3D0YA

Crystal structure of s100b in the calcium and zinc loaded state at ph 6.5
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
89
structure length
89
Chain Sequence
SELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDNDGDGECDFQEFMAFVAMVTTACHEFFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords Protein S100-B
publication title The crystal structures of human S100B in the zinc- and calcium-loaded state at three pH values reveal zinc ligand swapping.
pubmed doi rcsb
source organism Homo sapiens
total genus 33
structure length 89
sequence length 89
ec nomenclature
pdb deposition date 2008-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3d0yA00
3TZ1A 2LLSA 3BUNB 2ZRTA 2O60A 1UHJA 3A8RA 3SIBA 1KK8C 2I18A 2JPTA 2RGIA 1EL4A 1A03A 4N5XA 4AQIA 2MLEC 2O5GA 5JJGA 1BMOA 4A4CA 1J1EA 2BE6A 3CWGA 4C0JA 1FI6A 4C0KA 4YGBB 1A75B 4R1EA 2L98A 4DRWA 1K96A 2BKIB 2R2IA 1MQ1A 1K2HA 2MRDA 2IS9A 1TRFA 1E8AA 3F45A 1SNLA 1QVIY 2LMVA 2WCFA 5CSNA 3SG5A 4U8DA 3TDIA 3JVTC 1ZOTB 2FJUB 1CFCA 1EJ3A 2Y4QA 2ZN9A 5HKYA 4PE7A 1G4YR 2AUCA 1CDMA 1SL7A 2M29A 5CSFA 2MA2A 1CTRA 5AANA 1K9PA 3SG7A 3A4UB 1VRKA 1QTXA 2JOJA 2WCEA 4OVNF 1MXLC 4P2YB 1K94A 3CR4X 1SYMA 1A4PA 1UURA 1TNQA 1LA3A 1F54A 1NIWA 1HT9A 1CDLA 4GAOA 1DJIA 1CMFA 3SG2A 4ORAB 1XFYO 1UWOA 2KAYA 1WLMA 4NQGA 1CKKA 1MR8A 1QLKA 4WQ2A 3PM8A 1IG5A 1DMOA 1GJYA 3I5HB 2KYCA 1WDCC 1SY9A 1K8UA 5HYDA 1UHHA 3CR5X 1Y6WA 1M45A 2COLB 1Y1AA 4MN0A 4DIRA 3CS1A 1A29A 3CZTX 1B47A 2JTTA 2CNPA 2JT3A 2Y1NA 3EKHA 3SG3A 3VROA 4YI9A 2JT0A 1S6JA 2QPTA 5GQQC 2HETA 3TDZA 1RROA 1B1GA 1YRUB 2KFHA 1RFJA 4MLWA 4CLNA 2L2EA 1J7QA 1JFJA 3PSRA 3SG6A 2OS8C 4QJ4B 1CFDA 3I5GB 4DUQA 1GQMA 3LCPC 4OCIA 2L4IA 1DVIA 1XFVO 2NLNA 3IF7A 1CFFA 5HLOA 3AAKA 2HQWA 2PSRA 2EC6B 1ALWA 3HCMA 1PSRA 1RECA 3ZWHA 3SG4A 5CPVA 3DVMA 5D7FA 5FYXA 5HKWA 4HSZA 1BF5A 2ZRSA 2M8UA 1TCOB 1NCYA 2CBLA 1DTLA 3GK2A 3NSKA 3I5HC 1DJGA 1BLQA 1TNXA 3AKAA 4ZCVA 1IRJA 2JULA 1K93D 2F8PA 2JT8A 1UP5A 3BUXB 1YVLA 5ER5A 1UHIA 4JPZB 1J1DA 5TNCA 1J7PA 2NCPA 2K2AA 1KWOC 2JC2A 1OOJA 3LLEA 1S6IA 1RJVA 3FWCA 1J7RA 1BODA 2EHBA 2KBIA 1DJYA 2CCMA 2LE9B 1N2DA 3VGOA 1OZSA 1IKUA 3D0YA 1N65A 4CFRA 2KI6D 1KSMA 1QASA 3O6BA 1BR4B 1JF0A 4GGNA 1QXPA 1H8BA 2KFGA 2M97A 3C1VA 3CTNA 3I5FB 1FI5A 1B8LA 1SR6B 2EC6C 1IGVA 2D8NA 2Q91A 1V1GA 3TUYB 4YRUA 1U5IA 3GOFA 1RK9A 1K9KA 1LA0A 1PVAA 1QX2A 2M49B 4L9MA 4FTGA 1X02A 4FQOA 2MBXA 4XJKB 2KOTA 1SL9A 2BECA 2H61A 5BPJA 3O2PA 2KI4B 5I2OA 2LVIA 2M1KB 1JUOA 1QV1A 3JTDB 3BXKA 4MRYA 5I2LA 2LLUA 1SK6D 1UHKA 4NDBA 3CLNA 1G8IA 2LHIA 1QX7A 3GK4X 4GNKB 1F8HA 1B8CA 4AOMA 1XA5A 1YX8A 2LVVA 3CGAA 1BOCA 1JC2A 1PALA 1S5GZ 4AQJA 1EXRA 1L2OB 3BUMB 1GGWA 2I7AA 2KI6C 3RM1A 3BQ3A 1DT7B 4MZJA 4MBEA 1PSBA 1GGZA 1QATA 2AMIA 3I5IC 2PRUA 2ISDA 4GFTA 4WRIA 1JFKA 4IL1A 1NX2A 3VRPA 1SR6C 1NWDA 4MVFA 1DJHA 1TTXA 4XJKA 2WOSA 5DKQA 1J55A 3VRRA 2LV7A 2CXJA 3AKBA 1DJWA 1NSHA 1XFZO 3FWBA 1KFUS 3CR2A 2OTGB 2ZN8A 5I2QA 2ZKMX 1ODBA 2BCBA 1LINA 1DF0B 1J7OA 1AP4A 4DS7A 2PVBA 5HKZA 2KI4C 3ZNIA 1QIVA 1WLZA 1S26D 3JTDC 4I5JA 1SCMB 3O4YA 2ZNEA 2K7BA 1S5GY 1IQ5A 2LC5A 2LMTA 1QS7A 1R2UA 4N1GA 2F2OA 1H4BA 4OV2A 5D69A 4C0LA 3PFVA 4F0ZB 2WCBA 4OR9B 3GK1A 5KTYA 3OB2B 4ZCUA 3PATA 5KU1A 2LVJA 1SW8A 1UUSA 2L4HA 1YUTA 1YVHA 2JXLA 4A4BA 2BE4A 2JXCA 3FIAA 1AVSA 1C7WA 1XYDA 1K90D 3BUOB 1MWNA 1DJZA 2JU0A 4ICBA 3VRNA 1SL8A 1C7VA 3LK0A 5J3XA 3PALA 1DF0A 2OPOA 1KCYA 2PASA 1K9UA 2L50A 1SKTA 2OTGC 2G2BA 2KGRA 1QIWA 4WQ3A 1EG3A 4Q04A 4QJ5B 3D0YB 1LVCD 2MLFC 1XVJA 1BR1B 2WNDA 1LKJA 1IH0A 1CM1A 3BYAA 5IBWA 1SCMC 4YBHB 2FCEA 4PHNA 3OX6A 2LVKA 1MXEA 3BOWA 1NCXA 1KQMB 5B8IB 2BL0B 3IQQA 3PN7B 1U5IB 4ORBB 1TN4A 4TNCA 3WNXB 1XK4C 1L7ZA 2MHHA 1V1FA 2K7OA 1B4CA 2E6WA 1N0YA 5AFPA 1UHNA 1MUXA 1HQVA 3NSOA 4MEWA 2LUCA 1R6PA 1WRZA 1YURA 1BT6A 1MF8B 1A2XA 1YX7A 4CIDA 2KSPA 5AERA 1TIZA 2LP3A 3I5GC 2LAPA 1SMGA 1M39A 2DOQA 1OE9B 1FW4A 2KYFA 2LUXA 1AHRA 3IQOA 1KFUL 5AEQA 1M46A 4MZKA 2NXQA 2F3ZA 2M9GA 1KK7Z 2LCPA 4PE4A 2I2RE 1PULA 3FS7A 2JRFA 1F71A 1YR5A 1FPWA 4P5OE 2Y5IA 1DGVA 4PHMA 3OB1B 1CLBA 2L5XB 4YGEB 1F55A 1EH2A 2PALA 2MAZA 4GGFA 1KQMC 2GGMA 2GV5A 5KSZA 1CNPA 2KNEA 4PHKA 1QLSA 1C07A 2KBMA 1QV0A 3O78A 1BJFA 2KFFA 1NX3A 4I5KA 1NX0A 1KQVA 4JQ0D 3JVTB 2F33A 4OKHA 2H61C 2AAOA 1Y1UA 3EVRA 1RTP1 2K7DA 2KAVA 1JWDA 1AJ5A 5AXIA 4MRXA 3E3RA 4UPGA 5DKRA 2H2KA 2Q4UA 1WY9A 2HPSA 4YGCB 4XYNA 1KK7Y 2FCDA 5F6TA 1CDNA 2G9BA 1YUUA 1NP8A 1TCFA 2K7CA 3TDUA 3I5FC 3KHEA 2JNFA 4I5LB 1B7TZ 1MHOA 2CTNA 3EVUA 4CPVA 2KQYA 3TUYC 1ZMZA 4GBAA 3KF9A 1CFPA 1W7JB 2MJWB 1QJTA 1YTZC 1WDCB 3DVEA 4D1EA 1OMVA 4CFQA 1WRLA 3EK8A 1ZFSA 1TOPA 4BY4A 1SRAA 1OZOA 5ER4X 4PE0A 4DCKA 1NX1A 3ICBA 4NDDA 4ORCB 1CDPA 1IJ5A 4PALA 1Q80A 2L51A 3TS5B 1F70A 3KPXA 1SBJA 4YGAA 3VRQA 2KAXA 2ZNDA 5CSJA 1JBAA 4HRHA 4PCWA 2I94A 1Y1XA 1OQPA 1CB1A 2F3YA 2OS8B 2E30A 1FBVA 3RLZA 1L2OC 1PRWA 2LLTA 1S36A 2LP2A 3BOWB 1KFXS 1F4QA 3OX5A 1IQ3A 2P6BB 1SCVA 1B7TY 2M7NA 3BUWB 4N1FA 2LM5A 5HLVA 4YGDB 2JWWA 3AAJA 2HF5A 1QX5B 1A75A 4HRGA 4I5NB 1ZACA 2JNXA 3HX4A 2K61A 3WHTB 4YI8A 1TNPA 2M1UA 2BCAA 3EK4A 1RWYA 2LHLA 1EG4A 1YUSA 4MZLA 2PMYA 3EVVA 2FOTA 3KEVA 5G08A 2BBNA 1CMGA 4M2QA 1AJ4A 1NPQA 1SPYA 1ZUZA 1BG1A 1IJ6A 1KSOA 4E68A 3TS5C 2M0RA 5K89A 1KWOB 2K0JA 2WC8A 1PK0D 3MSEB 5DKNA 1S1EA 2WORA 1XO5A 3H4SE 3WXAA 1G33A 4ETOA 1OMDA 1JF2A 2BBMA 2JZIA 3OP0A 3WHUB 2LNKA 2A4JA 2Y1MA 3OHMB 4BY5A 4USLA 3EK7A 1LXFC 2EGDA 2KGBC 3SJSA 1YRTB 1W7IB 1CM4A 2M7LA 2NZ0A 3PLFB 4M2PA 2LANA 4GUKA 2KDHA 1AUIB 1K95A 1XK4A 1ALVA 1M31A 3DF0B 2K2FA 1CLLA 4PHJA 1JSAA 3K21A 3KO0A 1OSAA 3D10A 2JTZA 4MSPA 1BU3A 1NYAA 1S6CA 1M63B 2F2PA 1D1OA 2L0PA 1KK8B 2B1UA 2BCXA 1PVBA 2VRGA 1DGUA 2SCPA 4JWQA 5CSIA 2K8MB 1CLMA 3QRXA 3NXAA 1NUBA 1S3PA 2CT9A 3M0WA 3NSLA 5I8NA 2BL0C 3PN7C 5JOLA 1TNWA 2NCOA 3LL8B 1XFUO 2M3WA 2QACA 1NCZA 3EKJA 1Y0VH 2JQ6A 1F4OA 2SASA 1IWQA 3I5IB 1KFXL 3DVJA 4GGFC 3LK1A 2HQ8A 1OMRA 1AK8A 2KHNA 2V53A 4GPLB 3DF0A 3DD4A 1QVIZ 3DVKA 4M2OA 1WRKA 1XFWO 3NSIA 3SIAA 2KQ6A 2GGZA 4NDCA 1B8RA 4QJ3B 1XFXO 5PALA 4PE1A 1DJXA 4HREE 1B9AA 4PDZA 1FF1A 2ZFDA 2LMUA 2BKHB 2TN4A
