 A;  1SRA A;  2FJU B;  2M0R A;  2KQY A;  2FJY A;  1H4B A;  2KI4 C;  2K7D A;  1AK8 A;  2PMY A;  3DVJ A;  2EHB A;  3HX4 A;  4KYN A;  4DIR A;  5AER A;  1F70 A;  1QVI Y;  2FCE A;  5AXI A;  1LA0 A;  3EKJ A;  2K7B A;  3AKB A;  3CZ2 A;  5ER4 X;  3A8R A;  1S5G Z;  2OTG B;  2PRU A;  4GUK A;  1KQM B;  1PVB A;  4HRE E;  5AEQ A;  5EL2 A;  3FE6 A;  4WQ3 A;  1SL7 A;  5DKN A;  1W7I B;  3EK4 A;  4MSP A;  5I94 A;  1JFJ A;  4NDC A;  2QEO A;  1HT9 A;  3CWG A;  4XJK A;  1X02 A;  3TUY B;  1K9K A;  1CNP A;  3AAK A;  2KFF A;  4BY5 A;  3SG2 A;  1CM1 A;  1CMF A;  5I2O A;  2GV5 A;  1M63 B;  2H2K A;  3TDZ A;  1B4C A;  4MZK A;  3PJI A;  2KI6 C;  1DEK A;  3VRO A;  2ZKM X;  3ZWH A;  3OB1 B;  1YX7 A;  4FTG A;  2LNK A;  4PDZ A;  3I5I B;  3SG4 A;  3WXA A;  1DGU A;  1XO5 A;  1SMG A;  3DVE A;  1J7O A;  1G33 A;  1VRK A;  3VRQ A;  2L5X B;  3EK7 A;  3CLN A;  2L50 A;  3DZT A;  2NZ0 A;  2H8V A;  2KI6 D;  1XVJ A;  1V1G A;  4OCI A;  3BOW B;  3R1V A;  2A4J A;  3AAJ A;  3EVR A;  3D0Y B;  1DMO A;  2MLF C;  1EG3 A;  2F2P A;  1UUR A;  1S36 A;  1DT7 B;  3FWC A;  1YTZ C;  4IL1 A;  1K9U A;  1IJ5 A;  1Y1A A;  4R1E A;  1LA3 A;  1TWO A;  4BY4 A;  4PHM A;  1PSB A;  1XK4 A;  5B8I B;  1F4Q A;  1QV0 A;  3SIB A;  1SBJ A;  4PE4 A;  1ZOT B;  1NX3 A;  2COL B;  1TNW A;  4PHN A;  2KBI A;  1OOG A;  3DYE A;  3NXA A;  2MBX A;  1LIN A;  2MAZ A;  1WRL A;  2EC6 B;  2MJW B;  2OS8 B;  4MZJ A;  4OKH A;  1MR8 A;  1PUL A;  4JKT A;  2L5Y A;  2ZN8 A;  2PVB A;  3R1P A;  5FYX A;  4XJK B;  3B87 A;  4I5J A;  1XA5 A;  3GK4 X;  3B6X A;  1BMO A;  2K7C A;  5AFP A;  3BFH A;  1IQ5 A;  1OOI X;  3B86 A;  2CT9 A;  4CFQ A;  1OQP A;  1C3Y A;  3A4U B;  1GGW A;  1FI6 A;  1H8B A;  4INX A;  2P6B B;  2G9B A;  2SCP A;  2Y4Q A;  2NLN A;  5JOL A;  3RM1 A;  1DF0 A;  2LHL A;  5HKW A;  4DCK A;  2QPT A;  1V1F A;  1QLS A;  1KWO B;  3CYZ A;  1PRW A;  2BCA A;  1SCM C;  4DUQ A;  2FOT A;  3I5H B; 
#chains in the Genus database with same CATH homology
