3D0YA

Crystal structure of s100b in the calcium and zinc loaded state at ph 6.5
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
89
structure length
89
Chain Sequence
SELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDNDGDGECDFQEFMAFVAMVTTACHEFFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein S100-B
publication title The crystal structures of human S100B in the zinc- and calcium-loaded state at three pH values reveal zinc ligand swapping.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal binding protein
total genus 33
structure length 89
sequence length 89
ec nomenclature
pdb deposition date 2008-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3d0yA00
1ALWA 4XJKB 1UHIA 2LP3A 1PVBA 5JOLA 3I5GC 1J7PA 1BF5A 3I5GB 1JWDA 1IKUA 2KGBC 5HLVA 1KSMA 1YUSA 3HX4A 2KBIA 1J1DA 2L4IA 3DVJA 2KBMA 2QPTA 1Y6WA 1B8RA 4CIDA 1DJZA 4TNCA 2SCPA 2P6BB 4N5XA 4OCIA 1B8LA 1NX2A 1YVLA 2HETA 2KI6D 2LANA 3EKHA 2Y1MA 4R1EA 1DJXA 1K93D 2KOTA 2KGRA 4I5NB 1UUSA 4CFQA 4MN0A 2ZN8A 1QATA 4ORBB 1AHRA 5TNCA 1C7WA 2MRDA 1DJGA 2JXLA 1XK4A 2F2PA 2K0JA 3I5IC 4PHMA 5CSNA 1QV0A 2TN4A 5D7FA 5JJGA 1CKKA 4C0LA 4ETOA 1QVIY 1L7ZA 1MXEA 1CFDA 1J7RA 2FCEA 1UURA 5AXIA 1GQMA 1SK6D 1KK8B 1SR6C 1XFVO 2Y1NA 1IGVA 2I2RE 2KI6C 2GV5A 2FOTA 3O78A 2KAXA 1SRAA 5HKZA 1SNLA 5D69A 3EVRA 2ZKMX 4HRHA 2KSPA 3FS7A 2LM5A 1Y1AA 1BR4B 1N65A 2COLB 4NDBA 4BY4A 2G2BA 5AEQA 2ZNDA 1DJWA 1GGWA 2LVKA 3GOFA 1FPWA 2JRFA 1Q80A 1EL4A 1QASA 2JTZA 1B7TZ 1CFPA 1XFZO 3O4YA 1PVAA 2CT9A 2FCDA 1IQ5A 4MVFA 1KWOC 1JSAA 1DJHA 1KQMC 1F54A 3KEVA 2KFHA 5GQQC 1SYMA 1DTLA 3SIAA 1TNPA 3ZWHA 1CM1A 5AERA 3LCPC 1EH2A 1BMOA 1PSBA 1MUXA 1PALA 1RFJA 1V1GA 1KQVA 1PK0D 3I5FB 2Q4UA 1M63B 1S5GY 2H61A 2EC6B 4USLA 1B9AA 1ALVA 2JULA 4GGFC 2KNEA 1UHHA 2H2KA 2M7NA 1PSRA 2JPTA 2F33A 3JTDB 2HPSA 1KK7Y 2OTGC 3PN7B 4JWQA 3SG7A 1G4YR 3RM1A 3SG5A 3DVEA 2K2FA 1A4PA 1YTZC 3PLFB 3EK4A 4MRYA 5PALA 1AJ5A 1UHKA 3O2PA 2L5XB 2OS8C 5K89A 4YGAA 1BR1B 1MXLC 3KHEA 1Y0VH 1NX0A 3C1VA 1NIWA 1DT7B 3TS5B 2NCPA 2JTTA 1OQPA 2F8PA 1YR5A 1NCZA 1N0YA 3BUXB 1SCMB 1CTRA 2R2IA 2EHBA 2F2OA 4DS7A 2KAYA 2KFGA 2BBNA 2GGZA 2V53A 2LUCA 1SW8A 2MLFC 1AK8A 1BOCA 3LK0A 1F55A 1K90D 1FI6A 3CR4X 4ORCB 4CPVA 1SMGA 1PULA 1PRWA 1KFUS 1ODBA 2Y4QA 1A03A 1NWDA 1SKTA 1SY9A 1LA3A 3IQQA 4YGEB 2BBMA 2HF5A 2JZIA 3TDZA 1XK4C 1SBJA 1JBAA 4HRGA 1V1FA 4JPZB 4YGBB 2LV7A 1U5IB 2I94A 2LP2A 4YGCB 1UHNA 5KU1A 1KCYA 4AOMA 2JNFA 2O5GA 1M31A 2K7CA 2BCAA 1WLMA 1M46A 3CZTX 4MSPA 1YUTA 1LA0A 4PCWA 4C0JA 2F3ZA 3A8RA 2K2AA 3TDUA 3BUOB 3NSLA 3PM8A 2IS9A 1OMDA 1HQVA 3PALA 1TCFA 1CMGA 4YRUA 4PE0A 2KDHA 2LC5A 3EKJA 1IQ3A 2HQWA 3VRRA 1CM4A 1OMVA 2CNPA 4UPGA 1B8CA 4GUKA 1AVSA 2PRUA 4L9MA 5AANA 1SL9A 1NCYA 2M0RA 2BECA 1MF8B 1QIWA 2CTNA 1BU3A 2LLTA 2ZRTA 3D0YA 1R2UA 4JQ0D 1TTXA 1U5IA 2VRGA 3OX6A 2G9BA 1W7JB 2PMYA 1G33A 3BUWB 3QRXA 5DKNA 1Y1UA 1Y1XA 1SPYA 1QJTA 1WRKA 4MZLA 2AAOA 2L51A 3CWGA 3FIAA 5DKQA 1EXRA 2AUCA 2KFFA 2ZNEA 3ZNIA 1KK8C 2ISDA 1WLZA 4C0KA 4HREE 3F45A 3TUYB 4YI8A 3NSKA 1G8IA 4MRXA 3RLZA 3DF0A 3TZ1A 4I5JA 1D1OA 2KAVA 3AKBA 3PFVA 2MLEC 4U8DA 1CDPA 5DKRA 1K9KA 2I18A 3FWBA 1NCXA 5CSIA 1CB1A 1JF0A 3NSIA 1F70A 1K94A 4YBHB 4WRIA 3EK7A 3OB2B 5KTYA 2O60A 2BE6A 1FW4A 1B7TY 2M3WA 1SL7A 1QXPA 1WY9A 3WHUB 1K2HA 3MSEB 2MHHA 1NYAA 2K8MB 1QTXA 1S1EA 2E6WA 3CS1A 1DMOA 1H8BA 1IWQA 1A75B 3O6BA 2A4JA 4DIRA 4PE4A 2FJUB 3GK1A 3H4SE 1CDNA 3I5FC 3IQOA 2EC6C 4MLWA 1CFCA 1RECA 2BKIB 1YVHA 2K7DA 2AMIA 1RWYA 4I5LB 2LCPA 1QLKA 2KI4B 2PASA 2LLSA 2SASA 2NXQA 1DJIA 1UWOA 3JTDC 1B47A 3PN7C 4MZJA 4QJ5B 3IF7A 3GK4X 1TCOB 5BPJA 1W7IB 5B8IB 3VRNA 2JT3A 1MWNA 2KHNA 3NXAA 1XFUO 1OE9B 2L98A 4MEWA 4MZKA 1OZOA 2MAZA 4GNKB 1K8UA 3EK8A 3HCMA 4ORAB 1S36A 1QIVA 1EJ3A 1QV1A 1R6PA 2LAPA 3NSOA 5HKWA 1OSAA 1KFXL 4GAOA 2JT8A 1A75A 1MHOA 2LVIA 1DF0A 2ZN9A 4M2PA 4ZCUA 1WDCB 1QLSA 1RJVA 1RROA 4OKHA 1C7VA 2LUXA 1YURA 2BCBA 1IG5A 1XFXO 2K7BA 3TS5C 1RTP1 2M8UA 2GGMA 1F4OA 1SCMC 2M97A 3SJSA 2B1UA 2L50A 1JC2A 5ER5A 5CSFA 3AAKA 1CFFA 3K21A 5I2OA 4GGNA 2I7AA 2CXJA 4YI9A 3WNXB 3VGOA 4N1FA 2HQ8A 4XYNA 4PHKA 3BUMB 1M39A 1WRZA 3I5HB 4M2OA 1DVIA 2LMTA 4MBEA 3EVUA 2PVBA 1RK9A 2BKHB 5F6TA 2NCOA 4HSZA 4Q04A 4GGFA 2KYFA 3OP0A 3D0YB 3VRQA 4NDDA 4FTGA 3KO0A 4GBAA 1F8HA 1JFKA 4AQIA 3WXAA 2M1UA 4PHJA 2WNDA 3WHTB 1IJ6A 1YX8A 1ZMZA 1NPQA 2DOQA 1S6CA 1VRKA 1TOPA 1AJ4A 2E30A 1WRLA 3BOWA 1L2OB 1CDLA 3DVMA 2BL0C 3PATA 3DF0B 2BL0B 1AUIB 2CCMA 4P2YB 3CR5X 3A4UB 1AP4A 1K95A 1FF1A 5HYDA 4QJ3B 1QS7A 3AAJA 4PE1A 5HLOA 1CLBA 2LNKA 1DGVA 2LMVA 2K7OA 4I5KA 2MA2A 3FWCA 1TNQA 4A4CA 4ZCVA 3LL8B 1QX7A 1A2XA 1BT6A 1DGUA 1XFYO 3SIBA 4AQJA 2LLUA 1OOJA 3OB1B 2KQYA 1ZUZA 3VROA 1CLLA 3KPXA 5CSJA 2LHIA 5FYXA 1CMFA 1F71A 2CBLA 3BYAA 3DD4A 1SCVA 5IBWA 2KYCA 1S26D 3TUYC 4YGDB 1B1GA 1OMRA 1HT9A 4OR9B 1GJYA 2MBXA 1CLMA 4WQ2A 1C07A 2H61C 1TIZA 1YUUA 1LKJA 2BE4A 1NUBA 3BQ3A 4D1EA 1E8AA 2Q91A 2JT0A 2M7LA 4XJKA 5I8NA 3I5IB 3M0WA 1N2DA 1YRUB 2ZFDA 1EG3A 1QVIZ 5G08A 5I2QA 5CPVA 2PALA 1QX5B 1XO5A 3CTNA 4A4BA 1UHJA 4N1GA 4PE7A 3E3RA 4OVNF 4DRWA 1NP8A 1S6IA 1SR6B 2PSRA 2M1KB 3SG2A 1DJYA 1K96A 1BG1A 1DF0B 2L2EA 4E68A 1JUOA 1NX1A 2LHLA 1A29A 1LVCD 1J55A 2RGIA 3CGAA 3BXKA 4PDZA 3BUNB 1JF2A 1ZFSA 2KI4C 2JC2A 2L4HA 3PSRA 1TNXA 4PHNA 1BJFA 2LMUA 4DUQA 3LK1A 2LVJA 1LINA 1X02A 3OHMB 2KQ6A 1IJ5A 4PALA 1BODA 1JFJA 2JOJA 1XA5A 1KWOB 3ICBA 3TDIA 1KQMB 4CLNA 2WOSA 1KSOA 5J3XA 3SG4A 2D8NA 2EGDA 2M49B 2OPOA 2WORA 5HKYA 1S3PA 1S6JA 1KFUL 4WQ3A 1S5GZ 1K9PA 2QACA 2JQ6A 1TNWA 4ICBA 1UP5A 1WDCC 2L0PA 4GPLB 1XVJA 1K9UA 1KK7Z 4F0ZB 2OTGB 3VRPA 2WCEA 1OZSA 2WCBA 1ZOTB 3CR2A 1CDMA 2BCXA 3AKAA 1FBVA 1J7QA 2MJWB 1CNPA 3DVKA 2JWWA 2JNXA 1LXFC 1NX3A 3BOWB 4QJ4B 1FI5A 2JU0A 4NDCA 1IH0A 2WC8A 2WCFA 5I2LA 1YX7A 3I5HC 2F3YA 1H4BA 1MR8A 2OS8B 1EG4A 2ZRSA 2M9GA 1TN4A 1BLQA 4BY5A 5ER4X 1MQ1A 4CFRA 1XFWO 2LVVA 4M2QA 1J7OA 3OX5A 1J1EA 1NSHA 1B4CA 3JVTC 3JVTB 4IL1A 2JXCA 1TRFA 3LLEA 4P5OE 2NZ0A 2NLNA 3SG3A 3D10A 2Y5IA 3CLNA 2LE9B 4NQGA 3EVVA 5KSZA 2K61A 1IRJA 1F4QA 2M29A 1KFXS 3KF9A 4GFTA 1QX2A 1L2OC 1XYDA 1SL8A 4OV2A 1YRTB 1GGZA 1ZACA 4DCKA 3SG6A 3GK2A 5AFPA 4FQOA 1M45A