chains in the Genus database with same CATH superfamily
3TZ1A 2LLSA 3BUNB 2ZRTA 2O60A 1UHJA 3A8RA 3SIBA 1KK8C 2I18A 2JPTA 2RGIA 1EL4A 2YGUA 3OGNA 4N5XA 1A03A 4AQIA 2MLEC 2O5GA 5JJGA 1BMOA 4A4CA 1J1EA 2BE6A 3CWGA 4C0JA 1FI6A 4C0KA 4YGBB 1A75B 4R1EA 2L98A 4DRWA 1K96A 2BKIB 2R2IA 1MQ1A 1K2HA 1IIOA 2MRDA 3D74A 2IS9A 1TRFA 1Z4HA 1E8AA 3F45A 1SNLA 1QVIY 2LMVA 2QEOA 2WCFA 5CSNA 3R72A 4U8DA 3SG5A 3TDIA 3JVTC 2JPOA 1ZOTB 2FJUB 3BFBA 3K1EA 1CFCA 1EJ3A 3OBVA 2Y4QA 3BFHA 2ZN9A 5HKYA 4PE7A 1G4YR 2AUCA 3L4AA 1CDMA 1SL7A 2M29A 5CSFA 2MA2A 1CTRA 5AANA 1K9PA 3SG7A 3A4UB 1VRKA 1QTXA 2JOJA 2WCEA 4OVNF 1MXLC 4P2YB 1K94A 3CR4X 1SYMA 3S0EA 1A4PA 1UURA 1TNQA 1LA3A 1F54A 1NIWA 1HT9A 1CDLA 4GAOA 1DJIA 1CMFA 3SG2A 4ORAB 1XFYO 4PT1A 1UWOA 2KAYA 1WLMA 4NQGA 1CKKA 1MR8A 1QLKA 4WQ2A 3PM8A 1IG5A 1DMOA 1GJYA 3I5HB 2KYCA 1WDCC 3PM2A 1SY9A 1K8UA 3Q8IA 5HYDA 1UHHA 3CR5X 1Y6WA 1T14A 2KPHA 1M45A 2COLB 1Y1AA 4MN0A 4DIRA 3CS1A 1A29A 2WCLA 3CZTX 1B47A 3D77A 2JTTA 2CNPA 2JT3A 2Y1NA 3EKHA 3SG3A 3VROA 4YI9A 2JT0A 1S6JA 2QPTA 5GQQC 2HETA 3VB1A 3TDZA 1RROA 1SSEB 1B1GA 1YRUB 2KFHA 1RFJA 4MLWA 4CLNA 2L2EA 1J7QA 1JFJA 2H8VA 3PSRA 2OS8C 3SG6A 4QJ4B 1CFDA 3I5GB 4DUQA 1GQMA 3LCPC 4OCIA 2L4IA 1DVIA 1XFVO 2NLNA 3IF7A 1CFFA 5HLOA 1XFRA 1OOHA 3AAKA 2WCHA 2HQWA 3FE9A 2L2CA 2PSRA 2EC6B 1ALWA 3HCMA 1PSRA 1P28A 1RECA 3SG4A 5CPVA 3DVMA 5D7FA 5FYXA 5HKWA 4HSZA 2FJYA 1BF5A 3D75A 2ZRSA 2M8UA 1TCOB 1NCYA 2CBLA 5FI7A 1DTLA 3GK2A 3NSKA 3I5HC 1DJGA 1BLQA 1TNXA 3AKAA 3V2LA 4ZCVA 1IRJA 2JULA 1K93D 2F8PA 2JT8A 1UP5A 3BUXB 5D3OA 1YVLA 5ER5A 1UHIA 4JPZB 1J1DA 5TNCA 1J7PA 2NCPA 2K2AA 1KWOC 2JC2A 1OOJA 3LLEA 1S6IA 1RJVA 3FWCA 1J7RA 1BODA 2EHBA 2KBIA 1DJYA 2CCMA 2LE9B 1N2DA 3VGOA 1OZSA 1IKUA 2BNXA 1N65A 3D0YA 4CFRA 2KI6D 1KSMA 1QASA 3O6BA 1BR4B 1JF0A 4GGNA 1QXPA 1H8BA 2KFGA 2M97A 3C1VA 3CTNA 3I5FB 5I94A 1FI5A 1B8LA 1SR6B 2EC6C 1IGVA 2D8NA 2Q91A 1V1GA 4INWA 3TUYB 4YRUA 3RZSA 1U5IA 3GOFA 1RK9A 1K9KA 1LA0A 1PVAA 1QX2A 2M49B 4L9MA 4FTGA 3D78A 1X02A 4FQOA 2MBXA 4XJKB 2KOTA 2BAPA 4OZDA 1SL9A 2BECA 1GM0A 2H61A 5BPJA 3O2PA 2KI4B 5I2OA 2LVIA 2M1KB 1JUOA 1QV1A 3JTDB 3BXKA 4MRYA 5I2LA 2LLUA 1SK6D 1UHKA 4NDBA 3CLNA 1G8IA 2LHIA 1QX7A 1QWVA 3GK4X 4GNKB 1F8HA 1B8CA 2WCMA 4AOMA 1XA5A 1YX8A 2LVVA 3CGAA 1BOCA 1JC2A 1PALA 1S5GZ 4AQJA 1EXRA 1L2OB 3BUMB 3R1PA 1GGWA 2I7AA 2KI6C 3RM1A 3BQ3A 1DT7B 4MZJA 4MBEA 1PSBA 1GGZA 3DY9A 1QATA 2AMIA 3I5IC 2PRUA 2ISDA 4GFTA 4WRIA 1JFKA 3L4LA 4IL1A 1C3YA 3CABA 1NX2A 1DQEA 1SR6C 2QEBA 1NWDA 4MVFA 1DJHA 1DEKA 1TTXA 2WOSA 4XJKA 1J55A 5DKQA 3VRRA 2LV7A 2CXJA 3AKBA 1DJWA 1NSHA 1TUJA 1XFZO 3FWBA 1KFUS 3CR2A 2OTGB 2WCJA 2ZN8A 5I2QA 2ZKMX 1ODBA 2BCBA 1LINA 3CYZA 1DF0B 1J7OA 1AP4A 4DS7A 2PVBA 1OOFA 5HKZA 2KI4C 3L47A 3ZNIA 1QIVA 1WLZA 1S26D 3JTDC 4I5JA 1SCMB 3O4YA 2ZNEA 2GTEA 1S5GY 2K7BA 1IQ5A 2LC5A 2LMTA 3QMEA 1QS7A 1R2UA 4N1GA 2F2OA 1H4BA 4OV2A 5D69A 4C0LA 3PFVA 4F0ZB 2WCBA 3CZ0A 4OR9B 5FI6A 3FE6A 3GK1A 5KTYA 3OB2B 4ZCUA 3PATA 5KU1A 2LVJA 1SW8A 1UUSA 2L4HA 1W9ZA 1YUTA 1YVHA 2JXLA 2BE4A 4A4BA 2JXCA 3FIAA 1AVSA 1C7WA 1XYDA 1K90D 3BUOB 1MWNA 1DJZA 2JU0A 4ICBA 3VRNA 1SL8A 1C7VA 3LK0A 5J3XA 3PALA 1DF0A 2OPOA 3EG5B 1KCYA 2PASA 1K9UA 2L50A 5DICA 1SKTA 3B88A 2OTGC 2G2BA 2KGRA 3SS5A 1QIWA 4WQ3A 1EG3A 3IVTA 4Q04A 4QJ5B 3D0YB 1LVCD 2MLFC 1XVJA 1BR1B 2WNDA 1LKJA 1IH0A 1CM1A 3BYAA 4F7FA 5IBWA 1SCMC 4YBHB 2FCEA 4PHNA 3OX6A 2LVKA 1MXEA 3BOWA 1NCXA 1KQMB 5B8IB 2BL0B 3IQQA 3PN7B 1U5IB 4ORBB 1TN4A 4TNCA 3SS3A 3WNXB 1XK4C 2KLDA 1L7ZA 2MHHA 1V1FA 2K7OA 1B4CA 2E6WA 1N0YA 5AFPA 1UHNA 1MUXA 1HQVA 3S0AA 3NSOA 4MEWA 2LUCA 1R6PA 1WRZA 1TUZA 1YURA 1BT6A 1MF8B 1A2XA 1YX7A 4CIDA 2KSPA 2P71A 5AERA 1TIZA 2LP3A 3I5GC 2LAPA 1SMGA 1M39A 2DOQA 1OE9B 1FW4A 1OW4A 2KYFA 2LUXA 1AHRA 3IQOA 1KFUL 1OOGA 5AEQA 1M46A 4MZKA 2NXQA 2F3ZA 2M9GA 1KK7Z 2LCPA 4PE4A 2I2RE 1PULA 3FS7A 2JRFA 1F71A 3N7HA 1YR5A 1FPWA 4P5OE 2WC5A 3B7AA 2Y5IA 1DGVA 4PHMA 3OB1B 1CLBA 2L5XB 4YGEB 1F55A 1EH2A 2PALA 2MAZA 4GGFA 1KQMC 3S0BA 2GGMA 2GV5A 5KSZA 1CNPA 2KNEA 4PHKA 3BJHA 1QLSA 1C07A 2KBMA 2PYQA 1QV0A 3B87A 1BJFA 2KFFA 3O78A 1NX3A 4I5KA 1NX0A 1KQVA 4JQ0D 3JVTB 2F33A 4OKHA 2H61C 2AAOA 1Y1UA 3EVRA 1RTP1 2K7DA 2KAVA 1JWDA 2QEHA 1AJ5A 5AXIA 4MRXA 3E3RA 3ZWHA 4UPGA 5DKRA 2H2KA 2Q4UA 1WY9A 2HPSA 4YGCB 4XYNA 1KK7Y 2FCDA 5F6TA 5FI2A 1CDNA 2G9BA 1YUUA 1NP8A 1TCFA 2K7CA 3TDUA 3I5FC 3KHEA 2JNFA 4I5LB 2WCKA 1B7TZ 1MHOA 2CTNA 3EVUA 4CPVA 2KQYA 3TUYC 1ZMZA 4GBAA 3KF9A 3R1OA 1CFPA 1W7JB 2MJWB 1QJTA 1YTZC 1WDCB 3DVEA 3DXLA 4D1EA 1OMVA 4CFQA 1WRLA 3EK8A 3FE8A 1ZFSA 1TOPA 4BY4A 1SRAA 1OZOA 5ER4X 4PE0A 4DCKA 1NX1A 3ICBA 4NDDA 4ORCB 1CDPA 1IJ5A 4PALA 1Q80A 2L51A 3TS5B 1F70A 3KPXA 1SBJA 4YGAA 3VRQA 2KAXA 2ZNDA 3PJIA 5CSJA 4HRHA 1JBAA 4PCWA 2I94A 1Y1XA 1OQPA 1CB1A 2F3YA 2OS8B 2E30A 1TWOA 1FBVA 3O4XA 3RLZA 3S0FA 1L2OC 