3D0YA

Crystal structure of s100b in the calcium and zinc loaded state at ph 6.5
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
89
structure length
89
Chain Sequence
SELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDNDGDGECDFQEFMAFVAMVTTACHEFFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein S100-B
publication title The crystal structures of human S100B in the zinc- and calcium-loaded state at three pH values reveal zinc ligand swapping.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal binding protein
total genus 33
structure length 89
sequence length 89
ec nomenclature
pdb deposition date 2008-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3d0yA00
2BKHB 1QXPA 5BPJA 1KWOC 1PSRA 1QX5B 4PE4A 1ODBA 1AJ5A 1JSAA 4GNKB 4HSZA 1J55A 2FCEA 1CDMA 2KOTA 2LUXA 1SL8A 3DD4A 1DJGA 1RROA 1DJZA 2ZFDA 3O6BA 4IL1A 2RGIA 4MRYA 3CGAA 1DT7B 1QX2A 2AAOA 2H61A 1AUIB 1XFWO 2GGZA 2Y1MA 2FOTA 4PHJA 2K61A 2WC8A 3DVEA 1CDNA 1BMOA 1J1DA 2HETA 4YRUA 1S6JA 5D7FA 4MVFA 1MQ1A 4YGCB 4HREE 1WRKA 2JNXA 2LMUA 3EK4A 1OMRA 2ZRSA 1FPWA 1UURA 4AOMA 5JOLA 1TTXA 2JU0A 1A29A 2KAXA 4OKHA 1QX7A 3TDUA 2LVKA 2LM5A 1BOCA 4USLA 4GGNA 1K2HA 2O60A 1SCMC 2OS8C 1CFFA 4HRHA 2ZNDA 3WNXB 2NXQA 2BECA 1BLQA 3LK1A 1FBVA 1XVJA 1A75A 2KNEA 3CWGA 2LAPA 4JWQA 1IQ3A 2H61C 2CXJA 1BT6A 1NPQA 3LCPC 3LL8B 2KFFA 2JPTA 1DJWA 2ISDA 1ALWA 2I7AA 1B7TY 1MXEA 1MWNA 3PN7B 2K2FA 1UHHA 2M97A 3DVKA 3O78A 3EKHA 4N1FA 1B8RA 2CT9A 3OB2B 1MXLC 1NUBA 1SW8A 2MLEC 1N65A 2AMIA 2FCDA 2KQ6A 2KSPA 1Y0VH 2BBNA 2LLTA 2MA2A 3NSOA 1DJIA 3TZ1A 3EVVA 1LINA 3SIBA 1CLMA 3KHEA 4DS7A 1F8HA 2KFGA 3CZTX 4QJ5B 1K9PA 2NCPA 1M45A 1RK9A 2BE4A 3IQOA 1DF0A 1UUSA 5HKYA 5CSJA 1TOPA 3OP0A 1NP8A 1TNPA 1S26D 1CDLA 1KK8B 1NCXA 1TNXA 2KBIA 4HRGA 1SL7A 5AANA 1YRUB 2AUCA 3IF7A 3FIAA 1EJ3A 1M31A 1ZACA 2M29A 2JZIA 4C0KA 2SCPA 1SRAA 4NQGA 3I5GB 3I5IC 3A8RA 1IWQA 3AKAA 1EG4A 5I8NA 1SBJA 1PVAA 1WRZA 4FTGA 1EL4A 1M46A 3BQ3A 2LP2A 4N5XA 2KYCA 3AKBA 1L7ZA 1KQMC 3VGOA 1H4BA 3LLEA 2LMVA 2OTGC 4ICBA 1M63B 3GK4X 1QIWA 1YUTA 2KI6D 1RTP1 1KFUS 3CR2A 1DF0B 3DVMA 4ZCUA 3GK1A 2KI4B 1ZMZA 1QV1A 1WDCB 3JVTC 1A03A 1C7VA 1GGWA 1KSOA 5HYDA 2SASA 3LK0A 3PSRA 2I2RE 1J1EA 4ORAB 4OVNF 1CLBA 2JOJA 1CFDA 2L4HA 2Y5IA 4CLNA 1Y1UA 2PASA 1NX1A 3NXAA 3BUNB 1J7RA 4XJKA 3I5FB 1TCOB 2LC5A 4JQ0D 2L4IA 5I2LA 5I2OA 1UP5A 2FJUB 2KBMA 1E8AA 2Q91A 3GK2A 1J7PA 5G08A 2Y4QA 3WHUB 2WORA 4C0LA 2K7DA 1BF5A 5KU1A 4OR9B 4DCKA 3QRXA 1KSMA 1BJFA 2Q4UA 1OSAA 1C07A 1K96A 3CR5X 1DVIA 1IQ5A 1YX7A 3DVJA 1NCZA 4PCWA 3PLFB 1OZOA 1IKUA 1SMGA 1NX3A 1HQVA 4GUKA 2JTTA 1WRLA 4GAOA 1QASA 2LLSA 4E68A 5DKQA 2KFHA 2NCOA 3ICBA 1K9KA 1YX8A 2L0PA 5CSFA 3BOWB 1S36A 1RWYA 1QATA 1XYDA 1LA0A 1IRJA 1DTLA 5AERA 3VROA 4P5OE 2R2IA 3VRQA 3KF9A 4ZCVA 2MJWB 3CR4X 1SY9A 2KAYA 2PMYA 2E30A 1CFPA 4P2YB 3D0YA 2M8UA 4M2QA 2KYFA 1EG3A 2PRUA 1QLSA 4XJKB 1QJTA 3MSEB 2F2OA 4FQOA 1K90D 2GGMA 4MBEA 1Y6WA 1CM1A 1NX0A 1MUXA 1D1OA 3PM8A 1JF2A 1X02A 2BKIB 2L50A 1OMDA 3PN7C 2DOQA 3OB1B 2WNDA 4PE7A 3DF0A 2GV5A 1SL9A 1L2OB 2HF5A 2LVIA 3E3RA 1AK8A 1PALA 3BUMB 1FI6A 1ALVA 2MAZA 4M2OA 4MSPA 1IJ6A 4WQ3A 3BYAA 3PALA 4YI8A 1SKTA 2L2EA 2KGBC 1KK8C 5DKRA 1LXFC 2LE9B 2HQ8A 2LMTA 3TUYB 2WCEA 3A4UB 3VRRA 1F54A 2EC6B 2K7CA 2KAVA 3JTDB 3K21A 4GPLB 4MN0A 1JWDA 1G8IA 1TIZA 1CM4A 3I5GC 1WLZA 1MR8A 2L98A 5CPVA 2F8PA 4CIDA 3D0YB 2V53A 1SNLA 2F2PA 4PALA 5ER4X 5HLVA 2K7BA 5FYXA 4D1EA 1S6CA 1YUSA 2E6WA 1AJ4A 2L5XB 3HCMA 4PDZA 3CS1A 4YGAA 1XFYO 3TS5B 1C7WA 1PK0D 2KDHA 1YTZC 4L9MA 3TDIA 1YVHA 2NLNA 4WQ2A 3DF0B 2HQWA 4I5NB 1KFXL 3M0WA 1UWOA 1IH0A 1J7QA 2M7NA 2BCAA 2JTZA 3SG2A 2F33A 2KQYA 2CCMA 2LVJA 4YGEB 1TNQA 1JFJA 1IGVA 2KI4C 1WDCC 4PE0A 1NSHA 4JPZB 4ETOA 1BODA 3VRNA 1M39A 2WCBA 3BOWA 5TNCA 1N0YA 3O4YA 1IJ5A 1QVIZ 1U5IB 2JQ6A 2M1KB 1B8CA 2H2KA 2NZ0A 4CPVA 1KCYA 1K95A 2BCXA 5CSIA 3CTNA 4MEWA 1RJVA 1V1GA 2P6BB 3I5FC 4F0ZB 1XFVO 1F55A 4GBAA 4OV2A 2WOSA 1FF1A 3I5HB 2A4JA 2M3WA 1CLLA 3SG7A 4I5LB 2M0RA 2PVBA 3EVUA 4NDDA 5GQQC 1XK4A 5I2QA 3ZWHA 1SR6B 3OX5A 1QS7A 1PRWA 2B1UA 2BE6A 4ORCB 3O2PA 4NDBA 3EKJA 2LANA 1A2XA 2ZNEA 3SG4A 2K2AA 3EVRA 1S5GZ 3KPXA 1F70A 1G4YR 1OE9B 4I5KA 1DJYA 1QLKA 1YRTB 3RLZA 1NCYA 1OZSA 1QV0A 2LV7A 2M9GA 1WLMA 3BUWB 2BL0B 4DIRA 1TCFA 2L51A 1AVSA 1R2UA 2VRGA 4MLWA 1S6IA 4YBHB 3WXAA 4DUQA 1ZFSA 1DJHA 2KGRA 1KK7Z 1UHKA 4MZKA 1GGZA 4PHKA 3KO0A 1XFUO 3BXKA 2MLFC 3SG6A 4Q04A 2ZN8A 4MZLA 4YGBB 1XK4C 4PE1A 4GGFA 5J3XA 1OQPA 1S3PA 2K7OA 2LVVA 1EXRA 5HKZA 1DGUA 3NSKA 5F6TA 2JWWA 2OPOA 1IG5A 4QJ4B 2ZKMX 1FI5A 1JBAA 2JULA 3PFVA 1CMGA 1N2DA 2QPTA 3NSLA 1KWOB 1PSBA 1UHJA 1XFZO 2F3ZA 1LKJA 2F3YA 1JC2A 1L2OC 2D8NA 3SG5A 2QACA 1CKKA 3GOFA 2KHNA 2KI6C 2JT0A 2LCPA 3IQQA 2BBMA 4M2PA 2HPSA 1QTXA 1Y1AA 1SPYA 1UHIA 2MHHA 2I94A 2LNKA 3CLNA 1UHNA 2EGDA 2M1UA 1ZOTB 2LUCA 2G9BA 4GGFC 3TUYC 3TDZA 2EC6C 3JTDC 1K9UA 4GFTA 1B4CA 4UPGA 5ER5A 1XFXO 1A4PA 2JT8A 5KSZA 1NYAA 1B47A 1Q80A 3HX4A 5KTYA 1TRFA 3OHMB 1QVIY 1SK6D 1CMFA 1K93D 4BY5A 2JT3A 2O5GA 3VRPA 1B8LA 1U5IA 2CNPA 2MRDA 2LHLA 1F4OA 2COLB 5AEQA 4A4BA 3AAJA 1BG1A 4C0JA 1NIWA 3KEVA 5D69A 1BU3A 3C1VA 1SCMB 2OS8B 3OX6A 4PHMA 1EH2A 3BUOB 3EK7A 3TS5C 4MZJA 1KFUL 1K94A 2TN4A 3EK8A 3FWBA 1WY9A 2JC2A 4AQIA 1CDPA 1YUUA 5DKNA 1J7OA 2JXLA 4YI9A 1JF0A 1RECA 1B1GA 1S5GY 1DGVA 1YVLA 3PATA 1RFJA 3F45A 1LA3A 4XYNA 1B9AA 1JUOA 4NDCA 1BR1B 2CTNA 4WRIA 1YR5A 1HT9A 3SG3A 2ZRTA 1GQMA 2I18A 1SCVA 1NWDA 4U8DA 4N1GA 2JXCA 5B8IB 5AXIA 2PALA 4CFQA 3D10A 3FWCA 1KK7Y 1XA5A 1CTRA 1PVBA 2M49B 4TNCA 4ORBB 4YGDB 1NX2A 5AFPA 3I5HC 4PHNA 4QJ3B 4DRWA 2LLUA 5HKWA 2ZN9A 3SIAA 3WHTB 1CFCA 1A75B 1SYMA 2Y1NA 2M7LA 1PULA 1BR4B 1TNWA 1OOJA 1SR6C 1K8UA 5PALA 1TN4A 2K8MB 5JJGA 3RM1A 2JRFA 3I5IB 4OCIA 1ZUZA 3AAKA 4A4CA 1B7TZ 1JFKA 1AP4A 4R1EA 1MHOA 1DJXA 2MBXA 4MRXA 1GJYA 2BL0C 2IS9A 1CNPA 1YURA 1AHRA 1W7JB 1KQMB 1MF8B 5HLOA 3FS7A 1W7IB 1XO5A 2LP3A 1F4QA 2OTGB 3H4SE 4BY4A 3NSIA 2BCBA 1FW4A 2EHBA 1F71A 1G33A 1LVCD 5CSNA 2JNFA 2G2BA 1V1FA 1KQVA 1DMOA 3BUXB 1VRKA 4I5JA 1QIVA 1OMVA 1Y1XA 2LHIA 5K89A 1CB1A 2PSRA 2WCFA 1R6PA 3SJSA 5IBWA 1H8BA 3JVTB 1S1EA 4AQJA 1KFXS 4CFRA 2K0JA 2CBLA 3ZNIA