chains in the Genus database with same CATH superfamily
1ALWA 4XJKB 1UHIA 2LP3A 1PVBA 5JOLA 3I5GC 1J7PA 1BF5A 3I5GB 2WC6A 1JWDA 1IKUA 2KGBC 5HLVA 1KSMA 3NGVA 1YUSA 3HX4A 2KBIA 3PJIA 1J1DA 2L4IA 3DVJA 2KBMA 2QPTA 1Y6WA 1B8RA 4CIDA 1DJZA 4TNCA 2SCPA 2P6BB 1DEKA 4N5XA 4OCIA 3S0BA 1B8LA 1NX2A 1YVLA 2HETA 2KI6D 2LANA 3EKHA 2Y1MA 5EL2A 4R1EA 1DJXA 1K93D 2KOTA 2KGRA 4I5NB 1UUSA 4CFQA 4MN0A 2ZN8A 1QATA 1QWVA 1AHRA 4ORBB 5TNCA 2ERBA 1C7WA 2MRDA 1DJGA 2JXLA 1XK4A 2F2PA 2K0JA 3I5IC 4PHMA 5CSNA 1QV0A 2TN4A 5D7FA 5JJGA 3CZ1A 1CKKA 3N7HA 4C0LA 4ETOA 1QVIY 1L7ZA 4INXA 1MXEA 1CFDA 1J7RA 2FCEA 1UURA 5AXIA 1GQMA 3CYZA 1SK6D 1KK8B 1SR6C 1XFVO 3DYEA 2Y1NA 1IGVA 2I2RE 2KI6C 2GV5A 2QEVA 2FOTA 4JD9A 3O78A 2KAXA 1SRAA 5HKZA 2JPOA 1SNLA 5D69A 3EVRA 2ZKMX 4HRHA 2KSPA 3FS7A 2LM5A 1Y1AA 1BR4B 1N65A 2COLB 4NDBA 4BY4A 2G2BA 5AEQA 2ZNDA 1DJWA 1GGWA 2LVKA 3GOFA 1FPWA 2JRFA 1Q80A 1EL4A 3R1PA 1QASA 2JTZA 1B7TZ 3L4LA 1CFPA 1XFZO 3O4YA 1PVAA 2CT9A 2FCDA 1IQ5A 4MVFA 1KWOC 1JSAA 1OOIX 1DJHA 5I94A 1KQMC 1F54A 3KEVA 2KFHA 5GQQC 1SYMA 1DTLA 3SIAA 3L47A 1TNPA 3ZWHA 1CM1A 5AERA 3BFBA 3LCPC 3L4AA 1EH2A 1BMOA 1PSBA 1MUXA 1PALA 1RFJA 1V1GA 1KQVA 1PK0D 3I5FB 2Q4UA 1M63B 1S5GY 2H61A 2EC6B 4USLA 1B9AA 1ALVA 2WC5A 2JULA 4GGFC 2KNEA 3S0AA 1UHHA 3DZTA 2H2KA 2M7NA 1PSRA 2JPTA 2F33A 3JTDB 2HPSA 1KK7Y 2OTGC 3PN7B 2WCMA 2BAPA 4JWQA 3D75A 3SG7A 1G4YR 3RM1A 3SG5A 3DVEA 3S0DA 2K2FA 1A4PA 1YTZC 3PLFB 3EK4A 4MRYA 3B87A 5PALA 3R72A 1AJ5A 1UHKA 3O2PA 2L5XB 3SS4A 2OS8C 5K89A 1TUJA 4YGAA 1BR1B 1MXLC 3KHEA 1Y0VH 1NX0A 3C1VA 1NIWA 1DT7B 3TS5B 2P71A 2NCPA 2JTTA 5D3OA 1OQPA 2F8PA 1YR5A 1NCZA 1N0YA 3BUXB 1SCMB 1CTRA 2R2IA 2EHBA 2F2OA 4DS7A 2KAYA 2KFGA 2BBNA 2GGZA 2V53A 2LUCA 1SW8A 2MLFC 1AK8A 1BOCA 3LK0A 1F55A 1K90D 1FI6A 3VB1A 3CR4X 4ORCB 4CPVA 1SMGA 1PULA 1PRWA 1W9ZA 1KFUS 1ODBA 2Y4QA 1A03A 1NWDA 1OOHA 1SKTA 1SY9A 1LA3A 3IQQA 4YGEB 2BBMA 2HF5A 2JZIA 3TDZA 1XK4C 1SBJA 1JBAA 4HRGA 1V1FA 4JPZB 4YGBB 2LV7A 1U5IB 2H8VA 2I94A 2KLEA 1OOFA 2LP2A 1UHNA 3R1VA 4YGCB 5KU1A 1KCYA 4AOMA 2JNFA 2O5GA 1M31A 2K7CA 2BCAA 1WLMA 1M46A 3CZTX 4MSPA 1YUTA 1LA0A 4PCWA 4C0JA 2F3ZA 3A8RA 2K2AA 3TDUA 3BUOB 3NSLA 1DC1A 3PM8A 2IS9A 1OMDA 2QEBA 1HQVA 3PALA 1TCFA 1CMGA 3R1OA 4YRUA 1XFRA 4PE0A 2KDHA 2LC5A 3EKJA 2WCJA 2HQWA 3VRRA 1CM4A 1OMVA 1IQ3A 2CNPA 4UPGA 1B8CA 4GUKA 3UO9A 1AVSA 2PRUA 4L9MA 3D78A 5AANA 3D73A 1SL9A 1NCYA 3BJHA 2M0RA 2BECA 1MF8B 1QIWA 2CTNA 1BU3A 2LLTA 2ZRTA 3D0YA 1R2UA 4JQ0D 3D76A 1TTXA 1U5IA 2VRGA 3OX6A 2G9BA 1DQEA 1W7JB 2PMYA 1G33A 3BUWB 3QRXA 5DKNA 1Y1UA 1Y1XA 1SPYA 1QJTA 1WRKA 4MZLA 2AAOA 2L51A 3CWGA 3FIAA 3DY9A 1EXRA 5DKQA 2AUCA 2KFFA 2ZNEA 3ZNIA 1KK8C 2ISDA 1WLZA 4C0KA 4HREE 3F45A 3TUYB 4YI8A 3NSKA 4PT1A 1G8IA 4MRXA 3RLZA 3DF0A 2P70A 4I5JA 3TZ1A 1D1OA 2KAVA 3AKBA 3PFVA 2MLEC 4U8DA 1CDPA 5DKRA 1K9KA 5FI6A 2I18A 3FWBA 1NCXA 5CSIA 3SS5A 1CB1A 1JF0A 3NSIA 1F70A 1K94A 4YBHB 4WRIA 3EK7A 3OB2B 5KTYA 2O60A 2BE6A 1FW4A 1B7TY 2M3WA 1SL7A 1QXPA 3D77A 2YGUA 1WY9A 3WHUB 1K2HA 3MSEB 2MHHA 1NYAA 2K8MB 1QTXA 1S1EA 2E6WA 3CS1A 1DMOA 1H8BA 1IWQA 1A75B 3O6BA 2A4JA 4DIRA 4PE4A 2FJUB 4F7FA 3GK1A 3H4SE 1CDNA 3I5FC 3IQOA 2EC6C 3B6XA 4MLWA 1CFCA 1RECA 2BKIB 1YVHA 2K7DA 2AMIA 1RWYA 4I5LB 2LCPA 1QLKA 2KI4B 2PASA 2LLSA 2PYQA 2SASA 2NXQA 1DJIA 1UWOA 1Z4HA 1B47A 3JTDC 3PN7C 4MZJA 4QJ5B 3EG5B 3IF7A 3GK4X 1TCOB 3D74A 5BPJA 3RZSA 1W7IB 5B8IB 3VRNA 2JT3A 1MWNA 2KHNA 3NXAA 1XFUO 1OE9B 2L98A 4MEWA 4MZKA 1OZOA 1DELA 2MAZA 4GNKB 1C3ZA 1K8UA 3EK8A 3HCMA 4ORAB 1S36A 1QIVA 1EJ3A 1QV1A 1R6PA 2LAPA 3NSOA 5HKWA 1OSAA 1KFXL 4GAOA 2PQLA 2JT8A 1A75A 1MHOA 2LVIA 1DF0A 2ZN9A 4M2PA 4ZCUA 1WDCB 1QLSA 1RJVA 1RROA 4OKHA 1C7VA 2LUXA 1YURA 2BCBA 1IG5A 1XFXO 2K7BA 3TS5C 1RTP1 2M8UA 2GGMA 1Z2CB 1F4OA 1SCMC 2M97A 3SJSA 2B1UA 2L50A 5AFPA 1JC2A 5ER5A 5CSFA 3AAKA 1CFFA 1GM0A 1OW4A 3B7AA 3K21A 5I2OA 4GGNA 2I7AA 2CXJA 4YI9A 5DICA 3WNXB 3VGOA 4N1FA 2HQ8A 4DUQA 3DXLA 4XYNA 1LS8A 4PHKA 4JKTA 3BUMB 1M39A 1WRZA 3I5HB 3NHTA 2L5YA 4M2OA 1DVIA 2LMTA 4MBEA 3EVUA 2PVBA 1RK9A 2BKHB 5F6TA 2L2CA 2NCOA 4HSZA 4Q04A 3SS3A 4GGFA 2BNXA 2KYFA 3D0YB 3OP0A 3VRQA 4NDDA 4FTGA 3KO0A 4GBAA 1F8HA 1JFKA 4AQIA 3WXAA 2M1UA 4PHJA 2WCKA 2WNDA 3FE6A 3WHTB 2QDIA 1IJ6A 1YX8A 3B86A 1ZMZA 1NPQA 4FQTA 2DOQA 1S6CA 1VRKA 2K60A 1TOPA 1AJ4A 2E30A 1WRLA 3BOWA 1L2OB 1CDLA 3DVMA 2BL0C 3FE9A 3DF0B 3PATA 2BL0B 3CABA 1AUIB 2CCMA 4P2YB 3CR5X 3A4UB 3V2LA 2WCLA 1AP4A 1TWOA 1K95A 1FF1A 5HYDA 4QJ3B 1QS7A 3AAJA 4PE1A 5HLOA 1CLBA 2LNKA 1DGVA 3Q8IA 2LMVA 2K7OA 3CZ2A 4I5KA 2WCHA 2MA2A 3FWCA 1TNQA 4A4CA 4ZCVA 1TUZA 3LL8B 1QX7A 1A2XA 1BT6A 1DGUA 1XFYO 1ORGA 3SIBA 2LLUA 4AQJA 1OOJA 3OB1B 2KQYA 1ZUZA 3VROA 1CLLA 3KPXA 3CDNA 5CSJA 2LHIA 5FYXA 1CMFA 1F71A 2CBLA 3BYAA 3DD4A 1SCVA 5IBWA 2KYCA 1S26D 3TUYC 4YGDB 1B1GA 1OMRA 1HT9A 4OR9B 1GJYA 2MBXA 