1LS8A 1PRWA 1S36A 2LLTA 2LP2A 3VRPA 3BOWB 3UO9A 1KFXS 1F4QA 3OX5A 1IQ3A 2P6BB 2P70A 1DELA 4IJ7A 1SCVA 1B7TY 2M7NA 3BUWB 4N1FA 2LM5A 5HLVA 4YGDB 2JWWA 3AAJA 2HF5A 1QX5B 1A75A 4HRGA 3SS4A 4I5NB 1ZACA 2JNXA 3HX4A 2K61A 3WHTB 4YI8A 1TNPA 2M1UA 2BCAA 3EK4A 2QEVA 1RWYA 2LHLA 1EG4A 3BFAA 1YUSA 4MZLA 2PMYA 3EVVA 2FOTA 3KEVA 5G08A 2BBNA 1CMGA 4M2QA 1AJ4A 3B86A 5HL1A 1NPQA 1SPYA 1ZUZA 1BG1A 1IJ6A 1KSOA 4E68A 3TS5C 2PQLA 1ORGA 2M0RA 5K89A 1KWOB 2K0JA 1C3ZA 2WC8A 1Z2CB 1PK0D 3MSEB 3NHTA 5DKNA 1S1EA 2WORA 1XO5A 1DC1A 3H4SE 3WXAA 1G33A 4ETOA 1OMDA 1JF2A 2BBMA 2JZIA 3OP0A 3WHUB 2LNKA 2A4JA 2Y1MA 3OHMB 3S0DA 4BY5A 4USLA 3EK7A 1LXFC 2EGDA 3D76A 2K60A 2KGBC 3SJSA 1YRTB 1W7IB 1CM4A 2M7LA 1OOIX 2NZ0A 3PLFB 4FQTA 4M2PA 2LANA 4GUKA 2KLEA 2KDHA 1AUIB 1K95A 1XK4A 1ALVA 2L5YA 1M31A 3DF0B 4JKTA 2K2FA 1CLLA 3B6XA 4KYNA 3K21A 3KO0A 3NGVA 4PHJA 1JSAA 1OSAA 5EL2A 3D10A 4JD9A 2JTZA 4MSPA 1BU3A 3CZ1A 1NYAA 1S6CA 1M63B 3DYEA 2F2PA 3D73A 1D1OA 2L0PA 1KK8B 2B1UA 2BCXA 1PVBA 2VRGA 1DGUA 2SCPA 4JWQA 5CSIA 2K8MB 3NHIA 1CLMA 3QRXA 4INXA 3NXAA 1NUBA 1S3PA 2CT9A 3M0WA 3NSLA 5I8NA 2BL0C 3PN7C 5JOLA 1TNWA 2NCOA 3S0GA 3LL8B 1XFUO 2M3WA 2QACA 1NCZA 3EKJA 1Y0VH 2JQ6A 1F4OA 2SASA 3CDNA 3CZ2A 1IWQA 3I5IB 1KFXL 3DVJA 4GGFC 3LK1A 2HQ8A 1OMRA 1AK8A 2KHNA 2V53A 4GPLB 3DF0A 3DD4A 2WC6A 1QVIZ 2ERBA 3DVKA 4M2OA 1WRKA 1XFWO 2QDIA 3R1VA 3NSIA 3SIAA 2KQ6A 2GGZA 4NDCA 1B8RA 4QJ3B 1XFXO 5PALA 4PE1A 1DJXA 4HREE 3UNWA 1B9AA 3DZTA 4PDZA 1FF1A 2ZFDA 2LMUA 2BKHB 2TN4A
chains in the Genus database with same CATH topology
3TZ1A 2LLSA 3BUNB 2ZRTA 2O60A 1UHJA 3A8RA 3SIBA 1KK8C 2I18A 2JPTA 2RGIA 1EL4A 1A03A 4N5XA 4AQIA 2MLEC 2O5GA 5JJGA 1BMOA 4A4CA 1J1EA 2BE6A 3CWGA 4C0JA 1FI6A 4C0KA 4YGBB 1A75B 4R1EA 2L98A 4DRWA 1K96A 2BKIB 2R2IA 1MQ1A 1K2HA 2MRDA 2IS9A 1TRFA 1E8AA 3F45A 1SNLA 1QVIY 2LMVA 2WCFA 5CSNA 3SG5A 4U8DA 3TDIA 3JVTC 1ZOTB 2FJUB 1CFCA 1EJ3A 2Y4QA 2ZN9A 5HKYA 4PE7A 1G4YR 2AUCA 1CDMA 1SL7A 2M29A 5CSFA 2MA2A 1CTRA 5AANA 1K9PA 3SG7A 3A4UB 1VRKA 1QTXA 2JOJA 2WCEA 4OVNF 1MXLC 4P2YB 1K94A 3CR4X 1SYMA 1A4PA 1UURA 1TNQA 1LA3A 1F54A 1NIWA 1HT9A 1CDLA 4GAOA 1DJIA 1CMFA 3SG2A 4ORAB 1XFYO 1UWOA 2KAYA 1WLMA 4NQGA 1CKKA 1MR8A 1QLKA 4WQ2A 3PM8A 1IG5A 1DMOA 1GJYA 3I5HB 2KYCA 1WDCC 1SY9A 1K8UA 5HYDA 1UHHA 3CR5X 1Y6WA 1M45A 2COLB 1Y1AA 4MN0A 4DIRA 3CS1A 1A29A 3CZTX 1B47A 2JTTA 2CNPA 2JT3A 2Y1NA 3EKHA 3SG3A 3VROA 4YI9A 2JT0A 1S6JA 2QPTA 5GQQC 2HETA 3TDZA 1RROA 1B1GA 1YRUB 2KFHA 1RFJA 4MLWA 4CLNA 2L2EA 1J7QA 1JFJA 3PSRA 3SG6A 2OS8C 4QJ4B 1CFDA 3I5GB 4DUQA 1GQMA 3LCPC 4OCIA 2L4IA 1DVIA 1XFVO 2NLNA 3IF7A 1CFFA 5HLOA 3AAKA 2HQWA 2PSRA 2EC6B 1ALWA 3HCMA 1PSRA 1RECA 3ZWHA 3SG4A 5CPVA 3DVMA 5D7FA 5FYXA 5HKWA 4HSZA 1BF5A 2ZRSA 2M8UA 1TCOB 1NCYA 2CBLA 1DTLA 3GK2A 3NSKA 3I5HC 1DJGA 1BLQA 1TNXA 3AKAA 4ZCVA 1IRJA 2JULA 1K93D 2F8PA 2JT8A 1UP5A 3BUXB 1YVLA 5ER5A 1UHIA 4JPZB 1J1DA 5TNCA 1J7PA 2NCPA 2K2AA 1KWOC 2JC2A 1OOJA 3LLEA 1S6IA 1RJVA 3FWCA 1J7RA 1BODA 2EHBA 2KBIA 1DJYA 2CCMA 2LE9B 1N2DA 3VGOA 1OZSA 1IKUA 3D0YA 1N65A 4CFRA 2KI6D 1KSMA 1QASA 3O6BA 1BR4B 1JF0A 4GGNA 1QXPA 1H8BA 2KFGA 2M97A 3C1VA 3CTNA 3I5FB 1FI5A 1B8LA 1SR6B 2EC6C 1IGVA 2D8NA 2Q91A 1V1GA 3TUYB 4YRUA 1U5IA 3GOFA 1RK9A 1K9KA 1LA0A 1PVAA 1QX2A 2M49B 4L9MA 4FTGA 1X02A 4FQOA 2MBXA 4XJKB 2KOTA 1SL9A 2BECA 2H61A 5BPJA 3O2PA 2KI4B 5I2OA 2LVIA 2M1KB 1JUOA 1QV1A 3JTDB 3BXKA 4MRYA 5I2LA 2LLUA 1SK6D 1UHKA 4NDBA 3CLNA 1G8IA 2LHIA 1QX7A 3GK4X 4GNKB 1F8HA 1B8CA 4AOMA 1XA5A 1YX8A 2LVVA 3CGAA 1BOCA 1JC2A 1PALA 1S5GZ 4AQJA 1EXRA 1L2OB 3BUMB 1GGWA 2I7AA 2KI6C 3RM1A 3BQ3A 1DT7B 4MZJA 4MBEA 1PSBA 1GGZA 1QATA 2AMIA 3I5IC 2PRUA 2ISDA 4GFTA 4WRIA 1JFKA 4IL1A 1NX2A 3VRPA 1SR6C 1NWDA 4MVFA 1DJHA 1TTXA 4XJKA 2WOSA 5DKQA 1J55A 3VRRA 2LV7A 2CXJA 3AKBA 1DJWA 1NSHA 1XFZO 3FWBA 1KFUS 3CR2A 2OTGB 2ZN8A 5I2QA 2ZKMX 1ODBA 2BCBA 1LINA 1DF0B 1J7OA 1AP4A 4DS7A 2PVBA 5HKZA 2KI4C 3ZNIA 1QIVA 1WLZA 1S26D 3JTDC 4I5JA 1SCMB 3O4YA 2ZNEA 2K7BA 1S5GY 1IQ5A 2LC5A 2LMTA 1QS7A 1R2UA 4N1GA 2F2OA 1H4BA 4OV2A 5D69A 4C0LA 3PFVA 4F0ZB 2WCBA 4OR9B 3GK1A 5KTYA 3OB2B 4ZCUA 3PATA 5KU1A 2LVJA 1SW8A 1UUSA 2L4HA 1YUTA 1YVHA 2JXLA 4A4BA 2BE4A 2JXCA 3FIAA 1AVSA 1C7WA 1XYDA 1K90D 3BUOB 1MWNA 1DJZA 2JU0A 4ICBA 3VRNA 1SL8A 1C7VA 3LK0A 5J3XA 3PALA 1DF0A 2OPOA 1KCYA 2PASA 1K9UA 2L50A 1SKTA 2OTGC 2G2BA 2KGRA 1QIWA 4WQ3A 1EG3A 4Q04A 4QJ5B 3D0YB 1LVCD 2MLFC 1XVJA 1BR1B 2WNDA 1LKJA 1IH0A 1CM1A 3BYAA 5IBWA 1SCMC 4YBHB 2FCEA 4PHNA 3OX6A 2LVKA 1MXEA 3BOWA 1NCXA 1KQMB 5B8IB 2BL0B 3IQQA 3PN7B 1U5IB 4ORBB 1TN4A 4TNCA 3WNXB 1XK4C 1L7ZA 2MHHA 1V1FA 2K7OA 1B4CA 2E6WA 1N0YA 5AFPA 1UHNA 1MUXA 1HQVA 3NSOA 4MEWA 2LUCA 1R6PA 1WRZA 1YURA 1BT6A 1MF8B 1A2XA 1YX7A 4CIDA 2KSPA 5AERA 1TIZA 2LP3A 3I5GC 2LAPA 1SMGA 1M39A 2DOQA 1OE9B 1FW4A 2KYFA 2LUXA 1AHRA 3IQOA 1KFUL 5AEQA 1M46A 4MZKA 2NXQA 2F3ZA 2M9GA 1KK7Z 2LCPA 4PE4A 2I2RE 1PULA 3FS7A 2JRFA 1F71A 1YR5A 1FPWA 4P5OE 2Y5IA 1DGVA 4PHMA 3OB1B 1CLBA 2L5XB 4YGEB 1F55A 1EH2A 2PALA 2MAZA 4GGFA 1KQMC 2GGMA 2GV5A 5KSZA 1CNPA 2KNEA 4PHKA 1QLSA 1C07A 2KBMA 1QV0A 3O78A 1BJFA 2KFFA 1NX3A 4I5KA 1NX0A 1KQVA 4JQ0D 3JVTB 2F33A 4OKHA 2H61C 2AAOA 1Y1UA 3EVRA 1RTP1 2K7DA 2KAVA 1JWDA 1AJ5A 5AXIA 4MRXA 3E3RA 4UPGA 5DKRA 2H2KA 2Q4UA 1WY9A 2HPSA 4YGCB 4XYNA 1KK7Y 2FCDA 5F6TA 1CDNA 2G9BA 1YUUA 1NP8A 1TCFA 2K7CA 3TDUA 3I5FC 3KHEA 2JNFA 4I5LB 1B7TZ 1MHOA 2CTNA 3EVUA 4CPVA 2KQYA 3TUYC 1ZMZA 4GBAA 3KF9A 1CFPA 1W7JB 2MJWB 1QJTA 1YTZC 1WDCB 3DVEA 4D1EA 1OMVA 