chains in the Genus database with same CATH superfamily
2BKHB 1QXPA 5BPJA 3PJIA 1KWOC 1PSRA 1QX5B 4PE4A 1ODBA 3SS4A 1AJ5A 1TUJA 1JSAA 4GNKB 4HSZA 1J55A 2FCEA 1CDMA 2KOTA 2LUXA 1SL8A 3DD4A 2H8VA 1DJGA 1RROA 1DJZA 2ZFDA 3O6BA 4IL1A 2RGIA 4MRYA 3CGAA 1DT7B 1QX2A 2AAOA 2H61A 1AUIB 1XFWO 2GGZA 2Y1MA 2FOTA 4PHJA 2K61A 2WC8A 3DVEA 1CDNA 1BMOA 1J1DA 2HETA 4YRUA 1S6JA 5D7FA 4MVFA 1MQ1A 4YGCB 4HREE 1WRKA 2JNXA 2LMUA 3EK4A 1OMRA 2ZRSA 5HL1A 1FPWA 1UURA 4AOMA 5JOLA 1TTXA 2JU0A 1A29A 2KAXA 4OKHA 1QX7A 3TDUA 2LVKA 2LM5A 1BOCA 4USLA 4GGNA 1K2HA 2O60A 1SCMC 2OS8C 1CFFA 4HRHA 2ZNDA 3WNXB 2NXQA 2BECA 5D3OA 1BLQA 1W9ZA 3LK1A 1FBVA 1XVJA 1A75A 2KNEA 3CWGA 2LAPA 4JWQA 1IQ3A 2H61C 2CXJA 1BT6A 1NPQA 3LCPC 3LL8B 2P71A 2KFFA 2WCKA 2JPTA 1DJWA 2ISDA 1ALWA 2QEOA 2I7AA 1B7TY 1MXEA 1MWNA 3PN7B 2K2FA 3S0AA 1UHHA 2M97A 3DVKA 3O78A 3EKHA 4N1FA 3S0FA 1B8RA 2CT9A 3BFBA 3OB2B 1MXLC 1NUBA 1SW8A 2MLEC 1N65A 2AMIA 3DY9A 2FCDA 2KQ6A 2KSPA 1Y0VH 2BBNA 2LLTA 2MA2A 3NSOA 1DJIA 3TZ1A 3EVVA 1LINA 3SIBA 1CLMA 3KHEA 4DS7A 1TWOA 1F8HA 2KFGA 3CZTX 4QJ5B 1K9PA 2NCPA 1M45A 1RK9A 2BE4A 3IQOA 1DF0A 3S0BA 1UUSA 5HKYA 5CSJA 1TOPA 3K1EA 3OP0A 1NP8A 1TNPA 1S26D 1CDLA 1KK8B 1NCXA 1TNXA 2KBIA 4HRGA 1SL7A 5AANA 1YRUB 1DELA 2AUCA 3IF7A 3FIAA 1EJ3A 1M31A 1ZACA 2M29A 3CABA 2JZIA 3B88A 4C0KA 2SCPA 1SRAA 5DICA 4NQGA 3I5GB 3I5IC 1IIOA 3A8RA 1IWQA 3AKAA 1EG4A 5I8NA 1SBJA 1C3YA 1PVAA 1WRZA 3NHIA 4FTGA 1EL4A 1M46A 3SS3A 3BQ3A 2LP2A 4N5XA 2KYCA 3AKBA 1L7ZA 1KQMC 3VGOA 1H4BA 3LLEA 2LMVA 2OTGC 4ICBA 5EL2A 3L47A 1M63B 2WC6A 3GK4X 2L2CA 1QIWA 1YUTA 2KI6D 1RTP1 1KFUS 3Q8IA 3CR2A 1DF0B 3DVMA 1DC1A 4OZDA 1DQEA 4ZCUA 3GK1A 1LS8A 1ZMZA 2KI4B 1QV1A 1WDCB 2QEVA 3JVTC 1A03A 1C7VA 1GGWA 1KSOA 5HYDA 2WCJA 2SASA 3LK0A 3PSRA 2I2RE 1J1EA 4ORAB 4OVNF 1CLBA 2JOJA 1CFDA 2L4HA 2Y5IA 3R1OA 4CLNA 1Y1UA 2PASA 1XFRA 1NX1A 3NXAA 3BUNB 1J7RA 3BFAA 3I5FB 4XJKA 1TCOB 2LC5A 4JQ0D 2L4IA 5I2LA 5I2OA 1UP5A 2FJUB 2KBMA 1E8AA 2Q91A 3GK2A 1J7PA 5G08A 2Y4QA 3WHUB 2WORA 3IVTA 2K7DA 4C0LA 1BF5A 5KU1A 4OR9B 4DCKA 3QRXA 1KSMA 1BJFA 2ERBA 2Q4UA 1OSAA 3R1VA 1C07A 1K96A 3CR5X 1DVIA 1IQ5A 1YX7A 3DVJA 1NCZA 4PCWA 3PLFB 1OZOA 1IKUA 1SMGA 1NX3A 1HQVA 4GUKA 2JTTA 1WRLA 4GAOA 1QASA 2LLSA 4E68A 5DKQA 2KFHA 2NCOA 3ICBA 1K9KA 1YX8A 2L0PA 5CSFA 3B6XA 3BOWB 1S36A 1RWYA 3S0DA 1XYDA 1QATA 1LA0A 1IRJA 1DTLA 5AERA 3V2LA 3VROA 3UO9A 4P5OE 2R2IA 3VRQA 3KF9A 4ZCVA 2MJWB 3CR4X 1SY9A 2KAYA 2PMYA 2E30A 1CFPA 4P2YB 3D0YA 2M8UA 4M2QA 2KYFA 2WCLA 1EG3A 2PRUA 1QLSA 4XJKB 1QJTA 3MSEB 2F2OA 4FQOA 1K90D 2GGMA 4MBEA 3RZSA 1Y6WA 1CM1A 1NX0A 1MUXA 1OOHA 1GM0A 1D1OA 3PM8A 1JF2A 1X02A 2BKIB 2L50A 1OMDA 3PN7C 3FE8A 2DOQA 3OB1B 3L4LA 2WNDA 4PE7A 3D78A 3DF0A 2GV5A 1SL9A 3R72A 1L2OB 2HF5A 2LVIA 3E3RA 1AK8A 1PALA 3BUMB 1FI6A 1ALVA 2MAZA 4M2OA 4MSPA 1IJ6A 4WQ3A 3BYAA 3PALA 4YI8A 1SKTA 2L2EA 2KGBC 1KK8C 5DKRA 1LXFC 1Z4HA 2LE9B 2HQ8A 2LMTA 2PQLA 2WCEA 3A4UB 3TUYB 3VRRA 2EC6B 2K7CA 2KAVA 3JTDB 1ORGA 3K21A 4GPLB 4MN0A 1JWDA 1Z2CB 1G8IA 1TIZA 1CM4A 1P28A 2QEHA 3I5GC 1WLZA 1MR8A 2L98A 5CPVA 2F8PA 4CIDA 4IJ7A 3D0YB 2V53A 1SNLA 2F2PA 4PALA 5ER4X 2PYQA 4JKTA 1C3ZA 5HLVA 2K7BA 5FYXA 4D1EA 2GTEA 3CYZA 1S6CA 1YUSA 2E6WA 1AJ4A 2L5XB 3HCMA 4PDZA 3CS1A 4YGAA 1XFYO 3TS5B 1C7WA 1PK0D 2KDHA 1YTZC 4L9MA 3TDIA 1YVHA 2NLNA 4WQ2A 3DF0B 2BNXA 2HQWA 4I5NB 1KFXL 3M0WA 1UWOA 1IH0A 1J7QA 2M7NA 1QWVA 2BCAA 2JTZA 2KLDA 2F33A 2KQYA 3SG2A 3DZTA 2CCMA 2LVJA 1TUZA 4PT1A 1TNQA 4YGEB 1JFJA 1IGVA 2KI4C 1WDCC 4PE0A 1NSHA 4JPZB 4ETOA 1BODA 3VRNA 1M39A 2WCBA 3BOWA 5TNCA 1N0YA 3O4YA 1IJ5A 1QVIZ 1U5IB 2JQ6A 2M1KB 1B8CA 2H2KA 2NZ0A 3BJHA 4CPVA 1KCYA 1K95A 2BCXA 5CSIA 3CTNA 4MEWA 1RJVA 1V1GA 2P6BB 3I5FC 4F0ZB 1XFVO 1F55A 4GBAA 4OV2A 2WOSA 1FF1A 3I5HB 2A4JA 2M3WA 1CLLA 3SG7A 4I5LB 2M0RA 2PVBA 3EVUA 4NDDA 5GQQC 2L5YA 1XK4A 5I2QA 3ZWHA 1SR6B 3B87A 3D74A 3OX5A 1QS7A 1PRWA 2B1UA 1OOIX 2BE6A 4ORCB 5FI6A 3O2PA 4NDBA 3EKJA 2LANA 1A2XA 2ZNEA 1OW4A 3SG4A 2K2AA 3EVRA 1S5GZ 1T14A 3KPXA 1F70A 1G4YR 1OE9B 4I5KA 1DJYA 1QLKA 1YRTB 3RLZA 1NCYA 3O4XA 3NGVA 1OZSA 1QV0A 2LV7A 2M9GA 1WLMA 3BUWB 2BL0B 4DIRA 1TCFA 2L51A 2QEBA 1AVSA 1R2UA 2VRGA 4JD9A 4MLWA 1S6IA 4YBHB 3WXAA 3QMEA 4INWA 4DUQA 3UNWA 1ZFSA 1DJHA 2KGRA 1KK7Z 1UHKA 3OGNA 4MZKA 1GGZA 4PHKA 3KO0A 1XFUO 3BXKA 2JPOA 2MLFC 3FE6A 3S0EA 2YGUA 3SG6A 3SS5A 4Q04A 2ZN8A 2WCMA 4MZLA 4YGBB 1XK4C 3D75A 4PE1A 4GGFA 5J3XA 1OQPA 1S3PA 2K7OA 2LVVA 1EXRA 5HKZA 1DGUA 3NSKA 5F6TA 2JWWA 2OPOA 1IG5A 4QJ4B 2ZKMX 3D77A 1FI5A 1JBAA 3CZ0A 2JULA 3PFVA 1CMGA 1N2DA 2QPTA 4F7FA 3NSLA 1KWOB 1PSBA 4KYNA 1UHJA 1XFZO 2F3ZA 1LKJA 2F3YA 1JC2A 1L2OC 2D8NA 3SG5A 2QACA 1CKKA 3CDNA 3GOFA 2KHNA 2KI6C 2JT0A 2LCPA 2P70A 2BBMA 3IQQA 4M2PA 3NHTA 2HPSA 1QTXA 5I94A 1Y1AA 3OBVA 1OOGA 1SPYA 1UHIA 