 1J55 A;  2LAP A;  4YI8 A;  3DF0 A;  4MZL A;  3AKA A;  2BE6 A;  2KAV A;  1OZO A;  3I5F B;  1FI5 A;  3PSR A;  1XFV O;  3JVT C;  1CM4 A;  3C1V A;  1KFX L;  2PSR A;  5CSN A;  2KGR A;  3KPX A;  2JC2 A;  4PHJ A;  1C7W A;  1BJF A;  1ZAC A;  4DRW A;  1XYD A;  2AAO A;  1TCF A;  4NQG A;  1QAS A;  1BF5 A;  1IKU A;  2I18 A;  1J7R A;  1SKT A;  2DOQ A;  2JXL A;  4C0K A;  1D1O A;  5F6T A;  1S5G Y;  3LLE A;  2BCX A;  1YX8 A;  2JRF A;  1IRJ A;  2JU0 A;  2KFG A;  2LVV A;  2WCF A;  1DJG A;  1RJV A;  2Y1N A;  1PAL A;  3FWB A;  2LMT A;  2ISD A;  1YRU B;  1CB1 A;  2M97 A;  3CTN A;  1M45 A;  2JUL A;  2KI4 B;  3FIA A;  2LVK A;  1DJX A;  1G4Y R;  4ICB A;  1N0Y A;  1BT6 A;  1SR6 C;  4YBH B;  5KSZ A;  2M7N A;  1HQV A;  5KU1 A;  2WC8 A;  3BUX B;  1ALW A;  5I8N A;  1B47 A;  1IJ6 A;  1SYM A;  1W7J B;  1EH2 A;  2KYF A;  3I5G C;  1IWQ A;  2M1K B;  3IF7 A;  4CFR A;  2Y1M A;  4ORA B;  1GJY A;  1DF0 B;  4ETO A;  1NWD A;  3CR2 A;  1KFX S;  1NIW A;  1BOC A;  1ZFS A;  4GNK B;  4YI9 A;  4M2Q A;  2V53 A;  3BQ3 A;  1RTP 1;  4ORB B;  2MHH A;  1QAT A;  2F2O A;  4L9M A;  1S6J A;  1JC2 A;  1PK0 D;  2E6W A;  2JWW A;  1AUI B;  1WLZ A;  5I2L A;  2TN4 A;  1TOP A;  1CFP A;  1DTL A;  4C0J A;  1S3P A;  2K61 A;  5CPV A;  1M39 A;  1FW4 A;  1BR4 B;  1KK7 Y;  2E30 A;  1YUU A;  3KHE A;  2GGM A;  1OMR A;  4MBE A;  4NDB A;  3WHU B;  4AQI A;  3TS5 C;  2K2F A;  4GPL B;  4I5N B;  4HSZ A;  2GGZ A;  2RGI A;  2MRD A;  3VRP A;  2F8P A;  1DVI A;  1ALV A;  2JT8 A;  1IG5 A;  3SJS A;  4YGC B;  2M8U A;  1C7V A;  1FF1 A;  2CCM A;  2HQW A;  1LVC D;  1TRF A;  1ZMZ A;  2JTZ A;  1TNQ A;  2KFH A;  1AJ5 A;  1QJT A;  4WRI A;  2BEC A;  2H61 C;  1WRK A;  3O6B A;  1DJI A;  4I5L B;  5DKQ A;  5KTY A;  1QIW A;  1B8R A;  2KBM A;  2I2R E;  1L2O C;  2R2I A;  1A4P A;  1L7Z A;  2G2B A;  1SCV A;  2FCD A;  2JXC A;  2LE9 B;  3OX6 A;  1K2H A;  1KK7 Z;  1NCX A;  2HQ8 A;  3CR4 X;  3NSK A;  4I5K A;  3TDU A;  3JTD C;  3O4Y A;  2BKH B;  1UUS A;  3OHM B;  5IBW A;  1SK6 D;  1B1G A;  2WCB A;  2WOS A;  2D8N A;  2LC5 