1CLMA 4WQ2A 3NHIA 1C07A 2H61C 1TIZA 1YUUA 1LKJA 2BE4A 1NUBA 3BQ3A 4D1EA 1E8AA 2Q91A 2JT0A 5FI2A 4XJKA 2M7LA 5I8NA 3I5IB 3M0WA 3UNWA 1N2DA 1YRUB 2ZFDA 1EG3A 1QVIZ 5G08A 5I2QA 5CPVA 2PALA 1QX5B 1XO5A 3CTNA 4OZDA 4A4BA 1UHJA 4N1GA 5HL1A 2FJYA 4PE7A 3E3RA 4OVNF 4DRWA 3OBVA 1NP8A 1S6IA 1SR6B 2PSRA 2M1KB 3OGNA 3SG2A 1DJYA 3S0FA 1K96A 1BG1A 1T14A 1DF0B 2L2EA 4E68A 1JUOA 1NX1A 2LHLA 1A29A 1LVCD 1J55A 2RGIA 4KYNA 3CGAA 3BXKA 4PDZA 3BUNB 4IJ7A 1JF2A 1P28A 1ZFSA 2JC2A 2KI4C 2L4HA 1TNXA 3PSRA 1BJFA 2LMUA 4PHNA 3LK1A 2LVJA 1LINA 1X02A 3OHMB 2KQ6A 1IJ5A 4PALA 1BODA 1JFJA 2JOJA 1XA5A 1KWOB 3ICBA 3TDIA 2KLDA 3CZ0A 3B88A 1SSEB 1KQMB 4CLNA 2WOSA 1C3YA 1KSOA 5J3XA 3SG4A 1IIOA 2D8NA 2EGDA 2M49B 2OPOA 2WORA 5HKYA 1S3PA 1S6JA 1KFUL 4WQ3A 1S5GZ 1K9PA 2QACA 2JQ6A 1TNWA 4ICBA 1UP5A 1WDCC 2L0PA 4GPLB 1XVJA 1K9UA 1KK7Z 4F0ZB 2QEOA 2OTGB 4INWA 5FI7A 3VRPA 2WCEA 1OZSA 2WCBA 1ZOTB 3CR2A 1CDMA 2BCXA 3AKAA 1FBVA 3BFHA 3IVTA 1J7QA 3S0GA 2MJWB 1CNPA 3DVKA 2JWWA 2JNXA 1LXFC 1OOGA 1NX3A 3BOWB 4QJ4B 1FI5A 2JU0A 4NDCA 1IH0A 2WC8A 2GTEA 2WCFA 5I2LA 1YX7A 3I5HC 2F3YA 1H4BA 1MR8A 2OS8B 1EG4A 2ZRSA 2M9GA 1TN4A 2KPHA 1BLQA 4BY5A 5ER4X 3S0EA 1MQ1A 4CFRA 3BFAA 1XFWO 2LVVA 4M2QA 1J7OA 3OX5A 1J1EA 1NSHA 1B4CA 3JVTC 3JVTB 3QMEA 4IL1A 3PM2A 2JXCA 3FE8A 1TRFA 3LLEA 4P5OE 2NZ0A 2NLNA 3SG3A 3D10A 2Y5IA 3CLNA 2LE9B 4NQGA 3EVVA 5KSZA 2K61A 1IRJA 1F4QA 2M29A 1KFXS 3KF9A 4GFTA 1QX2A 1L2OC 1XYDA 1SL8A 2QEHA 3O4XA 4OV2A 1YRTB 1GGZA 1ZACA 4DCKA 3SG6A 3GK2A 3K1EA 4FQOA 1M45A
chains in the Genus database with same CATH topology
1ALWA 4XJKB 1UHIA 2LP3A 1PVBA 5JOLA 3I5GC 1J7PA 1BF5A 3I5GB 1JWDA 1IKUA 2KGBC 5HLVA 1KSMA 1YUSA 3HX4A 2KBIA 1J1DA 2L4IA 3DVJA 2KBMA 2QPTA 1Y6WA 1B8RA 4CIDA 1DJZA 4TNCA 2SCPA 2P6BB 4N5XA 4OCIA 1B8LA 1NX2A 1YVLA 2HETA 2KI6D 2LANA 3EKHA 2Y1MA 4R1EA 1DJXA 1K93D 2KOTA 2KGRA 4I5NB 1UUSA 4CFQA 4MN0A 2ZN8A 1QATA 4ORBB 1AHRA 5TNCA 1C7WA 2MRDA 1DJGA 2JXLA 1XK4A 2F2PA 2K0JA 3I5IC 4PHMA 5CSNA 1QV0A 2TN4A 5D7FA 5JJGA 1CKKA 4C0LA 4ETOA 1QVIY 1L7ZA 1MXEA 1CFDA 1J7RA 2FCEA 1UURA 5AXIA 1GQMA 1SK6D 1KK8B 1SR6C 1XFVO 2Y1NA 1IGVA 2I2RE 2KI6C 2GV5A 2FOTA 3O78A 2KAXA 1SRAA 5HKZA 1SNLA 5D69A 3EVRA 2ZKMX 4HRHA 2KSPA 3FS7A 2LM5A 1Y1AA 1BR4B 1N65A 2COLB 4NDBA 4BY4A 2G2BA 5AEQA 2ZNDA 1DJWA 1GGWA 2LVKA 3GOFA 1FPWA 2JRFA 1Q80A 1EL4A 1QASA 2JTZA 1B7TZ 1CFPA 1XFZO 3O4YA 1PVAA 2CT9A 2FCDA 1IQ5A 4MVFA 1KWOC 1JSAA 1DJHA 1KQMC 1F54A 3KEVA 2KFHA 5GQQC 1SYMA 1DTLA 3SIAA 1TNPA 3ZWHA 1CM1A 5AERA 3LCPC 1EH2A 1BMOA 1PSBA 1MUXA 1PALA 1RFJA 1V1GA 1KQVA 1PK0D 3I5FB 2Q4UA 1M63B 1S5GY 2H61A 2EC6B 4USLA 1B9AA 1ALVA 2JULA 4GGFC 2KNEA 1UHHA 2H2KA 2M7NA 1PSRA 2JPTA 2F33A 3JTDB 2HPSA 1KK7Y 2OTGC 3PN7B 4JWQA 3SG7A 1G4YR 3RM1A 3SG5A 3DVEA 2K2FA 1A4PA 1YTZC 3PLFB 3EK4A 4MRYA 5PALA 1AJ5A 1UHKA 3O2PA 2L5XB 2OS8C 5K89A 4YGAA 1BR1B 1MXLC 3KHEA 1Y0VH 1NX0A 3C1VA 1NIWA 1DT7B 3TS5B 2NCPA 2JTTA 1OQPA 2F8PA 1YR5A 1NCZA 1N0YA 3BUXB 1SCMB 1CTRA 2R2IA 2EHBA 2F2OA 4DS7A 2KAYA 2KFGA 2BBNA 2GGZA 2V53A 2LUCA 1SW8A 2MLFC 1AK8A 1BOCA 3LK0A 1F55A 1K90D 1FI6A 3CR4X 4ORCB 4CPVA 1SMGA 1PULA 1PRWA 1KFUS 1ODBA 2Y4QA 1A03A 1NWDA 1SKTA 1SY9A 1LA3A 3IQQA 4YGEB 2BBMA 2HF5A 2JZIA 3TDZA 1XK4C 1SBJA 1JBAA 4HRGA 1V1FA 4JPZB 4YGBB 2LV7A 1U5IB 2I94A 2LP2A 4YGCB 1UHNA 5KU1A 1KCYA 4AOMA 2JNFA 2O5GA 1M31A 2K7CA 2BCAA 1WLMA 1M46A 3CZTX 4MSPA 1YUTA 1LA0A 4PCWA 4C0JA 2F3ZA 3A8RA 2K2AA 3TDUA 3BUOB 3NSLA 3PM8A 2IS9A 1OMDA 1HQVA 3PALA 1TCFA 1CMGA 4YRUA 4PE0A 2KDHA 2LC5A 3EKJA 1IQ3A 2HQWA 3VRRA 1CM4A 1OMVA 2CNPA 4UPGA 1B8CA 4GUKA 1AVSA 2PRUA 4L9MA 5AANA 1SL9A 1NCYA 2M0RA 2BECA 1MF8B 1QIWA 2CTNA 1BU3A 2LLTA 2ZRTA 3D0YA 1R2UA 4JQ0D 1TTXA 1U5IA 2VRGA 3OX6A 2G9BA 1W7JB 2PMYA 1G33A 3BUWB 3QRXA 5DKNA 1Y1UA 1Y1XA 1SPYA 1QJTA 1WRKA 4MZLA 2AAOA 2L51A 3CWGA 3FIAA 5DKQA 1EXRA 2AUCA 2KFFA 2ZNEA 3ZNIA 1KK8C 2ISDA 1WLZA 4C0KA 4HREE 3F45A 3TUYB 4YI8A 3NSKA 1G8IA 4MRXA 3RLZA 3DF0A 3TZ1A 4I5JA 1D1OA 2KAVA 3AKBA 3PFVA 2MLEC 4U8DA 1CDPA 5DKRA 1K9KA 2I18A 3FWBA 1NCXA 5CSIA 1CB1A 1JF0A 3NSIA 1F70A 1K94A 4YBHB 4WRIA 3EK7A 3OB2B 5KTYA 2O60A 2BE6A 1FW4A 1B7TY 2M3WA 1SL7A 1QXPA 1WY9A 3WHUB 1K2HA 3MSEB 2MHHA 1NYAA 2K8MB 1QTXA 1S1EA 2E6WA 3CS1A 1DMOA 1H8BA 1IWQA 1A75B 3O6BA 2A4JA 4DIRA 4PE4A 2FJUB 3GK1A 3H4SE 1CDNA 3I5FC 3IQOA 2EC6C 4MLWA 1CFCA 1RECA 2BKIB 1YVHA 2K7DA 2AMIA 1RWYA 4I5LB 2LCPA 1QLKA 2KI4B 2PASA 2LLSA 2SASA 2NXQA 1DJIA 1UWOA 3JTDC 1B47A 3PN7C 4MZJA 4QJ5B 3IF7A 3GK4X 1TCOB 5BPJA 1W7IB 5B8IB 3VRNA 2JT3A 1MWNA 2KHNA 3NXAA 1XFUO 1OE9B 2L98A 4MEWA 4MZKA 1OZOA 2MAZA 4GNKB 1K8UA 3EK8A 3HCMA 4ORAB 1S36A 1QIVA 1EJ3A 1QV1A 1R6PA 2LAPA 3NSOA 5HKWA 1OSAA 1KFXL 4GAOA 2JT8A 1A75A 1MHOA 2LVIA 1DF0A 2ZN9A 4M2PA 4ZCUA 1WDCB 1QLSA 1RJVA 1RROA 4OKHA 1C7VA 2LUXA 1YURA 2BCBA 1IG5A 1XFXO 2K7BA 3TS5C 1RTP1 2M8UA 2GGMA 1F4OA 1SCMC 2M97A 3SJSA 2B1UA 2L50A 1JC2A 5ER5A 5CSFA 3AAKA 1CFFA 3K21A 5I2OA 4GGNA 2I7AA 2CXJA 4YI9A 3WNXB 3VGOA 4N1FA 2HQ8A 4XYNA 4PHKA 3BUMB 1M39A 1WRZA 3I5HB 4M2OA 1DVIA 2LMTA 4MBEA 3EVUA 2PVBA 1RK9A 2BKHB 5F6TA 2NCOA 4HSZA 4Q04A 4GGFA 2KYFA 3OP0A 3D0YB 3VRQA 4NDDA 4FTGA 3KO0A 4GBAA 1F8HA 1JFKA 4AQIA 3WXAA 2M1UA 4PHJA 2WNDA 3WHTB 1IJ6A 1YX8A 1ZMZA 1NPQA 2DOQA 1S6CA 1VRKA 1TOPA 1AJ4A 2E30A 1WRLA 3BOWA 1L2OB 1CDLA 3DVMA 2BL0C 3PATA 3DF0B 2BL0B 1AUIB 2CCMA 4P2YB 3CR5X 3A4UB 1AP4A 1K95A 1FF1A 5HYDA 4QJ3B 1QS7A 3AAJA 4PE1A 5HLOA 1CLBA 2LNKA 1DGVA 2LMVA 2K7OA 4I5KA 2MA2A 3FWCA 1TNQA 4A4CA 4ZCVA 3LL8B 1QX7A 1A2XA 1BT6A 