2BAPA 2I94A 2LNKA 2MHHA 3CLNA 1UHNA 2EGDA 2M1UA 1ZOTB 2LUCA 2G9BA 4GGFC 5FI2A 3TDZA 2EC6C 3JTDC 1K9UA 4GFTA 3TUYC 1B4CA 4UPGA 5ER5A 2KPHA 1XFXO 1A4PA 2JT8A 5KSZA 1DEKA 1NYAA 1B47A 1Q80A 3HX4A 5KTYA 1TRFA 3OHMB 1QVIY 1SK6D 1CMFA 1K93D 4BY5A 2JT3A 2O5GA 3VRPA 1B8LA 1U5IA 2CNPA 2MRDA 2LHLA 1F4OA 2COLB 5AEQA 4A4BA 2WC5A 3AAJA 1BG1A 4C0JA 1NIWA 3KEVA 5D69A 1BU3A 3C1VA 2FJYA 1SCMB 2OS8B 3OX6A 4PHMA 5FI7A 1EH2A 3PM2A 3BUOB 3EK7A 3TS5C 4MZJA 1KFUL 1K94A 2TN4A 3EK8A 3FWBA 1WY9A 2JC2A 4AQIA 1CDPA 1YUUA 5DKNA 1J7OA 3B86A 2JXLA 1SSEB 4YI9A 1F54A 1JF0A 1RECA 1B1GA 1S5GY 1DGVA 1YVLA 3PATA 1RFJA 3F45A 1LA3A 4XYNA 1B9AA 1JUOA 4NDCA 1BR1B 2CTNA 4WRIA 1YR5A 1HT9A 3SG3A 2WCHA 1GQMA 2KLEA 2ZRTA 3FE9A 2I18A 3DXLA 1SCVA 1NWDA 4U8DA 4N1GA 2JXCA 4INXA 5B8IB 5AXIA 2PALA 4CFQA 3D10A 3FWCA 1KK7Y 1XA5A 1CTRA 1PVBA 2M49B 4TNCA 4ORBB 4YGDB 1NX2A 5AFPA 3I5HC 4PHNA 4QJ3B 4DRWA 2LLUA 5HKWA 2ZN9A 3SIAA 3WHTB 1CFCA 1A75B 1SYMA 2Y1NA 2M7LA 1PULA 1BR4B 1TNWA 1OOJA 1SR6C 1K8UA 5PALA 1TN4A 2K8MB 5JJGA 3VB1A 3B7AA 3RM1A 2JRFA 4FQTA 3CZ1A 3I5IB 3N7HA 4OCIA 1ZUZA 3AAKA 4A4CA 1B7TZ 1JFKA 1AP4A 3D76A 4R1EA 1MHOA 1DJXA 2MBXA 4MRXA 1GJYA 2BL0C 2IS9A 3BFHA 1CNPA 1OOFA 1YURA 1AHRA 1W7JB 1KQMB 1MF8B 5HLOA 3FS7A 1W7IB 1XO5A 2LP3A 3S0GA 1F4QA 2OTGB 3H4SE 3L4AA 3NSIA 4BY4A 2BCBA 2K60A 1FW4A 2EHBA 1F71A 1G33A 1LVCD 3EG5B 5CSNA 2JNFA 2G2BA 1V1FA 1KQVA 1DMOA 3DYEA 3BUXB 1VRKA 4I5JA 1QIVA 1OMVA 1Y1XA 3R1PA 2LHIA 5K89A 1CB1A 2PSRA 2WCFA 1R6PA 3SJSA 5IBWA 1H8BA 3JVTB 3D73A 1S1EA 4AQJA 1KFXS 4CFRA 3CZ2A 2QDIA 2K0JA 2CBLA 3ZNIA
chains in the Genus database with same CATH topology
2BKHB 1QXPA 5BPJA 1KWOC 1PSRA 1QX5B 4PE4A 1ODBA 1AJ5A 1JSAA 4GNKB 4HSZA 1J55A 2FCEA 1CDMA 2KOTA 2LUXA 1SL8A 3DD4A 1DJGA 1RROA 1DJZA 2ZFDA 3O6BA 4IL1A 2RGIA 4MRYA 3CGAA 1DT7B 1QX2A 2AAOA 2H61A 1AUIB 1XFWO 2GGZA 2Y1MA 2FOTA 4PHJA 2K61A 2WC8A 3DVEA 1CDNA 1BMOA 1J1DA 2HETA 4YRUA 1S6JA 5D7FA 4MVFA 1MQ1A 4YGCB 4HREE 1WRKA 2JNXA 2LMUA 3EK4A 1OMRA 2ZRSA 1FPWA 1UURA 4AOMA 5JOLA 1TTXA 2JU0A 1A29A 2KAXA 4OKHA 1QX7A 3TDUA 2LVKA 2LM5A 1BOCA 4USLA 4GGNA 1K2HA 2O60A 1SCMC 2OS8C 1CFFA 4HRHA 2ZNDA 3WNXB 2NXQA 2BECA 1BLQA 3LK1A 1FBVA 1XVJA 1A75A 2KNEA 3CWGA 2LAPA 4JWQA 1IQ3A 2H61C 2CXJA 1BT6A 1NPQA 3LCPC 3LL8B 2KFFA 2JPTA 1DJWA 2ISDA 1ALWA 2I7AA 1B7TY 1MXEA 1MWNA 3PN7B 2K2FA 1UHHA 2M97A 3DVKA 3O78A 3EKHA 4N1FA 1B8RA 2CT9A 3OB2B 1MXLC 1NUBA 1SW8A 2MLEC 1N65A 2AMIA 2FCDA 2KQ6A 2KSPA 1Y0VH 2BBNA 2LLTA 2MA2A 3NSOA 1DJIA 3TZ1A 3EVVA 1LINA 3SIBA 1CLMA 3KHEA 4DS7A 1F8HA 2KFGA 3CZTX 4QJ5B 1K9PA 2NCPA 1M45A 1RK9A 2BE4A 3IQOA 1DF0A 1UUSA 5HKYA 5CSJA 1TOPA 3OP0A 1NP8A 1TNPA 1S26D 1CDLA 1KK8B 1NCXA 1TNXA 2KBIA 4HRGA 1SL7A 5AANA 1YRUB 2AUCA 3IF7A 3FIAA 1EJ3A 1M31A 1ZACA 2M29A 2JZIA 4C0KA 2SCPA 1SRAA 4NQGA 3I5GB 3I5IC 3A8RA 1IWQA 3AKAA 1EG4A 5I8NA 1SBJA 1PVAA 1WRZA 4FTGA 1EL4A 1M46A 3BQ3A 2LP2A 4N5XA 2KYCA 3AKBA 1L7ZA 1KQMC 3VGOA 1H4BA 3LLEA 2LMVA 2OTGC 4ICBA 1M63B 3GK4X 1QIWA 1YUTA 2KI6D 1RTP1 1KFUS 3CR2A 1DF0B 3DVMA 4ZCUA 3GK1A 2KI4B 1ZMZA 1QV1A 1WDCB 3JVTC 1A03A 1C7VA 1GGWA 1KSOA 5HYDA 2SASA 3LK0A 3PSRA 2I2RE 1J1EA 4ORAB 4OVNF 1CLBA 2JOJA 1CFDA 2L4HA 2Y5IA 4CLNA 1Y1UA 2PASA 1NX1A 3NXAA 3BUNB 1J7RA 4XJKA 3I5FB 1TCOB 2LC5A 4JQ0D 2L4IA 5I2LA 5I2OA 1UP5A 2FJUB 2KBMA 1E8AA 2Q91A 3GK2A 1J7PA 5G08A 2Y4QA 3WHUB 2WORA 4C0LA 2K7DA 1BF5A 5KU1A 4OR9B 4DCKA 3QRXA 1KSMA 1BJFA 2Q4UA 1OSAA 1C07A 1K96A 3CR5X 1DVIA 1IQ5A 1YX7A 3DVJA 1NCZA 4PCWA 3PLFB 1OZOA 1IKUA 1SMGA 1NX3A 1HQVA 4GUKA 2JTTA 1WRLA 4GAOA 1QASA 2LLSA 4E68A 5DKQA 2KFHA 2NCOA 3ICBA 1K9KA 1YX8A 2L0PA 5CSFA 3BOWB 1S36A 1RWYA 1QATA 1XYDA 1LA0A 1IRJA 1DTLA 5AERA 3VROA 4P5OE 2R2IA 3VRQA 3KF9A 4ZCVA 2MJWB 3CR4X 1SY9A 2KAYA 2PMYA 2E30A 1CFPA 4P2YB 3D0YA 2M8UA 4M2QA 2KYFA 1EG3A 2PRUA 1QLSA 4XJKB 1QJTA 3MSEB 2F2OA 4FQOA 1K90D 2GGMA 4MBEA 1Y6WA 1CM1A 1NX0A 1MUXA 1D1OA 3PM8A 1JF2A 1X02A 2BKIB 2L50A 1OMDA 3PN7C 2DOQA 3OB1B 2WNDA 4PE7A 3DF0A 2GV5A 1SL9A 1L2OB 2HF5A 2LVIA 3E3RA 1AK8A 1PALA 3BUMB 1FI6A 1ALVA 2MAZA 4M2OA 4MSPA 1IJ6A 4WQ3A 3BYAA 3PALA 4YI8A 1SKTA 2L2EA 2KGBC 1KK8C 5DKRA 1LXFC 2LE9B 2HQ8A 2LMTA 3TUYB 2WCEA 3A4UB 3VRRA 1F54A 2EC6B 2K7CA 2KAVA 3JTDB 3K21A 4GPLB 4MN0A 1JWDA 1G8IA 1TIZA 1CM4A 3I5GC 1WLZA 1MR8A 2L98A 5CPVA 2F8PA 4CIDA 3D0YB 2V53A 1SNLA 2F2PA 4PALA 5ER4X 5HLVA 2K7BA 5FYXA 4D1EA 1S6CA 1YUSA 2E6WA 1AJ4A 2L5XB 3HCMA 4PDZA 3CS1A 4YGAA 1XFYO 3TS5B 1C7WA 1PK0D 2KDHA 1YTZC 4L9MA 3TDIA 1YVHA 2NLNA 4WQ2A 3DF0B 2HQWA 4I5NB 1KFXL 3M0WA 1UWOA 1IH0A 1J7QA 2M7NA 2BCAA 2JTZA 3SG2A 2F33A 2KQYA 2CCMA 2LVJA 4YGEB 1TNQA 1JFJA 1IGVA 2KI4C 1WDCC 4PE0A 1NSHA 4JPZB 4ETOA 1BODA 3VRNA 1M39A 2WCBA 3BOWA 5TNCA 1N0YA 3O4YA 1IJ5A 1QVIZ 1U5IB 2JQ6A 2M1KB 1B8CA 2H2KA 2NZ0A 4CPVA 1KCYA 1K95A 2BCXA 5CSIA 3CTNA 4MEWA 1RJVA 1V1GA 2P6BB 3I5FC 4F0ZB 1XFVO 1F55A 4GBAA 4OV2A 2WOSA 1FF1A 3I5HB 2A4JA 2M3WA 1CLLA 3SG7A 4I5LB 2M0RA 2PVBA 3EVUA 4NDDA 5GQQC 1XK4A 5I2QA 3ZWHA 1SR6B 3OX5A 1QS7A 1PRWA 2B1UA 2BE6A 4ORCB 3O2PA 4NDBA 3EKJA 2LANA 1A2XA 2ZNEA 3SG4A 2K2AA 3EVRA 1S5GZ 3KPXA 1F70A 1G4YR 1OE9B 4I5KA 1DJYA 1QLKA 1YRTB 3RLZA 1NCYA 1OZSA 1QV0A 2LV7A 2M9GA 1WLMA 3BUWB 2BL0B 4DIRA 1TCFA 2L51A 1AVSA 1R2UA 2VRGA 4MLWA 1S6IA 4YBHB 3WXAA 4DUQA 1ZFSA 1DJHA 2KGRA 1KK7Z 1UHKA 4MZKA 1GGZA 4PHKA 3KO0A 1XFUO 3BXKA 2MLFC 3SG6A 4Q04A 2ZN8A 4MZLA 4YGBB 1XK4C 4PE1A 4GGFA 5J3XA 1OQPA 1S3PA 2K7OA 2LVVA 1EXRA 5HKZA 1DGUA 3NSKA 5F6TA 2JWWA 2OPOA 1IG5A 4QJ4B 