1OSAA

Crystal structure of recombinant paramecium tetraurelia calmodulin at 1.68 angstroms resolution
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
148
structure length
148
Chain Sequence
AEQLTEEQIAEFKEAFALFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLSLMARKMKEQDSEEELIEAFKVFDRDGNGLISAAELRHVMTNLGEKLTDDEVDEMIREADIDGDGHINYEEFVRMMVSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the recombinant Paramecium tetraurelia calmodulin at 1.68 A resolution.
pubmed doi rcsb
source organism Paramecium tetraurelia
molecule tags Calcium-binding protein
molecule keywords CALMODULIN
total genus 53
structure length 148
sequence length 148
ec nomenclature
pdb deposition date 1993-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1osaA01
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1osaA02
1KK8C 2EC6B 1K9KA 2SCPA 1KK7Z 2M9GA 2F8PA 3NSLA 1KQMB 1XK4C 1JWDA 1DGVA 4JWQA 5DKQA 1N2DA 1QLSA 1B8CA 2GV5A 1L2OC 1NSHA 4CFQA 2M7NA 1LINA 4M2QA 1QX5B 2AAOA 1BOCA 1XO5A 1TNQA 1AP4A 1IGVA 2F2PA 1JC2A 1BT6A 3WHUB 2JTTA 1OZOA 1K93D 2BKIB 1K2HA 2FOTA 1C7WA 1J1DA 2BL0B 1SPYA 1B4CA 1H4BA 1SRAA 2BECA 2PVBA 3D10A 5CPVA 3O2PA 1WRLA 3CS1A 4I5JA 4PE1A 4NDDA 2JOJA 1NX2A 1FBVA 1LVCD 5F6TA 5HKZA 1NP8A 4DRWA 3GK1A 1M46A 3SG3A 1NPQA 1DF0A 1PSRA 1EL4A 5CSJA 1KWOB 1ALWA 2KQYA 2GGZA 1L2OB 1G4YR 2G2BA 4PHKA 4ORBB 2JT8A 1J7QA 1V1FA 1QASA 1QV1A 3PM8A 1WY9A 1B1GA 1Y6WA 3O6BA 2LV7A 4PE4A 1J7PA 2LE9B 1SY9A 1F8HA 4Q04A 1S6JA 1KSOA 2NCOA 2LANA 1CFPA 1S36A 2NCPA 4OCIA 1FF1A 1OZSA 2JWWA 3CR4X 3K21A 1LA3A 3CWGA 2KHNA 3EK7A 1ZFSA 1QVIZ 3I5IC 3H4SE 4ZCUA 1UP5A 1KK7Y 3EKHA 1DMOA 1G33A 2QACA 2HETA 1QVIY 2NLNA 1MUXA 1QTXA 1IH0A 1QV0A 2LCPA 1QXPA 2LMTA 2MLEC 1B8LA 5PALA 1QLKA 1S6IA 3OX5A 5DKRA 1F54A 3WHTB 3WXAA 4GGFA 1M39A 4WRIA 3TS5B 3ZNIA 2KAXA 2LHIA 3CR5X 1QS7A 4YGDB 2IS9A 4FQOA 2LMVA 3LCPC 1IRJA 2WCBA 1KK8B 2LUXA 3FS7A 1UUSA 2JC2A 1DJHA 4ETOA 1KFUL 2KFGA 2L50A 2ZNEA 2M8UA 2PRUA 1EH2A 2KFFA 3SG7A 2AUCA 2MAZA 5IBWA 2M97A 2LM5A 1YUSA 4AQIA 1AJ4A 1DJWA 2LNKA 1C7VA 1CMFA 3GOFA 1DTLA 4A4CA 2I18A 1BR1B 4F0ZB 1IG5A 5I2LA 1ALVA 1CMGA 2MLFC 2PALA 4HSZA 2OTGB 4A4BA 1DGUA 1QX7A 3BOWB 5K89A 1CKKA 2B1UA 1IJ6A 1MWNA 4JQ0D 1J1EA 3BUNB 4NDBA 5AXIA 1G8IA 3BYAA 2KI4B 1OMRA 1TCOB 1XYDA 1UWOA 3HCMA 1GGWA 1NWDA 1OE9B 1ZMZA 2ZN9A 2MRDA 1K96A 3EK8A 1YVLA 1OMDA 3RLZA 4PHJA 2G9BA 1CB1A 4YGEB 1FI5A 4MVFA 2GGMA 4OR9B 3OHMB 1K94A 4N1GA 4MEWA 1A75A 2JQ6A 3F45A 4PDZA 3SG2A 5CSFA 1SW8A 2E6WA 5GQQC 1S1EA 1F4OA 2DOQA 2MBXA 1CM4A 1GQMA 1KFUS 1TTXA 1WRKA 1XFXO 2JNXA 1JF0A 2LUCA 1BG1A 3I5FB 3M0WA 1OQPA 1A03A 2K7OA 2KYCA 2KI4C 2OS8C 2L0PA 4WQ3A 3VRNA 2FCEA 1PK0D 2L4IA 3I5IB 3AAJA 3CR2A 3OB1B 5D69A 3ZWHA 4I5NB 4D1EA 1VRKA 2SASA 3MSEB 3I5HB 2O5GA 1TNPA 1M31A 3KF9A 1SNLA 1A4PA 1PSBA 3D0YB 5HKYA 4ORCB 3BUWB 1E8AA 1KSMA 1KFXS 3LK0A 1QATA 1OMVA 2M1UA 3TUYB 3AKBA 2LVKA 2H2KA 1SL9A 2BCBA 1K95A 1B7TZ 3AKAA 2LMUA 3VGOA 5HLOA 1J7OA 1QX2A 4MN0A 1NX1A 4GNKB 1B7TY 3CGAA 1Q80A 1NCYA 3PSRA 2BBMA 2EHBA 2BE6A 1FI6A 3CZTX 2ZN8A 5TNCA 2MA2A 2E30A 5CSIA 3SG4A 1J55A 1MHOA 5DKNA 3VRPA 1HT9A 1MXEA 4I5LB 1JUOA 1IQ3A 1F55A 1YR5A 2QPTA 3BXKA 4GPLB 3EKJA 2KGRA 1QJTA 3IF7A 3EVUA 1RWYA 2LLTA 1M45A 1SK6D 2HF5A 3FWCA 3VRRA 5AFPA 1X02A 1SL8A 1CFFA 2NXQA 1S3PA 3KO0A 3NSOA 1QIWA 1CLLA 1RROA 3TDIA 4DS7A 1NUBA 1PALA 2Y5IA 2K2FA 1XFVO 1H8BA 3EVVA 3VRQA 1WDCB 1YX7A 1DJZA 3NSKA 2KBIA 1RFJA 2RGIA 1JFKA 1S6CA 3D0YA 3SG5A 1Y1XA 4PHNA 2BE4A 2JRFA 1CDNA 3IQQA 1TNWA 2EC6C 4PALA 3LK1A 1N65A 1K8UA 1PRWA 1UHNA 5I2OA 1V1GA 2BBNA 3O78A 1NCZA 3ICBA 4GFTA 2R2IA 2LVIA 4JPZB 1ZUZA 3DF0A 4R1EA 2KOTA 2PMYA 1A2XA 1A29A 1SCMC 2Y1NA 4YGAA 4UPGA 1PULA 2KAVA 4QJ3B 4NDCA 1OOJA 1GJYA 1SKTA 1YVHA 1DT7B 2H61A 5ER5A 5J3XA 1WRZA 2P6BB 4C0KA 3EK4A 1NCXA 1A75B 2K2AA 2K7DA 2KYFA 4P2YB 1AUIB 1IJ5A 3GK4X 3I5HC 2JT0A 1BR4B 1WLMA 4ORAB 3DVJA 4DCKA 3KEVA 3TS5C 1LKJA 4TNCA 2KDHA 5B8IB 1WLZA 5G08A 4USLA 2CTNA 2ZRSA 3KPXA 2MJWB 1QIVA 3PN7C 4C0JA 1LA0A 1J7RA 2JU0A 2K7CA 1CNPA 5HLVA 3CLNA 1W7IB 3FIAA 4MSPA 1MQ1A 2F3YA 4PHMA 5AANA 1HQVA 3WNXB 1SYMA 2VRGA 1CDPA 4XJKA 2JT3A 3QRXA 2JNFA 2KSPA 1IWQA 1TNXA 2L5XB 2M29A 4YBHB 1K9UA 1K9PA 2LAPA 1BF5A 2OS8B 2M49B 4YI9A 1XFUO 4GAOA 1U5IB 2LVJA 4N1FA 3LL8B 2M0RA 2F2OA 5BPJA 1YRTB 2K8MB 1CFCA 1XK4A 5CSNA 2OPOA 1MXLC 2I7AA 3DD4A 1CLMA 2D8NA 2JXCA 2KBMA 4L9MA 1UHKA 2BKHB 1B47A 2K7BA 4N5XA 5AEQA 1D1OA 1YUTA 2L51A 2LP3A 2CNPA 3E3RA 2O60A 2WC8A 2JPTA 4U8DA 1IKUA 2BCAA 1EG3A 1TIZA 4DIRA 1BJFA 3DVEA 1RJVA 3JTDB 4ICBA 1ZACA 1AVSA 2WCEA 4GBAA 3BUOB 4OVNF 3TUYC 4HRHA 4XYNA 4MBEA 4CIDA 3I5GB 2Q91A 1XFWO 2L98A 4CFRA 1UHHA 1N0YA 3DF0B 1B9AA 1CLBA 1EJ3A 3OP0A 1TRFA 4I5KA 3RM1A 1BODA 3BOWA 4QJ5B 2L2EA 2F3ZA 4XJKB 1FPWA 5I2QA 1UHIA 1SCVA 3PFVA 4AOMA 1YRUB 4MRXA 3TDZA 4GGNA 5KTYA 4HRGA 3AAKA 1SBJA 2AMIA 2HPSA 4FTGA 1CDLA 2KFHA 4MRYA 3KHEA 5AERA 2K61A 1XVJA 1BU3A 1S5GY 5ER4X 2COLB 1JBAA 3O4YA 5I8NA 2M3WA 2KI6D 2KGBC 2OTGC 1NX3A 2K0JA 3GK2A 2ZRTA 1DJGA 2M7LA 5KSZA 1TN4A 3DVMA 3PLFB 2NZ0A 3BUXB 3OB2B 2A4JA 3JVTC 2WORA 1YX8A 5JJGA 1BMOA 1EXRA 2BCXA 3SIBA 2PSRA 3PALA 4GUKA 3TDUA 1F4QA 2JTZA 4MZLA 2Y1MA 1UHJA 1DJYA 1KCYA 1KQVA 4IL1A 1S5GZ 1R2UA 2CCMA 5D7FA 4NQGA 1XFZO 4M2OA 5HYDA 4BY4A 2ZNDA 4GGFC 5KU1A 1NX0A 1FW4A 3DVKA 4QJ4B 1MF8B 2L4HA 1AHRA 5FYXA 2TN4A 3I5GC 1YURA 1Y1AA 1B8RA 1AK8A 4E68A 2FJUB 2HQWA 2WOSA 3EVRA 2WCFA 1M63B 1CFDA 2KNEA 3TZ1A 1PVBA 2JXLA 4YGBB 2LC5A 4ZCVA 2ISDA 4DUQA 3A8RA 1SCMB 1BLQA 4CPVA 4PE7A 2CT9A 4AQJA 4C0LA 4PCWA 1U5IA 1CM1A 1XA5A 4BY5A 1C07A 3FWBA 2ZKMX 3JTDC 2FCDA 5HKWA 1L7ZA 3OX6A 3JVTB 3SG6A 1KQMC 1JSAA 2ZFDA 2BL0C 1DVIA 1YTZC 2KI6C 1R6PA 3SJSA 3HX4A 1RTP1 3BUMB 1IQ5A 3IQOA 3CTNA 2CXJA 1YUUA 1DF0B 2Q4UA 3NSIA 1W7JB 4MLWA 1NYAA 1SR6C 1F70A 1PVAA 4PE0A 4OV2A 1AJ5A 1S26D 5JOLA 4CLNA 2EGDA 2CBLA 2MHHA 2JULA 1MR8A 3I5FC 4MZKA 2H61C 2I2RE 4YGCB 4M2PA 2KAYA 2F33A 2PASA 2JZIA 1UURA 3A4UB 2LLUA 3VROA 2M1KB 4YRUA 1GGZA 1JFJA 1TCFA 1Y1UA 1NIWA 2LHLA 2LVVA 3PATA 1K90D 1SR6B 4WQ2A 2HQ8A 2KQ6A 1F71A 4MZJA 2V53A 2WNDA 3NXAA 2I94A 3PN7B 3SIAA 1KFXL 2Y4QA 2LLSA 1DJXA 3BQ3A 1DJIA 1XFYO 4HREE 1EG4A 1CTRA 1OSAA 1Y0VH 3LLEA 4YI8A 3C1VA 1SL7A 1ODBA 4P5OE 1ZOTB 1LXFC 1KWOC 2LP2A 1JF2A 1WDCC 1RK9A 1RECA 1CDMA 1SMGA 1TOPA 4OKHA