4CFQA 1WRLA 3EK8A 1ZFSA 1TOPA 4BY4A 1SRAA 1OZOA 5ER4X 4PE0A 4DCKA 1NX1A 3ICBA 4NDDA 4ORCB 1CDPA 1IJ5A 4PALA 1Q80A 2L51A 3TS5B 1F70A 3KPXA 1SBJA 4YGAA 3VRQA 2KAXA 2ZNDA 5CSJA 1JBAA 4HRHA 4PCWA 2I94A 1Y1XA 1OQPA 1CB1A 2F3YA 2OS8B 2E30A 1FBVA 3RLZA 1L2OC 1PRWA 2LLTA 1S36A 2LP2A 3BOWB 1KFXS 1F4QA 3OX5A 1IQ3A 2P6BB 1SCVA 1B7TY 2M7NA 3BUWB 4N1FA 2LM5A 5HLVA 4YGDB 2JWWA 3AAJA 2HF5A 1QX5B 1A75A 4HRGA 4I5NB 1ZACA 2JNXA 3HX4A 2K61A 3WHTB 4YI8A 1TNPA 2M1UA 2BCAA 3EK4A 1RWYA 2LHLA 1EG4A 1YUSA 4MZLA 2PMYA 3EVVA 2FOTA 3KEVA 5G08A 2BBNA 1CMGA 4M2QA 1AJ4A 1NPQA 1SPYA 1ZUZA 1BG1A 1IJ6A 1KSOA 4E68A 3TS5C 2M0RA 5K89A 1KWOB 2K0JA 2WC8A 1PK0D 3MSEB 5DKNA 1S1EA 2WORA 1XO5A 3H4SE 3WXAA 1G33A 4ETOA 1OMDA 1JF2A 2BBMA 2JZIA 3OP0A 3WHUB 2LNKA 2A4JA 2Y1MA 3OHMB 4BY5A 4USLA 3EK7A 1LXFC 2EGDA 2KGBC 3SJSA 1YRTB 1W7IB 1CM4A 2M7LA 2NZ0A 3PLFB 4M2PA 2LANA 4GUKA 2KDHA 1AUIB 1K95A 1XK4A 1ALVA 1M31A 3DF0B 2K2FA 1CLLA 4PHJA 1JSAA 3K21A 3KO0A 1OSAA 3D10A 2JTZA 4MSPA 1BU3A 1NYAA 1S6CA 1M63B 2F2PA 1D1OA 2L0PA 1KK8B 2B1UA 2BCXA 1PVBA 2VRGA 1DGUA 2SCPA 4JWQA 5CSIA 2K8MB 1CLMA 3QRXA 3NXAA 1NUBA 1S3PA 2CT9A 3M0WA 3NSLA 5I8NA 2BL0C 3PN7C 5JOLA 1TNWA 2NCOA 3LL8B 1XFUO 2M3WA 2QACA 1NCZA 3EKJA 1Y0VH 2JQ6A 1F4OA 2SASA 1IWQA 3I5IB 1KFXL 3DVJA 4GGFC 3LK1A 2HQ8A 1OMRA 1AK8A 2KHNA 2V53A 4GPLB 3DF0A 3DD4A 1QVIZ 3DVKA 4M2OA 1WRKA 1XFWO 3NSIA 3SIAA 2KQ6A 2GGZA 4NDCA 1B8RA 4QJ3B 1XFXO 5PALA 4PE1A 1DJXA 4HREE 1B9AA 4PDZA 1FF1A 2ZFDA 2LMUA 2BKHB 2TN4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TZ1 A;  2LLS A;  3BUN B;  2ZRT A;  2O60 A;  1UHJ A;  3A8R A;  3SIB A;  1KK8 C;  2I18 A;  2JPT A;  2RGI A;  1EL4 A;  1A03 A;  4N5X A;  4AQI A;  2MLE C;  2O5G A;  5JJG A;  1BMO A;  4A4C A;  1J1E A;  2BE6 A;  3CWG A;  4C0J A;  1FI6 A;  4C0K A;  4YGB B;  1A75 B;  4R1E A;  2L98 A;  4DRW A;  1K96 A;  2BKI B;  2R2I A;  1MQ1 A;  1K2H A;  2MRD A;  2IS9 A;  1TRF A;  1E8A A;  3F45 A;  1SNL A;  1QVI Y;  2LMV A;  2WCF A;  5CSN A;  3SG5 A;  4U8D A;  3TDI A;  3JVT C;  1ZOT B;  2FJU B;  1CFC A;  1EJ3 A;  2Y4Q A;  2ZN9 A;  5HKY A;  4PE7 A;  1G4Y R;  2AUC A;  1CDM A;  1SL7 A;  2M29 A;  5CSF A;  2MA2 A;  1CTR A;  5AAN A;  1K9P A;  3SG7 A;  3A4U B;  1VRK A;  1QTX A;  2JOJ A;  2WCE A;  4OVN F;  1MXL C;  4P2Y B;  1K94 A;  3CR4 X;  1SYM A;  1A4P A;  1UUR A;  1TNQ A;  1LA3 A;  1F54 A;  1NIW A;  1HT9 A;  1CDL A;  4GAO A;  1DJI A;  1CMF A;  3SG2 A;  4ORA B;  1XFY O;  1UWO A;  2KAY A;  1WLM A;  4NQG A;  1CKK A;  1MR8 A;  1QLK A;  4WQ2 A;  3PM8 A;  1IG5 A;  1DMO A;  1GJY A;  3I5H B;  2KYC A;  1WDC C;  1SY9 A;  1K8U A;  5HYD A;  1UHH A;  3CR5 X;  1Y6W A;  1M45 A;  2COL B;  1Y1A A;  4MN0 A;  4DIR A;  3CS1 A;  1A29 A;  3CZT X;  1B47 A;  2JTT A;  2CNP A;  2JT3 A;  2Y1N A;  3EKH A;  3SG3 A;  3VRO A;  4YI9 A;  2JT0 A;  1S6J A;  2QPT A;  5GQQ C;  2HET A;  3TDZ A;  1RRO A;  1B1G A;  1YRU B;  2KFH A;  1RFJ A;  4MLW A;  4CLN A;  2L2E A;  1J7Q A;  1JFJ A;  3PSR A;  3SG6 A;  2OS8 C;  4QJ4 B;  1CFD A;  3I5G B;  4DUQ A;  1GQM A;  3LCP C;  4OCI A;  2L4I A;  1DVI A;  1XFV O;  2NLN A;  3IF7 A;  1CFF A;  5HLO A;  3AAK A;  2HQW A;  2PSR A;  2EC6 B;  1ALW A;  3HCM A;  1PSR A;  1REC A;  3ZWH A;  3SG4 A;  5CPV A;  3DVM A;  5D7F A;  5FYX A;  5HKW A;  4HSZ A;  1BF5 A;  2ZRS A;  2M8U A;  1TCO B;  1NCY A;  2CBL A;  1DTL A;  3GK2 A;  3NSK A;  3I5H C;  1DJG A;  1BLQ A;  1TNX A;  3AKA A;  4ZCV A;  1IRJ A;  2JUL A;  1K93 D;  2F8P A;  2JT8 A;  1UP5 A;  3BUX B;  1YVL A;  5ER5 A;  1UHI A;  4JPZ B;  1J1D A;  5TNC A;  1J7P A;  2NCP A;  2K2A A;  1KWO C;  2JC2 A;  1OOJ A;  3LLE A;  1S6I A;  1RJV A;  3FWC A;  1J7R A;  1BOD A;  2EHB A;  2KBI A;  1DJY A;  2CCM A;  2LE9 B;  1N2D A;  3VGO A;  1OZS A;  1IKU A;  3D0Y A;  1N65 A;  4CFR A;  2KI6 D;  1KSM A;  1QAS A;  3O6B A;  1BR4 B;  1JF0 A;  4GGN A;  1QXP A;  1H8B A;  2KFG A;  2M97 A;  3C1V A;  3CTN A;  3I5F B;  1FI5 A;  1B8L A;  1SR6 B;  2EC6 C;  1IGV A;  2D8N A;  2Q91 A;  1V1G A;  3TUY B;  4YRU A;  1U5I A;  3GOF A;  1RK9 A;  1K9K A;  1LA0 A;  1PVA A;  1QX2 A;  2M49 B;  4L9M A;  4FTG A;  1X02 A;  4FQO A;  2MBX A;  4XJK B;  2KOT A;  1SL9 A;  2BEC A;  2H61 A;  5BPJ A;  3O2P A;  2KI4 B;  5I2O A;  2LVI A;  2M1K B;  1JUO A;  1QV1 A;  3JTD B;  3BXK A;  4MRY A;  5I2L A;  2LLU A;  1SK6 D;  1UHK A;  4NDB A;  3CLN A;  1G8I A;  2LHI A;  1QX7 A;  3GK4 X;  4GNK B;  1F8H A;  1B8C A;  4AOM A;  1XA5 A;  1YX8 A;  2LVV A;  3CGA A;  1BOC A;  1JC2 A;  1PAL A;  1S5G Z;  4AQJ A;  1EXR A;  1L2O B;  3BUM B;  1GGW A;  2I7A A;  2KI6 C;  3RM1 A;  3BQ3 A;  1DT7 B;  4MZJ A;  4MBE A;  1PSB A;  1GGZ A;  1QAT A;  2AMI A;  3I5I C;  2PRU A;  2ISD A;  4GFT A;  4WRI A;  1JFK A;  4IL1 A;  1NX2 A;  3VRP A;  1SR6 C;  1NWD A;  4MVF A;  1DJH A;  1TTX A;  4XJK A;  2WOS A;  5DKQ A;  1J55 A;  3VRR A;  2LV7 A;  2CXJ A;  3AKB A;  1DJW A;  1NSH A;  1XFZ O;  3FWB A;  1KFU S;  3CR2 A;  2OTG B;  2ZN8 A;  5I2Q A;  2ZKM X;  1ODB A;  2BCB A;  1LIN A;  1DF0 B;  1J7O A;  1AP4 A;  4DS7 A;  2PVB A;  5HKZ A;  2KI4 C;  3ZNI A;  1QIV A;  1WLZ A;  1S26 D;  3JTD C;  4I5J A;  1SCM B;  3O4Y A;  2ZNE A;  2K7B A;  1S5G Y;  1IQ5 A;  2LC5 A;  2LMT A;  1QS7 A;  1R2U A;  4N1G A;  2F2O A;  1H4B A;  4OV2 A;  5D69 A;  4C0L A;  3PFV A;  4F0Z B;  2WCB A;  4OR9 B;  3GK1 A;  5KTY A;  3OB2 B;  4ZCU A;  3PAT A;  5KU1 A;  2LVJ A;  1SW8 A;  1UUS A;  2L4H A;  1YUT A;  1YVH A;  2JXL A;  4A4B A;  2BE4 A;  2JXC A;  3FIA A;  