2ZKMX 1FI5A 1JBAA 2JULA 3PFVA 1CMGA 1N2DA 2QPTA 3NSLA 1KWOB 1PSBA 1UHJA 1XFZO 2F3ZA 1LKJA 2F3YA 1JC2A 1L2OC 2D8NA 3SG5A 2QACA 1CKKA 3GOFA 2KHNA 2KI6C 2JT0A 2LCPA 3IQQA 2BBMA 4M2PA 2HPSA 1QTXA 1Y1AA 1SPYA 1UHIA 2MHHA 2I94A 2LNKA 3CLNA 1UHNA 2EGDA 2M1UA 1ZOTB 2LUCA 2G9BA 4GGFC 3TUYC 3TDZA 2EC6C 3JTDC 1K9UA 4GFTA 1B4CA 4UPGA 5ER5A 1XFXO 1A4PA 2JT8A 5KSZA 1NYAA 1B47A 1Q80A 3HX4A 5KTYA 1TRFA 3OHMB 1QVIY 1SK6D 1CMFA 1K93D 4BY5A 2JT3A 2O5GA 3VRPA 1B8LA 1U5IA 2CNPA 2MRDA 2LHLA 1F4OA 2COLB 5AEQA 4A4BA 3AAJA 1BG1A 4C0JA 1NIWA 3KEVA 5D69A 1BU3A 3C1VA 1SCMB 2OS8B 3OX6A 4PHMA 1EH2A 3BUOB 3EK7A 3TS5C 4MZJA 1KFUL 1K94A 2TN4A 3EK8A 3FWBA 1WY9A 2JC2A 4AQIA 1CDPA 1YUUA 5DKNA 1J7OA 2JXLA 4YI9A 1JF0A 1RECA 1B1GA 1S5GY 1DGVA 1YVLA 3PATA 1RFJA 3F45A 1LA3A 4XYNA 1B9AA 1JUOA 4NDCA 1BR1B 2CTNA 4WRIA 1YR5A 1HT9A 3SG3A 2ZRTA 1GQMA 2I18A 1SCVA 1NWDA 4U8DA 4N1GA 2JXCA 5B8IB 5AXIA 2PALA 4CFQA 3D10A 3FWCA 1KK7Y 1XA5A 1CTRA 1PVBA 2M49B 4TNCA 4ORBB 4YGDB 1NX2A 5AFPA 3I5HC 4PHNA 4QJ3B 4DRWA 2LLUA 5HKWA 2ZN9A 3SIAA 3WHTB 1CFCA 1A75B 1SYMA 2Y1NA 2M7LA 1PULA 1BR4B 1TNWA 1OOJA 1SR6C 1K8UA 5PALA 1TN4A 2K8MB 5JJGA 3RM1A 2JRFA 3I5IB 4OCIA 1ZUZA 3AAKA 4A4CA 1B7TZ 1JFKA 1AP4A 4R1EA 1MHOA 1DJXA 2MBXA 4MRXA 1GJYA 2BL0C 2IS9A 1CNPA 1YURA 1AHRA 1W7JB 1KQMB 1MF8B 5HLOA 3FS7A 1W7IB 1XO5A 2LP3A 1F4QA 2OTGB 3H4SE 4BY4A 3NSIA 2BCBA 1FW4A 2EHBA 1F71A 1G33A 1LVCD 5CSNA 2JNFA 2G2BA 1V1FA 1KQVA 1DMOA 3BUXB 1VRKA 4I5JA 1QIVA 1OMVA 1Y1XA 2LHIA 5K89A 1CB1A 2PSRA 2WCFA 1R6PA 3SJSA 5IBWA 1H8BA 3JVTB 1S1EA 4AQJA 1KFXS 4CFRA 2K0JA 2CBLA 3ZNIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BKH B;  1QXP A;  5BPJ A;  1KWO C;  1PSR A;  1QX5 B;  4PE4 A;  1ODB A;  1AJ5 A;  1JSA A;  4GNK B;  4HSZ A;  1J55 A;  2FCE A;  1CDM A;  2KOT A;  2LUX A;  1SL8 A;  3DD4 A;  1DJG A;  1RRO A;  1DJZ A;  2ZFD A;  3O6B A;  4IL1 A;  2RGI A;  4MRY A;  3CGA A;  1DT7 B;  1QX2 A;  2AAO A;  2H61 A;  1AUI B;  1XFW O;  2GGZ A;  2Y1M A;  2FOT A;  4PHJ A;  2K61 A;  2WC8 A;  3DVE A;  1CDN A;  1BMO A;  1J1D A;  2HET A;  4YRU A;  1S6J A;  5D7F A;  4MVF A;  1MQ1 A;  4YGC B;  4HRE E;  1WRK A;  2JNX A;  2LMU A;  3EK4 A;  1OMR A;  2ZRS A;  1FPW A;  1UUR A;  4AOM A;  5JOL A;  1TTX A;  2JU0 A;  1A29 A;  2KAX A;  4OKH A;  1QX7 A;  3TDU A;  2LVK A;  2LM5 A;  1BOC A;  4USL A;  4GGN A;  1K2H A;  2O60 A;  1SCM C;  2OS8 C;  1CFF A;  4HRH A;  2ZND A;  3WNX B;  2NXQ A;  2BEC A;  1BLQ A;  3LK1 A;  1FBV A;  1XVJ A;  1A75 A;  2KNE A;  3CWG A;  2LAP A;  4JWQ A;  1IQ3 A;  2H61 C;  2CXJ A;  1BT6 A;  1NPQ A;  3LCP C;  3LL8 B;  2KFF A;  2JPT A;  1DJW A;  2ISD A;  1ALW A;  2I7A A;  1B7T Y;  1MXE A;  1MWN A;  3PN7 B;  2K2F A;  1UHH A;  2M97 A;  3DVK A;  3O78 A;  3EKH A;  4N1F A;  1B8R A;  2CT9 A;  3OB2 B;  1MXL C;  1NUB A;  1SW8 A;  2MLE C;  1N65 A;  2AMI A;  2FCD A;  2KQ6 A;  2KSP A;  1Y0V H;  2BBN A;  2LLT A;  2MA2 A;  3NSO A;  1DJI A;  3TZ1 A;  3EVV A;  1LIN A;  3SIB A;  1CLM A;  3KHE A;  4DS7 A;  1F8H A;  2KFG A;  3CZT X;  4QJ5 B;  1K9P A;  2NCP A;  1M45 A;  1RK9 A;  2BE4 A;  3IQO A;  1DF0 A;  1UUS A;  5HKY A;  5CSJ A;  1TOP A;  3OP0 A;  1NP8 A;  1TNP A;  1S26 D;  1CDL A;  1KK8 B;  1NCX A;  1TNX A;  2KBI A;  4HRG A;  1SL7 A;  5AAN A;  1YRU B;  2AUC A;  3IF7 A;  3FIA A;  1EJ3 A;  1M31 A;  1ZAC A;  2M29 A;  2JZI A;  4C0K A;  2SCP A;  1SRA A;  4NQG A;  3I5G B;  3I5I C;  3A8R A;  1IWQ A;  3AKA A;  1EG4 A;  5I8N A;  1SBJ A;  1PVA A;  1WRZ A;  4FTG A;  1EL4 A;  1M46 A;  3BQ3 A;  2LP2 A;  4N5X A;  2KYC A;  3AKB A;  1L7Z A;  1KQM C;  3VGO A;  1H4B A;  3LLE A;  2LMV A;  2OTG C;  4ICB A;  1M63 B;  3GK4 X;  1QIW A;  1YUT A;  2KI6 D;  1RTP 1;  1KFU S;  3CR2 A;  1DF0 B;  3DVM A;  4ZCU A;  3GK1 A;  2KI4 B;  1ZMZ A;  1QV1 A;  1WDC B;  3JVT C;  1A03 A;  1C7V A;  1GGW A;  1KSO A;  5HYD A;  2SAS A;  3LK0 A;  3PSR A;  2I2R E;  1J1E A;  4ORA B;  4OVN F;  1CLB A;  2JOJ A;  1CFD A;  2L4H A;  2Y5I A;  4CLN A;  1Y1U A;  2PAS A;  1NX1 A;  3NXA A;  3BUN B;  1J7R A;  4XJK A;  3I5F B;  1TCO B;  2LC5 A;  4JQ0 D;  2L4I A;  5I2L A;  5I2O A;  1UP5 A;  2FJU B;  2KBM A;  1E8A A;  2Q91 A;  3GK2 A;  1J7P A;  5G08 A;  2Y4Q A;  3WHU B;  2WOR A;  4C0L A;  2K7D A;  1BF5 A;  5KU1 A;  4OR9 B;  4DCK A;  3QRX A;  1KSM A;  1BJF A;  2Q4U A;  1OSA A;  1C07 A;  1K96 A;  3CR5 X;  1DVI A;  1IQ5 A;  1YX7 A;  3DVJ A;  1NCZ A;  4PCW A;  3PLF B;  1OZO A;  1IKU A;  1SMG A;  1NX3 A;  1HQV A;  4GUK A;  2JTT A;  1WRL A;  4GAO A;  1QAS A;  2LLS A;  4E68 A;  5DKQ A;  2KFH A;  2NCO A;  3ICB A;  1K9K A;  1YX8 A;  2L0P A;  5CSF A;  3BOW B;  1S36 A;  1RWY A;  1QAT A;  1XYD A;  1LA0 A;  1IRJ A;  1DTL A;  5AER A;  3VRO A;  4P5O E;  2R2I A;  3VRQ A;  3KF9 A;  4ZCV A;  2MJW B;  3CR4 X;  1SY9 A;  2KAY A;  2PMY A;  2E30 A;  1CFP A;  4P2Y B;  3D0Y A;  2M8U A;  4M2Q A;  2KYF A;  1EG3 A;  2PRU A;  1QLS A;  4XJK B;  1QJT A;  3MSE B;  2F2O A;  4FQO A;  1K90 D;  2GGM A;  4MBE A;  1Y6W A;  1CM1 A;  1NX0 A;  1MUX A;  1D1O A;  3PM8 A;  1JF2 A;  1X02 A;  2BKI B;  2L50 A;  1OMD A;  3PN7 C;  2DOQ A;  3OB1 B;  2WND A;  4PE7 A;  3DF0 A;  2GV5 A;  1SL9 A;  1L2O B;  2HF5 A;  2LVI A;  3E3R A;  1AK8 A;  1PAL A;  3BUM B;  1FI6 A;  1ALV A;  2MAZ A;  4M2O A;  4MSP A;  1IJ6 A;  4WQ3 A;  3BYA A;  3PAL A;  4YI8 A;  1SKT A;  2L2E A;  2KGB C;  1KK8 C;  5DKR A;  1LXF C;  2LE9 B;  2HQ8 A;  2LMT A;  3TUY B;  2WCE A;  3A4U B;  3VRR A;  1F54 A;  