A;  4P5O E;  1YR5 A;  1EG4 A;  2L4H A;  1XFW O;  1NX1 A;  1ZUZ A;  2LHI A;  1NCZ A;  2BCB A;  1A29 A;  3BXK A;  1RWY A;  3H4S E;  4PCW A;  4PHK A;  1JSA A;  1JWD A;  1XFZ O;  3CGA A;  3OP0 A;  2LP3 A;  2K2A A;  1IGV A;  1SCM B;  2BKI B;  3ICB A;  2O60 A;  3PFV A;  3NSI A;  2KSP A;  3PN7 C;  4M2O A;  5HKY A;  3GK2 A;  2JPT A;  3IQQ A;  1A2X A;  1YRT B;  1KFU L;  1RFJ A;  1DJW A;  1WLM A;  3JVT B;  1CMF A;  1JBA A;  2K0J A;  1SY9 A;  2KGB C;  1SPY A;  4GGF A;  1Q80 A;  1A75 A;  1OOJ A;  1MHO A;  2MA2 A;  2NCO A;  1E8A A;  1IH0 A;  1S6I A;  1SNL A;  3CR5 X;  5CSF A;  3SG5 A;  3LK1 A;  2JNF A;  3BYA A;  1S1E A;  4AOM A;  4DS7 A;  5HLV A;  1CLB A;  1NX2 A;  2BL0 C;  1R2U A;  1F71 A;  1NCY A;  2KAY A;  3D10 A;  3CS1 A;  4A4B A;  4N1G A;  1NX0 A;  2KQ6 A;  2BBM A;  1KK8 C;  1GGZ A;  1DJY A;  1UWO A;  2M9G A;  2LLS A;  2WCE A;  3OB2 B;  5PAL A;  4GGN A;  1K93 D;  1U5I A;  2M1U A;  2H61 A;  1SL8 A;  2JTT A;  2OS8 C;  1CTR A;  1LXF C;  3QRX A;  4MRY A;  1J7P A;  3ZNI A;  1SR6 B;  1TN4 A;  2B1U A;  3BUO B;  2CTN A;  4USL A;  1MF8 B;  2F3Y A;  2MLE C;  1KCY A;  5D69 A;  1OMD A;  2KAX A;  2PAL A;  1QX2 A;  2AMI A;  4A4C A;  3MSE B;  3I5G B;  4WQ2 A;  3LL8 B;  1B9A A;  3TZ1 A;  3PAT A;  4YRU A;  2ZFD A;  2O5G A;  2LV7 A;  3O78 A;  3PLF B;  3VRN A;  1MXE A;  1MUX A;  4YGB B;  1KFU S;  4MN0 A;  1CKK A;  3NSL A;  1R6P A;  3WHT B;  1BU3 A;  1XFX O;  2CNP A;  1REC A;  1RK9 A;  1A03 A;  2ZN9 A;  1NP8 A;  1DGV A;  1AJ4 A;  1N65 A;  1XFY O;  1Y0V H;  3PAL A;  1K96 A;  4N1F A;  4PE1 A;  1MXL C;  2L4I A;  1A75 B;  4MEW A;  4QJ3 B;  1JF2 A;  5DKR A;  1CDL A;  1CLM A;  1TCO B;  4YGD B;  4E68 A;  1Y1X A;  2JQ6 A;  3IQO A;  2M3W A;  3E3R A;  3TS5 B;  4AQJ A;  1WDC C;  2WOR A;  2HF5 A;  1Y6W A;  3DF0 B;  3O2P A;  1CMG A;  2ZND A;  5HLO A;  5I2Q A;  1F55 A;  3BUN B;  1SW8 A;  3VRR A;  1OZS A;  2K8M B;  1CDM A;  3FS7 A;  3HCM A;  2Y5I A;  4GGF C;  1PVA A;  5AAN A;  1CFF A;  4PE7 A;  4MRX A;  1KSM A;  4HRH A;  1U5I