1AVS A;  1C7W A;  1XYD A;  1K90 D;  3BUO B;  1MWN A;  1DJZ A;  2JU0 A;  4ICB A;  3VRN A;  1SL8 A;  1C7V A;  3LK0 A;  5J3X A;  3PAL A;  1DF0 A;  2OPO A;  1KCY A;  2PAS A;  1K9U A;  2L50 A;  1SKT A;  2OTG C;  2G2B A;  2KGR A;  1QIW A;  4WQ3 A;  1EG3 A;  4Q04 A;  4QJ5 B;  3D0Y B;  1LVC D;  2MLF C;  1XVJ A;  1BR1 B;  2WND A;  1LKJ A;  1IH0 A;  1CM1 A;  3BYA A;  5IBW A;  1SCM C;  4YBH B;  2FCE A;  4PHN A;  3OX6 A;  2LVK A;  1MXE A;  3BOW A;  1NCX A;  1KQM B;  5B8I B;  2BL0 B;  3IQQ A;  3PN7 B;  1U5I B;  4ORB B;  1TN4 A;  4TNC A;  3WNX B;  1XK4 C;  1L7Z A;  2MHH A;  1V1F A;  2K7O A;  1B4C A;  2E6W A;  1N0Y A;  5AFP A;  1UHN A;  1MUX A;  1HQV A;  3NSO A;  4MEW A;  2LUC A;  1R6P A;  1WRZ A;  1YUR A;  1BT6 A;  1MF8 B;  1A2X A;  1YX7 A;  4CID A;  2KSP A;  5AER A;  1TIZ A;  2LP3 A;  3I5G C;  2LAP A;  1SMG A;  1M39 A;  2DOQ A;  1OE9 B;  1FW4 A;  2KYF A;  2LUX A;  1AHR A;  3IQO A;  1KFU L;  5AEQ A;  1M46 A;  4MZK A;  2NXQ A;  2F3Z A;  2M9G A;  1KK7 Z;  2LCP A;  4PE4 A;  2I2R E;  1PUL A;  3FS7 A;  2JRF A;  1F71 A;  1YR5 A;  1FPW A;  4P5O E;  2Y5I A;  1DGV A;  4PHM A;  3OB1 B;  1CLB A;  2L5X B;  4YGE B;  1F55 A;  1EH2 A;  2PAL A;  2MAZ A;  4GGF A;  1KQM C;  2GGM A;  2GV5 A;  5KSZ A;  1CNP A;  2KNE A;  4PHK A;  1QLS A;  1C07 A;  2KBM A;  1QV0 A;  3O78 A;  1BJF A;  2KFF A;  1NX3 A;  4I5K A;  1NX0 A;  1KQV A;  4JQ0 D;  3JVT B;  2F33 A;  4OKH A;  2H61 C;  2AAO A;  1Y1U A;  3EVR A;  1RTP 1;  2K7D A;  2KAV A;  1JWD A;  1AJ5 A;  5AXI A;  4MRX A;  3E3R A;  4UPG A;  5DKR A;  2H2K A;  2Q4U A;  1WY9 A;  2HPS A;  4YGC B;  4XYN A;  1KK7 Y;  2FCD A;  5F6T A;  1CDN A;  2G9B A;  1YUU A;  1NP8 A;  1TCF A;  2K7C A;  3TDU A;  3I5F C;  3KHE A;  2JNF A;  4I5L B;  1B7T Z;  1MHO A;  2CTN A;  3EVU A;  4CPV A;  2KQY A;  3TUY C;  1ZMZ A;  4GBA A;  3KF9 A;  1CFP A;  1W7J B;  2MJW B;  1QJT A;  1YTZ C;  1WDC B;  3DVE A;  4D1E A;  1OMV A;  4CFQ A;  1WRL A;  3EK8 A;  1ZFS A;  1TOP A;  4BY4 A;  1SRA A;  1OZO A;  5ER4 X;  4PE0 A;  4DCK A;  1NX1 A;  3ICB A;  4NDD A;  4ORC B;  1CDP A;  1IJ5 A;  4PAL A;  1Q80 A;  2L51 A;  3TS5 B;  1F70 A;  3KPX A;  1SBJ A;  4YGA A;  3VRQ A;  2KAX A;  2ZND A;  5CSJ A;  1JBA A;  4HRH A;  4PCW A;  2I94 A;  1Y1X A;  1OQP A;  1CB1 A;  2F3Y A;  2OS8 B;  2E30 A;  1FBV A;  3RLZ A;  1L2O C;  1PRW A;  2LLT A;  1S36 A;  2LP2 A;  3BOW B;  1KFX S;  1F4Q A;  3OX5 A;  1IQ3 A;  2P6B B;  1SCV A;  1B7T Y;  2M7N A;  3BUW B;  4N1F A;  2LM5 A;  5HLV A;  4YGD B;  2JWW A;  3AAJ A;  2HF5 A;  1QX5 B;  1A75 A;  4HRG A;  4I5N B;  1ZAC A;  2JNX A;  3HX4 A;  2K61 A;  3WHT B;  4YI8 A;  1TNP A;  2M1U A;  2BCA A;  3EK4 A;  1RWY A;  2LHL A;  1EG4 A;  1YUS A;  4MZL A;  2PMY A;  3EVV A;  2FOT A;  3KEV A;  5G08 A;  2BBN A;  1CMG A;  4M2Q A;  1AJ4 A;  1NPQ A;  1SPY A;  1ZUZ A;  1BG1 A;  1IJ6 A;  1KSO A;  4E68 A;  3TS5 C;  2M0R A;  5K89 A;  1KWO B;  2K0J A;  2WC8 A;  1PK0 D;  3MSE B;  5DKN A;  1S1E A;  2WOR A;  1XO5 A;  3H4S E;  3WXA A;  1G33 A;  4ETO A;  1OMD A;  1JF2 A;  2BBM A;  2JZI A;  3OP0 A;  3WHU B;  2LNK A;  2A4J A;  2Y1M A;  3OHM B;  4BY5 A;  4USL A;  3EK7 A;  1LXF C;  2EGD A;  2KGB C;  3SJS A;  1YRT B;  1W7I B;  1CM4 A;  2M7L A;  2NZ0 A;  3PLF B;  4M2P A;  2LAN A;  4GUK A;  2KDH A;  1AUI B;  1K95 A;  1XK4 A;  1ALV A;  1M31 A;  3DF0 B;  2K2F A;  1CLL A;  4PHJ A;  1JSA A;  3K21 A;  3KO0 A;  1OSA A;  3D10 A;  2JTZ A;  4MSP A;  1BU3 A;  1NYA A;  1S6C A;  1M63 B;  2F2P A;  1D1O A;  2L0P A;  1KK8 B;  2B1U A;  2BCX A;  1PVB A;  2VRG A;  1DGU A;  2SCP A;  4JWQ A;  5CSI A;  2K8M B;  1CLM A;  3QRX A;  3NXA A;  1NUB A;  1S3P A;  2CT9 A;  3M0W A;  3NSL A;  5I8N A;  2BL0 C;  3PN7 C;  5JOL A;  1TNW A;  2NCO A;  3LL8 B;  1XFU O;  2M3W A;  2QAC A;  1NCZ A;  3EKJ A;  1Y0V H;  2JQ6 A;  1F4O A;  2SAS A;  1IWQ A;  3I5I B;  1KFX L;  3DVJ A;  4GGF C;  3LK1 A;  2HQ8 A;  1OMR A;  1AK8 A;  2KHN A;  2V53 A;  4GPL B;  3DF0 A;  3DD4 A;  1QVI Z;  3DVK A;  4M2O A;  1WRK A;  1XFW O;  3NSI A;  3SIA A;  2KQ6 A;  2GGZ A;  4NDC A;  1B8R A;  4QJ3 B;  1XFX O;  5PAL A;  4PE1 A;  1DJX A;  4HRE E;  1B9A A;  4PDZ A;  1FF1 A;  2ZFD A;  2LMU A;  2BKH B;  2TN4 A; 
#chains in the Genus database with same CATH topology
 3TZ1 A;  2LLS A;  3BUN B;  2ZRT A;  2O60 A;  1UHJ A;  3A8R A;  3SIB A;  1KK8 C;  2I18 A;  2JPT A;  2RGI A;  1EL4 A;  2YGU A;  3OGN A;  4N5X A;  1A03 A;  4AQI A;  2MLE C;  2O5G A;  5JJG A;  1BMO A;  4A4C A;  1J1E A;  2BE6 A;  3CWG A;  4C0J A;  1FI6 A;  4C0K A;  4YGB B;  1A75 B;  4R1E A;  2L98 A;  4DRW A;  1K96 A;  2BKI B;  2R2I A;  1MQ1 A;  1K2H A;  1IIO A;  2MRD A;  3D74 A;  2IS9 A;  1TRF A;  1Z4H A;  1E8A A;  3F45 A;  1SNL A;  1QVI Y;  2LMV A;  2QEO A;  2WCF A;  5CSN A;  3R72 A;  4U8D A;  3SG5 A;  3TDI A;  3JVT C;  2JPO A;  1ZOT B;  2FJU B;  3BFB A;  3K1E A;  1CFC A;  1EJ3 A;  3OBV A;  2Y4Q A;  3BFH A;  2ZN9 A;  5HKY A;  4PE7 A;  1G4Y R;  2AUC A;  3L4A A;  1CDM A;  1SL7 A;  2M29 A;  5CSF A;  2MA2 A;  1CTR A;  5AAN A;  1K9P A;  3SG7 A;  3A4U B;  1VRK A;  1QTX A;  2JOJ A;  2WCE A;  4OVN F;  1MXL C;  4P2Y B;  1K94 A;  3CR4 X;  1SYM A;  3S0E A;  1A4P A;  1UUR A;  1TNQ A;  1LA3 A;  1F54 A;  1NIW A;  1HT9 A;  1CDL A;  4GAO A;  1DJI A;  1CMF A;  3SG2 A;  4ORA B;  1XFY O;  4PT1 A;  1UWO A;  2KAY A;  1WLM A;  4NQG A;  1CKK A;  1MR8 A;  1QLK A;  4WQ2 A;  3PM8 A;  1IG5 A;  1DMO A;  1GJY A;  3I5H B;  2KYC A;  1WDC C;  3PM2 A;  1SY9 A;  1K8U A;  