1DGUA 1XFYO 3SIBA 4AQJA 2LLUA 1OOJA 3OB1B 2KQYA 1ZUZA 3VROA 1CLLA 3KPXA 5CSJA 2LHIA 5FYXA 1CMFA 1F71A 2CBLA 3BYAA 3DD4A 1SCVA 5IBWA 2KYCA 1S26D 3TUYC 4YGDB 1B1GA 1OMRA 1HT9A 4OR9B 1GJYA 2MBXA 1CLMA 4WQ2A 1C07A 2H61C 1TIZA 1YUUA 1LKJA 2BE4A 1NUBA 3BQ3A 4D1EA 1E8AA 2Q91A 2JT0A 2M7LA 4XJKA 5I8NA 3I5IB 3M0WA 1N2DA 1YRUB 2ZFDA 1EG3A 1QVIZ 5G08A 5I2QA 5CPVA 2PALA 1QX5B 1XO5A 3CTNA 4A4BA 1UHJA 4N1GA 4PE7A 3E3RA 4OVNF 4DRWA 1NP8A 1S6IA 1SR6B 2PSRA 2M1KB 3SG2A 1DJYA 1K96A 1BG1A 1DF0B 2L2EA 4E68A 1JUOA 1NX1A 2LHLA 1A29A 1LVCD 1J55A 2RGIA 3CGAA 3BXKA 4PDZA 3BUNB 1JF2A 1ZFSA 2KI4C 2JC2A 2L4HA 3PSRA 1TNXA 4PHNA 1BJFA 2LMUA 4DUQA 3LK1A 2LVJA 1LINA 1X02A 3OHMB 2KQ6A 1IJ5A 4PALA 1BODA 1JFJA 2JOJA 1XA5A 1KWOB 3ICBA 3TDIA 1KQMB 4CLNA 2WOSA 1KSOA 5J3XA 3SG4A 2D8NA 2EGDA 2M49B 2OPOA 2WORA 5HKYA 1S3PA 1S6JA 1KFUL 4WQ3A 1S5GZ 1K9PA 2QACA 2JQ6A 1TNWA 4ICBA 1UP5A 1WDCC 2L0PA 4GPLB 1XVJA 1K9UA 1KK7Z 4F0ZB 2OTGB 3VRPA 2WCEA 1OZSA 2WCBA 1ZOTB 3CR2A 1CDMA 2BCXA 3AKAA 1FBVA 1J7QA 2MJWB 1CNPA 3DVKA 2JWWA 2JNXA 1LXFC 1NX3A 3BOWB 4QJ4B 1FI5A 2JU0A 4NDCA 1IH0A 2WC8A 2WCFA 5I2LA 1YX7A 3I5HC 2F3YA 1H4BA 1MR8A 2OS8B 1EG4A 2ZRSA 2M9GA 1TN4A 1BLQA 4BY5A 5ER4X 1MQ1A 4CFRA 1XFWO 2LVVA 4M2QA 1J7OA 3OX5A 1J1EA 1NSHA 1B4CA 3JVTC 3JVTB 4IL1A 2JXCA 1TRFA 3LLEA 4P5OE 2NZ0A 2NLNA 3SG3A 3D10A 2Y5IA 3CLNA 2LE9B 4NQGA 3EVVA 5KSZA 2K61A 1IRJA 1F4QA 2M29A 1KFXS 3KF9A 4GFTA 1QX2A 1L2OC 1XYDA 1SL8A 4OV2A 1YRTB 1GGZA 1ZACA 4DCKA 3SG6A 3GK2A 5AFPA 4FQOA 1M45A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ALW A;  4XJK B;  1UHI A;  2LP3 A;  1PVB A;  5JOL A;  3I5G C;  1J7P A;  1BF5 A;  3I5G B;  1JWD A;  1IKU A;  2KGB C;  5HLV A;  1KSM A;  1YUS A;  3HX4 A;  2KBI A;  1J1D A;  2L4I A;  3DVJ A;  2KBM A;  2QPT A;  1Y6W A;  1B8R A;  4CID A;  1DJZ A;  4TNC A;  2SCP A;  2P6B B;  4N5X A;  4OCI A;  1B8L A;  1NX2 A;  1YVL A;  2HET A;  2KI6 D;  2LAN A;  3EKH A;  2Y1M A;  4R1E A;  1DJX A;  1K93 D;  2KOT A;  2KGR A;  4I5N B;  1UUS A;  4CFQ A;  4MN0 A;  2ZN8 A;  1QAT A;  4ORB B;  1AHR A;  5TNC A;  1C7W A;  2MRD A;  1DJG A;  2JXL A;  1XK4 A;  2F2P A;  2K0J A;  3I5I C;  4PHM A;  5CSN A;  1QV0 A;  2TN4 A;  5D7F A;  5JJG A;  1CKK A;  4C0L A;  4ETO A;  1QVI Y;  1L7Z A;  1MXE A;  1CFD A;  1J7R A;  2FCE A;  1UUR A;  5AXI A;  1GQM A;  1SK6 D;  1KK8 B;  1SR6 C;  1XFV O;  2Y1N A;  1IGV A;  2I2R E;  2KI6 C;  2GV5 A;  2FOT A;  3O78 A;  2KAX A;  1SRA A;  5HKZ A;  1SNL A;  5D69 A;  3EVR A;  2ZKM X;  4HRH A;  2KSP A;  3FS7 A;  2LM5 A;  1Y1A A;  1BR4 B;  1N65 A;  2COL B;  4NDB A;  4BY4 A;  2G2B A;  5AEQ A;  2ZND A;  1DJW A;  1GGW A;  2LVK A;  3GOF A;  1FPW A;  2JRF A;  1Q80 A;  1EL4 A;  1QAS A;  2JTZ A;  1B7T Z;  1CFP A;  1XFZ O;  3O4Y A;  1PVA A;  2CT9 A;  2FCD A;  1IQ5 A;  4MVF A;  1KWO C;  1JSA A;  1DJH A;  1KQM C;  1F54 A;  3KEV A;  2KFH A;  5GQQ C;  1SYM A;  1DTL A;  3SIA A;  1TNP A;  3ZWH A;  1CM1 A;  5AER A;  3LCP C;  1EH2 A;  1BMO A;  1PSB A;  1MUX A;  1PAL A;  1RFJ A;  1V1G A;  1KQV A;  1PK0 D;  3I5F B;  2Q4U A;  1M63 B;  1S5G Y;  2H61 A;  2EC6 B;  4USL A;  1B9A A;  1ALV A;  2JUL A;  4GGF C;  2KNE A;  1UHH A;  2H2K A;  2M7N A;  1PSR A;  2JPT A;  2F33 A;  3JTD B;  2HPS A;  1KK7 Y;  2OTG C;  3PN7 B;  4JWQ A;  3SG7 A;  1G4Y R;  3RM1 A;  3SG5 A;  3DVE A;  2K2F A;  1A4P A;  1YTZ C;  3PLF B;  3EK4 A;  4MRY A;  5PAL A;  1AJ5 A;  1UHK A;  3O2P A;  2L5X B;  2OS8 C;  5K89 A;  4YGA A;  1BR1 B;  1MXL C;  3KHE A;  1Y0V H;  1NX0 A;  3C1V A;  1NIW A;  1DT7 B;  3TS5 B;  2NCP A;  2JTT A;  1OQP A;  2F8P A;  1YR5 A;  1NCZ A;  1N0Y A;  3BUX B;  1SCM B;  1CTR A;  2R2I A;  2EHB A;  2F2O A;  4DS7 A;  2KAY A;  2KFG A;  2BBN A;  2GGZ A;  2V53 A;  2LUC A;  1SW8 A;  2MLF C;  1AK8 A;  1BOC A;  3LK0 A;  1F55 A;  1K90 D;  1FI6 A;  3CR4 X;  4ORC B;  4CPV A;  1SMG A;  1PUL A;  1PRW A;  1KFU S;  1ODB A;  2Y4Q A;  1A03 A;  1NWD A;  1SKT A;  1SY9 A;  1LA3 A;  3IQQ A;  4YGE B;  2BBM A;  2HF5 A;  2JZI A;  3TDZ A;  1XK4 C;  1SBJ A;  1JBA A;  4HRG A;  1V1F A;  4JPZ B;  4YGB B;  2LV7 A;  1U5I B;  2I94 A;  2LP2 A;  4YGC B;  1UHN A;  5KU1 A;  1KCY A;  4AOM A;  2JNF A;  2O5G A;  1M31 A;  2K7C A;  2BCA A;  1WLM A;  1M46 A;  3CZT X;  4MSP A;  1YUT A;  1LA0 A;  4PCW A;  4C0J A;  2F3Z A;  3A8R A;  2K2A A;  3TDU A;  3BUO B;  3NSL A;  3PM8 A;  2IS9 A;  1OMD A;  1HQV A;  3PAL A;  1TCF A;  1CMG A;  4YRU A;  4PE0 A;  2KDH A;  2LC5 A;  3EKJ A;  1IQ3 A;  2HQW A;  3VRR A;  1CM4 A;  1OMV A;  2CNP A;  4UPG A;  1B8C A;  4GUK A;  1AVS A;  2PRU A;  4L9M A;  5AAN A;  1SL9 A;  1NCY A;  2M0R A;  2BEC A;  1MF8 B;  1QIW A;  2CTN A;  1BU3 A;  2LLT A;  2ZRT A;  3D0Y A;  1R2U A;  4JQ0 D;  1TTX A;  1U5I A;  2VRG A;  3OX6 A;  2G9B A;  1W7J B;  2PMY A;  1G33 A;  3BUW B;  3QRX A;  5DKN A;  1Y1U A;  1Y1X A;  1SPY A;  1QJT A;  1WRK A;  4MZL A;  2AAO A;  2L51 A;  3CWG A;  3FIA A;  5DKQ A;  1EXR A;  2AUC A;  2KFF A;  2ZNE A;  3ZNI A;  1KK8 C;  2ISD A;  1WLZ A;  4C0K A;  4HRE E;  3F45 A;  3TUY B;  4YI8 A;  3NSK A;  1G8I A;  4MRX A;  3RLZ A;  3DF0 A;  3TZ1 A;  4I5J A;  1D1O A;  2KAV A;  3AKB A;  3PFV A;  2MLE C;  4U8D A;  1CDP A;  5DKR A;  1K9K A;  2I18 A;  3FWB A;  1NCX A;  5CSI A;  1CB1 A;  1JF0 A;  3NSI A;  1F70 A;  1K94 A;  4YBH B;  4WRI A;  3EK7 A;  3OB2 B;  5KTY A;  2O60 A;  2BE6 A;  1FW4 A;  1B7T Y;  2M3W A;  1SL7 A;  1QXP A;  1WY9 A;  3WHU B;  1K2H A;  3MSE B;  2MHH A;  1NYA A;  2K8M B;  1QTX A;  1S1E A;  