chains in the Genus database with same CATH superfamily
1KK8C 1OOGA 2EC6B 1K9KA 2SCPA 1KK7Z 2M9GA 2F8PA 3NSLA 1KQMB 1XK4C 1JWDA 1DGVA 3O4XA 4JWQA 5DKQA 1N2DA 1QLSA 1B8CA 2GV5A 3SS5A 1L2OC 1NSHA 4CFQA 2M7NA 1LINA 4M2QA 1QX5B 1IIOA 2AAOA 1BOCA 1XO5A 1TNQA 1AP4A 1IGVA 2F2PA 1JC2A 1BT6A 3WHUB 2JTTA 1OZOA 1K93D 2BKIB 1K2HA 2FOTA 1C7WA 3CZ2A 1J1DA 2BL0B 1SPYA 1B4CA 1C3YA 1H4BA 1SRAA 3CYZA 2BECA 2PVBA 3D10A 5CPVA 3O2PA 3PM2A 3S0FA 1WRLA 3CS1A 3D76A 4I5JA 4NDDA 2JOJA 1NX2A 4PE1A 1FBVA 1LVCD 5F6TA 3D74A 5HKZA 1NP8A 4DRWA 3GK1A 1M46A 3SG3A 1NPQA 1DF0A 1PSRA 1EL4A 5CSJA 1KWOB 1ALWA 2KQYA 2GGZA 1L2OB 1G4YR 2G2BA 4PHKA 1OW4A 4ORBB 2YGUA 2JT8A 1Z2CB 1J7QA 1GM0A 3OBVA 1V1FA 1QASA 1QV1A 3PM8A 1WY9A 1B1GA 1Y6WA 3O6BA 2LV7A 4PE4A 1J7PA 5DICA 2LE9B 1SY9A 1F8HA 4Q04A 1S6JA 1KSOA 2BAPA 2NCOA 1QWVA 2LANA 1CFPA 1S36A 2NCPA 4OCIA 5FI7A 1OZSA 1FF1A 2JWWA 3CR4X 3K21A 1LA3A 3CWGA 2KHNA 3EK7A 1ZFSA 1QVIZ 3I5IC 3NHTA 3PJIA 3H4SE 4ZCUA 1UP5A 1KK7Y 3EKHA 1DMOA 1G33A 2QACA 2HETA 1QVIY 2NLNA 1MUXA 1QTXA 1IH0A 1QV0A 2LCPA 1QXPA 2LMTA 2MLEC 1B8LA 5PALA 1QLKA 1S6IA 3OX5A 3EG5B 3R72A 5DKRA 3WHTB 1F54A 3WXAA 4KYNA 4GGFA 1M39A 2FJYA 3DY9A 4WRIA 2L2CA 3TS5B 3ZNIA 2KAXA 2LHIA 3CR5X 1QS7A 4YGDB 2IS9A 4FQOA 2LMVA 3LCPC 1IRJA 2WCBA 1KK8B 2LUXA 3FS7A 1UUSA 2JC2A 1DJHA 4ETOA 1KFUL 2P71A 2KFGA 2L50A 2QEBA 2ZNEA 2M8UA 2PRUA 2QEVA 1EH2A 2KFFA 3SG7A 2PYQA 2AUCA 2MAZA 5HL1A 5IBWA 2M97A 2LM5A 2P70A 2WC5A 1YUSA 4AQIA 1AJ4A 1DJWA 2LNKA 1C7VA 1CMFA 3GOFA 1DTLA 4PT1A 4A4CA 1BR1B 2I18A 4F0ZB 1IG5A 5I2LA 1ALVA 3UO9A 1CMGA 2MLFC 2PALA 4HSZA 2OTGB 3V2LA 1DGUA 4A4BA 1QX7A 3BOWB 3IVTA 2WCJA 5K89A 1CKKA 2B1UA 1IJ6A 1MWNA 4JQ0D 1J1EA 3BUNB 4NDBA 5AXIA 1G8IA 3BYAA 2KI4B 1OMRA 1TCOB 1XYDA 1UWOA 3HCMA 1GGWA 1NWDA 1OE9B 1ZMZA 2ZN9A 2MRDA 1K96A 3EK8A 1YVLA 1OMDA 3RLZA 4PHJA 2G9BA 1CB1A 4YGEB 2KLDA 1FI5A 3CABA 4MVFA 2KLEA 2GGMA 4OR9B 3OHMB 1K94A 4N1GA 4MEWA 1A75A 2JQ6A 3F45A 4PDZA 3SG2A 5CSFA 1SW8A 1W9ZA 2E6WA 5GQQC 3D78A 1S1EA 5I94A 1F4OA 2DOQA 2MBXA 1CM4A 1GQMA 1KFUS 1TTXA 1WRKA 1XFXO 2JNXA 1JF0A 2LUCA 1BG1A 3I5FB 3M0WA 1OQPA 1A03A 2K7OA 2KYCA 2KI4C 2OS8C 2L0PA 4WQ3A 3VRNA 2FCEA 1PK0D 2L4IA 3I5IB 1OOHA 3AAJA 3CR2A 3OB1B 3L47A 5D69A 3ZWHA 4I5NB 3OGNA 4D1EA 1VRKA 2SASA 3S0GA 3MSEB 3I5HB 2O5GA 1TNPA 1M31A 3KF9A 3Q8IA 1SNLA 3DZTA 1A4PA 1PSBA 3B87A 3D0YB 5HKYA 4ORCB 3BUWB 2H8VA 1E8AA 1KSMA 3L4AA 1KFXS 3LK0A 1QATA 1OMVA 1P28A 2M1UA 3FE6A 3TUYB 3AKBA 2LVKA 2H2KA 1SL9A 2BCBA 1K95A 1B7TZ 3AKAA 2LMUA 3VGOA 5HLOA 1J7OA 1QX2A 4MN0A 1NX1A 4GNKB 1B7TY 3B86A 1Q80A 3CGAA 1NCYA 3PSRA 2BBMA 2EHBA 3BFHA 2BE6A 3NGVA 1FI6A 3CZTX 2ZN8A 5TNCA 1DQEA 2E30A 2MA2A 5CSIA 3SG4A 1J55A 2ERBA 1MHOA 5DKNA 3VRPA 1HT9A 1MXEA 4I5LB 1JUOA 1IQ3A 1T14A 1F55A 1YR5A 2QPTA 3BXKA 4GPLB 3EKJA 2KGRA 1QJTA 3IF7A 3EVUA 1RWYA 2LLTA 1M45A 1SK6D 2HF5A 3FWCA 3VRRA 5AFPA 1X02A 1SL8A 1CFFA 2NXQA 1S3PA 3KO0A 3NSOA 3R1VA 3L4LA 1QIWA 1CLLA 1RROA 3TDIA 4DS7A 1NUBA 1PALA 2Y5IA 2K2FA 3BFBA 3DXLA 1XFVO 1H8BA 3EVVA 3VRQA 2WCMA 1WDCB 1YX7A 1DJZA 3NSKA 2KBIA 1RFJA 2RGIA 1JFKA 1S6CA 3D0YA 3SG5A 1Y1XA 4PHNA 2BE4A 2JRFA 1CDNA 3IQQA 1TNWA 2EC6C 4PALA 3LK1A 1N65A 1K8UA 1PRWA 1UHNA 5I2OA 3NHIA 1V1GA 2BBNA 3O78A 1NCZA 3ICBA 4GFTA 2R2IA 2LVIA 4JPZB 1ZUZA 2WC6A 3DF0A 2KOTA 2PMYA 1A2XA 1A29A 1SCMC 2Y1NA 4R1EA 4YGAA 4UPGA 1PULA 2KAVA 4QJ3B 4NDCA 1OOJA 1GJYA 1SKTA 1YVHA 1DT7B 2H61A 5ER5A 3SS3A 3B6XA 5J3XA 1WRZA 2L5YA 2P6BB 5EL2A 3EK4A 3UNWA 1NCXA 4C0KA 1A75B 2K2AA 2K7DA 2KYFA 4P2YB 1AUIB 1IJ5A 3GK4X 3I5HC 2JT0A 1BR4B 1WLMA 4ORAB 3DVJA 4FQTA 4DCKA 3DYEA 3KEVA 1LKJA 3TS5C 4TNCA 2KDHA 5B8IB 1WLZA 5G08A 4USLA 1Z4HA 2CTNA 2ZRSA 3CZ0A 3KPXA 2MJWB 3R1OA 1QIVA 3PN7C 4C0JA 1LA0A 1J7RA 2JU0A 2K7CA 1CNPA 5HLVA 3CLNA 1W7IB 3FIAA 4MSPA 3BFAA 1MQ1A 2F3YA 4PHMA 5AANA 1HQVA 3WNXB 1SYMA 2VRGA 1CDPA 4XJKA 2JT3A 3QRXA 2JNFA 2KSPA 1IWQA 1TNXA 2L5XB 2M29A 4YBHB 1K9UA 1K9PA 2LAPA 1BF5A 2OS8B 2M49B 1DEKA 4YI9A 1XFUO 4GAOA 1U5IB 2LVJA 4N1FA 3LL8B 2M0RA 2F2OA 1TWOA 5BPJA 1YRTB 2K8MB 2QDIA 1XK4A 1CFCA 5CSNA 2OPOA 1MXLC 2I7AA 4INXA 2BNXA 3DD4A 1CLMA 2D8NA 2JXCA 2KBMA 4L9MA 1UHKA 2BKHB 1B47A 2K7BA 4N5XA 5AEQA 1D1OA 1YUTA 2L51A 2LP3A 2CNPA 3E3RA 3CDNA 2O60A 2WC8A 4JD9A 2JPTA 3B88A 4U8DA 1IKUA 2BCAA 1EG3A 1TIZA 4DIRA 1BJFA 2PQLA 3DVEA 1RJVA 3BJHA 3JTDB 4ICBA 3S0AA 1ZACA 1AVSA 2WCEA 4GBAA 3BUOB 4OZDA 4OVNF 3TUYC 4HRHA 4IJ7A 4MBEA 4XYNA 3I5GB 4CIDA 2Q91A 1XFWO 2L98A 4CFRA 1UHHA 4F7FA 1N0YA 3DF0B 1B9AA 2WCKA 2WCLA 1CLBA 1EJ3A 1LS8A 3OP0A 1TRFA 4I5KA 3RM1A 1BODA 2GTEA 3BOWA 3D73A 4QJ5B 2L2EA 2F3ZA 4XJKB 1FPWA 5I2QA 1UHIA 1SCVA 3PFVA 4AOMA 1YRUB 4MRXA 3TDZA 4GGNA 5KTYA 4HRGA 3AAKA 1SBJA 2AMIA 2HPSA 4FTGA 1CDLA 2KFHA 4MRYA 3KHEA 3RZSA 