B;  4Q04 A;  2JT3 A;  1Y1U A;  1JF0 A;  2CXJ A;  1YVL A;  2JZI A;  2BBN A;  1BR1 B;  3BUW B;  4MVF A;  1OMV A;  2LVI A;  1AP4 A;  1EXR A;  1M46 A;  4GAO A;  2JT0 A;  2VRG A;  1BOD A;  1L2O B;  1YUR A;  1K9P A;  3LK0 A;  1B8C A;  1S26 D;  1TIZ A;  3CZT X;  4M2P A;  1F54 A;  1QIV A;  1NUB A;  3TDI A;  5JJG A;  1B8L A;  1JUO A;  1LKJ A;  1QX7 A;  2KHN A;  3JTD B;  3EK8 A;  2LCP A;  2LMV A;  1UP5 A;  3OX5 A;  1CFD A;  2ZNE A;  1BG1 A;  1K90 D;  2KDH A;  1GQM A;  2OTG C;  1ODB A;  5ER5 A;  1KQM C;  1AHR A;  3M0W A;  1JFK A;  2OPO A;  2M49 B;  1N2D A;  1KSO A;  1RRO A;  1UHH A;  3SG7 A;  1G8I A;  2I7A A;  1CDP A;  2WND A;  4TNC A;  4HRG A;  1J7Q A;  1QTX A;  3GK1 A;  1QVI Z;  3TUY C;  3BUM B;  3DD4 A;  1J1D A;  3PN7 B;  1TNX A;  1DJH A;  1PSR A;  2ZRS A;  5CSI A;  3VGO A;  1M31 A;  1OE9 B;  1OSA A;  5GQQ C;  1F8H A;  1UHK A;  1UHN A;  4D1E A;  2LLU A;  3SG3 A;  5D7F A;  1K8U A;  2M29 A;  2NXQ A;  1UHI A;  1WY9 A;  3I5I C;  2LUC A;  2PAS A;  1IQ3 A;  5J3X A;  1K94 A;  3PM8 A;  4CPV A;  2BL0 B;  1MWN A;  1F4O A;  3KF9 A;  4ZCV A;  1EJ3 A;  3KEV A;  4CID A;  1DJZ A;  2KNE A;  4UPG A;  1NYA A;  1KK8 B;  3DVK A;  3F45 A;  1B7T Y;  3SG6 A;  2JNX A;  1CLL A;  1NSH A;  1FPW A;  1SL9 A;  1YUS A;  2LLT A;  1AVS A;  3KO0 A;  4PAL A;  2K7O A;  4YGA A;  4XYN A;  4JPZ B;  2HPS A;  2LM5 A;  1J1E A;  4P2Y B;  4GFT A;  1YUT A;  3DVM A;  2L2E A;  2Q91 A;  2LAN A;  1YVH A;  2EC6 C;  2LUX A;  2LMU A;  1KQV A;  1QX5 B;  2F33 A;  3LCP C;  1FBV A;  3SIA A;  1K95 A;  4CLN A;  5CSJ A;  5G08 A;  3EVU A;  3RLZ A;  2L0P A;  2KOT A;  1C07 A;  4PE0 A;  4ORC B;  5TNC A;  2CBL A;  5HYD A;  1QS7 A;  1CFC A;  1B7T Z;  4JWQ A;  5K89 A;  2ZRT A;  4ZCU A;  4C0L A;  2KYC A;  4U8D A;  4GBA A;  1S6C A;  1KWO C;  3EVV A;  1QV1 A;  3K21 A;  3I5H C;  1WDC B;  4QJ4 B;  1BLQ A;  1WRZ A;  2BE4 A;  2Q4U A;  2IS9 A;  2L98 A;  3I5F C;  2EGD A;  2I94 A;  4N5X A;  4OR9 B;  4OVN F;  2AUC A;  5BPJ A;  3GOF A;  2LVJ A;  4OV2 A;  2L51 A;  