2EC6 B;  2K7C A;  2KAV A;  3JTD B;  3K21 A;  4GPL B;  4MN0 A;  1JWD A;  1G8I A;  1TIZ A;  1CM4 A;  3I5G C;  1WLZ A;  1MR8 A;  2L98 A;  5CPV A;  2F8P A;  4CID A;  3D0Y B;  2V53 A;  1SNL A;  2F2P A;  4PAL A;  5ER4 X;  5HLV A;  2K7B A;  5FYX A;  4D1E A;  1S6C A;  1YUS A;  2E6W A;  1AJ4 A;  2L5X B;  3HCM A;  4PDZ A;  3CS1 A;  4YGA A;  1XFY O;  3TS5 B;  1C7W A;  1PK0 D;  2KDH A;  1YTZ C;  4L9M A;  3TDI A;  1YVH A;  2NLN A;  4WQ2 A;  3DF0 B;  2HQW A;  4I5N B;  1KFX L;  3M0W A;  1UWO A;  1IH0 A;  1J7Q A;  2M7N A;  2BCA A;  2JTZ A;  3SG2 A;  2F33 A;  2KQY A;  2CCM A;  2LVJ A;  4YGE B;  1TNQ A;  1JFJ A;  1IGV A;  2KI4 C;  1WDC C;  4PE0 A;  1NSH A;  4JPZ B;  4ETO A;  1BOD A;  3VRN A;  1M39 A;  2WCB A;  3BOW A;  5TNC A;  1N0Y A;  3O4Y A;  1IJ5 A;  1QVI Z;  1U5I B;  2JQ6 A;  2M1K B;  1B8C A;  2H2K A;  2NZ0 A;  4CPV A;  1KCY A;  1K95 A;  2BCX A;  5CSI A;  3CTN A;  4MEW A;  1RJV A;  1V1G A;  2P6B B;  3I5F C;  4F0Z B;  1XFV O;  1F55 A;  4GBA A;  4OV2 A;  2WOS A;  1FF1 A;  3I5H B;  2A4J A;  2M3W A;  1CLL A;  3SG7 A;  4I5L B;  2M0R A;  2PVB A;  3EVU A;  4NDD A;  5GQQ C;  1XK4 A;  5I2Q A;  3ZWH A;  1SR6 B;  3OX5 A;  1QS7 A;  1PRW A;  2B1U A;  2BE6 A;  4ORC B;  3O2P A;  4NDB A;  3EKJ A;  2LAN A;  1A2X A;  2ZNE A;  3SG4 A;  2K2A A;  3EVR A;  1S5G Z;  3KPX A;  1F70 A;  1G4Y R;  1OE9 B;  4I5K A;  1DJY A;  1QLK A;  1YRT B;  3RLZ A;  1NCY A;  1OZS A;  1QV0 A;  2LV7 A;  2M9G A;  1WLM A;  3BUW B;  2BL0 B;  4DIR A;  1TCF A;  2L51 A;  1AVS A;  1R2U A;  2VRG A;  4MLW A;  1S6I A;  4YBH B;  3WXA A;  4DUQ A;  1ZFS A;  1DJH A;  2KGR A;  1KK7 Z;  1UHK A;  4MZK A;  1GGZ A;  4PHK A;  3KO0 A;  1XFU O;  3BXK A;  2MLF C;  3SG6 A;  4Q04 A;  2ZN8 A;  4MZL A;  4YGB B;  1XK4 C;  4PE1 A;  4GGF A;  5J3X A;  1OQP A;  1S3P A;  2K7O A;  2LVV A;  1EXR A;  5HKZ A;  1DGU A;  3NSK A;  5F6T A;  2JWW A;  2OPO A;  1IG5 A;  4QJ4 B;  2ZKM X;  1FI5 A;  1JBA A;  2JUL A;  3PFV A;  1CMG A;  1N2D A;  2QPT A;  3NSL A;  1KWO B;  1PSB A;  1UHJ A;  1XFZ O;  2F3Z A;  1LKJ A;  2F3Y A;  1JC2 A;  1L2O C;  2D8N A;  3SG5 A;  2QAC A;  1CKK A;  3GOF A;  2KHN A;  2KI6 C;  2JT0 A;  2LCP A;  3IQQ A;  2BBM A;  4M2P A;  2HPS A;  1QTX A;  1Y1A A;  1SPY A;  1UHI A;  2MHH A;  2I94 A;  2LNK A;  3CLN A;  1UHN A;  2EGD A;  2M1U A;  1ZOT B;  2LUC A;  2G9B A;  4GGF C;  3TUY C;  3TDZ A;  2EC6 C;  3JTD C;  1K9U A;  4GFT A;  1B4C A;  4UPG A;  5ER5 A;  1XFX O;  1A4P A;  2JT8 A;  5KSZ A;  1NYA A;  1B47 A;  1Q80 A;  3HX4 A;  5KTY A;  1TRF A;  3OHM B;  1QVI Y;  1SK6 D;  1CMF A;  1K93 D;  4BY5 A;  2JT3 A;  2O5G A;  3VRP A;  1B8L A;  1U5I A;  2CNP A;  2MRD A;  2LHL A;  1F4O A;  2COL B;  5AEQ A;  4A4B A;  3AAJ A;  1BG1 A;  4C0J A;  1NIW A;  3KEV A;  5D69 A;  1BU3 A;  3C1V A;  1SCM B;  2OS8 B;  3OX6 A;  4PHM A;  1EH2 A;  3BUO B;  3EK7 A;  3TS5 C;  4MZJ A;  1KFU L;  1K94 A;  2TN4 A;  3EK8 A;  3FWB A;  1WY9 A;  2JC2 A;  4AQI A;  1CDP A;  1YUU A;  5DKN A;  1J7O A;  2JXL A;  4YI9 A;  1JF0 A;  1REC A;  1B1G A;  1S5G Y;  1DGV A;  1YVL A;  3PAT A;  1RFJ A;  3F45 A;  1LA3 A;  4XYN A;  1B9A A;  1JUO A;  4NDC A;  1BR1 B;  2CTN A;  4WRI A;  1YR5 A;  1HT9 A;  3SG3 A;  2ZRT A;  1GQM A;  2I18 A;  1SCV A;  1NWD A;  4U8D A;  4N1G A;  2JXC A;  5B8I B;  5AXI A;  2PAL A;  4CFQ A;  3D10 A;  3FWC A;  1KK7 Y;  1XA5 A;  1CTR A;  1PVB A;  2M49 B;  4TNC A;  4ORB B;  4YGD B;  1NX2 A;  5AFP A;  3I5H C;  4PHN A;  4QJ3 B;  4DRW A;  2LLU A;  5HKW A;  2ZN9 A;  3SIA A;  3WHT B;  1CFC A;  1A75 B;  1SYM A;  2Y1N A;  2M7L A;  1PUL A;  1BR4 B;  1TNW A;  1OOJ A;  1SR6 C;  1K8U A;  5PAL A;  1TN4 A;  2K8M B;  5JJG A;  3RM1 A;  2JRF A;  3I5I B;  4OCI A;  1ZUZ A;  3AAK A;  4A4C A;  1B7T Z;  1JFK A;  1AP4 A;  4R1E A;  1MHO A;  1DJX A;  2MBX A;  4MRX A;  1GJY A;  2BL0 C;  2IS9 A;  1CNP A;  1YUR A;  1AHR A;  1W7J B;  1KQM B;  1MF8 B;  5HLO A;  3FS7 A;  1W7I B;  1XO5 A;  2LP3 A;  1F4Q A;  2OTG B;  3H4S E;  4BY4 A;  3NSI A;  2BCB A;  1FW4 A;  2EHB A;  1F71 A;  1G33 A;  1LVC D;  5CSN A;  2JNF A;  2G2B A;  1V1F A;  1KQV A;  1DMO A;  3BUX B;  1VRK A;  4I5J A;  1QIV A;  1OMV A;  1Y1X A;  2LHI A;  5K89 A;  1CB1 A;  2PSR A;  2WCF A;  1R6P A;  3SJS A;  5IBW A;  1H8B A;  3JVT B;  1S1E A;  4AQJ A;  1KFX S;  4CFR A;  2K0J A;  2CBL A;  3ZNI A; 
#chains in the Genus database with same CATH topology
 2BKH B;  1QXP A;  5BPJ A;  3PJI A;  1KWO C;  1PSR A;  1QX5 B;  4PE4 A;  1ODB A;  3SS4 A;  1AJ5 A;  1TUJ A;  1JSA A;  4GNK B;  4HSZ A;  1J55 A;  2FCE A;  1CDM A;  2KOT A;  2LUX A;  1SL8 A;  3DD4 A;  2H8V A;  1DJG A;  1RRO A;  1DJZ A;  2ZFD A;  3O6B A;  4IL1 A;  2RGI A;  4MRY A;  3CGA A;  1DT7 B;  1QX2 A;  2AAO A;  2H61 A;  1AUI B;  1XFW O;  2GGZ A;  2Y1M A;  2FOT A;  4PHJ A;  2K61 A;  2WC8 A;  3DVE A;  1CDN A;  1BMO A;  1J1D A;  2HET A;  4YRU A;  1S6J A;  5D7F A;  4MVF A;  1MQ1 A;  4YGC B;  4HRE E;  1WRK A;  2JNX A;  2LMU A;  3EK4 A;  1OMR A;  2ZRS A;  5HL1 A;  1FPW A;  1UUR A;  4AOM A;  5JOL A;  1TTX A;  2JU0 A;  1A29 A;  2KAX A;  4OKH A;  1QX7 A;  3TDU A;  2LVK A;  2LM5 A;  1BOC A;  4USL A;  4GGN A;  1K2H A;  2O60 A;  1SCM C;  2OS8 C;  1CFF A;  4HRH A;  2ZND A;  3WNX B;  2NXQ A;  2BEC A;  5D3O A;  1BLQ A;  1W9Z A;  3LK1 A;  1FBV A;  1XVJ A;  1A75 A;  2KNE A;  3CWG A;  2LAP A;  4JWQ A;  1IQ3 A;  2H61 C;  2CXJ A;  1BT6 A;  1NPQ A;  3LCP C;  3LL8 B;  2P71 A;  2KFF A;  2WCK A;  2JPT A;  1DJW A;  2ISD