5AERA 2K61A 2JPOA 1XVJA 1BU3A 1S5GY 5ER4X 2COLB 4INWA 3O4YA 1JBAA 5I8NA 2M3WA 2KI6D 2KGBC 2OTGC 1NX3A 2K0JA 3GK2A 2ZRTA 1DJGA 2M7LA 5KSZA 1TN4A 3DVMA 3PLFB 1TUZA 2NZ0A 3BUXB 3OB2B 2A4JA 3JVTC 2WORA 1YX8A 5JJGA 1BMOA 1EXRA 2BCXA 3SIBA 3S0EA 2PSRA 1OOIX 3PALA 4GUKA 3TDUA 1F4QA 3FE9A 2JTZA 4MZLA 2Y1MA 3VB1A 1UHJA 1DJYA 1KCYA 1KQVA 4IL1A 3B7AA 1S5GZ 1R2UA 2CCMA 5D7FA 4NQGA 1XFZO 4M2OA 5HYDA 4BY4A 2ZNDA 4GGFC 5KU1A 1NX0A 2QEHA 1FW4A 3DVKA 4QJ4B 1ORGA 1MF8B 3R1PA 2L4HA 1AHRA 5FYXA 2TN4A 3N7HA 3I5GC 1TUJA 1YURA 1Y1AA 2KPHA 1B8RA 1AK8A 3D75A 4E68A 2FJUB 2HQWA 2WOSA 3EVRA 2WCFA 1M63B 1CFDA 2KNEA 3TZ1A 1PVBA 2JXLA 4YGBB 2LC5A 4ZCVA 3FE8A 2ISDA 4DUQA 3A8RA 1SCMB 3S0DA 1BLQA 4CPVA 4PE7A 5FI2A 2CT9A 4AQJA 4C0LA 4PCWA 1SSEB 5D3OA 1U5IA 1CM1A 1XA5A 4BY5A 1C07A 3FWBA 2ZKMX 3JTDC 1XFRA 2FCDA 5HKWA 1L7ZA 3OX6A 3JVTB 3SG6A 1KQMC 3S0BA 1JSAA 2ZFDA 2BL0C 1DVIA 1YTZC 2KI6C 1R6PA 3SJSA 3HX4A 1RTP1 2WCHA 3BUMB 3CZ1A 1IQ5A 3IQOA 3K1EA 3CTNA 2CXJA 1YUUA 1DF0B 2Q4UA 3NSIA 1W7JB 4MLWA 1NYAA 1SR6C 1F70A 1PVAA 3QMEA 4PE0A 4OV2A 1AJ5A 1S26D 5JOLA 4CLNA 2EGDA 2CBLA 2MHHA 2JULA 1MR8A 1DELA 3I5FC 3SS4A 3D77A 4MZKA 2H61C 2I2RE 4YGCB 1C3ZA 4M2PA 2KAYA 2F33A 2PASA 2JZIA 1UURA 3A4UB 2LLUA 3VROA 2M1KB 4YRUA 1GGZA 1JFJA 1TCFA 1Y1UA 1NIWA 2LHLA 2LVVA 2QEOA 1K90D 3PATA 1SR6B 4WQ2A 4JKTA 1OOFA 2HQ8A 2KQ6A 1F71A 4MZJA 2V53A 2WNDA 3NXAA 2I94A 5FI6A 3PN7B 3SIAA 1KFXL 2Y4QA 2LLSA 1DJXA 3BQ3A 1DJIA 1XFYO 4HREE 1EG4A 1CTRA 1OSAA 1Y0VH 3LLEA 4YI8A 3C1VA 1SL7A 1ODBA 2K60A 4P5OE 1ZOTB 1LXFC 1KWOC 2LP2A 1DC1A 1JF2A 1WDCC 1RK9A 1RECA 1CDMA 1SMGA 1TOPA 4OKHA
chains in the Genus database with same CATH topology
1KK8C 2EC6B 1K9KA 2SCPA 1KK7Z 2M9GA 2F8PA 3NSLA 1KQMB 1XK4C 1JWDA 1DGVA 4JWQA 5DKQA 1N2DA 1QLSA 1B8CA 2GV5A 1L2OC 1NSHA 4CFQA 2M7NA 1LINA 4M2QA 1QX5B 2AAOA 1BOCA 1XO5A 1TNQA 1AP4A 1IGVA 2F2PA 1JC2A 1BT6A 3WHUB 2JTTA 1OZOA 1K93D 2BKIB 1K2HA 2FOTA 1C7WA 1J1DA 2BL0B 1SPYA 1B4CA 1H4BA 1SRAA 2BECA 2PVBA 3D10A 5CPVA 3O2PA 1WRLA 3CS1A 4I5JA 4PE1A 4NDDA 2JOJA 1NX2A 1FBVA 1LVCD 5F6TA 5HKZA 1NP8A 4DRWA 3GK1A 1M46A 3SG3A 1NPQA 1DF0A 1PSRA 1EL4A 5CSJA 1KWOB 1ALWA 2KQYA 2GGZA 1L2OB 1G4YR 2G2BA 4PHKA 4ORBB 2JT8A 1J7QA 1V1FA 1QASA 1QV1A 3PM8A 1WY9A 1B1GA 1Y6WA 3O6BA 2LV7A 4PE4A 1J7PA 2LE9B 1SY9A 1F8HA 4Q04A 1S6JA 1KSOA 2NCOA 2LANA 1CFPA 1S36A 2NCPA 4OCIA 1FF1A 1OZSA 2JWWA 3CR4X 3K21A 1LA3A 3CWGA 2KHNA 3EK7A 1ZFSA 1QVIZ 3I5IC 3H4SE 4ZCUA 1UP5A 1KK7Y 3EKHA 1DMOA 1G33A 2QACA 2HETA 1QVIY 2NLNA 1MUXA 1QTXA 1IH0A 1QV0A 2LCPA 1QXPA 2LMTA 2MLEC 1B8LA 5PALA 1QLKA 1S6IA 3OX5A 5DKRA 1F54A 3WHTB 3WXAA 4GGFA 1M39A 4WRIA 3TS5B 3ZNIA 2KAXA 2LHIA 3CR5X 1QS7A 4YGDB 2IS9A 4FQOA 2LMVA 3LCPC 1IRJA 2WCBA 1KK8B 2LUXA 3FS7A 1UUSA 2JC2A 1DJHA 4ETOA 1KFUL 2KFGA 2L50A 2ZNEA 2M8UA 2PRUA 1EH2A 2KFFA 3SG7A 2AUCA 2MAZA 5IBWA 2M97A 2LM5A 1YUSA 4AQIA 1AJ4A 1DJWA 2LNKA 1C7VA 1CMFA 3GOFA 1DTLA 4A4CA 2I18A 1BR1B 4F0ZB 1IG5A 5I2LA 1ALVA 1CMGA 2MLFC 2PALA 4HSZA 2OTGB 4A4BA 1DGUA 1QX7A 3BOWB 5K89A 1CKKA 2B1UA 1IJ6A 1MWNA 4JQ0D 1J1EA 3BUNB 4NDBA 5AXIA 1G8IA 3BYAA 2KI4B 1OMRA 1TCOB 1XYDA 1UWOA 3HCMA 1GGWA 1NWDA 1OE9B 1ZMZA 2ZN9A 2MRDA 1K96A 3EK8A 1YVLA 1OMDA 3RLZA 4PHJA 2G9BA 1CB1A 4YGEB 1FI5A 4MVFA 2GGMA 4OR9B 3OHMB 1K94A 4N1GA 4MEWA 1A75A 2JQ6A 3F45A 4PDZA 3SG2A 5CSFA 1SW8A 2E6WA 5GQQC 1S1EA 1F4OA 2DOQA 2MBXA 1CM4A 1GQMA 1KFUS 1TTXA 1WRKA 1XFXO 2JNXA 1JF0A 2LUCA 1BG1A 3I5FB 3M0WA 1OQPA 1A03A 2K7OA 2KYCA 2KI4C 2OS8C 2L0PA 4WQ3A 3VRNA 2FCEA 1PK0D 2L4IA 3I5IB 3AAJA 3CR2A 3OB1B 5D69A 3ZWHA 4I5NB 4D1EA 1VRKA 2SASA 3MSEB 3I5HB 2O5GA 1TNPA 1M31A 3KF9A 1SNLA 1A4PA 1PSBA 3D0YB 5HKYA 4ORCB 3BUWB 1E8AA 1KSMA 1KFXS 3LK0A 1QATA 1OMVA 2M1UA 3TUYB 3AKBA 2LVKA 2H2KA 1SL9A 2BCBA 1K95A 1B7TZ 3AKAA 2LMUA 3VGOA 5HLOA 1J7OA 1QX2A 4MN0A 1NX1A 4GNKB 1B7TY 3CGAA 1Q80A 1NCYA 3PSRA 2BBMA 2EHBA 2BE6A 1FI6A 3CZTX 2ZN8A 5TNCA 2MA2A 2E30A 5CSIA 3SG4A 1J55A 1MHOA 5DKNA 3VRPA 1HT9A 1MXEA 4I5LB 1JUOA 1IQ3A 1F55A 1YR5A 2QPTA 3BXKA 4GPLB 3EKJA 2KGRA 1QJTA 3IF7A 3EVUA 1RWYA 2LLTA 1M45A 1SK6D 2HF5A 3FWCA 3VRRA 5AFPA 1X02A 1SL8A 1CFFA 2NXQA 1S3PA 3KO0A 3NSOA 1QIWA 1CLLA 1RROA 3TDIA 4DS7A 1NUBA 1PALA 2Y5IA 2K2FA 1XFVO 1H8BA 3EVVA 3VRQA 1WDCB 1YX7A 1DJZA 3NSKA 2KBIA 1RFJA 2RGIA 1JFKA 1S6CA 3D0YA 3SG5A 1Y1XA 4PHNA 2BE4A 2JRFA 1CDNA 3IQQA 1TNWA 2EC6C 4PALA 3LK1A 1N65A 1K8UA 1PRWA 1UHNA 5I2OA 1V1GA 2BBNA 3O78A 1NCZA 3ICBA 4GFTA 2R2IA 2LVIA 4JPZB 1ZUZA 3DF0A 4R1EA 2KOTA 2PMYA 1A2XA 1A29A 1SCMC 2Y1NA 4YGAA 4UPGA 1PULA 2KAVA 4QJ3B 4NDCA 1OOJA 1GJYA 1SKTA 1YVHA 1DT7B 2H61A 5ER5A 5J3XA 1WRZA 2P6BB 4C0KA 3EK4A 1NCXA 1A75B 2K2AA 2K7DA 2KYFA 4P2YB 1AUIB 1IJ5A 3GK4X 3I5HC 2JT0A 1BR4B 1WLMA 4ORAB 3DVJA 4DCKA 3KEVA 3TS5C 1LKJA 4TNCA 2KDHA 5B8IB 1WLZA 5G08A 4USLA 2CTNA 2ZRSA 3KPXA 2MJWB 1QIVA 3PN7C 4C0JA 1LA0A 1J7RA 2JU0A 2K7CA 1CNPA 5HLVA 3CLNA 1W7IB 3FIAA 4MSPA 1MQ1A 2F3YA 4PHMA 5AANA 1HQVA 3WNXB 1SYMA 2VRGA 1CDPA 4XJKA 2JT3A 3QRXA 2JNFA 2KSPA 1IWQA 1TNXA 2L5XB 2M29A 4YBHB 1K9UA 1K9PA 2LAPA 1BF5A 2OS8B 2M49B 4YI9A 1XFUO 4GAOA 1U5IB 2LVJA 4N1FA 3LL8B 2M0RA 2F2OA 5BPJA 1YRTB 2K8MB 1CFCA 1XK4A 5CSNA 2OPOA 1MXLC 2I7AA 3DD4A 1CLMA 2D8NA 2JXCA 2KBMA 4L9MA 1UHKA 2BKHB 1B47A 2K7BA 4N5XA 5AEQA 1D1OA 1YUTA 2L51A 2LP3A 2CNPA 3E3RA 2O60A 2WC8A 2JPTA 4U8DA 1IKUA 2BCAA 1EG3A 1TIZA 4DIRA 1BJFA 3DVEA 1RJVA 3JTDB 4ICBA 1ZACA 1AVSA 2WCEA 4GBAA 3BUOB 4OVNF 3TUYC 4HRHA 4XYNA 4MBEA 4CIDA 3I5GB 2Q91A 1XFWO 2L98A 4CFRA 1UHHA 1N0YA 3DF0B 1B9AA 1CLBA 