3Q8I A;  5HYD A;  1UHH A;  3CR5 X;  1Y6W A;  1T14 A;  2KPH A;  1M45 A;  2COL B;  1Y1A A;  4MN0 A;  4DIR A;  3CS1 A;  1A29 A;  2WCL A;  3CZT X;  1B47 A;  3D77 A;  2JTT A;  2CNP A;  2JT3 A;  2Y1N A;  3EKH A;  3SG3 A;  3VRO A;  4YI9 A;  2JT0 A;  1S6J A;  2QPT A;  5GQQ C;  2HET A;  3VB1 A;  3TDZ A;  1RRO A;  1SSE B;  1B1G A;  1YRU B;  2KFH A;  1RFJ A;  4MLW A;  4CLN A;  2L2E A;  1J7Q A;  1JFJ A;  2H8V A;  3PSR A;  2OS8 C;  3SG6 A;  4QJ4 B;  1CFD A;  3I5G B;  4DUQ A;  1GQM A;  3LCP C;  4OCI A;  2L4I A;  1DVI A;  1XFV O;  2NLN A;  3IF7 A;  1CFF A;  5HLO A;  1XFR A;  1OOH A;  3AAK A;  2WCH A;  2HQW A;  3FE9 A;  2L2C A;  2PSR A;  2EC6 B;  1ALW A;  3HCM A;  1PSR A;  1P28 A;  1REC A;  3SG4 A;  5CPV A;  3DVM A;  5D7F A;  5FYX A;  5HKW A;  4HSZ A;  2FJY A;  1BF5 A;  3D75 A;  2ZRS A;  2M8U A;  1TCO B;  1NCY A;  2CBL A;  5FI7 A;  1DTL A;  3GK2 A;  3NSK A;  3I5H C;  1DJG A;  1BLQ A;  1TNX A;  3AKA A;  3V2L A;  4ZCV A;  1IRJ A;  2JUL A;  1K93 D;  2F8P A;  2JT8 A;  1UP5 A;  3BUX B;  5D3O A;  1YVL A;  5ER5 A;  1UHI A;  4JPZ B;  1J1D A;  5TNC A;  1J7P A;  2NCP A;  2K2A A;  1KWO C;  2JC2 A;  1OOJ A;  3LLE A;  1S6I A;  1RJV A;  3FWC A;  1J7R A;  1BOD A;  2EHB A;  2KBI A;  1DJY A;  2CCM A;  2LE9 B;  1N2D A;  3VGO A;  1OZS A;  1IKU A;  2BNX A;  1N65 A;  3D0Y A;  4CFR A;  2KI6 D;  1KSM A;  1QAS A;  3O6B A;  1BR4 B;  1JF0 A;  4GGN A;  1QXP A;  1H8B A;  2KFG A;  2M97 A;  3C1V A;  3CTN A;  3I5F B;  5I94 A;  1FI5 A;  1B8L A;  1SR6 B;  2EC6 C;  1IGV A;  2D8N A;  2Q91 A;  1V1G A;  4INW A;  3TUY B;  4YRU A;  3RZS A;  1U5I A;  3GOF A;  1RK9 A;  1K9K A;  1LA0 A;  1PVA A;  1QX2 A;  2M49 B;  4L9M A;  4FTG A;  3D78 A;  1X02 A;  4FQO A;  2MBX A;  4XJK B;  2KOT A;  2BAP A;  4OZD A;  1SL9 A;  2BEC A;  1GM0 A;  2H61 A;  5BPJ A;  3O2P A;  2KI4 B;  5I2O A;  2LVI A;  2M1K B;  1JUO A;  1QV1 A;  3JTD B;  3BXK A;  4MRY A;  5I2L A;  2LLU A;  1SK6 D;  1UHK A;  4NDB A;  3CLN A;  1G8I A;  2LHI A;  1QX7 A;  1QWV A;  3GK4 X;  4GNK B;  1F8H A;  1B8C A;  2WCM A;  4AOM A;  1XA5 A;  1YX8 A;  2LVV A;  3CGA A;  1BOC A;  1JC2 A;  1PAL A;  1S5G Z;  4AQJ A;  1EXR A;  1L2O B;  3BUM B;  3R1P A;  1GGW A;  2I7A A;  2KI6 C;  3RM1 A;  3BQ3 A;  1DT7 B;  4MZJ A;  4MBE A;  1PSB A;  1GGZ A;  3DY9 A;  1QAT A;  2AMI A;  3I5I C;  2PRU A;  2ISD A;  4GFT A;  4WRI A;  1JFK A;  3L4L A;  4IL1 A;  1C3Y A;  3CAB A;  1NX2 A;  1DQE A;  1SR6 C;  2QEB A;  1NWD A;  4MVF A;  1DJH A;  1DEK A;  1TTX A;  2WOS A;  4XJK A;  1J55 A;  5DKQ A;  3VRR A;  2LV7 A;  2CXJ A;  3AKB A;  1DJW A;  1NSH A;  1TUJ A;  1XFZ O;  3FWB A;  1KFU S;  3CR2 A;  2OTG B;  2WCJ A;  2ZN8 A;  5I2Q A;  2ZKM X;  1ODB A;  2BCB A;  1LIN A;  3CYZ A;  1DF0 B;  1J7O A;  1AP4 A;  4DS7 A;  2PVB A;  1OOF A;  5HKZ A;  2KI4 C;  3L47 A;  3ZNI A;  1QIV A;  1WLZ A;  1S26 D;  3JTD C;  4I5J A;  1SCM B;  3O4Y A;  2ZNE A;  2GTE A;  1S5G Y;  2K7B A;  1IQ5 A;  2LC5 A;  2LMT A;  3QME A;  1QS7 A;  1R2U A;  4N1G A;  2F2O A;  1H4B A;  4OV2 A;  5D69 A;  4C0L A;  3PFV A;  4F0Z B;  2WCB A;  3CZ0 A;  4OR9 B;  5FI6 A;  3FE6 A;  3GK1 A;  5KTY A;  3OB2 B;  4ZCU A;  3PAT A;  5KU1 A;  2LVJ A;  1SW8 A;  1UUS A;  2L4H A;  1W9Z A;  1YUT A;  1YVH A;  2JXL A;  2BE4 A;  4A4B A;  2JXC A;  3FIA A;  1AVS A;  1C7W A;  1XYD A;  1K90 D;  3BUO B;  1MWN A;  1DJZ A;  2JU0 A;  4ICB A;  3VRN A;  1SL8 A;  1C7V A;  3LK0 A;  5J3X A;  3PAL A;  1DF0 A;  2OPO A;  3EG5 B;  1KCY A;  2PAS A;  1K9U A;  2L50 A;  5DIC A;  1SKT A;  3B88 A;  2OTG C;  2G2B A;  2KGR A;  3SS5 A;  1QIW A;  4WQ3 A;  1EG3 A;  3IVT A;  4Q04 A;  4QJ5 B;  3D0Y B;  1LVC D;  2MLF C;  1XVJ A;  1BR1 B;  2WND A;  1LKJ A;  1IH0 A;  1CM1 A;  3BYA A;  4F7F A;  5IBW A;  1SCM C;  4YBH B;  2FCE A;  4PHN A;  3OX6 A;  2LVK A;  1MXE A;  3BOW A;  1NCX A;  1KQM B;  5B8I B;  2BL0 B;  3IQQ A;  3PN7 B;  1U5I B;  4ORB B;  1TN4 A;  4TNC A;  3SS3 A;  3WNX B;  1XK4 C;  2KLD A;  1L7Z A;  2MHH A;  1V1F A;  2K7O A;  1B4C A;  2E6W A;  1N0Y A;  5AFP A;  1UHN A;  1MUX A;  1HQV A;  3S0A A;  3NSO A;  4MEW A;  2LUC A;  1R6P A;  1WRZ A;  1TUZ A;  1YUR A;  1BT6 A;  1MF8 B;  1A2X A;  1YX7 A;  4CID A;  2KSP A;  2P71 A;  5AER A;  1TIZ A;  2LP3 A;  3I5G C;  2LAP A;  1SMG A;  1M39 A;  2DOQ A;  1OE9 B;  1FW4 A;  1OW4 A;  2KYF A;  2LUX A;  1AHR A;  3IQO A;  1KFU L;  1OOG A;  5AEQ A;  1M46 A;  4MZK A;  2NXQ A;  2F3Z A;  2M9G A;  1KK7 Z;  2LCP A;  4PE4 A;  2I2R E;  1PUL A;  3FS7 A;  2JRF A;  1F71 A;  3N7H A;  1YR5 A;  1FPW A;  4P5O E;  2WC5 A;  3B7A A;  2Y5I A;  1DGV A;  4PHM A;  3OB1 B;  1CLB A;  2L5X B;  4YGE B;  1F55 A;  1EH2 A;  2PAL A;  2MAZ A;  4GGF A;  1KQM C;  3S0B A;  2GGM A;  2GV5 A;  5KSZ A;  1CNP A;  2KNE A;  4PHK A;  3BJH A;  1QLS A;  1C07 A;  2KBM A;  2PYQ A;  1QV0 A;  3B87 A;  1BJF A;  2KFF A;  3O78 A;  1NX3 A;  4I5K A;  1NX0 A;  1KQV A;  4JQ0 D;  3JVT B;  2F33 A;  4OKH A;  2H61 C;  2AAO A;  1Y1U A;  3EVR A;  1RTP 1;  2K7D A;  2KAV A;  1JWD A;  2QEH A;  1AJ5 A;  5AXI A;  4MRX A;  3E3R A;  3ZWH A;  4UPG A;  5DKR A;  2H2K A;  2Q4U A;  1WY9 A;  2HPS A;  4YGC B;  4XYN A;  1KK7 Y;  2FCD A;  5F6T A;  5FI2 A;  1CDN A;  2G9B A;  1YUU A;  1NP8 A;  1TCF A;  2K7C A;  3TDU A;  3I5F C;  3KHE A;  2JNF A;  4I5L B;  2WCK A;  1B7T Z;  1MHO A;  2CTN A;  3EVU A;  4CPV A;  2KQY A;  3TUY C;  1ZMZ A;  4GBA A;  3KF9 A;  3R1O A;  1CFP A;  1W7J B;  2MJW B;  1QJT A;  1YTZ C;  1WDC B;  3DVE A;  3DXL A;  4D1E A;  1OMV A;  