2E6W A;  3CS1 A;  1DMO A;  1H8B A;  1IWQ A;  1A75 B;  3O6B A;  2A4J A;  4DIR A;  4PE4 A;  2FJU B;  3GK1 A;  3H4S E;  1CDN A;  3I5F C;  3IQO A;  2EC6 C;  4MLW A;  1CFC A;  1REC A;  2BKI B;  1YVH A;  2K7D A;  2AMI A;  1RWY A;  4I5L B;  2LCP A;  1QLK A;  2KI4 B;  2PAS A;  2LLS A;  2SAS A;  2NXQ A;  1DJI A;  1UWO A;  3JTD C;  1B47 A;  3PN7 C;  4MZJ A;  4QJ5 B;  3IF7 A;  3GK4 X;  1TCO B;  5BPJ A;  1W7I B;  5B8I B;  3VRN A;  2JT3 A;  1MWN A;  2KHN A;  3NXA A;  1XFU O;  1OE9 B;  2L98 A;  4MEW A;  4MZK A;  1OZO A;  2MAZ A;  4GNK B;  1K8U A;  3EK8 A;  3HCM A;  4ORA B;  1S36 A;  1QIV A;  1EJ3 A;  1QV1 A;  1R6P A;  2LAP A;  3NSO A;  5HKW A;  1OSA A;  1KFX L;  4GAO A;  2JT8 A;  1A75 A;  1MHO A;  2LVI A;  1DF0 A;  2ZN9 A;  4M2P A;  4ZCU A;  1WDC B;  1QLS A;  1RJV A;  1RRO A;  4OKH A;  1C7V A;  2LUX A;  1YUR A;  2BCB A;  1IG5 A;  1XFX O;  2K7B A;  3TS5 C;  1RTP 1;  2M8U A;  2GGM A;  1F4O A;  1SCM C;  2M97 A;  3SJS A;  2B1U A;  2L50 A;  1JC2 A;  5ER5 A;  5CSF A;  3AAK A;  1CFF A;  3K21 A;  5I2O A;  4GGN A;  2I7A A;  2CXJ A;  4YI9 A;  3WNX B;  3VGO A;  4N1F A;  2HQ8 A;  4XYN A;  4PHK A;  3BUM B;  1M39 A;  1WRZ A;  3I5H B;  4M2O A;  1DVI A;  2LMT A;  4MBE A;  3EVU A;  2PVB A;  1RK9 A;  2BKH B;  5F6T A;  2NCO A;  4HSZ A;  4Q04 A;  4GGF A;  2KYF A;  3OP0 A;  3D0Y B;  3VRQ A;  4NDD A;  4FTG A;  3KO0 A;  4GBA A;  1F8H A;  1JFK A;  4AQI A;  3WXA A;  2M1U A;  4PHJ A;  2WND A;  3WHT B;  1IJ6 A;  1YX8 A;  1ZMZ A;  1NPQ A;  2DOQ A;  1S6C A;  1VRK A;  1TOP A;  1AJ4 A;  2E30 A;  1WRL A;  3BOW A;  1L2O B;  1CDL A;  3DVM A;  2BL0 C;  3PAT A;  3DF0 B;  2BL0 B;  1AUI B;  2CCM A;  4P2Y B;  3CR5 X;  3A4U B;  1AP4 A;  1K95 A;  1FF1 A;  5HYD A;  4QJ3 B;  1QS7 A;  3AAJ A;  4PE1 A;  5HLO A;  1CLB A;  2LNK A;  1DGV A;  2LMV A;  2K7O A;  4I5K A;  2MA2 A;  3FWC A;  1TNQ A;  4A4C A;  4ZCV A;  3LL8 B;  1QX7 A;  1A2X A;  1BT6 A;  1DGU A;  1XFY O;  3SIB A;  4AQJ A;  2LLU A;  1OOJ A;  3OB1 B;  2KQY A;  1ZUZ A;  3VRO A;  1CLL A;  3KPX A;  5CSJ A;  2LHI A;  5FYX A;  1CMF A;  1F71 A;  2CBL A;  3BYA A;  3DD4 A;  1SCV A;  5IBW A;  2KYC A;  1S26 D;  3TUY C;  4YGD B;  1B1G A;  1OMR A;  1HT9 A;  4OR9 B;  1GJY A;  2MBX A;  1CLM A;  4WQ2 A;  1C07 A;  2H61 C;  1TIZ A;  1YUU A;  1LKJ A;  2BE4 A;  1NUB A;  3BQ3 A;  4D1E A;  1E8A A;  2Q91 A;  2JT0 A;  2M7L A;  4XJK A;  5I8N A;  3I5I B;  3M0W A;  1N2D A;  1YRU B;  2ZFD A;  1EG3 A;  1QVI Z;  5G08 A;  5I2Q A;  5CPV A;  2PAL A;  1QX5 B;  1XO5 A;  3CTN A;  4A4B A;  1UHJ A;  4N1G A;  4PE7 A;  3E3R A;  4OVN F;  4DRW A;  1NP8 A;  1S6I A;  1SR6 B;  2PSR A;  2M1K B;  3SG2 A;  1DJY A;  1K96 A;  1BG1 A;  1DF0 B;  2L2E A;  4E68 A;  1JUO A;  1NX1 A;  2LHL A;  1A29 A;  1LVC D;  1J55 A;  2RGI A;  3CGA A;  3BXK A;  4PDZ A;  3BUN B;  1JF2 A;  1ZFS A;  2KI4 C;  2JC2 A;  2L4H A;  3PSR A;  1TNX A;  4PHN A;  1BJF A;  2LMU A;  4DUQ A;  3LK1 A;  2LVJ A;  1LIN A;  1X02 A;  3OHM B;  2KQ6 A;  1IJ5 A;  4PAL A;  1BOD A;  1JFJ A;  2JOJ A;  1XA5 A;  1KWO B;  3ICB A;  3TDI A;  1KQM B;  4CLN A;  2WOS A;  1KSO A;  5J3X A;  3SG4 A;  2D8N A;  2EGD A;  2M49 B;  2OPO A;  2WOR A;  5HKY A;  1S3P A;  1S6J A;  1KFU L;  4WQ3 A;  1S5G Z;  1K9P A;  2QAC A;  2JQ6 A;  1TNW A;  4ICB A;  1UP5 A;  1WDC C;  2L0P A;  4GPL B;  1XVJ A;  1K9U A;  1KK7 Z;  4F0Z B;  2OTG B;  3VRP A;  2WCE A;  1OZS A;  2WCB A;  1ZOT B;  3CR2 A;  1CDM A;  2BCX A;  3AKA A;  1FBV A;  1J7Q A;  2MJW B;  1CNP A;  3DVK A;  2JWW A;  2JNX A;  1LXF C;  1NX3 A;  3BOW B;  4QJ4 B;  1FI5 A;  2JU0 A;  4NDC A;  1IH0 A;  2WC8 A;  2WCF A;  5I2L A;  1YX7 A;  3I5H C;  2F3Y A;  1H4B A;  1MR8 A;  2OS8 B;  1EG4 A;  2ZRS A;  2M9G A;  1TN4 A;  1BLQ A;  4BY5 A;  5ER4 X;  1MQ1 A;  4CFR A;  1XFW O;  2LVV A;  4M2Q A;  1J7O A;  3OX5 A;  1J1E A;  1NSH A;  1B4C A;  3JVT C;  3JVT B;  4IL1 A;  2JXC A;  1TRF A;  3LLE A;  4P5O E;  2NZ0 A;  2NLN A;  3SG3 A;  3D10 A;  2Y5I A;  3CLN A;  2LE9 B;  4NQG A;  3EVV A;  5KSZ A;  2K61 A;  1IRJ A;  1F4Q A;  2M29 A;  1KFX S;  3KF9 A;  4GFT A;  1QX2 A;  1L2O C;  1XYD A;  1SL8 A;  4OV2 A;  1YRT B;  1GGZ A;  1ZAC A;  4DCK A;  3SG6 A;  3GK2 A;  5AFP A;  4FQO A;  1M45 A; 
#chains in the Genus database with same CATH topology
 1ALW A;  4XJK B;  1UHI A;  2LP3 A;  1PVB A;  5JOL A;  3I5G C;  1J7P A;  1BF5 A;  3I5G B;  2WC6 A;  1JWD A;  1IKU A;  2KGB C;  5HLV A;  1KSM A;  3NGV A;  1YUS A;  3HX4 A;  2KBI A;  3PJI A;  1J1D A;  2L4I A;  3DVJ A;  2KBM A;  2QPT A;  1Y6W A;  1B8R A;  4CID A;  1DJZ A;  4TNC A;  2SCP A;  2P6B B;  1DEK A;  4N5X A;  4OCI A;  3S0B A;  1B8L A;  1NX2 A;  1YVL A;  2HET A;  2KI6 D;  2LAN A;  3EKH A;  2Y1M A;  5EL2 A;  4R1E A;  1DJX A;  1K93 D;  2KOT A;  2KGR A;  4I5N B;  1UUS A;  4CFQ A;  4MN0 A;  2ZN8 A;  1QAT A;  1QWV A;  1AHR A;  4ORB B;  5TNC A;  2ERB A;  1C7W A;  2MRD A;  1DJG A;  2JXL A;  1XK4 A;  2F2P A;  2K0J A;  3I5I C;  4PHM A;  5CSN A;  1QV0 A;  2TN4 A;  5D7F A;  5JJG A;  3CZ1 A;  1CKK A;  3N7H A;  4C0L A;  4ETO A;  1QVI Y;  1L7Z A;  4INX A;  1MXE A;  1CFD A;  1J7R A;  2FCE A;  1UUR A;  5AXI A;  1GQM A;  3CYZ A;  1SK6 D;  1KK8 B;  1SR6 C;  1XFV O;  3DYE A;  2Y1N A;  1IGV A;  2I2R E;  2KI6 C;  2GV5 A;  2QEV A;  2FOT A;  4JD9 A;  3O78 A;  2KAX A;  1SRA A;  5HKZ A;  2JPO A;  1SNL A;  5D69 A;  3EVR A;  2ZKM X;  4HRH A;  2KSP A;  3FS7 A;  2LM5 A;  1Y1A A;  1BR4 B;  1N65 A;  2COL B;  4NDB A;  4BY4 A;  2G2B A;  5AEQ A;  2ZND A;  