1EJ3A 3OP0A 1TRFA 4I5KA 3RM1A 1BODA 3BOWA 4QJ5B 2L2EA 2F3ZA 4XJKB 1FPWA 5I2QA 1UHIA 1SCVA 3PFVA 4AOMA 1YRUB 4MRXA 3TDZA 4GGNA 5KTYA 4HRGA 3AAKA 1SBJA 2AMIA 2HPSA 4FTGA 1CDLA 2KFHA 4MRYA 3KHEA 5AERA 2K61A 1XVJA 1BU3A 1S5GY 5ER4X 2COLB 1JBAA 3O4YA 5I8NA 2M3WA 2KI6D 2KGBC 2OTGC 1NX3A 2K0JA 3GK2A 2ZRTA 1DJGA 2M7LA 5KSZA 1TN4A 3DVMA 3PLFB 2NZ0A 3BUXB 3OB2B 2A4JA 3JVTC 2WORA 1YX8A 5JJGA 1BMOA 1EXRA 2BCXA 3SIBA 2PSRA 3PALA 4GUKA 3TDUA 1F4QA 2JTZA 4MZLA 2Y1MA 1UHJA 1DJYA 1KCYA 1KQVA 4IL1A 1S5GZ 1R2UA 2CCMA 5D7FA 4NQGA 1XFZO 4M2OA 5HYDA 4BY4A 2ZNDA 4GGFC 5KU1A 1NX0A 1FW4A 3DVKA 4QJ4B 1MF8B 2L4HA 1AHRA 5FYXA 2TN4A 3I5GC 1YURA 1Y1AA 1B8RA 1AK8A 4E68A 2FJUB 2HQWA 2WOSA 3EVRA 2WCFA 1M63B 1CFDA 2KNEA 3TZ1A 1PVBA 2JXLA 4YGBB 2LC5A 4ZCVA 2ISDA 4DUQA 3A8RA 1SCMB 1BLQA 4CPVA 4PE7A 2CT9A 4AQJA 4C0LA 4PCWA 1U5IA 1CM1A 1XA5A 4BY5A 1C07A 3FWBA 2ZKMX 3JTDC 2FCDA 5HKWA 1L7ZA 3OX6A 3JVTB 3SG6A 1KQMC 1JSAA 2ZFDA 2BL0C 1DVIA 1YTZC 2KI6C 1R6PA 3SJSA 3HX4A 1RTP1 3BUMB 1IQ5A 3IQOA 3CTNA 2CXJA 1YUUA 1DF0B 2Q4UA 3NSIA 1W7JB 4MLWA 1NYAA 1SR6C 1F70A 1PVAA 4PE0A 4OV2A 1AJ5A 1S26D 5JOLA 4CLNA 2EGDA 2CBLA 2MHHA 2JULA 1MR8A 3I5FC 4MZKA 2H61C 2I2RE 4YGCB 4M2PA 2KAYA 2F33A 2PASA 2JZIA 1UURA 3A4UB 2LLUA 3VROA 2M1KB 4YRUA 1GGZA 1JFJA 1TCFA 1Y1UA 1NIWA 2LHLA 2LVVA 3PATA 1K90D 1SR6B 4WQ2A 2HQ8A 2KQ6A 1F71A 4MZJA 2V53A 2WNDA 3NXAA 2I94A 3PN7B 3SIAA 1KFXL 2Y4QA 2LLSA 1DJXA 3BQ3A 1DJIA 1XFYO 4HREE 1EG4A 1CTRA 1OSAA 1Y0VH 3LLEA 4YI8A 3C1VA 1SL7A 1ODBA 4P5OE 1ZOTB 1LXFC 1KWOC 2LP2A 1JF2A 1WDCC 1RK9A 1RECA 1CDMA 1SMGA 1TOPA 4OKHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KK8 C;  2EC6 B;  1K9K A;  2SCP A;  1KK7 Z;  2M9G A;  2F8P A;  3NSL A;  1KQM B;  1XK4 C;  1JWD A;  1DGV A;  4JWQ A;  5DKQ A;  1N2D A;  1QLS A;  1B8C A;  2GV5 A;  1L2O C;  1NSH A;  4CFQ A;  2M7N A;  1LIN A;  4M2Q A;  1QX5 B;  2AAO A;  1BOC A;  1XO5 A;  1TNQ A;  1AP4 A;  1IGV A;  2F2P A;  1JC2 A;  1BT6 A;  3WHU B;  2JTT A;  1OZO A;  1K93 D;  2BKI B;  1K2H A;  2FOT A;  1C7W A;  1J1D A;  2BL0 B;  1SPY A;  1B4C A;  1H4B A;  1SRA A;  2BEC A;  2PVB A;  3D10 A;  5CPV A;  3O2P A;  1WRL A;  3CS1 A;  4I5J A;  4PE1 A;  4NDD A;  2JOJ A;  1NX2 A;  1FBV A;  1LVC D;  5F6T A;  5HKZ A;  1NP8 A;  4DRW A;  3GK1 A;  1M46 A;  3SG3 A;  1NPQ A;  1DF0 A;  1PSR A;  1EL4 A;  5CSJ A;  1KWO B;  1ALW A;  2KQY A;  2GGZ A;  1L2O B;  1G4Y R;  2G2B A;  4PHK A;  4ORB B;  2JT8 A;  1J7Q A;  1V1F A;  1QAS A;  1QV1 A;  3PM8 A;  1WY9 A;  1B1G A;  1Y6W A;  3O6B A;  2LV7 A;  4PE4 A;  1J7P A;  2LE9 B;  1SY9 A;  1F8H A;  4Q04 A;  1S6J A;  1KSO A;  2NCO A;  2LAN A;  1CFP A;  1S36 A;  2NCP A;  4OCI A;  1FF1 A;  1OZS A;  2JWW A;  3CR4 X;  3K21 A;  1LA3 A;  3CWG A;  2KHN A;  3EK7 A;  1ZFS A;  1QVI Z;  3I5I C;  3H4S E;  4ZCU A;  1UP5 A;  1KK7 Y;  3EKH A;  1DMO A;  1G33 A;  2QAC A;  2HET A;  1QVI Y;  2NLN A;  1MUX A;  1QTX A;  1IH0 A;  1QV0 A;  2LCP A;  1QXP A;  2LMT A;  2MLE C;  1B8L A;  5PAL A;  1QLK A;  1S6I A;  3OX5 A;  5DKR A;  1F54 A;  3WHT B;  3WXA A;  4GGF A;  1M39 A;  4WRI A;  3TS5 B;  3ZNI A;  2KAX A;  2LHI A;  3CR5 X;  1QS7 A;  4YGD B;  2IS9 A;  4FQO A;  2LMV A;  3LCP C;  1IRJ A;  2WCB A;  1KK8 B;  2LUX A;  3FS7 A;  1UUS A;  2JC2 A;  1DJH A;  4ETO A;  1KFU L;  2KFG A;  2L50 A;  2ZNE A;  2M8U A;  2PRU A;  1EH2 A;  2KFF A;  3SG7 A;  2AUC A;  2MAZ A;  5IBW A;  2M97 A;  2LM5 A;  1YUS A;  4AQI A;  1AJ4 A;  1DJW A;  2LNK A;  1C7V A;  1CMF A;  3GOF A;  1DTL A;  4A4C A;  2I18 A;  1BR1 B;  4F0Z B;  1IG5 A;  5I2L A;  1ALV A;  1CMG A;  2MLF C;  2PAL A;  4HSZ A;  2OTG B;  4A4B A;  1DGU A;  1QX7 A;  3BOW B;  5K89 A;  1CKK A;  2B1U A;  1IJ6 A;  1MWN A;  4JQ0 D;  1J1E A;  3BUN B;  4NDB A;  5AXI A;  1G8I A;  3BYA A;  2KI4 B;  1OMR A;  1TCO B;  1XYD A;  1UWO A;  3HCM A;  1GGW A;  1NWD A;  1OE9 B;  1ZMZ A;  2ZN9 A;  2MRD A;  1K96 A;  3EK8 A;  1YVL A;  1OMD A;  3RLZ A;  4PHJ A;  2G9B A;  1CB1 A;  4YGE B;  1FI5 A;  4MVF A;  2GGM A;  4OR9 B;  3OHM B;  1K94 A;  4N1G A;  4MEW A;  1A75 A;  2JQ6 A;  3F45 A;  4PDZ A;  3SG2 A;  5CSF A;  1SW8 A;  2E6W A;  5GQQ C;  1S1E A;  1F4O A;  2DOQ A;  2MBX A;  1CM4 A;  1GQM A;  1KFU S;  1TTX A;  1WRK A;  1XFX O;  2JNX A;  1JF0 A;  2LUC A;  1BG1 A;  3I5F B;  3M0W A;  1OQP A;  1A03 A;  2K7O A;  2KYC A;  2KI4 C;  2OS8 C;  2L0P A;  4WQ3 A;  3VRN A;  2FCE A;  1PK0 D;  2L4I A;  3I5I B;  3AAJ A;  3CR2 A;  3OB1 B;  5D69 A;  3ZWH A;  4I5N B;  4D1E A;  1VRK A;  2SAS A;  3MSE B;  3I5H B;  2O5G A;  1TNP A;  1M31 A;  3KF9 A;  1SNL A;  1A4P A;  1PSB A;  3D0Y B;  5HKY A;  4ORC B;  3BUW B;  1E8A A;  1KSM A;  1KFX S;  3LK0 A;  1QAT A;  1OMV A;  2M1U A;  3TUY B;  3AKB A;  2LVK A;  2H2K A;  1SL9 A;  2BCB A;  1K95 A;  1B7T Z;  3AKA A;  2LMU A;  3VGO A;  5HLO A;  1J7O A;  1QX2 A;  4MN0 A;  1NX1 A;  4GNK B;  1B7T Y;  3CGA A;  1Q80 A;  1NCY A;  3PSR A;  2BBM A;  2EHB A;  2BE6 A;  1FI6 A;  3CZT X;  2ZN8 A;  5TNC A;  2MA2 A;  2E30 A;  5CSI A;  3SG4 A;  1J55 A;  1MHO A;  5DKN A;  3VRP A;  1HT9 A;  1MXE A;  4I5L B;  1JUO A;  1IQ3 A;  1F55 A;  1YR5 A;  2QPT A;  3BXK A;  4GPL B;  3EKJ A;  2KGR A;  1QJT A;  3IF7 A;  3EVU A;  1RWY A;  2LLT A;  1M45 A;  1SK6 D;  2HF5 A;  3FWC A;  3VRR A;  5AFP A;  1X02 A;  1SL8 A;  1CFF A;  2NXQ A;  1S3P A;  3KO0 A;  3NSO A;  1QIW A;  1CLL A;  1RRO A;  3TDI A;  4DS7 A;  1NUB A;  1PAL A;  2Y5I A;  2K2F A;  1XFV O;  1H8B A;  3EVV A;  3VRQ A;  1WDC B;  1YX7 A;  1DJZ A;  3NSK A;  