4CFQ A;  1WRL A;  3EK8 A;  3FE8 A;  1ZFS A;  1TOP A;  4BY4 A;  1SRA A;  1OZO A;  5ER4 X;  4PE0 A;  4DCK A;  1NX1 A;  3ICB A;  4NDD A;  4ORC B;  1CDP A;  1IJ5 A;  4PAL A;  1Q80 A;  2L51 A;  3TS5 B;  1F70 A;  3KPX A;  1SBJ A;  4YGA A;  3VRQ A;  2KAX A;  2ZND A;  3PJI A;  5CSJ A;  4HRH A;  1JBA A;  4PCW A;  2I94 A;  1Y1X A;  1OQP A;  1CB1 A;  2F3Y A;  2OS8 B;  2E30 A;  1TWO A;  1FBV A;  3O4X A;  3RLZ A;  3S0F A;  1L2O C;  1LS8 A;  1PRW A;  1S36 A;  2LLT A;  2LP2 A;  3VRP A;  3BOW B;  3UO9 A;  1KFX S;  1F4Q A;  3OX5 A;  1IQ3 A;  2P6B B;  2P70 A;  1DEL A;  4IJ7 A;  1SCV A;  1B7T Y;  2M7N A;  3BUW B;  4N1F A;  2LM5 A;  5HLV A;  4YGD B;  2JWW A;  3AAJ A;  2HF5 A;  1QX5 B;  1A75 A;  4HRG A;  3SS4 A;  4I5N B;  1ZAC A;  2JNX A;  3HX4 A;  2K61 A;  3WHT B;  4YI8 A;  1TNP A;  2M1U A;  2BCA A;  3EK4 A;  2QEV A;  1RWY A;  2LHL A;  1EG4 A;  3BFA A;  1YUS A;  4MZL A;  2PMY A;  3EVV A;  2FOT A;  3KEV A;  5G08 A;  2BBN A;  1CMG A;  4M2Q A;  1AJ4 A;  3B86 A;  5HL1 A;  1NPQ A;  1SPY A;  1ZUZ A;  1BG1 A;  1IJ6 A;  1KSO A;  4E68 A;  3TS5 C;  2PQL A;  1ORG A;  2M0R A;  5K89 A;  1KWO B;  2K0J A;  1C3Z A;  2WC8 A;  1Z2C B;  1PK0 D;  3MSE B;  3NHT A;  5DKN A;  1S1E A;  2WOR A;  1XO5 A;  1DC1 A;  3H4S E;  3WXA A;  1G33 A;  4ETO A;  1OMD A;  1JF2 A;  2BBM A;  2JZI A;  3OP0 A;  3WHU B;  2LNK A;  2A4J A;  2Y1M A;  3OHM B;  3S0D A;  4BY5 A;  4USL A;  3EK7 A;  1LXF C;  2EGD A;  3D76 A;  2K60 A;  2KGB C;  3SJS A;  1YRT B;  1W7I B;  1CM4 A;  2M7L A;  1OOI X;  2NZ0 A;  3PLF B;  4FQT A;  4M2P A;  2LAN A;  4GUK A;  2KLE A;  2KDH A;  1AUI B;  1K95 A;  1XK4 A;  1ALV A;  2L5Y A;  1M31 A;  3DF0 B;  4JKT A;  2K2F A;  1CLL A;  3B6X A;  4KYN A;  3K21 A;  3KO0 A;  3NGV A;  4PHJ A;  1JSA A;  1OSA A;  5EL2 A;  3D10 A;  4JD9 A;  2JTZ A;  4MSP A;  1BU3 A;  3CZ1 A;  1NYA A;  1S6C A;  1M63 B;  3DYE A;  2F2P A;  3D73 A;  1D1O A;  2L0P A;  1KK8 B;  2B1U A;  2BCX A;  1PVB A;  2VRG A;  1DGU A;  2SCP A;  4JWQ A;  5CSI A;  2K8M B;  3NHI A;  1CLM A;  3QRX A;  4INX A;  3NXA A;  1NUB A;  1S3P A;  2CT9 A;  3M0W A;  3NSL A;  5I8N A;  2BL0 C;  3PN7 C;  5JOL A;  1TNW A;  2NCO A;  3S0G A;  3LL8 B;  1XFU O;  2M3W A;  2QAC A;  1NCZ A;  3EKJ A;  1Y0V H;  2JQ6 A;  1F4O A;  2SAS A;  3CDN A;  3CZ2 A;  1IWQ A;  3I5I B;  1KFX L;  3DVJ A;  4GGF C;  3LK1 A;  2HQ8 A;  1OMR A;  1AK8 A;  2KHN A;  2V53 A;  4GPL B;  3DF0 A;  3DD4 A;  2WC6 A;  1QVI Z;  2ERB A;  3DVK A;  4M2O A;  1WRK A;  1XFW O;  2QDI A;  3R1V A;  3NSI A;  3SIA A;  2KQ6 A;  2GGZ A;  4NDC A;  1B8R A;  4QJ3 B;  1XFX O;  5PAL A;  4PE1 A;  1DJX A;  4HRE E;  3UNW A;  1B9A A;  3DZT A;  4PDZ A;  1FF1 A;  2ZFD A;  2LMU A;  2BKH B;  2TN4 A; 
#chains in the Genus database with same CATH homology
 3TZ1 A;  2LLS A;  3BUN B;  2ZRT A;  2O60 A;  1UHJ A;  3A8R A;  3SIB A;  1KK8 C;  2I18 A;  2JPT A;  2RGI A;  1EL4 A;  1A03 A;  4N5X A;  4AQI A;  2MLE C;  2O5G A;  5JJG A;  1BMO A;  4A4C A;  1J1E A;  2BE6 A;  3CWG A;  4C0J A;  1FI6 A;  4C0K A;  4YGB B;  1A75 B;  4R1E A;  2L98 A;  4DRW A;  1K96 A;  2BKI B;  2R2I A;  1MQ1 A;  1K2H A;  2MRD A;  2IS9 A;  1TRF A;  1E8A A;  3F45 A;  1SNL A;  1QVI Y;  2LMV A;  2WCF A;  5CSN A;  3SG5 A;  4U8D A;  3TDI A;  3JVT C;  1ZOT B;  2FJU B;  1CFC A;  1EJ3 A;  2Y4Q A;  2ZN9 A;  5HKY A;  4PE7 A;  1G4Y R;  2AUC A;  1CDM A;  1SL7 A;  2M29 A;  5CSF A;  2MA2 A;  1CTR A;  5AAN A;  1K9P A;  3SG7 A;  3A4U B;  1VRK A;  1QTX A;  2JOJ A;  2WCE A;  4OVN F;  1MXL C;  4P2Y B;  1K94 A;  3CR4 X;  1SYM A;  1A4P A;  1UUR A;  1TNQ A;  1LA3 A;  1F54 A;  1NIW A;  1HT9 A;  1CDL A;  4GAO A;  1DJI A;  1CMF A;  3SG2 A;  4ORA B;  1XFY O;  1UWO A;  2KAY A;  1WLM A;  4NQG A;  1CKK A;  1MR8 A;  1QLK A;  4WQ2 A;  3PM8 A;  1IG5 A;  1DMO A;  1GJY A;  3I5H B;  2KYC A;  1WDC C;  1SY9 A;  1K8U A;  5HYD A;  1UHH A;  3CR5 X;  1Y6W A;  1M45 A;  2COL B;  1Y1A A;  4MN0 A;  4DIR A;  3CS1 A;  1A29 A;  3CZT X;  1B47 A;  2JTT A;  2CNP A;  2JT3 A;  2Y1N A;  3EKH A;  3SG3 A;  3VRO A;  4YI9 A;  2JT0 A;  1S6J A;  2QPT A;  5GQQ C;  2HET A;  3TDZ A;  1RRO A;  1B1G A;  1YRU B;  2KFH A;  1RFJ A;  4MLW A;  4CLN A;  2L2E A;  1J7Q A;  1JFJ A;  3PSR A;  3SG6 A;  2OS8 C;  4QJ4 B;  1CFD A;  3I5G B;  4DUQ A;  1GQM A;  3LCP C;  4OCI A;  2L4I A;  1DVI A;  1XFV O;  2NLN A;  3IF7 A;  1CFF A;  5HLO A;  3AAK A;  2HQW A;  2PSR A;  2EC6 B;  1ALW A;  3HCM A;  1PSR A;  1REC A;  3ZWH A;  3SG4 A;  5CPV A;  3DVM A;  5D7F A;  5FYX A;  5HKW A;  4HSZ A;  1BF5 A;  2ZRS A;  2M8U A;  1TCO B;  1NCY A;  2CBL A;  1DTL A;  3GK2 A;  3NSK A;  3I5H C;  1DJG A;  1BLQ A;  1TNX A;  3AKA A;  4ZCV A;  1IRJ A;  2JUL A;  1K93 D;  2F8P A;  2JT8 A;  1UP5 A;  3BUX B;  1YVL A;  5ER5 A;  1UHI A;  4JPZ B;  1J1D A;  5TNC A;  1J7P A;  2NCP A;  2K2A A;  1KWO C;  2JC2 A;  1OOJ A;  3LLE A;  1S6I A;  1RJV A;  3FWC A;  1J7R A;  1BOD A;  2EHB A;  2KBI A;  1DJY A;  2CCM A;  2LE9 B;  1N2D A;  3VGO A;  1OZS A;  1IKU A;  3D0Y A;  1N65 A;  4CFR A;  2KI6 D;  1KSM A;  1QAS A;  3O6B A;  1BR4 B;  1JF0 A;  4GGN A;  1QXP A;  1H8B A;  2KFG A;  2M97 A;  3C1V A;  3CTN A;  3I5F B;  1FI5 A;  1B8L A;  1SR6 B;  2EC6 C;  1IGV A;  2D8N A;  2Q91 A;  1V1G A;  3TUY B;  4YRU A;  1U5I A;  3GOF A;  1RK9 A;  1K9K A;  1LA0 A;  1PVA A;  1QX2 A;  2M49 B;  4L9M A;  4FTG A;  1X02 A;  4FQO A;  2MBX A;  4XJK B;  2KOT A;  1SL9 A;  2BEC A;  2H61 A;  5BPJ A;  3O2P A;  2KI4 B;  5I2O A;  2LVI A;  2M1K