A;  1ALW A;  2QEO A;  2I7A A;  1B7T Y;  1MXE A;  1MWN A;  3PN7 B;  2K2F A;  3S0A A;  1UHH A;  2M97 A;  3DVK A;  3O78 A;  3EKH A;  4N1F A;  3S0F A;  1B8R A;  2CT9 A;  3BFB A;  3OB2 B;  1MXL C;  1NUB A;  1SW8 A;  2MLE C;  1N65 A;  2AMI A;  3DY9 A;  2FCD A;  2KQ6 A;  2KSP A;  1Y0V H;  2BBN A;  2LLT A;  2MA2 A;  3NSO A;  1DJI A;  3TZ1 A;  3EVV A;  1LIN A;  3SIB A;  1CLM A;  3KHE A;  4DS7 A;  1TWO A;  1F8H A;  2KFG A;  3CZT X;  4QJ5 B;  1K9P A;  2NCP A;  1M45 A;  1RK9 A;  2BE4 A;  3IQO A;  1DF0 A;  3S0B A;  1UUS A;  5HKY A;  5CSJ A;  1TOP A;  3K1E A;  3OP0 A;  1NP8 A;  1TNP A;  1S26 D;  1CDL A;  1KK8 B;  1NCX A;  1TNX A;  2KBI A;  4HRG A;  1SL7 A;  5AAN A;  1YRU B;  1DEL A;  2AUC A;  3IF7 A;  3FIA A;  1EJ3 A;  1M31 A;  1ZAC A;  2M29 A;  3CAB A;  2JZI A;  3B88 A;  4C0K A;  2SCP A;  1SRA A;  5DIC A;  4NQG A;  3I5G B;  3I5I C;  1IIO A;  3A8R A;  1IWQ A;  3AKA A;  1EG4 A;  5I8N A;  1SBJ A;  1C3Y A;  1PVA A;  1WRZ A;  3NHI A;  4FTG A;  1EL4 A;  1M46 A;  3SS3 A;  3BQ3 A;  2LP2 A;  4N5X A;  2KYC A;  3AKB A;  1L7Z A;  1KQM C;  3VGO A;  1H4B A;  3LLE A;  2LMV A;  2OTG C;  4ICB A;  5EL2 A;  3L47 A;  1M63 B;  2WC6 A;  3GK4 X;  2L2C A;  1QIW A;  1YUT A;  2KI6 D;  1RTP 1;  1KFU S;  3Q8I A;  3CR2 A;  1DF0 B;  3DVM A;  1DC1 A;  4OZD A;  1DQE A;  4ZCU A;  3GK1 A;  1LS8 A;  1ZMZ A;  2KI4 B;  1QV1 A;  1WDC B;  2QEV A;  3JVT C;  1A03 A;  1C7V A;  1GGW A;  1KSO A;  5HYD A;  2WCJ A;  2SAS A;  3LK0 A;  3PSR A;  2I2R E;  1J1E A;  4ORA B;  4OVN F;  1CLB A;  2JOJ A;  1CFD A;  2L4H A;  2Y5I A;  3R1O A;  4CLN A;  1Y1U A;  2PAS A;  1XFR A;  1NX1 A;  3NXA A;  3BUN B;  1J7R A;  3BFA A;  3I5F B;  4XJK A;  1TCO B;  2LC5 A;  4JQ0 D;  2L4I A;  5I2L A;  5I2O A;  1UP5 A;  2FJU B;  2KBM A;  1E8A A;  2Q91 A;  3GK2 A;  1J7P A;  5G08 A;  2Y4Q A;  3WHU B;  2WOR A;  3IVT A;  2K7D A;  4C0L A;  1BF5 A;  5KU1 A;  4OR9 B;  4DCK A;  3QRX A;  1KSM A;  1BJF A;  2ERB A;  2Q4U A;  1OSA A;  3R1V A;  1C07 A;  1K96 A;  3CR5 X;  1DVI A;  1IQ5 A;  1YX7 A;  3DVJ A;  1NCZ A;  4PCW A;  3PLF B;  1OZO A;  1IKU A;  1SMG A;  1NX3 A;  1HQV A;  4GUK A;  2JTT A;  1WRL A;  4GAO A;  1QAS A;  2LLS A;  4E68 A;  5DKQ A;  2KFH A;  2NCO A;  3ICB A;  1K9K A;  1YX8 A;  2L0P A;  5CSF A;  3B6X A;  3BOW B;  1S36 A;  1RWY A;  3S0D A;  1XYD A;  1QAT A;  1LA0 A;  1IRJ A;  1DTL A;  5AER A;  3V2L A;  3VRO A;  3UO9 A;  4P5O E;  2R2I A;  3VRQ A;  3KF9 A;  4ZCV A;  2MJW B;  3CR4 X;  1SY9 A;  2KAY A;  2PMY A;  2E30 A;  1CFP A;  4P2Y B;  3D0Y A;  2M8U A;  4M2Q A;  2KYF A;  2WCL A;  1EG3 A;  2PRU A;  1QLS A;  4XJK B;  1QJT A;  3MSE B;  2F2O A;  4FQO A;  1K90 D;  2GGM A;  4MBE A;  3RZS A;  1Y6W A;  1CM1 A;  1NX0 A;  1MUX A;  1OOH A;  1GM0 A;  1D1O A;  3PM8 A;  1JF2 A;  1X02 A;  2BKI B;  2L50 A;  1OMD A;  3PN7 C;  3FE8 A;  2DOQ A;  3OB1 B;  3L4L A;  2WND A;  4PE7 A;  3D78 A;  3DF0 A;  2GV5 A;  1SL9 A;  3R72 A;  1L2O B;  2HF5 A;  2LVI A;  3E3R A;  1AK8 A;  1PAL A;  3BUM B;  1FI6 A;  1ALV A;  2MAZ A;  4M2O A;  4MSP A;  1IJ6 A;  4WQ3 A;  3BYA A;  3PAL A;  4YI8 A;  1SKT A;  2L2E A;  2KGB C;  1KK8 C;  5DKR A;  1LXF C;  1Z4H A;  2LE9 B;  2HQ8 A;  2LMT A;  2PQL A;  2WCE A;  3A4U B;  3TUY B;  3VRR A;  2EC6 B;  2K7C A;  2KAV A;  3JTD B;  1ORG A;  3K21 A;  4GPL B;  4MN0 A;  1JWD A;  1Z2C B;  1G8I A;  1TIZ A;  1CM4 A;  1P28 A;  2QEH A;  3I5G C;  1WLZ A;  1MR8 A;  2L98 A;  5CPV A;  2F8P A;  4CID A;  4IJ7 A;  3D0Y B;  2V53 A;  1SNL A;  2F2P A;  4PAL A;  5ER4 X;  2PYQ A;  4JKT A;  1C3Z A;  5HLV A;  2K7B A;  5FYX A;  4D1E A;  2GTE A;  3CYZ A;  1S6C A;  1YUS A;  2E6W A;  1AJ4 A;  2L5X B;  3HCM A;  4PDZ A;  3CS1 A;  4YGA A;  1XFY O;  3TS5 B;  1C7W A;  1PK0 D;  2KDH A;  1YTZ C;  4L9M A;  3TDI A;  1YVH A;  2NLN A;  4WQ2 A;  3DF0 B;  2BNX A;  2HQW A;  4I5N B;  1KFX L;  3M0W A;  1UWO A;  1IH0 A;  1J7Q A;  2M7N A;  1QWV A;  2BCA A;  2JTZ A;  2KLD A;  2F33 A;  2KQY A;  3SG2 A;  3DZT A;  2CCM A;  2LVJ A;  1TUZ A;  4PT1 A;  1TNQ A;  4YGE B;  1JFJ A;  1IGV A;  2KI4 C;  1WDC C;  4PE0 A;  1NSH A;  4JPZ B;  4ETO A;  1BOD A;  3VRN A;  1M39 A;  2WCB A;  3BOW A;  5TNC A;  1N0Y A;  3O4Y A;  1IJ5 A;  1QVI Z;  1U5I B;  2JQ6 A;  2M1K B;  1B8C A;  2H2K A;  2NZ0 A;  3BJH A;  4CPV A;  1KCY A;  1K95 A;  2BCX A;  5CSI A;  3CTN A;  4MEW A;  1RJV A;  1V1G A;  2P6B B;  3I5F C;  4F0Z B;  1XFV O;  1F55 A;  4GBA A;  4OV2 A;  2WOS A;  1FF1 A;  3I5H B;  2A4J A;  2M3W A;  1CLL A;  3SG7 A;  4I5L B;  2M0R A;  2PVB A;  3EVU A;  4NDD A;  5GQQ C;  2L5Y A;  1XK4 A;  5I2Q A;  3ZWH A;  1SR6 B;  3B87 A;  3D74 A;  3OX5 A;  1QS7 A;  1PRW A;  2B1U A;  1OOI X;  2BE6 A;  4ORC B;  5FI6 A;  3O2P A;  4NDB A;  3EKJ A;  2LAN A;  1A2X A;  2ZNE A;  1OW4 A;  3SG4 A;  2K2A A;  3EVR A;  1S5G Z;  1T14 A;  3KPX A;  1F70 A;  1G4Y R;  1OE9 B;  4I5K A;  1DJY A;  1QLK A;  1YRT B;  3RLZ A;  1NCY A;  3O4X A;  3NGV A;  1OZS A;  1QV0 A;  2LV7 A;  2M9G A;  1WLM A;  3BUW B;  2BL0 B;  4DIR A;  1TCF A;  2L51 A;  2QEB A;  1AVS A;  1R2U A;  2VRG A;  4JD9 A;  4MLW A;  1S6I A;  4YBH B;  3WXA A;  3QME A;  4INW A;  4DUQ A;  3UNW A;  1ZFS A;  1DJH A;  2KGR A;  1KK7 Z;  1UHK A;  3OGN A;  4MZK A;  1GGZ A;  4PHK A;  3KO0 A;  1XFU O;  3BXK A;  2JPO A;  2MLF C;  3FE6 A;  3S0E A;  2YGU A;  3SG6 A;  3SS5 A;  4Q04 A;  2ZN8 A;  2WCM A;  4MZL A;  4YGB B;  1XK4 C;  3D75 A;  4PE1 A;  4GGF A;  5J3X A;  1OQP A;  1S3P A;  2K7O A;  2LVV