2KBI A;  1RFJ A;  2RGI A;  1JFK A;  1S6C A;  3D0Y A;  3SG5 A;  1Y1X A;  4PHN A;  2BE4 A;  2JRF A;  1CDN A;  3IQQ A;  1TNW A;  2EC6 C;  4PAL A;  3LK1 A;  1N65 A;  1K8U A;  1PRW A;  1UHN A;  5I2O A;  1V1G A;  2BBN A;  3O78 A;  1NCZ A;  3ICB A;  4GFT A;  2R2I A;  2LVI A;  4JPZ B;  1ZUZ A;  3DF0 A;  4R1E A;  2KOT A;  2PMY A;  1A2X A;  1A29 A;  1SCM C;  2Y1N A;  4YGA A;  4UPG A;  1PUL A;  2KAV A;  4QJ3 B;  4NDC A;  1OOJ A;  1GJY A;  1SKT A;  1YVH A;  1DT7 B;  2H61 A;  5ER5 A;  5J3X A;  1WRZ A;  2P6B B;  4C0K A;  3EK4 A;  1NCX A;  1A75 B;  2K2A A;  2K7D A;  2KYF A;  4P2Y B;  1AUI B;  1IJ5 A;  3GK4 X;  3I5H C;  2JT0 A;  1BR4 B;  1WLM A;  4ORA B;  3DVJ A;  4DCK A;  3KEV A;  3TS5 C;  1LKJ A;  4TNC A;  2KDH A;  5B8I B;  1WLZ A;  5G08 A;  4USL A;  2CTN A;  2ZRS A;  3KPX A;  2MJW B;  1QIV A;  3PN7 C;  4C0J A;  1LA0 A;  1J7R A;  2JU0 A;  2K7C A;  1CNP A;  5HLV A;  3CLN A;  1W7I B;  3FIA A;  4MSP A;  1MQ1 A;  2F3Y A;  4PHM A;  5AAN A;  1HQV A;  3WNX B;  1SYM A;  2VRG A;  1CDP A;  4XJK A;  2JT3 A;  3QRX A;  2JNF A;  2KSP A;  1IWQ A;  1TNX A;  2L5X B;  2M29 A;  4YBH B;  1K9U A;  1K9P A;  2LAP A;  1BF5 A;  2OS8 B;  2M49 B;  4YI9 A;  1XFU O;  4GAO A;  1U5I B;  2LVJ A;  4N1F A;  3LL8 B;  2M0R A;  2F2O A;  5BPJ A;  1YRT B;  2K8M B;  1CFC A;  1XK4 A;  5CSN A;  2OPO A;  1MXL C;  2I7A A;  3DD4 A;  1CLM A;  2D8N A;  2JXC A;  2KBM A;  4L9M A;  1UHK A;  2BKH B;  1B47 A;  2K7B A;  4N5X A;  5AEQ A;  1D1O A;  1YUT A;  2L51 A;  2LP3 A;  2CNP A;  3E3R A;  2O60 A;  2WC8 A;  2JPT A;  4U8D A;  1IKU A;  2BCA A;  1EG3 A;  1TIZ A;  4DIR A;  1BJF A;  3DVE A;  1RJV A;  3JTD B;  4ICB A;  1ZAC A;  1AVS A;  2WCE A;  4GBA A;  3BUO B;  4OVN F;  3TUY C;  4HRH A;  4XYN A;  4MBE A;  4CID A;  3I5G B;  2Q91 A;  1XFW O;  2L98 A;  4CFR A;  1UHH A;  1N0Y A;  3DF0 B;  1B9A A;  1CLB A;  1EJ3 A;  3OP0 A;  1TRF A;  4I5K A;  3RM1 A;  1BOD A;  3BOW A;  4QJ5 B;  2L2E A;  2F3Z A;  4XJK B;  1FPW A;  5I2Q A;  1UHI A;  1SCV A;  3PFV A;  4AOM A;  1YRU B;  4MRX A;  3TDZ A;  4GGN A;  5KTY A;  4HRG A;  3AAK A;  1SBJ A;  2AMI A;  2HPS A;  4FTG A;  1CDL A;  2KFH A;  4MRY A;  3KHE A;  5AER A;  2K61 A;  1XVJ A;  1BU3 A;  1S5G Y;  5ER4 X;  2COL B;  1JBA A;  3O4Y A;  5I8N A;  2M3W A;  2KI6 D;  2KGB C;  2OTG C;  1NX3 A;  2K0J A;  3GK2 A;  2ZRT A;  1DJG A;  2M7L A;  5KSZ A;  1TN4 A;  3DVM A;  3PLF B;  2NZ0 A;  3BUX B;  3OB2 B;  2A4J A;  3JVT C;  2WOR A;  1YX8 A;  5JJG A;  1BMO A;  1EXR A;  2BCX A;  3SIB A;  2PSR A;  3PAL A;  4GUK A;  3TDU A;  1F4Q A;  2JTZ A;  4MZL A;  2Y1M A;  1UHJ A;  1DJY A;  1KCY A;  1KQV A;  4IL1 A;  1S5G Z;  1R2U A;  2CCM A;  5D7F A;  4NQG A;  1XFZ O;  4M2O A;  5HYD A;  4BY4 A;  2ZND A;  4GGF C;  5KU1 A;  1NX0 A;  1FW4 A;  3DVK A;  4QJ4 B;  1MF8 B;  2L4H A;  1AHR A;  5FYX A;  2TN4 A;  3I5G C;  1YUR A;  1Y1A A;  1B8R A;  1AK8 A;  4E68 A;  2FJU B;  2HQW A;  2WOS A;  3EVR A;  2WCF A;  1M63 B;  1CFD A;  2KNE A;  3TZ1 A;  1PVB A;  2JXL A;  4YGB B;  2LC5 A;  4ZCV A;  2ISD A;  4DUQ A;  3A8R A;  1SCM B;  1BLQ A;  4CPV A;  4PE7 A;  2CT9 A;  4AQJ A;  4C0L A;  4PCW A;  1U5I A;  1CM1 A;  1XA5 A;  4BY5 A;  1C07 A;  3FWB A;  2ZKM X;  3JTD C;  2FCD A;  5HKW A;  1L7Z A;  3OX6 A;  3JVT B;  3SG6 A;  1KQM C;  1JSA A;  2ZFD A;  2BL0 C;  1DVI A;  1YTZ C;  2KI6 C;  1R6P A;  3SJS A;  3HX4 A;  1RTP 1;  3BUM B;  1IQ5 A;  3IQO A;  3CTN A;  2CXJ A;  1YUU A;  1DF0 B;  2Q4U A;  3NSI A;  1W7J B;  4MLW A;  1NYA A;  1SR6 C;  1F70 A;  1PVA A;  4PE0 A;  4OV2 A;  1AJ5 A;  1S26 D;  5JOL A;  4CLN A;  2EGD A;  2CBL A;  2MHH A;  2JUL A;  1MR8 A;  3I5F C;  4MZK A;  2H61 C;  2I2R E;  4YGC B;  4M2P A;  2KAY A;  2F33 A;  2PAS A;  2JZI A;  1UUR A;  3A4U B;  2LLU A;  3VRO A;  2M1K B;  4YRU A;  1GGZ A;  1JFJ A;  1TCF A;  1Y1U A;  1NIW A;  2LHL A;  2LVV A;  3PAT A;  1K90 D;  1SR6 B;  4WQ2 A;  2HQ8 A;  2KQ6 A;  1F71 A;  4MZJ A;  2V53 A;  2WND A;  3NXA A;  2I94 A;  3PN7 B;  3SIA A;  1KFX L;  2Y4Q A;  2LLS A;  1DJX A;  3BQ3 A;  1DJI A;  1XFY O;  4HRE E;  1EG4 A;  1CTR A;  1OSA A;  1Y0V H;  3LLE A;  4YI8 A;  3C1V A;  1SL7 A;  1ODB A;  4P5O E;  1ZOT B;  1LXF C;  1KWO C;  2LP2 A;  1JF2 A;  1WDC C;  1RK9 A;  1REC A;  1CDM A;  1SMG A;  1TOP A;  4OKH A; 
#chains in the Genus database with same CATH topology
 1KK8 C;  1OOG A;  2EC6 B;  1K9K A;  2SCP A;  1KK7 Z;  2M9G A;  2F8P A;  3NSL A;  1KQM B;  1XK4 C;  1JWD A;  1DGV A;  3O4X A;  4JWQ A;  5DKQ A;  1N2D A;  1QLS A;  1B8C A;  2GV5 A;  3SS5 A;  1L2O C;  1NSH A;  4CFQ A;  2M7N A;  1LIN A;  4M2Q A;  1QX5 B;  1IIO A;  2AAO A;  1BOC A;  1XO5 A;  1TNQ A;  1AP4 A;  1IGV A;  2F2P A;  1JC2 A;  1BT6 A;  3WHU B;  2JTT A;  1OZO A;  1K93 D;  2BKI B;  1K2H A;  2FOT A;  1C7W A;  3CZ2 A;  1J1D A;  2BL0 B;  1SPY A;  1B4C A;  1C3Y A;  1H4B A;  1SRA A;  3CYZ A;  2BEC A;  2PVB A;  3D10 A;  5CPV A;  3O2P A;  3PM2 A;  3S0F A;  1WRL A;  3CS1 A;  3D76 A;  4I5J A;  4NDD A;  2JOJ A;  1NX2 A;  4PE1 A;  1FBV A;  1LVC D;  5F6T A;  3D74 A;  5HKZ A;  1NP8 A;  4DRW A;  3GK1 A;  1M46 A;  3SG3 A;  1NPQ A;  1DF0 A;  1PSR A;  1EL4 A;  5CSJ A;  1KWO B;  1ALW A;  2KQY A;  2GGZ A;  1L2O B;  1G4Y R;  2G2B A;  4PHK A;  1OW4 A;  4ORB B;  2YGU A;  2JT8 A;  1Z2C B;  1J7Q A;  1GM0 A;  3OBV A;  1V1F A;  1QAS A;  1QV1 A;  3PM8 A;  1WY9 A;  1B1G A;  1Y6W A;  3O6B A;  2LV7 A;  4PE4 A;  1J7P A;  5DIC A;  2LE9 B;  1SY9 A;  1F8H A;  4Q04 A;  1S6J A;  1KSO A;  2BAP A;  2NCO A;  1QWV A;  