2SAS A;  3EKH A;  1CDN A;  5HKZ A;  1XFU O;  1TNP A;  4MLW A;  2JOJ A;  2F3Z A;  1QLK A;  1UHJ A;  4YGE B;  2HET A;  1NPQ A;  1TTX A;  1QXP A;  4F0Z B;  4JQ0 D;  4NDD A;  2LP2 A;  1XK4 C;  4FQO A;  2M7L A;  2NCP A;  2QAC A;  3WNX B;  1EL4 A;  3BOW A;  4QJ5 B;  3NSO A;  3D0Y A;  1MQ1 A;  1SRA A;  2FJU B;  2M0R A;  2KQY A;  1H4B A;  2KI4 C;  2K7D A;  1AK8 A;  2PMY A;  3DVJ A;  2EHB A;  3HX4 A;  4DIR A;  1F70 A;  5AER A;  1QVI Y;  2FCE A;  5AXI A;  1LA0 A;  3EKJ A;  2K7B A;  3AKB A;  5ER4 X;  3A8R A;  1S5G Z;  2OTG B;  2PRU A;  4GUK A;  1KQM B;  1PVB A;  4HRE E;  5AEQ A;  4WQ3 A;  1SL7 A;  5DKN A;  1W7I B;  3EK4 A;  4MSP A;  1JFJ A;  4NDC A;  1HT9 A;  3CWG A;  4XJK A;  1X02 A;  3TUY B;  1K9K A;  1CNP A;  3AAK A;  2KFF A;  4BY5 A;  3SG2 A;  1CM1 A;  5I2O A;  2GV5 A;  1M63 B;  2H2K A;  3TDZ A;  1B4C A;  4MZK A;  3VRO A;  2KI6 C;  2ZKM X;  3ZWH A;  3OB1 B;  1YX7 A;  4FTG A;  2LNK A;  4PDZ A;  3I5I B;  3SG4 A;  3WXA A;  1DGU A;  1XO5 A;  1SMG A;  3DVE A;  1J7O A;  1G33 A;  1VRK A;  3VRQ A;  2L5X B;  3EK7 A;  3CLN A;  2L50 A;  2NZ0 A;  2KI6 D;  1XVJ A;  1V1G A;  4OCI A;  3BOW B;  2A4J A;  3AAJ A;  3EVR A;  3D0Y B;  1DMO A;  2MLF C;  1EG3 A;  2F2P A;  1UUR A;  1S36 A;  1DT7 B;  3FWC A;  1YTZ C;  4IL1 A;  1K9U A;  1IJ5 A;  1Y1A A;  4R1E A;  1LA3 A;  4BY4 A;  5B8I B;  4PHM A;  1PSB A;  1XK4 A;  1F4Q A;  1QV0 A;  3SIB A;  1SBJ A;  4PE4 A;  1ZOT B;  1NX3 A;  2COL B;  1TNW A;  4PHN A;  2KBI A;  3NXA A;  2MBX A;  1LIN A;  2MAZ A;  1WRL A;  2EC6 B;  2MJW B;  2OS8 B;  4MZJ A;  4OKH A;  1MR8 A;  1PUL A;  2ZN8 A;  2PVB A;  5FYX A;  4XJK B;  4I5J A;  1XA5 A;  3GK4 X;  1BMO A;  2K7C A;  5AFP A;  1IQ5 A;  2CT9 A;  4CFQ A;  1OQP A;  3A4U B;  1GGW A;  1FI6 A;  1H8B A;  2P6B B;  2G9B A;  2SCP A;  2Y4Q A;  2NLN A;  5JOL A;  3RM1 A;  1DF0 A;  2LHL A;  5HKW A;  4DCK A;  2QPT A;  1V1F A;  1QLS A;  1KWO B;  1PRW A;  2BCA A;  1SCM C;  4DUQ A;  2FOT A;  3I5H B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...