1DJW A;  1GGW A;  2LVK A;  3GOF A;  1FPW A;  2JRF A;  1Q80 A;  1EL4 A;  3R1P A;  1QAS A;  2JTZ A;  1B7T Z;  3L4L A;  1CFP A;  1XFZ O;  3O4Y A;  1PVA A;  2CT9 A;  2FCD A;  1IQ5 A;  4MVF A;  1KWO C;  1JSA A;  1OOI X;  1DJH A;  5I94 A;  1KQM C;  1F54 A;  3KEV A;  2KFH A;  5GQQ C;  1SYM A;  1DTL A;  3SIA A;  3L47 A;  1TNP A;  3ZWH A;  1CM1 A;  5AER A;  3BFB A;  3LCP C;  3L4A A;  1EH2 A;  1BMO A;  1PSB A;  1MUX A;  1PAL A;  1RFJ A;  1V1G A;  1KQV A;  1PK0 D;  3I5F B;  2Q4U A;  1M63 B;  1S5G Y;  2H61 A;  2EC6 B;  4USL A;  1B9A A;  1ALV A;  2WC5 A;  2JUL A;  4GGF C;  2KNE A;  3S0A A;  1UHH A;  3DZT A;  2H2K A;  2M7N A;  1PSR A;  2JPT A;  2F33 A;  3JTD B;  2HPS A;  1KK7 Y;  2OTG C;  3PN7 B;  2WCM A;  2BAP A;  4JWQ A;  3D75 A;  3SG7 A;  1G4Y R;  3RM1 A;  3SG5 A;  3DVE A;  3S0D A;  2K2F A;  1A4P A;  1YTZ C;  3PLF B;  3EK4 A;  4MRY A;  3B87 A;  5PAL A;  3R72 A;  1AJ5 A;  1UHK A;  3O2P A;  2L5X B;  3SS4 A;  2OS8 C;  5K89 A;  1TUJ A;  4YGA A;  1BR1 B;  1MXL C;  3KHE A;  1Y0V H;  1NX0 A;  3C1V A;  1NIW A;  1DT7 B;  3TS5 B;  2P71 A;  2NCP A;  2JTT A;  5D3O A;  1OQP A;  2F8P A;  1YR5 A;  1NCZ A;  1N0Y A;  3BUX B;  1SCM B;  1CTR A;  2R2I A;  2EHB A;  2F2O A;  4DS7 A;  2KAY A;  2KFG A;  2BBN A;  2GGZ A;  2V53 A;  2LUC A;  1SW8 A;  2MLF C;  1AK8 A;  1BOC A;  3LK0 A;  1F55 A;  1K90 D;  1FI6 A;  3VB1 A;  3CR4 X;  4ORC B;  4CPV A;  1SMG A;  1PUL A;  1PRW A;  1W9Z A;  1KFU S;  1ODB A;  2Y4Q A;  1A03 A;  1NWD A;  1OOH A;  1SKT A;  1SY9 A;  1LA3 A;  3IQQ A;  4YGE B;  2BBM A;  2HF5 A;  2JZI A;  3TDZ A;  1XK4 C;  1SBJ A;  1JBA A;  4HRG A;  1V1F A;  4JPZ B;  4YGB B;  2LV7 A;  1U5I B;  2H8V A;  2I94 A;  2KLE A;  1OOF A;  2LP2 A;  1UHN A;  3R1V A;  4YGC B;  5KU1 A;  1KCY A;  4AOM A;  2JNF A;  2O5G A;  1M31 A;  2K7C A;  2BCA A;  1WLM A;  1M46 A;  3CZT X;  4MSP A;  1YUT A;  1LA0 A;  4PCW A;  4C0J A;  2F3Z A;  3A8R A;  2K2A A;  3TDU A;  3BUO B;  3NSL A;  1DC1 A;  3PM8 A;  2IS9 A;  1OMD A;  2QEB A;  1HQV A;  3PAL A;  1TCF A;  1CMG A;  3R1O A;  4YRU A;  1XFR A;  4PE0 A;  2KDH A;  2LC5 A;  3EKJ A;  2WCJ A;  2HQW A;  3VRR A;  1CM4 A;  1OMV A;  1IQ3 A;  2CNP A;  4UPG A;  1B8C A;  4GUK A;  3UO9 A;  1AVS A;  2PRU A;  4L9M A;  3D78 A;  5AAN A;  3D73 A;  1SL9 A;  1NCY A;  3BJH A;  2M0R A;  2BEC A;  1MF8 B;  1QIW A;  2CTN A;  1BU3 A;  2LLT A;  2ZRT A;  3D0Y A;  1R2U A;  4JQ0 D;  3D76 A;  1TTX A;  1U5I A;  2VRG A;  3OX6 A;  2G9B A;  1DQE A;  1W7J B;  2PMY A;  1G33 A;  3BUW B;  3QRX A;  5DKN A;  1Y1U A;  1Y1X A;  1SPY A;  1QJT A;  1WRK A;  4MZL A;  2AAO A;  2L51 A;  3CWG A;  3FIA A;  3DY9 A;  1EXR A;  5DKQ A;  2AUC A;  2KFF A;  2ZNE A;  3ZNI A;  1KK8 C;  2ISD A;  1WLZ A;  4C0K A;  4HRE E;  3F45 A;  3TUY B;  4YI8 A;  3NSK A;  4PT1 A;  1G8I A;  4MRX A;  3RLZ A;  3DF0 A;  2P70 A;  4I5J A;  3TZ1 A;  1D1O A;  2KAV A;  3AKB A;  3PFV A;  2MLE C;  4U8D A;  1CDP A;  5DKR A;  1K9K A;  5FI6 A;  2I18 A;  3FWB A;  1NCX A;  5CSI A;  3SS5 A;  1CB1 A;  1JF0 A;  3NSI A;  1F70 A;  1K94 A;  4YBH B;  4WRI A;  3EK7 A;  3OB2 B;  5KTY A;  2O60 A;  2BE6 A;  1FW4 A;  1B7T Y;  2M3W A;  1SL7 A;  1QXP A;  3D77 A;  2YGU A;  1WY9 A;  3WHU B;  1K2H A;  3MSE B;  2MHH A;  1NYA A;  2K8M B;  1QTX A;  1S1E A;  2E6W A;  3CS1 A;  1DMO A;  1H8B A;  1IWQ A;  1A75 B;  3O6B A;  2A4J A;  4DIR A;  4PE4 A;  2FJU B;  4F7F A;  3GK1 A;  3H4S E;  1CDN A;  3I5F C;  3IQO A;  2EC6 C;  3B6X A;  4MLW A;  1CFC A;  1REC A;  2BKI B;  1YVH A;  2K7D A;  2AMI A;  1RWY A;  4I5L B;  2LCP A;  1QLK A;  2KI4 B;  2PAS A;  2LLS A;  2PYQ A;  2SAS A;  2NXQ A;  1DJI A;  1UWO A;  1Z4H A;  1B47 A;  3JTD C;  3PN7 C;  4MZJ A;  4QJ5 B;  3EG5 B;  3IF7 A;  3GK4 X;  1TCO B;  3D74 A;  5BPJ A;  3RZS A;  1W7I B;  5B8I B;  3VRN A;  2JT3 A;  1MWN A;  2KHN A;  3NXA A;  1XFU O;  1OE9 B;  2L98 A;  4MEW A;  4MZK A;  1OZO A;  1DEL A;  2MAZ A;  4GNK B;  1C3Z A;  1K8U A;  3EK8 A;  3HCM A;  4ORA B;  1S36 A;  1QIV A;  1EJ3 A;  1QV1 A;  1R6P A;  2LAP A;  3NSO A;  5HKW A;  1OSA A;  1KFX L;  4GAO A;  2PQL A;  2JT8 A;  1A75 A;  1MHO A;  2LVI A;  1DF0 A;  2ZN9 A;  4M2P A;  4ZCU A;  1WDC B;  1QLS A;  1RJV A;  1RRO A;  4OKH A;  1C7V A;  2LUX A;  1YUR A;  2BCB A;  1IG5 A;  1XFX O;  2K7B A;  3TS5 C;  1RTP 1;  2M8U A;  2GGM A;  1Z2C B;  1F4O A;  1SCM C;  2M97 A;  3SJS A;  2B1U A;  2L50 A;  5AFP A;  1JC2 A;  5ER5 A;  5CSF A;  3AAK A;  1CFF A;  1GM0 A;  1OW4 A;  3B7A A;  3K21 A;  5I2O A;  4GGN A;  2I7A A;  2CXJ A;  4YI9 A;  5DIC A;  3WNX B;  3VGO A;  4N1F A;  2HQ8 A;  4DUQ A;  3DXL A;  4XYN A;  1LS8 A;  4PHK A;  4JKT A;  3BUM B;  1M39 A;  1WRZ A;  3I5H B;  3NHT A;  2L5Y A;  4M2O A;  1DVI A;  2LMT A;  4MBE A;  3EVU A;  2PVB A;  1RK9 A;  2BKH B;  5F6T A;  2L2C A;  2NCO A;  4HSZ A;  4Q04 A;  3SS3 A;  4GGF A;  2BNX A;  2KYF A;  3D0Y B;  3OP0 A;  3VRQ A;  4NDD A;  4FTG A;  3KO0 A;  4GBA A;  1F8H A;  1JFK A;  4AQI A;  3WXA A;  2M1U A;  4PHJ A;  2WCK A;  2WND A;  3FE6 A;  3WHT B;  2QDI A;  1IJ6 A;  1YX8 A;  3B86 A;  1ZMZ A;  1NPQ A;  4FQT A;  2DOQ A;  1S6C A;  1VRK A;  2K60 A;  1TOP A;  1AJ4 A;  2E30 A;  1WRL A;  3BOW A;  1L2O B;  1CDL A;  3DVM A;  2BL0 C;  3FE9 A;  3DF0 B;  3PAT A;  2BL0 B;  3CAB A;  1AUI B;  2CCM A;  4P2Y B;  3CR5 X;  3A4U B;  3V2L A;  2WCL A;  1AP4 A;  1TWO A;  1K95 A;  1FF1 A;  5HYD A;  4QJ3 B;  1QS7 A;  3AAJ A;  4PE1 A;  5HLO A;  1CLB A;  2LNK A;  1DGV A;  3Q8I A;  2LMV A;  2K7O A;  3CZ2 A;  4I5K