2LAN A;  1CFP A;  1S36 A;  2NCP A;  4OCI A;  5FI7 A;  1OZS A;  1FF1 A;  2JWW A;  3CR4 X;  3K21 A;  1LA3 A;  3CWG A;  2KHN A;  3EK7 A;  1ZFS A;  1QVI Z;  3I5I C;  3NHT A;  3PJI A;  3H4S E;  4ZCU A;  1UP5 A;  1KK7 Y;  3EKH A;  1DMO A;  1G33 A;  2QAC A;  2HET A;  1QVI Y;  2NLN A;  1MUX A;  1QTX A;  1IH0 A;  1QV0 A;  2LCP A;  1QXP A;  2LMT A;  2MLE C;  1B8L A;  5PAL A;  1QLK A;  1S6I A;  3OX5 A;  3EG5 B;  3R72 A;  5DKR A;  3WHT B;  1F54 A;  3WXA A;  4KYN A;  4GGF A;  1M39 A;  2FJY A;  3DY9 A;  4WRI A;  2L2C A;  3TS5 B;  3ZNI A;  2KAX A;  2LHI A;  3CR5 X;  1QS7 A;  4YGD B;  2IS9 A;  4FQO A;  2LMV A;  3LCP C;  1IRJ A;  2WCB A;  1KK8 B;  2LUX A;  3FS7 A;  1UUS A;  2JC2 A;  1DJH A;  4ETO A;  1KFU L;  2P71 A;  2KFG A;  2L50 A;  2QEB A;  2ZNE A;  2M8U A;  2PRU A;  2QEV A;  1EH2 A;  2KFF A;  3SG7 A;  2PYQ A;  2AUC A;  2MAZ A;  5HL1 A;  5IBW A;  2M97 A;  2LM5 A;  2P70 A;  2WC5 A;  1YUS A;  4AQI A;  1AJ4 A;  1DJW A;  2LNK A;  1C7V A;  1CMF A;  3GOF A;  1DTL A;  4PT1 A;  4A4C A;  1BR1 B;  2I18 A;  4F0Z B;  1IG5 A;  5I2L A;  1ALV A;  3UO9 A;  1CMG A;  2MLF C;  2PAL A;  4HSZ A;  2OTG B;  3V2L A;  1DGU A;  4A4B A;  1QX7 A;  3BOW B;  3IVT A;  2WCJ A;  5K89 A;  1CKK A;  2B1U A;  1IJ6 A;  1MWN A;  4JQ0 D;  1J1E A;  3BUN B;  4NDB A;  5AXI A;  1G8I A;  3BYA A;  2KI4 B;  1OMR A;  1TCO B;  1XYD A;  1UWO A;  3HCM A;  1GGW A;  1NWD A;  1OE9 B;  1ZMZ A;  2ZN9 A;  2MRD A;  1K96 A;  3EK8 A;  1YVL A;  1OMD A;  3RLZ A;  4PHJ A;  2G9B A;  1CB1 A;  4YGE B;  2KLD A;  1FI5 A;  3CAB A;  4MVF A;  2KLE A;  2GGM A;  4OR9 B;  3OHM B;  1K94 A;  4N1G A;  4MEW A;  1A75 A;  2JQ6 A;  3F45 A;  4PDZ A;  3SG2 A;  5CSF A;  1SW8 A;  1W9Z A;  2E6W A;  5GQQ C;  3D78 A;  1S1E A;  5I94 A;  1F4O A;  2DOQ A;  2MBX A;  1CM4 A;  1GQM A;  1KFU S;  1TTX A;  1WRK A;  1XFX O;  2JNX A;  1JF0 A;  2LUC A;  1BG1 A;  3I5F B;  3M0W A;  1OQP A;  1A03 A;  2K7O A;  2KYC A;  2KI4 C;  2OS8 C;  2L0P A;  4WQ3 A;  3VRN A;  2FCE A;  1PK0 D;  2L4I A;  3I5I B;  1OOH A;  3AAJ A;  3CR2 A;  3OB1 B;  3L47 A;  5D69 A;  3ZWH A;  4I5N B;  3OGN A;  4D1E A;  1VRK A;  2SAS A;  3S0G A;  3MSE B;  3I5H B;  2O5G A;  1TNP A;  1M31 A;  3KF9 A;  3Q8I A;  1SNL A;  3DZT A;  1A4P A;  1PSB A;  3B87 A;  3D0Y B;  5HKY A;  4ORC B;  3BUW B;  2H8V A;  1E8A A;  1KSM A;  3L4A A;  1KFX S;  3LK0 A;  1QAT A;  1OMV A;  1P28 A;  2M1U A;  3FE6 A;  3TUY B;  3AKB A;  2LVK A;  2H2K A;  1SL9 A;  2BCB A;  1K95 A;  1B7T Z;  3AKA A;  2LMU A;  3VGO A;  5HLO A;  1J7O A;  1QX2 A;  4MN0 A;  1NX1 A;  4GNK B;  1B7T Y;  3B86 A;  1Q80 A;  3CGA A;  1NCY A;  3PSR A;  2BBM A;  2EHB A;  3BFH A;  2BE6 A;  3NGV A;  1FI6 A;  3CZT X;  2ZN8 A;  5TNC A;  1DQE A;  2E30 A;  2MA2 A;  5CSI A;  3SG4 A;  1J55 A;  2ERB A;  1MHO A;  5DKN A;  3VRP A;  1HT9 A;  1MXE A;  4I5L B;  1JUO A;  1IQ3 A;  1T14 A;  1F55 A;  1YR5 A;  2QPT A;  3BXK A;  4GPL B;  3EKJ A;  2KGR A;  1QJT A;  3IF7 A;  3EVU A;  1RWY A;  2LLT A;  1M45 A;  1SK6 D;  2HF5 A;  3FWC A;  3VRR A;  5AFP A;  1X02 A;  1SL8 A;  1CFF A;  2NXQ A;  1S3P A;  3KO0 A;  3NSO A;  3R1V A;  3L4L A;  1QIW A;  1CLL A;  1RRO A;  3TDI A;  4DS7 A;  1NUB A;  1PAL A;  2Y5I A;  2K2F A;  3BFB A;  3DXL A;  1XFV O;  1H8B A;  3EVV A;  3VRQ A;  2WCM A;  1WDC B;  1YX7 A;  1DJZ A;  3NSK A;  2KBI A;  1RFJ A;  2RGI A;  1JFK A;  1S6C A;  3D0Y A;  3SG5 A;  1Y1X A;  4PHN A;  2BE4 A;  2JRF A;  1CDN A;  3IQQ A;  1TNW A;  2EC6 C;  4PAL A;  3LK1 A;  1N65 A;  1K8U A;  1PRW A;  1UHN A;  5I2O A;  3NHI A;  1V1G A;  2BBN A;  3O78 A;  1NCZ A;  3ICB A;  4GFT A;  2R2I A;  2LVI A;  4JPZ B;  1ZUZ A;  2WC6 A;  3DF0 A;  2KOT A;  2PMY A;  1A2X A;  1A29 A;  1SCM C;  2Y1N A;  4R1E A;  4YGA A;  4UPG A;  1PUL A;  2KAV A;  4QJ3 B;  4NDC A;  1OOJ A;  1GJY A;  1SKT A;  1YVH A;  1DT7 B;  2H61 A;  5ER5 A;  3SS3 A;  3B6X A;  5J3X A;  1WRZ A;  2L5Y A;  2P6B B;  5EL2 A;  3EK4 A;  3UNW A;  1NCX A;  4C0K A;  1A75 B;  2K2A A;  2K7D A;  2KYF A;  4P2Y B;  1AUI B;  1IJ5 A;  3GK4 X;  3I5H C;  2JT0 A;  1BR4 B;  1WLM A;  4ORA B;  3DVJ A;  4FQT A;  4DCK A;  3DYE A;  3KEV A;  1LKJ A;  3TS5 C;  4TNC A;  2KDH A;  5B8I B;  1WLZ A;  5G08 A;  4USL A;  1Z4H A;  2CTN A;  2ZRS A;  3CZ0 A;  3KPX A;  2MJW B;  3R1O A;  1QIV A;  3PN7 C;  4C0J A;  1LA0 A;  1J7R A;  2JU0 A;  2K7C A;  1CNP A;  5HLV A;  3CLN A;  1W7I B;  3FIA A;  4MSP A;  3BFA A;  1MQ1 A;  2F3Y A;  4PHM A;  5AAN A;  1HQV A;  3WNX B;  1SYM A;  2VRG A;  1CDP A;  4XJK A;  2JT3 A;  3QRX A;  2JNF A;  2KSP A;  1IWQ A;  1TNX A;  2L5X B;  2M29 A;  4YBH B;  1K9U A;  1K9P A;  2LAP A;  1BF5 A;  2OS8 B;  2M49 B;  1DEK A;  4YI9 A;  1XFU O;  4GAO A;  1U5I B;  2LVJ A;  4N1F A;  3LL8 B;  2M0R A;  2F2O A;  1TWO A;  5BPJ A;  1YRT B;  2K8M B;  2QDI A;  1XK4 A;  1CFC A;  5CSN A;  2OPO A;  1MXL C;  2I7A A;  4INX A;  2BNX A;  3DD4 A;  1CLM A;  2D8N A;  2JXC A;  2KBM A;  4L9M A;  1UHK A;  2BKH B;  1B47 A;  2K7B A;  4N5X A;  5AEQ A;  1D1O A;  1YUT A;  2L51 A;  2LP3 A;  2CNP A;  3E3R A;  3CDN A;  2O60 A;  2WC8 A;  4JD9 A;  2JPT A;  3B88 A;  4U8D A;  1IKU A;  2BCA A;  1EG3 A;  1TIZ A;  4DIR A;  1BJF A;  2PQL A;  3DVE A;  1RJV A;  3BJH A;  3JTD B;  4ICB A;  3S0A A;  1ZAC A;  1AVS A;  2WCE A;  4GBA A;  3BUO B;  4OZD A;  4OVN F;  3TUY C;  4HRH A;  4IJ7 A;  4MBE A;  4XYN A;  3I5G B;  4CID A;  2Q91 A;  1XFW O;  2L98 A;  4CFR A;  1UHH A;  4F7F A;  1N0Y A;  3DF0 B;  1B9A A;  2WCK A;  2WCL A;  1CLB A;  1EJ3 A;  1LS8 A;  