A;  1EXR A;  5HKZ A;  1DGU A;  3NSK A;  5F6T A;  2JWW A;  2OPO A;  1IG5 A;  4QJ4 B;  2ZKM X;  3D77 A;  1FI5 A;  1JBA A;  3CZ0 A;  2JUL A;  3PFV A;  1CMG A;  1N2D A;  2QPT A;  4F7F A;  3NSL A;  1KWO B;  1PSB A;  4KYN A;  1UHJ A;  1XFZ O;  2F3Z A;  1LKJ A;  2F3Y A;  1JC2 A;  1L2O C;  2D8N A;  3SG5 A;  2QAC A;  1CKK A;  3CDN A;  3GOF A;  2KHN A;  2KI6 C;  2JT0 A;  2LCP A;  2P70 A;  2BBM A;  3IQQ A;  4M2P A;  3NHT A;  2HPS A;  1QTX A;  5I94 A;  1Y1A A;  3OBV A;  1OOG A;  1SPY A;  1UHI A;  2BAP A;  2I94 A;  2LNK A;  2MHH A;  3CLN A;  1UHN A;  2EGD A;  2M1U A;  1ZOT B;  2LUC A;  2G9B A;  4GGF C;  5FI2 A;  3TDZ A;  2EC6 C;  3JTD C;  1K9U A;  4GFT A;  3TUY C;  1B4C A;  4UPG A;  5ER5 A;  2KPH A;  1XFX O;  1A4P A;  2JT8 A;  5KSZ A;  1DEK A;  1NYA A;  1B47 A;  1Q80 A;  3HX4 A;  5KTY A;  1TRF A;  3OHM B;  1QVI Y;  1SK6 D;  1CMF A;  1K93 D;  4BY5 A;  2JT3 A;  2O5G A;  3VRP A;  1B8L A;  1U5I A;  2CNP A;  2MRD A;  2LHL A;  1F4O A;  2COL B;  5AEQ A;  4A4B A;  2WC5 A;  3AAJ A;  1BG1 A;  4C0J A;  1NIW A;  3KEV A;  5D69 A;  1BU3 A;  3C1V A;  2FJY A;  1SCM B;  2OS8 B;  3OX6 A;  4PHM A;  5FI7 A;  1EH2 A;  3PM2 A;  3BUO B;  3EK7 A;  3TS5 C;  4MZJ A;  1KFU L;  1K94 A;  2TN4 A;  3EK8 A;  3FWB A;  1WY9 A;  2JC2 A;  4AQI A;  1CDP A;  1YUU A;  5DKN A;  1J7O A;  3B86 A;  2JXL A;  1SSE B;  4YI9 A;  1F54 A;  1JF0 A;  1REC A;  1B1G A;  1S5G Y;  1DGV A;  1YVL A;  3PAT A;  1RFJ A;  3F45 A;  1LA3 A;  4XYN A;  1B9A A;  1JUO A;  4NDC A;  1BR1 B;  2CTN A;  4WRI A;  1YR5 A;  1HT9 A;  3SG3 A;  2WCH A;  1GQM A;  2KLE A;  2ZRT A;  3FE9 A;  2I18 A;  3DXL A;  1SCV A;  1NWD A;  4U8D A;  4N1G A;  2JXC A;  4INX A;  5B8I B;  5AXI A;  2PAL A;  4CFQ A;  3D10 A;  3FWC A;  1KK7 Y;  1XA5 A;  1CTR A;  1PVB A;  2M49 B;  4TNC A;  4ORB B;  4YGD B;  1NX2 A;  5AFP A;  3I5H C;  4PHN A;  4QJ3 B;  4DRW A;  2LLU A;  5HKW A;  2ZN9 A;  3SIA A;  3WHT B;  1CFC A;  1A75 B;  1SYM A;  2Y1N A;  2M7L A;  1PUL A;  1BR4 B;  1TNW A;  1OOJ A;  1SR6 C;  1K8U A;  5PAL A;  1TN4 A;  2K8M B;  5JJG A;  3VB1 A;  3B7A A;  3RM1 A;  2JRF A;  4FQT A;  3CZ1 A;  3I5I B;  3N7H A;  4OCI A;  1ZUZ A;  3AAK A;  4A4C A;  1B7T Z;  1JFK A;  1AP4 A;  3D76 A;  4R1E A;  1MHO A;  1DJX A;  2MBX A;  4MRX A;  1GJY A;  2BL0 C;  2IS9 A;  3BFH A;  1CNP A;  1OOF A;  1YUR A;  1AHR A;  1W7J B;  1KQM B;  1MF8 B;  5HLO A;  3FS7 A;  1W7I B;  1XO5 A;  2LP3 A;  3S0G A;  1F4Q A;  2OTG B;  3H4S E;  3L4A A;  3NSI A;  4BY4 A;  2BCB A;  2K60 A;  1FW4 A;  2EHB A;  1F71 A;  1G33 A;  1LVC D;  3EG5 B;  5CSN A;  2JNF A;  2G2B A;  1V1F A;  1KQV A;  1DMO A;  3DYE A;  3BUX B;  1VRK A;  4I5J A;  1QIV A;  1OMV A;  1Y1X A;  3R1P A;  2LHI A;  5K89 A;  1CB1 A;  2PSR A;  2WCF A;  1R6P A;  3SJS A;  5IBW A;  1H8B A;  3JVT B;  3D73 A;  1S1E A;  4AQJ A;  1KFX S;  4CFR A;  3CZ2 A;  2QDI A;  2K0J A;  2CBL A;  3ZNI A; 
#chains in the Genus database with same CATH homology
 2BKH B;  1QXP A;  5BPJ A;  1KWO C;  1PSR A;  1QX5 B;  4PE4 A;  1ODB A;  1AJ5 A;  1JSA A;  4GNK B;  4HSZ A;  1J55 A;  2FCE A;  1CDM A;  2KOT A;  2LUX A;  1SL8 A;  3DD4 A;  1DJG A;  1RRO A;  1DJZ A;  2ZFD A;  3O6B A;  4IL1 A;  2RGI A;  4MRY A;  3CGA A;  1DT7 B;  1QX2 A;  2AAO A;  2H61 A;  1AUI B;  1XFW O;  2GGZ A;  2Y1M A;  2FOT A;  4PHJ A;  2K61 A;  2WC8 A;  3DVE A;  1CDN A;  1BMO A;  1J1D A;  2HET A;  4YRU A;  1S6J A;  5D7F A;  4MVF A;  1MQ1 A;  4YGC B;  4HRE E;  1WRK A;  2JNX A;  2LMU A;  3EK4 A;  1OMR A;  2ZRS A;  1FPW A;  1UUR A;  4AOM A;  5JOL A;  1TTX A;  2JU0 A;  1A29 A;  2KAX A;  4OKH A;  1QX7 A;  3TDU A;  2LVK A;  2LM5 A;  1BOC A;  4USL A;  4GGN A;  1K2H A;  2O60 A;  1SCM C;  2OS8 C;  1CFF A;  4HRH A;  2ZND A;  3WNX B;  2NXQ A;  2BEC A;  1BLQ A;  3LK1 A;  1FBV A;  1XVJ A;  1A75 A;  2KNE A;  3CWG A;  2LAP A;  4JWQ A;  1IQ3 A;  2H61 C;  2CXJ A;  1BT6 A;  1NPQ A;  3LCP C;  3LL8 B;  2KFF A;  2JPT A;  1DJW A;  2ISD A;  1ALW A;  2I7A A;  1B7T Y;  1MXE A;  1MWN A;  3PN7 B;  2K2F A;  1UHH A;  2M97 A;  3DVK A;  3O78 A;  3EKH A;  4N1F A;  1B8R A;  2CT9 A;  3OB2 B;  1MXL C;  1NUB A;  1SW8 A;  2MLE C;  1N65 A;  2AMI A;  2FCD A;  2KQ6 A;  2KSP A;  1Y0V H;  2BBN A;  2LLT A;  2MA2 A;  3NSO A;  1DJI A;  3TZ1 A;  3EVV A;  1LIN A;  3SIB A;  1CLM A;  3KHE A;  4DS7 A;  1F8H A;  2KFG A;  3CZT X;  4QJ5 B;  1K9P A;  2NCP A;  1M45 A;  1RK9 A;  2BE4 A;  3IQO A;  1DF0 A;  1UUS A;  5HKY A;  5CSJ A;  1TOP A;  3OP0 A;  1NP8 A;  1TNP A;  1S26 D;  1CDL A;  1KK8 B;  1NCX A;  1TNX A;  2KBI A;  4HRG A;  1SL7 A;  5AAN A;  1YRU B;  2AUC A;  3IF7 A;  3FIA A;  1EJ3 A;  1M31 A;  1ZAC A;  2M29 A;  2JZI A;  4C0K A;  2SCP A;  1SRA A;  4NQG A;  3I5G B;  3I5I C;  3A8R A;  1IWQ A;  3AKA A;  1EG4 A;  5I8N A;  1SBJ A;  1PVA A;  1WRZ A;  4FTG A;  1EL4 A;  1M46 A;  3BQ3 A;  2LP2 A;  4N5X A;  2KYC A;  3AKB A;  1L7Z A;  1KQM C;  3VGO A;  1H4B A;  3LLE A;  2LMV A;  2OTG C;  4ICB A;  1M63 B;  3GK4 X;  1QIW A;  1YUT A;  2KI6 D;  1RTP 1;  1KFU S;  3CR2 A;  1DF0 B;  3DVM A;  4ZCU A;  3GK1 A;  2KI4 B;  1ZMZ A;  1QV1 A;  1WDC B;  3JVT C;  1A03 A;  1C7V A;  1GGW A;  1KSO A;  5HYD A;  2SAS A;  3LK0 A;  3PSR A;  2I2R E;  1J1E A;  4ORA B;  4OVN F;  1CLB A;  2JOJ A;  1CFD A;  2L4H A;  2Y5I A;  4CLN A;  1Y1U A;  2PAS A;  1NX1 A;  3NXA A;  3BUN B;  1J7R A;  4XJK A;  3I5F B;  1TCO B;  2LC5 A;  4JQ0 D;  2L4I A;  5I2L A;  5I2O A;  1UP5 A;  2FJU B;  2KBM A;  1E8A