A;  2WCH A;  2MA2 A;  3FWC A;  1TNQ A;  4A4C A;  4ZCV A;  1TUZ A;  3LL8 B;  1QX7 A;  1A2X A;  1BT6 A;  1DGU A;  1XFY O;  1ORG A;  3SIB A;  2LLU A;  4AQJ A;  1OOJ A;  3OB1 B;  2KQY A;  1ZUZ A;  3VRO A;  1CLL A;  3KPX A;  3CDN A;  5CSJ A;  2LHI A;  5FYX A;  1CMF A;  1F71 A;  2CBL A;  3BYA A;  3DD4 A;  1SCV A;  5IBW A;  2KYC A;  1S26 D;  3TUY C;  4YGD B;  1B1G A;  1OMR A;  1HT9 A;  4OR9 B;  1GJY A;  2MBX A;  1CLM A;  4WQ2 A;  3NHI A;  1C07 A;  2H61 C;  1TIZ A;  1YUU A;  1LKJ A;  2BE4 A;  1NUB A;  3BQ3 A;  4D1E A;  1E8A A;  2Q91 A;  2JT0 A;  5FI2 A;  4XJK A;  2M7L A;  5I8N A;  3I5I B;  3M0W A;  3UNW A;  1N2D A;  1YRU B;  2ZFD A;  1EG3 A;  1QVI Z;  5G08 A;  5I2Q A;  5CPV A;  2PAL A;  1QX5 B;  1XO5 A;  3CTN A;  4OZD A;  4A4B A;  1UHJ A;  4N1G A;  5HL1 A;  2FJY A;  4PE7 A;  3E3R A;  4OVN F;  4DRW A;  3OBV A;  1NP8 A;  1S6I A;  1SR6 B;  2PSR A;  2M1K B;  3OGN A;  3SG2 A;  1DJY A;  3S0F A;  1K96 A;  1BG1 A;  1T14 A;  1DF0 B;  2L2E A;  4E68 A;  1JUO A;  1NX1 A;  2LHL A;  1A29 A;  1LVC D;  1J55 A;  2RGI A;  4KYN A;  3CGA A;  3BXK A;  4PDZ A;  3BUN B;  4IJ7 A;  1JF2 A;  1P28 A;  1ZFS A;  2JC2 A;  2KI4 C;  2L4H A;  1TNX A;  3PSR A;  1BJF A;  2LMU A;  4PHN A;  3LK1 A;  2LVJ A;  1LIN A;  1X02 A;  3OHM B;  2KQ6 A;  1IJ5 A;  4PAL A;  1BOD A;  1JFJ A;  2JOJ A;  1XA5 A;  1KWO B;  3ICB A;  3TDI A;  2KLD A;  3CZ0 A;  3B88 A;  1SSE B;  1KQM B;  4CLN A;  2WOS A;  1C3Y A;  1KSO A;  5J3X A;  3SG4 A;  1IIO A;  2D8N A;  2EGD A;  2M49 B;  2OPO A;  2WOR A;  5HKY A;  1S3P A;  1S6J A;  1KFU L;  4WQ3 A;  1S5G Z;  1K9P A;  2QAC A;  2JQ6 A;  1TNW A;  4ICB A;  1UP5 A;  1WDC C;  2L0P A;  4GPL B;  1XVJ A;  1K9U A;  1KK7 Z;  4F0Z B;  2QEO A;  2OTG B;  4INW A;  5FI7 A;  3VRP A;  2WCE A;  1OZS A;  2WCB A;  1ZOT B;  3CR2 A;  1CDM A;  2BCX A;  3AKA A;  1FBV A;  3BFH A;  3IVT A;  1J7Q A;  3S0G A;  2MJW B;  1CNP A;  3DVK A;  2JWW A;  2JNX A;  1LXF C;  1OOG A;  1NX3 A;  3BOW B;  4QJ4 B;  1FI5 A;  2JU0 A;  4NDC A;  1IH0 A;  2WC8 A;  2GTE A;  2WCF A;  5I2L A;  1YX7 A;  3I5H C;  2F3Y A;  1H4B A;  1MR8 A;  2OS8 B;  1EG4 A;  2ZRS A;  2M9G A;  1TN4 A;  2KPH A;  1BLQ A;  4BY5 A;  5ER4 X;  3S0E A;  1MQ1 A;  4CFR A;  3BFA A;  1XFW O;  2LVV A;  4M2Q A;  1J7O A;  3OX5 A;  1J1E A;  1NSH A;  1B4C A;  3JVT C;  3JVT B;  3QME A;  4IL1 A;  3PM2 A;  2JXC A;  3FE8 A;  1TRF A;  3LLE A;  4P5O E;  2NZ0 A;  2NLN A;  3SG3 A;  3D10 A;  2Y5I A;  3CLN A;  2LE9 B;  4NQG A;  3EVV A;  5KSZ A;  2K61 A;  1IRJ A;  1F4Q A;  2M29 A;  1KFX S;  3KF9 A;  4GFT A;  1QX2 A;  1L2O C;  1XYD A;  1SL8 A;  2QEH A;  3O4X A;  4OV2 A;  1YRT B;  1GGZ A;  1ZAC A;  4DCK A;  3SG6 A;  3GK2 A;  3K1E A;  4FQO A;  1M45 A; 
#chains in the Genus database with same CATH homology
 1ALW A;  4XJK B;  1UHI A;  2LP3 A;  1PVB A;  5JOL A;  3I5G C;  1J7P A;  1BF5 A;  3I5G B;  1JWD A;  1IKU A;  2KGB C;  5HLV A;  1KSM A;  1YUS A;  3HX4 A;  2KBI A;  1J1D A;  2L4I A;  3DVJ A;  2KBM A;  2QPT A;  1Y6W A;  1B8R A;  4CID A;  1DJZ A;  4TNC A;  2SCP A;  2P6B B;  4N5X A;  4OCI A;  1B8L A;  1NX2 A;  1YVL A;  2HET A;  2KI6 D;  2LAN A;  3EKH A;  2Y1M A;  4R1E A;  1DJX A;  1K93 D;  2KOT A;  2KGR A;  4I5N B;  1UUS A;  4CFQ A;  4MN0 A;  2ZN8 A;  1QAT A;  4ORB B;  1AHR A;  5TNC A;  1C7W A;  2MRD A;  1DJG A;  2JXL A;  1XK4 A;  2F2P A;  2K0J A;  3I5I C;  4PHM A;  5CSN A;  1QV0 A;  2TN4 A;  5D7F A;  5JJG A;  1CKK A;  4C0L A;  4ETO A;  1QVI Y;  1L7Z A;  1MXE A;  1CFD A;  1J7R A;  2FCE A;  1UUR A;  5AXI A;  1GQM A;  1SK6 D;  1KK8 B;  1SR6 C;  1XFV O;  2Y1N A;  1IGV A;  2I2R E;  2KI6 C;  2GV5 A;  2FOT A;  3O78 A;  2KAX A;  1SRA A;  5HKZ A;  1SNL A;  5D69 A;  3EVR A;  2ZKM X;  4HRH A;  2KSP A;  3FS7 A;  2LM5 A;  1Y1A A;  1BR4 B;  1N65 A;  2COL B;  4NDB A;  4BY4 A;  2G2B A;  5AEQ A;  2ZND A;  1DJW A;  1GGW A;  2LVK A;  3GOF A;  1FPW A;  2JRF A;  1Q80 A;  1EL4 A;  1QAS A;  2JTZ A;  1B7T Z;  1CFP A;  1XFZ O;  3O4Y A;  1PVA A;  2CT9 A;  2FCD A;  1IQ5 A;  4MVF A;  1KWO C;  1JSA A;  1DJH A;  1KQM C;  1F54 A;  3KEV A;  2KFH A;  5GQQ C;  1SYM A;  1DTL A;  3SIA A;  1TNP A;  3ZWH A;  1CM1 A;  5AER A;  3LCP C;  1EH2 A;  1BMO A;  1PSB A;  1MUX A;  1PAL A;  1RFJ A;  1V1G A;  1KQV A;  1PK0 D;  3I5F B;  2Q4U A;  1M63 B;  1S5G Y;  2H61 A;  2EC6 B;  4USL A;  1B9A A;  1ALV A;  2JUL A;  4GGF C;  2KNE A;  1UHH A;  2H2K A;  2M7N A;  1PSR A;  2JPT A;  2F33 A;  3JTD B;  2HPS A;  1KK7 Y;  2OTG C;  3PN7 B;  4JWQ A;  3SG7 A;  1G4Y R;  3RM1 A;  3SG5 A;  3DVE A;  2K2F A;  1A4P A;  1YTZ C;  3PLF B;  3EK4 A;  4MRY A;  5PAL A;  1AJ5 A;  1UHK A;  3O2P A;  2L5X B;  2OS8 C;  5K89 A;  4YGA A;  1BR1 B;  1MXL C;  3KHE A;  1Y0V H;  1NX0 A;  3C1V A;  1NIW A;  1DT7 B;  3TS5 B;  2NCP A;  2JTT A;  1OQP A;  2F8P A;  1YR5 A;  1NCZ A;  1N0Y A;  3BUX B;  1SCM B;  1CTR A;  2R2I A;  2EHB A;  2F2O A;  4DS7 A;  2KAY A;  2KFG A;  2BBN A;  2GGZ A;  2V53 A;  2LUC A;  1SW8 A;  2MLF C;  1AK8 A;  1BOC A;  3LK0 A;  1F55 A;  1K90 D;  1FI6 A;  3CR4 X;  4ORC B;  4CPV A;  1SMG A;  1PUL A;  1PRW A;  1KFU S;  1ODB A;  2Y4Q A;  1A03 A;  1NWD A;  1SKT A;  1SY9 A;  1LA3 A;  3IQQ A;  4YGE B;  2BBM A;  2HF5 A;  2JZI A;  3TDZ A;  1XK4 C;  1SBJ A;  1JBA A;  4HRG A;  1V1F A;  4JPZ B;  4YGB B;  2LV7 A;  1U5I B;  2I94 A;  2LP2 A;  4YGC B;  1UHN A;  5KU1 A;  1KCY A;  4AOM A;  2JNF A;  2O5G A;  1M31 A;  2K7C A;  2BCA A;  1WLM A;  1M46 A;  3CZT X;  4MSP A;  1YUT A;  1LA0 