3OP0 A;  1TRF A;  4I5K A;  3RM1 A;  1BOD A;  2GTE A;  3BOW A;  3D73 A;  4QJ5 B;  2L2E A;  2F3Z A;  4XJK B;  1FPW A;  5I2Q A;  1UHI A;  1SCV A;  3PFV A;  4AOM A;  1YRU B;  4MRX A;  3TDZ A;  4GGN A;  5KTY A;  4HRG A;  3AAK A;  1SBJ A;  2AMI A;  2HPS A;  4FTG A;  1CDL A;  2KFH A;  4MRY A;  3KHE A;  3RZS A;  5AER A;  2K61 A;  2JPO A;  1XVJ A;  1BU3 A;  1S5G Y;  5ER4 X;  2COL B;  4INW A;  3O4Y A;  1JBA A;  5I8N A;  2M3W A;  2KI6 D;  2KGB C;  2OTG C;  1NX3 A;  2K0J A;  3GK2 A;  2ZRT A;  1DJG A;  2M7L A;  5KSZ A;  1TN4 A;  3DVM A;  3PLF B;  1TUZ A;  2NZ0 A;  3BUX B;  3OB2 B;  2A4J A;  3JVT C;  2WOR A;  1YX8 A;  5JJG A;  1BMO A;  1EXR A;  2BCX A;  3SIB A;  3S0E A;  2PSR A;  1OOI X;  3PAL A;  4GUK A;  3TDU A;  1F4Q A;  3FE9 A;  2JTZ A;  4MZL A;  2Y1M A;  3VB1 A;  1UHJ A;  1DJY A;  1KCY A;  1KQV A;  4IL1 A;  3B7A A;  1S5G Z;  1R2U A;  2CCM A;  5D7F A;  4NQG A;  1XFZ O;  4M2O A;  5HYD A;  4BY4 A;  2ZND A;  4GGF C;  5KU1 A;  1NX0 A;  2QEH A;  1FW4 A;  3DVK A;  4QJ4 B;  1ORG A;  1MF8 B;  3R1P A;  2L4H A;  1AHR A;  5FYX A;  2TN4 A;  3N7H A;  3I5G C;  1TUJ A;  1YUR A;  1Y1A A;  2KPH A;  1B8R A;  1AK8 A;  3D75 A;  4E68 A;  2FJU B;  2HQW A;  2WOS A;  3EVR A;  2WCF A;  1M63 B;  1CFD A;  2KNE A;  3TZ1 A;  1PVB A;  2JXL A;  4YGB B;  2LC5 A;  4ZCV A;  3FE8 A;  2ISD A;  4DUQ A;  3A8R A;  1SCM B;  3S0D A;  1BLQ A;  4CPV A;  4PE7 A;  5FI2 A;  2CT9 A;  4AQJ A;  4C0L A;  4PCW A;  1SSE B;  5D3O A;  1U5I A;  1CM1 A;  1XA5 A;  4BY5 A;  1C07 A;  3FWB A;  2ZKM X;  3JTD C;  1XFR A;  2FCD A;  5HKW A;  1L7Z A;  3OX6 A;  3JVT B;  3SG6 A;  1KQM C;  3S0B A;  1JSA A;  2ZFD A;  2BL0 C;  1DVI A;  1YTZ C;  2KI6 C;  1R6P A;  3SJS A;  3HX4 A;  1RTP 1;  2WCH A;  3BUM B;  3CZ1 A;  1IQ5 A;  3IQO A;  3K1E A;  3CTN A;  2CXJ A;  1YUU A;  1DF0 B;  2Q4U A;  3NSI A;  1W7J B;  4MLW A;  1NYA A;  1SR6 C;  1F70 A;  1PVA A;  3QME A;  4PE0 A;  4OV2 A;  1AJ5 A;  1S26 D;  5JOL A;  4CLN A;  2EGD A;  2CBL A;  2MHH A;  2JUL A;  1MR8 A;  1DEL A;  3I5F C;  3SS4 A;  3D77 A;  4MZK A;  2H61 C;  2I2R E;  4YGC B;  1C3Z A;  4M2P A;  2KAY A;  2F33 A;  2PAS A;  2JZI A;  1UUR A;  3A4U B;  2LLU A;  3VRO A;  2M1K B;  4YRU A;  1GGZ A;  1JFJ A;  1TCF A;  1Y1U A;  1NIW A;  2LHL A;  2LVV A;  2QEO A;  1K90 D;  3PAT A;  1SR6 B;  4WQ2 A;  4JKT A;  1OOF A;  2HQ8 A;  2KQ6 A;  1F71 A;  4MZJ A;  2V53 A;  2WND A;  3NXA A;  2I94 A;  5FI6 A;  3PN7 B;  3SIA A;  1KFX L;  2Y4Q A;  2LLS A;  1DJX A;  3BQ3 A;  1DJI A;  1XFY O;  4HRE E;  1EG4 A;  1CTR A;  1OSA A;  1Y0V H;  3LLE A;  4YI8 A;  3C1V A;  1SL7 A;  1ODB A;  2K60 A;  4P5O E;  1ZOT B;  1LXF C;  1KWO C;  2LP2 A;  1DC1 A;  1JF2 A;  1WDC C;  1RK9 A;  1REC A;  1CDM A;  1SMG A;  1TOP A;  4OKH A; 
#chains in the Genus database with same CATH homology
 1KK8 C;  2EC6 B;  1K9K A;  2SCP A;  1KK7 Z;  2M9G A;  2F8P A;  3NSL A;  1KQM B;  1XK4 C;  1JWD A;  1DGV A;  4JWQ A;  5DKQ A;  1N2D A;  1QLS A;  1B8C A;  2GV5 A;  1L2O C;  1NSH A;  4CFQ A;  2M7N A;  1LIN A;  4M2Q A;  1QX5 B;  2AAO A;  1BOC A;  1XO5 A;  1TNQ A;  1AP4 A;  1IGV A;  2F2P A;  1JC2 A;  1BT6 A;  3WHU B;  2JTT A;  1OZO A;  1K93 D;  2BKI B;  1K2H A;  2FOT A;  1C7W A;  1J1D A;  2BL0 B;  1SPY A;  1B4C A;  1H4B A;  1SRA A;  2BEC A;  2PVB A;  3D10 A;  5CPV A;  3O2P A;  1WRL A;  3CS1 A;  4I5J A;  4PE1 A;  4NDD A;  2JOJ A;  1NX2 A;  1FBV A;  1LVC D;  5F6T A;  5HKZ A;  1NP8 A;  4DRW A;  3GK1 A;  1M46 A;  3SG3 A;  1NPQ A;  1DF0 A;  1PSR A;  1EL4 A;  5CSJ A;  1KWO B;  1ALW A;  2KQY A;  2GGZ A;  1L2O B;  1G4Y R;  2G2B A;  4PHK A;  4ORB B;  2JT8 A;  1J7Q A;  1V1F A;  1QAS A;  1QV1 A;  3PM8 A;  1WY9 A;  1B1G A;  1Y6W A;  3O6B A;  2LV7 A;  4PE4 A;  1J7P A;  2LE9 B;  1SY9 A;  1F8H A;  4Q04 A;  1S6J A;  1KSO A;  2NCO A;  2LAN A;  1CFP A;  1S36 A;  2NCP A;  4OCI A;  1FF1 A;  1OZS A;  2JWW A;  3CR4 X;  3K21 A;  1LA3 A;  3CWG A;  2KHN A;  3EK7 A;  1ZFS A;  1QVI Z;  3I5I C;  3H4S E;  4ZCU A;  1UP5 A;  1KK7 Y;  3EKH A;  1DMO A;  1G33 A;  2QAC A;  2HET A;  1QVI Y;  2NLN A;  1MUX A;  1QTX A;  1IH0 A;  1QV0 A;  2LCP A;  1QXP A;  2LMT A;  2MLE C;  1B8L A;  5PAL A;  1QLK A;  1S6I A;  3OX5 A;  5DKR A;  1F54 A;  3WHT B;  3WXA A;  4GGF A;  1M39 A;  4WRI A;  3TS5 B;  3ZNI A;  2KAX A;  2LHI A;  3CR5 X;  1QS7 A;  4YGD B;  2IS9 A;  4FQO A;  2LMV A;  3LCP C;  1IRJ A;  2WCB A;  1KK8 B;  2LUX A;  3FS7 A;  1UUS A;  2JC2 A;  1DJH A;  4ETO A;  1KFU L;  2KFG A;  2L50 A;  2ZNE A;  2M8U A;  2PRU A;  1EH2 A;  2KFF A;  3SG7 A;  2AUC A;  2MAZ A;  5IBW A;  2M97 A;  2LM5 A;  1YUS A;  4AQI A;  1AJ4 A;  1DJW A;  2LNK A;  1C7V A;  1CMF A;  3GOF A;  1DTL A;  4A4C A;  2I18 A;  1BR1 B;  4F0Z B;  1IG5 A;  5I2L A;  1ALV A;  1CMG A;  2MLF C;  2PAL A;  4HSZ A;  2OTG B;  4A4B A;  1DGU A;  1QX7 A;  3BOW B;  5K89 A;  1CKK A;  2B1U A;  1IJ6 A;  1MWN A;  4JQ0 D;  1J1E A;  3BUN B;  4NDB A;  5AXI A;  1G8I A;  3BYA A;  2KI4 B;  1OMR A;  1TCO B;  1XYD A;  1UWO A;  3HCM A;  1GGW A;  1NWD A;  1OE9 B;  1ZMZ A;  2ZN9 A;  2MRD A;  1K96 A;  3EK8 A;  1YVL A;  1OMD A;  3RLZ A;  4PHJ A;  2G9B A;  1CB1 A;  4YGE B;  1FI5 A;  4MVF A;  2GGM A;  4OR9 B;  3OHM B;  1K94 A;  4N1G A;  4MEW A;  1A75 A;  2JQ6 A;  3F45 A;  4PDZ A;  3SG2 A;  5CSF A;  1SW8 A;  2E6W A;  5GQQ C;  1S1E A;  1F4O A;  2DOQ A;  2MBX A;  1CM4 A;  1GQM A;  1KFU S;  1TTX A;  1WRK A;  1XFX O;  2JNX A;  1JF0 A;  2LUC A;  1BG1 A;  3I5F B;  3M0W A;  1OQP A;  1A03 A;  2K7O A;  2KYC