B;  1JUO A;  1QV1 A;  3JTD B;  3BXK A;  4MRY A;  5I2L A;  2LLU A;  1SK6 D;  1UHK A;  4NDB A;  3CLN A;  1G8I A;  2LHI A;  1QX7 A;  3GK4 X;  4GNK B;  1F8H A;  1B8C A;  4AOM A;  1XA5 A;  1YX8 A;  2LVV A;  3CGA A;  1BOC A;  1JC2 A;  1PAL A;  1S5G Z;  4AQJ A;  1EXR A;  1L2O B;  3BUM B;  1GGW A;  2I7A A;  2KI6 C;  3RM1 A;  3BQ3 A;  1DT7 B;  4MZJ A;  4MBE A;  1PSB A;  1GGZ A;  1QAT A;  2AMI A;  3I5I C;  2PRU A;  2ISD A;  4GFT A;  4WRI A;  1JFK A;  4IL1 A;  1NX2 A;  3VRP A;  1SR6 C;  1NWD A;  4MVF A;  1DJH A;  1TTX A;  4XJK A;  2WOS A;  5DKQ A;  1J55 A;  3VRR A;  2LV7 A;  2CXJ A;  3AKB A;  1DJW A;  1NSH A;  1XFZ O;  3FWB A;  1KFU S;  3CR2 A;  2OTG B;  2ZN8 A;  5I2Q A;  2ZKM X;  1ODB A;  2BCB A;  1LIN A;  1DF0 B;  1J7O A;  1AP4 A;  4DS7 A;  2PVB A;  5HKZ A;  2KI4 C;  3ZNI A;  1QIV A;  1WLZ A;  1S26 D;  3JTD C;  4I5J A;  1SCM B;  3O4Y A;  2ZNE A;  2K7B A;  1S5G Y;  1IQ5 A;  2LC5 A;  2LMT A;  1QS7 A;  1R2U A;  4N1G A;  2F2O A;  1H4B A;  4OV2 A;  5D69 A;  4C0L A;  3PFV A;  4F0Z B;  2WCB A;  4OR9 B;  3GK1 A;  5KTY A;  3OB2 B;  4ZCU A;  3PAT A;  5KU1 A;  2LVJ A;  1SW8 A;  1UUS A;  2L4H A;  1YUT A;  1YVH A;  2JXL A;  4A4B A;  2BE4 A;  2JXC A;  3FIA A;  1AVS A;  1C7W A;  1XYD A;  1K90 D;  3BUO B;  1MWN A;  1DJZ A;  2JU0 A;  4ICB A;  3VRN A;  1SL8 A;  1C7V A;  3LK0 A;  5J3X A;  3PAL A;  1DF0 A;  2OPO A;  1KCY A;  2PAS A;  1K9U A;  2L50 A;  1SKT A;  2OTG C;  2G2B A;  2KGR A;  1QIW A;  4WQ3 A;  1EG3 A;  4Q04 A;  4QJ5 B;  3D0Y B;  1LVC D;  2MLF C;  1XVJ A;  1BR1 B;  2WND A;  1LKJ A;  1IH0 A;  1CM1 A;  3BYA A;  5IBW A;  1SCM C;  4YBH B;  2FCE A;  4PHN A;  3OX6 A;  2LVK A;  1MXE A;  3BOW A;  1NCX A;  1KQM B;  5B8I B;  2BL0 B;  3IQQ A;  3PN7 B;  1U5I B;  4ORB B;  1TN4 A;  4TNC A;  3WNX B;  1XK4 C;  1L7Z A;  2MHH A;  1V1F A;  2K7O A;  1B4C A;  2E6W A;  1N0Y A;  5AFP A;  1UHN A;  1MUX A;  1HQV A;  3NSO A;  4MEW A;  2LUC A;  1R6P A;  1WRZ A;  1YUR A;  1BT6 A;  1MF8 B;  1A2X A;  1YX7 A;  4CID A;  2KSP A;  5AER A;  1TIZ A;  2LP3 A;  3I5G C;  2LAP A;  1SMG A;  1M39 A;  2DOQ A;  1OE9 B;  1FW4 A;  2KYF A;  2LUX A;  1AHR A;  3IQO A;  1KFU L;  5AEQ A;  1M46 A;  4MZK A;  2NXQ A;  2F3Z A;  2M9G A;  1KK7 Z;  2LCP A;  4PE4 A;  2I2R E;  1PUL A;  3FS7 A;  2JRF A;  1F71 A;  1YR5 A;  1FPW A;  4P5O E;  2Y5I A;  1DGV A;  4PHM A;  3OB1 B;  1CLB A;  2L5X B;  4YGE B;  1F55 A;  1EH2 A;  2PAL A;  2MAZ A;  4GGF A;  1KQM C;  2GGM A;  2GV5 A;  5KSZ A;  1CNP A;  2KNE A;  4PHK A;  1QLS A;  1C07 A;  2KBM A;  1QV0 A;  3O78 A;  1BJF A;  2KFF A;  1NX3 A;  4I5K A;  1NX0 A;  1KQV A;  4JQ0 D;  3JVT B;  2F33 A;  4OKH A;  2H61 C;  2AAO A;  1Y1U A;  3EVR A;  1RTP 1;  2K7D A;  2KAV A;  1JWD A;  1AJ5 A;  5AXI A;  4MRX A;  3E3R A;  4UPG A;  5DKR A;  2H2K A;  2Q4U A;  1WY9 A;  2HPS A;  4YGC B;  4XYN A;  1KK7 Y;  2FCD A;  5F6T A;  1CDN A;  2G9B A;  1YUU A;  1NP8 A;  1TCF A;  2K7C A;  3TDU A;  3I5F C;  3KHE A;  2JNF A;  4I5L B;  1B7T Z;  1MHO A;  2CTN A;  3EVU A;  4CPV A;  2KQY A;  3TUY C;  1ZMZ A;  4GBA A;  3KF9 A;  1CFP A;  1W7J B;  2MJW B;  1QJT A;  1YTZ C;  1WDC B;  3DVE A;  4D1E A;  1OMV A;  4CFQ A;  1WRL A;  3EK8 A;  1ZFS A;  1TOP A;  4BY4 A;  1SRA A;  1OZO A;  5ER4 X;  4PE0 A;  4DCK A;  1NX1 A;  3ICB A;  4NDD A;  4ORC B;  1CDP A;  1IJ5 A;  4PAL A;  1Q80 A;  2L51 A;  3TS5 B;  1F70 A;  3KPX A;  1SBJ A;  4YGA A;  3VRQ A;  2KAX A;  2ZND A;  5CSJ A;  1JBA A;  4HRH A;  4PCW A;  2I94 A;  1Y1X A;  1OQP A;  1CB1 A;  2F3Y A;  2OS8 B;  2E30 A;  1FBV A;  3RLZ A;  1L2O C;  1PRW A;  2LLT A;  1S36 A;  2LP2 A;  3BOW B;  1KFX S;  1F4Q A;  3OX5 A;  1IQ3 A;  2P6B B;  1SCV A;  1B7T Y;  2M7N A;  3BUW B;  4N1F A;  2LM5 A;  5HLV A;  4YGD B;  2JWW A;  3AAJ A;  2HF5 A;  1QX5 B;  1A75 A;  4HRG A;  4I5N B;  1ZAC A;  2JNX A;  3HX4 A;  2K61 A;  3WHT B;  4YI8 A;  1TNP A;  2M1U A;  2BCA A;  3EK4 A;  1RWY A;  2LHL A;  1EG4 A;  1YUS A;  4MZL A;  2PMY A;  3EVV A;  2FOT A;  3KEV A;  5G08 A;  2BBN A;  1CMG A;  4M2Q A;  1AJ4 A;  1NPQ A;  1SPY A;  1ZUZ A;  1BG1 A;  1IJ6 A;  1KSO A;  4E68 A;  3TS5 C;  2M0R A;  5K89 A;  1KWO B;  2K0J A;  2WC8 A;  1PK0 D;  3MSE B;  5DKN A;  1S1E A;  2WOR A;  1XO5 A;  3H4S E;  3WXA A;  1G33 A;  4ETO A;  1OMD A;  1JF2 A;  2BBM A;  2JZI A;  3OP0 A;  3WHU B;  2LNK A;  2A4J A;  2Y1M A;  3OHM B;  4BY5 A;  4USL A;  3EK7 A;  1LXF C;  2EGD A;  2KGB C;  3SJS A;  1YRT B;  1W7I B;  1CM4 A;  2M7L A;  2NZ0 A;  3PLF B;  4M2P A;  2LAN A;  4GUK A;  2KDH A;  1AUI B;  1K95 A;  1XK4 A;  1ALV A;  1M31 A;  3DF0 B;  2K2F A;  1CLL A;  4PHJ A;  1JSA A;  3K21 A;  3KO0 A;  1OSA A;  3D10 A;  2JTZ A;  4MSP A;  1BU3 A;  1NYA A;  1S6C A;  1M63 B;  2F2P A;  1D1O A;  2L0P A;  1KK8 B;  2B1U A;  2BCX A;  1PVB A;  2VRG A;  1DGU A;  2SCP A;  4JWQ A;  5CSI A;  2K8M B;  1CLM A;  3QRX A;  3NXA A;  1NUB A;  1S3P A;  2CT9 A;  3M0W A;  3NSL A;  5I8N A;  2BL0 C;  3PN7 C;  5JOL A;  1TNW A;  2NCO A;  3LL8 B;  1XFU O;  2M3W A;  2QAC A;  1NCZ A;  3EKJ A;  1Y0V H;  2JQ6 A;  1F4O A;  2SAS A;  1IWQ A;  3I5I B;  1KFX L;  3DVJ A;  4GGF C;  3LK1 A;  2HQ8 A;  1OMR A;  1AK8 A;  2KHN A;  2V53 A;  4GPL B;  3DF0 A;  3DD4 A;  1QVI Z;  3DVK A;  4M2O A;  1WRK A;  1XFW O;  3NSI A;  3SIA A;  2KQ6 A;  2GGZ A;  4NDC A;  1B8R A;  4QJ3 B;  1XFX O;  5PAL A;  4PE1 A;  1DJX A;  4HRE E;  1B9A A;  4PDZ A;  1FF1 A;  2ZFD A;  2LMU A;  2BKH B;  2TN4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...