A;  4PCW A;  4C0J A;  2F3Z A;  3A8R A;  2K2A A;  3TDU A;  3BUO B;  3NSL A;  3PM8 A;  2IS9 A;  1OMD A;  1HQV A;  3PAL A;  1TCF A;  1CMG A;  4YRU A;  4PE0 A;  2KDH A;  2LC5 A;  3EKJ A;  1IQ3 A;  2HQW A;  3VRR A;  1CM4 A;  1OMV A;  2CNP A;  4UPG A;  1B8C A;  4GUK A;  1AVS A;  2PRU A;  4L9M A;  5AAN A;  1SL9 A;  1NCY A;  2M0R A;  2BEC A;  1MF8 B;  1QIW A;  2CTN A;  1BU3 A;  2LLT A;  2ZRT A;  3D0Y A;  1R2U A;  4JQ0 D;  1TTX A;  1U5I A;  2VRG A;  3OX6 A;  2G9B A;  1W7J B;  2PMY A;  1G33 A;  3BUW B;  3QRX A;  5DKN A;  1Y1U A;  1Y1X A;  1SPY A;  1QJT A;  1WRK A;  4MZL A;  2AAO A;  2L51 A;  3CWG A;  3FIA A;  5DKQ A;  1EXR A;  2AUC A;  2KFF A;  2ZNE A;  3ZNI A;  1KK8 C;  2ISD A;  1WLZ A;  4C0K A;  4HRE E;  3F45 A;  3TUY B;  4YI8 A;  3NSK A;  1G8I A;  4MRX A;  3RLZ A;  3DF0 A;  3TZ1 A;  4I5J A;  1D1O A;  2KAV A;  3AKB A;  3PFV A;  2MLE C;  4U8D A;  1CDP A;  5DKR A;  1K9K A;  2I18 A;  3FWB A;  1NCX A;  5CSI A;  1CB1 A;  1JF0 A;  3NSI A;  1F70 A;  1K94 A;  4YBH B;  4WRI A;  3EK7 A;  3OB2 B;  5KTY A;  2O60 A;  2BE6 A;  1FW4 A;  1B7T Y;  2M3W A;  1SL7 A;  1QXP A;  1WY9 A;  3WHU B;  1K2H A;  3MSE B;  2MHH A;  1NYA A;  2K8M B;  1QTX A;  1S1E A;  2E6W A;  3CS1 A;  1DMO A;  1H8B A;  1IWQ A;  1A75 B;  3O6B A;  2A4J A;  4DIR A;  4PE4 A;  2FJU B;  3GK1 A;  3H4S E;  1CDN A;  3I5F C;  3IQO A;  2EC6 C;  4MLW A;  1CFC A;  1REC A;  2BKI B;  1YVH A;  2K7D A;  2AMI A;  1RWY A;  4I5L B;  2LCP A;  1QLK A;  2KI4 B;  2PAS A;  2LLS A;  2SAS A;  2NXQ A;  1DJI A;  1UWO A;  3JTD C;  1B47 A;  3PN7 C;  4MZJ A;  4QJ5 B;  3IF7 A;  3GK4 X;  1TCO B;  5BPJ A;  1W7I B;  5B8I B;  3VRN A;  2JT3 A;  1MWN A;  2KHN A;  3NXA A;  1XFU O;  1OE9 B;  2L98 A;  4MEW A;  4MZK A;  1OZO A;  2MAZ A;  4GNK B;  1K8U A;  3EK8 A;  3HCM A;  4ORA B;  1S36 A;  1QIV A;  1EJ3 A;  1QV1 A;  1R6P A;  2LAP A;  3NSO A;  5HKW A;  1OSA A;  1KFX L;  4GAO A;  2JT8 A;  1A75 A;  1MHO A;  2LVI A;  1DF0 A;  2ZN9 A;  4M2P A;  4ZCU A;  1WDC B;  1QLS A;  1RJV A;  1RRO A;  4OKH A;  1C7V A;  2LUX A;  1YUR A;  2BCB A;  1IG5 A;  1XFX O;  2K7B A;  3TS5 C;  1RTP 1;  2M8U A;  2GGM A;  1F4O A;  1SCM C;  2M97 A;  3SJS A;  2B1U A;  2L50 A;  1JC2 A;  5ER5 A;  5CSF A;  3AAK A;  1CFF A;  3K21 A;  5I2O A;  4GGN A;  2I7A A;  2CXJ A;  4YI9 A;  3WNX B;  3VGO A;  4N1F A;  2HQ8 A;  4XYN A;  4PHK A;  3BUM B;  1M39 A;  1WRZ A;  3I5H B;  4M2O A;  1DVI A;  2LMT A;  4MBE A;  3EVU A;  2PVB A;  1RK9 A;  2BKH B;  5F6T A;  2NCO A;  4HSZ A;  4Q04 A;  4GGF A;  2KYF A;  3OP0 A;  3D0Y B;  3VRQ A;  4NDD A;  4FTG A;  3KO0 A;  4GBA A;  1F8H A;  1JFK A;  4AQI A;  3WXA A;  2M1U A;  4PHJ A;  2WND A;  3WHT B;  1IJ6 A;  1YX8 A;  1ZMZ A;  1NPQ A;  2DOQ A;  1S6C A;  1VRK A;  1TOP A;  1AJ4 A;  2E30 A;  1WRL A;  3BOW A;  1L2O B;  1CDL A;  3DVM A;  2BL0 C;  3PAT A;  3DF0 B;  2BL0 B;  1AUI B;  2CCM A;  4P2Y B;  3CR5 X;  3A4U B;  1AP4 A;  1K95 A;  1FF1 A;  5HYD A;  4QJ3 B;  1QS7 A;  3AAJ A;  4PE1 A;  5HLO A;  1CLB A;  2LNK A;  1DGV A;  2LMV A;  2K7O A;  4I5K A;  2MA2 A;  3FWC A;  1TNQ A;  4A4C A;  4ZCV A;  3LL8 B;  1QX7 A;  1A2X A;  1BT6 A;  1DGU A;  1XFY O;  3SIB A;  4AQJ A;  2LLU A;  1OOJ A;  3OB1 B;  2KQY A;  1ZUZ A;  3VRO A;  1CLL A;  3KPX A;  5CSJ A;  2LHI A;  5FYX A;  1CMF A;  1F71 A;  2CBL A;  3BYA A;  3DD4 A;  1SCV A;  5IBW A;  2KYC A;  1S26 D;  3TUY C;  4YGD B;  1B1G A;  1OMR A;  1HT9 A;  4OR9 B;  1GJY A;  2MBX A;  1CLM A;  4WQ2 A;  1C07 A;  2H61 C;  1TIZ A;  1YUU A;  1LKJ A;  2BE4 A;  1NUB A;  3BQ3 A;  4D1E A;  1E8A A;  2Q91 A;  2JT0 A;  2M7L A;  4XJK A;  5I8N A;  3I5I B;  3M0W A;  1N2D A;  1YRU B;  2ZFD A;  1EG3 A;  1QVI Z;  5G08 A;  5I2Q A;  5CPV A;  2PAL A;  1QX5 B;  1XO5 A;  3CTN A;  4A4B A;  1UHJ A;  4N1G A;  4PE7 A;  3E3R A;  4OVN F;  4DRW A;  1NP8 A;  1S6I A;  1SR6 B;  2PSR A;  2M1K B;  3SG2 A;  1DJY A;  1K96 A;  1BG1 A;  1DF0 B;  2L2E A;  4E68 A;  1JUO A;  1NX1 A;  2LHL A;  1A29 A;  1LVC D;  1J55 A;  2RGI A;  3CGA A;  3BXK A;  4PDZ A;  3BUN B;  1JF2 A;  1ZFS A;  2KI4 C;  2JC2 A;  2L4H A;  3PSR A;  1TNX A;  4PHN A;  1BJF A;  2LMU A;  4DUQ A;  3LK1 A;  2LVJ A;  1LIN A;  1X02 A;  3OHM B;  2KQ6 A;  1IJ5 A;  4PAL A;  1BOD A;  1JFJ A;  2JOJ A;  1XA5 A;  1KWO B;  3ICB A;  3TDI A;  1KQM B;  4CLN A;  2WOS A;  1KSO A;  5J3X A;  3SG4 A;  2D8N A;  2EGD A;  2M49 B;  2OPO A;  2WOR A;  5HKY A;  1S3P A;  1S6J A;  1KFU L;  4WQ3 A;  1S5G Z;  1K9P A;  2QAC A;  2JQ6 A;  1TNW A;  4ICB A;  1UP5 A;  1WDC C;  2L0P A;  4GPL B;  1XVJ A;  1K9U A;  1KK7 Z;  4F0Z B;  2OTG B;  3VRP A;  2WCE A;  1OZS A;  2WCB A;  1ZOT B;  3CR2 A;  1CDM A;  2BCX A;  3AKA A;  1FBV A;  1J7Q A;  2MJW B;  1CNP A;  3DVK A;  2JWW A;  2JNX A;  1LXF C;  1NX3 A;  3BOW B;  4QJ4 B;  1FI5 A;  2JU0 A;  4NDC A;  1IH0 A;  2WC8 A;  2WCF A;  5I2L A;  1YX7 A;  3I5H C;  2F3Y A;  1H4B A;  1MR8 A;  2OS8 B;  1EG4 A;  2ZRS A;  2M9G A;  1TN4 A;  1BLQ A;  4BY5 A;  5ER4 X;  1MQ1 A;  4CFR A;  1XFW O;  2LVV A;  4M2Q A;  1J7O A;  3OX5 A;  1J1E A;  1NSH A;  1B4C A;  3JVT C;  3JVT B;  4IL1 A;  2JXC A;  1TRF A;  3LLE A;  4P5O E;  2NZ0 A;  2NLN A;  3SG3 A;  3D10 A;  2Y5I A;  3CLN A;  2LE9 B;  4NQG A;  3EVV A;  5KSZ A;  2K61 A;  1IRJ A;  1F4Q A;  2M29 A;  1KFX S;  3KF9 A;  4GFT A;  1QX2 A;  1L2O C;  1XYD A;  1SL8 A;  4OV2 A;  1YRT B;  1GGZ A;  1ZAC A;  4DCK A;  3SG6 A;  3GK2 A;  5AFP A;  4FQO A;  1M45 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...