A;  2KI4 C;  2OS8 C;  2L0P A;  4WQ3 A;  3VRN A;  2FCE A;  1PK0 D;  2L4I A;  3I5I B;  3AAJ A;  3CR2 A;  3OB1 B;  5D69 A;  3ZWH A;  4I5N B;  4D1E A;  1VRK A;  2SAS A;  3MSE B;  3I5H B;  2O5G A;  1TNP A;  1M31 A;  3KF9 A;  1SNL A;  1A4P A;  1PSB A;  3D0Y B;  5HKY A;  4ORC B;  3BUW B;  1E8A A;  1KSM A;  1KFX S;  3LK0 A;  1QAT A;  1OMV A;  2M1U A;  3TUY B;  3AKB A;  2LVK A;  2H2K A;  1SL9 A;  2BCB A;  1K95 A;  1B7T Z;  3AKA A;  2LMU A;  3VGO A;  5HLO A;  1J7O A;  1QX2 A;  4MN0 A;  1NX1 A;  4GNK B;  1B7T Y;  3CGA A;  1Q80 A;  1NCY A;  3PSR A;  2BBM A;  2EHB A;  2BE6 A;  1FI6 A;  3CZT X;  2ZN8 A;  5TNC A;  2MA2 A;  2E30 A;  5CSI A;  3SG4 A;  1J55 A;  1MHO A;  5DKN A;  3VRP A;  1HT9 A;  1MXE A;  4I5L B;  1JUO A;  1IQ3 A;  1F55 A;  1YR5 A;  2QPT A;  3BXK A;  4GPL B;  3EKJ A;  2KGR A;  1QJT A;  3IF7 A;  3EVU A;  1RWY A;  2LLT A;  1M45 A;  1SK6 D;  2HF5 A;  3FWC A;  3VRR A;  5AFP A;  1X02 A;  1SL8 A;  1CFF A;  2NXQ A;  1S3P A;  3KO0 A;  3NSO A;  1QIW A;  1CLL A;  1RRO A;  3TDI A;  4DS7 A;  1NUB A;  1PAL A;  2Y5I A;  2K2F A;  1XFV O;  1H8B A;  3EVV A;  3VRQ A;  1WDC B;  1YX7 A;  1DJZ A;  3NSK A;  2KBI A;  1RFJ A;  2RGI A;  1JFK A;  1S6C A;  3D0Y A;  3SG5 A;  1Y1X A;  4PHN A;  2BE4 A;  2JRF A;  1CDN A;  3IQQ A;  1TNW A;  2EC6 C;  4PAL A;  3LK1 A;  1N65 A;  1K8U A;  1PRW A;  1UHN A;  5I2O A;  1V1G A;  2BBN A;  3O78 A;  1NCZ A;  3ICB A;  4GFT A;  2R2I A;  2LVI A;  4JPZ B;  1ZUZ A;  3DF0 A;  4R1E A;  2KOT A;  2PMY A;  1A2X A;  1A29 A;  1SCM C;  2Y1N A;  4YGA A;  4UPG A;  1PUL A;  2KAV A;  4QJ3 B;  4NDC A;  1OOJ A;  1GJY A;  1SKT A;  1YVH A;  1DT7 B;  2H61 A;  5ER5 A;  5J3X A;  1WRZ A;  2P6B B;  4C0K A;  3EK4 A;  1NCX A;  1A75 B;  2K2A A;  2K7D A;  2KYF A;  4P2Y B;  1AUI B;  1IJ5 A;  3GK4 X;  3I5H C;  2JT0 A;  1BR4 B;  1WLM A;  4ORA B;  3DVJ A;  4DCK A;  3KEV A;  3TS5 C;  1LKJ A;  4TNC A;  2KDH A;  5B8I B;  1WLZ A;  5G08 A;  4USL A;  2CTN A;  2ZRS A;  3KPX A;  2MJW B;  1QIV A;  3PN7 C;  4C0J A;  1LA0 A;  1J7R A;  2JU0 A;  2K7C A;  1CNP A;  5HLV A;  3CLN A;  1W7I B;  3FIA A;  4MSP A;  1MQ1 A;  2F3Y A;  4PHM A;  5AAN A;  1HQV A;  3WNX B;  1SYM A;  2VRG A;  1CDP A;  4XJK A;  2JT3 A;  3QRX A;  2JNF A;  2KSP A;  1IWQ A;  1TNX A;  2L5X B;  2M29 A;  4YBH B;  1K9U A;  1K9P A;  2LAP A;  1BF5 A;  2OS8 B;  2M49 B;  4YI9 A;  1XFU O;  4GAO A;  1U5I B;  2LVJ A;  4N1F A;  3LL8 B;  2M0R A;  2F2O A;  5BPJ A;  1YRT B;  2K8M B;  1CFC A;  1XK4 A;  5CSN A;  2OPO A;  1MXL C;  2I7A A;  3DD4 A;  1CLM A;  2D8N A;  2JXC A;  2KBM A;  4L9M A;  1UHK A;  2BKH B;  1B47 A;  2K7B A;  4N5X A;  5AEQ A;  1D1O A;  1YUT A;  2L51 A;  2LP3 A;  2CNP A;  3E3R A;  2O60 A;  2WC8 A;  2JPT A;  4U8D A;  1IKU A;  2BCA A;  1EG3 A;  1TIZ A;  4DIR A;  1BJF A;  3DVE A;  1RJV A;  3JTD B;  4ICB A;  1ZAC A;  1AVS A;  2WCE A;  4GBA A;  3BUO B;  4OVN F;  3TUY C;  4HRH A;  4XYN A;  4MBE A;  4CID A;  3I5G B;  2Q91 A;  1XFW O;  2L98 A;  4CFR A;  1UHH A;  1N0Y A;  3DF0 B;  1B9A A;  1CLB A;  1EJ3 A;  3OP0 A;  1TRF A;  4I5K A;  3RM1 A;  1BOD A;  3BOW A;  4QJ5 B;  2L2E A;  2F3Z A;  4XJK B;  1FPW A;  5I2Q A;  1UHI A;  1SCV A;  3PFV A;  4AOM A;  1YRU B;  4MRX A;  3TDZ A;  4GGN A;  5KTY A;  4HRG A;  3AAK A;  1SBJ A;  2AMI A;  2HPS A;  4FTG A;  1CDL A;  2KFH A;  4MRY A;  3KHE A;  5AER A;  2K61 A;  1XVJ A;  1BU3 A;  1S5G Y;  5ER4 X;  2COL B;  1JBA A;  3O4Y A;  5I8N A;  2M3W A;  2KI6 D;  2KGB C;  2OTG C;  1NX3 A;  2K0J A;  3GK2 A;  2ZRT A;  1DJG A;  2M7L A;  5KSZ A;  1TN4 A;  3DVM A;  3PLF B;  2NZ0 A;  3BUX B;  3OB2 B;  2A4J A;  3JVT C;  2WOR A;  1YX8 A;  5JJG A;  1BMO A;  1EXR A;  2BCX A;  3SIB A;  2PSR A;  3PAL A;  4GUK A;  3TDU A;  1F4Q A;  2JTZ A;  4MZL A;  2Y1M A;  1UHJ A;  1DJY A;  1KCY A;  1KQV A;  4IL1 A;  1S5G Z;  1R2U A;  2CCM A;  5D7F A;  4NQG A;  1XFZ O;  4M2O A;  5HYD A;  4BY4 A;  2ZND A;  4GGF C;  5KU1 A;  1NX0 A;  1FW4 A;  3DVK A;  4QJ4 B;  1MF8 B;  2L4H A;  1AHR A;  5FYX A;  2TN4 A;  3I5G C;  1YUR A;  1Y1A A;  1B8R A;  1AK8 A;  4E68 A;  2FJU B;  2HQW A;  2WOS A;  3EVR A;  2WCF A;  1M63 B;  1CFD A;  2KNE A;  3TZ1 A;  1PVB A;  2JXL A;  4YGB B;  2LC5 A;  4ZCV A;  2ISD A;  4DUQ A;  3A8R A;  1SCM B;  1BLQ A;  4CPV A;  4PE7 A;  2CT9 A;  4AQJ A;  4C0L A;  4PCW A;  1U5I A;  1CM1 A;  1XA5 A;  4BY5 A;  1C07 A;  3FWB A;  2ZKM X;  3JTD C;  2FCD A;  5HKW A;  1L7Z A;  3OX6 A;  3JVT B;  3SG6 A;  1KQM C;  1JSA A;  2ZFD A;  2BL0 C;  1DVI A;  1YTZ C;  2KI6 C;  1R6P A;  3SJS A;  3HX4 A;  1RTP 1;  3BUM B;  1IQ5 A;  3IQO A;  3CTN A;  2CXJ A;  1YUU A;  1DF0 B;  2Q4U A;  3NSI A;  1W7J B;  4MLW A;  1NYA A;  1SR6 C;  1F70 A;  1PVA A;  4PE0 A;  4OV2 A;  1AJ5 A;  1S26 D;  5JOL A;  4CLN A;  2EGD A;  2CBL A;  2MHH A;  2JUL A;  1MR8 A;  3I5F C;  4MZK A;  2H61 C;  2I2R E;  4YGC B;  4M2P A;  2KAY A;  2F33 A;  2PAS A;  2JZI A;  1UUR A;  3A4U B;  2LLU A;  3VRO A;  2M1K B;  4YRU A;  1GGZ A;  1JFJ A;  1TCF A;  1Y1U A;  1NIW A;  2LHL A;  2LVV A;  3PAT A;  1K90 D;  1SR6 B;  4WQ2 A;  2HQ8 A;  2KQ6 A;  1F71 A;  4MZJ A;  2V53 A;  2WND A;  3NXA A;  2I94 A;  3PN7 B;  3SIA A;  1KFX L;  2Y4Q A;  2LLS A;  1DJX A;  3BQ3 A;  1DJI A;  1XFY O;  4HRE E;  1EG4 A;  1CTR A;  1OSA A;  1Y0V H;  3LLE A;  4YI8 A;  3C1V A;  1SL7 A;  1ODB A;  4P5O E;  1ZOT B;  1LXF C;  1KWO C;  2LP2 A;  1JF2 A;  1WDC C;  1RK9 A;  1REC A;  1CDM A;  1SMG A;  1TOP A;  4OKH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...