A;  2Q91 A;  3GK2 A;  1J7P A;  5G08 A;  2Y4Q A;  3WHU B;  2WOR A;  4C0L A;  2K7D A;  1BF5 A;  5KU1 A;  4OR9 B;  4DCK A;  3QRX A;  1KSM A;  1BJF A;  2Q4U A;  1OSA A;  1C07 A;  1K96 A;  3CR5 X;  1DVI A;  1IQ5 A;  1YX7 A;  3DVJ A;  1NCZ A;  4PCW A;  3PLF B;  1OZO A;  1IKU A;  1SMG A;  1NX3 A;  1HQV A;  4GUK A;  2JTT A;  1WRL A;  4GAO A;  1QAS A;  2LLS A;  4E68 A;  5DKQ A;  2KFH A;  2NCO A;  3ICB A;  1K9K A;  1YX8 A;  2L0P A;  5CSF A;  3BOW B;  1S36 A;  1RWY A;  1QAT A;  1XYD A;  1LA0 A;  1IRJ A;  1DTL A;  5AER A;  3VRO A;  4P5O E;  2R2I A;  3VRQ A;  3KF9 A;  4ZCV A;  2MJW B;  3CR4 X;  1SY9 A;  2KAY A;  2PMY A;  2E30 A;  1CFP A;  4P2Y B;  3D0Y A;  2M8U A;  4M2Q A;  2KYF A;  1EG3 A;  2PRU A;  1QLS A;  4XJK B;  1QJT A;  3MSE B;  2F2O A;  4FQO A;  1K90 D;  2GGM A;  4MBE A;  1Y6W A;  1CM1 A;  1NX0 A;  1MUX A;  1D1O A;  3PM8 A;  1JF2 A;  1X02 A;  2BKI B;  2L50 A;  1OMD A;  3PN7 C;  2DOQ A;  3OB1 B;  2WND A;  4PE7 A;  3DF0 A;  2GV5 A;  1SL9 A;  1L2O B;  2HF5 A;  2LVI A;  3E3R A;  1AK8 A;  1PAL A;  3BUM B;  1FI6 A;  1ALV A;  2MAZ A;  4M2O A;  4MSP A;  1IJ6 A;  4WQ3 A;  3BYA A;  3PAL A;  4YI8 A;  1SKT A;  2L2E A;  2KGB C;  1KK8 C;  5DKR A;  1LXF C;  2LE9 B;  2HQ8 A;  2LMT A;  3TUY B;  2WCE A;  3A4U B;  3VRR A;  1F54 A;  2EC6 B;  2K7C A;  2KAV A;  3JTD B;  3K21 A;  4GPL B;  4MN0 A;  1JWD A;  1G8I A;  1TIZ A;  1CM4 A;  3I5G C;  1WLZ A;  1MR8 A;  2L98 A;  5CPV A;  2F8P A;  4CID A;  3D0Y B;  2V53 A;  1SNL A;  2F2P A;  4PAL A;  5ER4 X;  5HLV A;  2K7B A;  5FYX A;  4D1E A;  1S6C A;  1YUS A;  2E6W A;  1AJ4 A;  2L5X B;  3HCM A;  4PDZ A;  3CS1 A;  4YGA A;  1XFY O;  3TS5 B;  1C7W A;  1PK0 D;  2KDH A;  1YTZ C;  4L9M A;  3TDI A;  1YVH A;  2NLN A;  4WQ2 A;  3DF0 B;  2HQW A;  4I5N B;  1KFX L;  3M0W A;  1UWO A;  1IH0 A;  1J7Q A;  2M7N A;  2BCA A;  2JTZ A;  3SG2 A;  2F33 A;  2KQY A;  2CCM A;  2LVJ A;  4YGE B;  1TNQ A;  1JFJ A;  1IGV A;  2KI4 C;  1WDC C;  4PE0 A;  1NSH A;  4JPZ B;  4ETO A;  1BOD A;  3VRN A;  1M39 A;  2WCB A;  3BOW A;  5TNC A;  1N0Y A;  3O4Y A;  1IJ5 A;  1QVI Z;  1U5I B;  2JQ6 A;  2M1K B;  1B8C A;  2H2K A;  2NZ0 A;  4CPV A;  1KCY A;  1K95 A;  2BCX A;  5CSI A;  3CTN A;  4MEW A;  1RJV A;  1V1G A;  2P6B B;  3I5F C;  4F0Z B;  1XFV O;  1F55 A;  4GBA A;  4OV2 A;  2WOS A;  1FF1 A;  3I5H B;  2A4J A;  2M3W A;  1CLL A;  3SG7 A;  4I5L B;  2M0R A;  2PVB A;  3EVU A;  4NDD A;  5GQQ C;  1XK4 A;  5I2Q A;  3ZWH A;  1SR6 B;  3OX5 A;  1QS7 A;  1PRW A;  2B1U A;  2BE6 A;  4ORC B;  3O2P A;  4NDB A;  3EKJ A;  2LAN A;  1A2X A;  2ZNE A;  3SG4 A;  2K2A A;  3EVR A;  1S5G Z;  3KPX A;  1F70 A;  1G4Y R;  1OE9 B;  4I5K A;  1DJY A;  1QLK A;  1YRT B;  3RLZ A;  1NCY A;  1OZS A;  1QV0 A;  2LV7 A;  2M9G A;  1WLM A;  3BUW B;  2BL0 B;  4DIR A;  1TCF A;  2L51 A;  1AVS A;  1R2U A;  2VRG A;  4MLW A;  1S6I A;  4YBH B;  3WXA A;  4DUQ A;  1ZFS A;  1DJH A;  2KGR A;  1KK7 Z;  1UHK A;  4MZK A;  1GGZ A;  4PHK A;  3KO0 A;  1XFU O;  3BXK A;  2MLF C;  3SG6 A;  4Q04 A;  2ZN8 A;  4MZL A;  4YGB B;  1XK4 C;  4PE1 A;  4GGF A;  5J3X A;  1OQP A;  1S3P A;  2K7O A;  2LVV A;  1EXR A;  5HKZ A;  1DGU A;  3NSK A;  5F6T A;  2JWW A;  2OPO A;  1IG5 A;  4QJ4 B;  2ZKM X;  1FI5 A;  1JBA A;  2JUL A;  3PFV A;  1CMG A;  1N2D A;  2QPT A;  3NSL A;  1KWO B;  1PSB A;  1UHJ A;  1XFZ O;  2F3Z A;  1LKJ A;  2F3Y A;  1JC2 A;  1L2O C;  2D8N A;  3SG5 A;  2QAC A;  1CKK A;  3GOF A;  2KHN A;  2KI6 C;  2JT0 A;  2LCP A;  3IQQ A;  2BBM A;  4M2P A;  2HPS A;  1QTX A;  1Y1A A;  1SPY A;  1UHI A;  2MHH A;  2I94 A;  2LNK A;  3CLN A;  1UHN A;  2EGD A;  2M1U A;  1ZOT B;  2LUC A;  2G9B A;  4GGF C;  3TUY C;  3TDZ A;  2EC6 C;  3JTD C;  1K9U A;  4GFT A;  1B4C A;  4UPG A;  5ER5 A;  1XFX O;  1A4P A;  2JT8 A;  5KSZ A;  1NYA A;  1B47 A;  1Q80 A;  3HX4 A;  5KTY A;  1TRF A;  3OHM B;  1QVI Y;  1SK6 D;  1CMF A;  1K93 D;  4BY5 A;  2JT3 A;  2O5G A;  3VRP A;  1B8L A;  1U5I A;  2CNP A;  2MRD A;  2LHL A;  1F4O A;  2COL B;  5AEQ A;  4A4B A;  3AAJ A;  1BG1 A;  4C0J A;  1NIW A;  3KEV A;  5D69 A;  1BU3 A;  3C1V A;  1SCM B;  2OS8 B;  3OX6 A;  4PHM A;  1EH2 A;  3BUO B;  3EK7 A;  3TS5 C;  4MZJ A;  1KFU L;  1K94 A;  2TN4 A;  3EK8 A;  3FWB A;  1WY9 A;  2JC2 A;  4AQI A;  1CDP A;  1YUU A;  5DKN A;  1J7O A;  2JXL A;  4YI9 A;  1JF0 A;  1REC A;  1B1G A;  1S5G Y;  1DGV A;  1YVL A;  3PAT A;  1RFJ A;  3F45 A;  1LA3 A;  4XYN A;  1B9A A;  1JUO A;  4NDC A;  1BR1 B;  2CTN A;  4WRI A;  1YR5 A;  1HT9 A;  3SG3 A;  2ZRT A;  1GQM A;  2I18 A;  1SCV A;  1NWD A;  4U8D A;  4N1G A;  2JXC A;  5B8I B;  5AXI A;  2PAL A;  4CFQ A;  3D10 A;  3FWC A;  1KK7 Y;  1XA5 A;  1CTR A;  1PVB A;  2M49 B;  4TNC A;  4ORB B;  4YGD B;  1NX2 A;  5AFP A;  3I5H C;  4PHN A;  4QJ3 B;  4DRW A;  2LLU A;  5HKW A;  2ZN9 A;  3SIA A;  3WHT B;  1CFC A;  1A75 B;  1SYM A;  2Y1N A;  2M7L A;  1PUL A;  1BR4 B;  1TNW A;  1OOJ A;  1SR6 C;  1K8U A;  5PAL A;  1TN4 A;  2K8M B;  5JJG A;  3RM1 A;  2JRF A;  3I5I B;  4OCI A;  1ZUZ A;  3AAK A;  4A4C A;  1B7T Z;  1JFK A;  1AP4 A;  4R1E A;  1MHO A;  1DJX A;  2MBX A;  4MRX A;  1GJY A;  2BL0 C;  2IS9 A;  1CNP A;  1YUR A;  1AHR A;  1W7J B;  1KQM B;  1MF8 B;  5HLO A;  3FS7 A;  1W7I B;  1XO5 A;  2LP3 A;  1F4Q A;  2OTG B;  3H4S E;  4BY4 A;  3NSI A;  2BCB A;  1FW4 A;  2EHB A;  1F71 A;  1G33 A;  1LVC D;  5CSN A;  2JNF A;  2G2B A;  1V1F A;  1KQV A;  1DMO A;  3BUX B;  1VRK A;  4I5J A;  1QIV A;  1OMV A;  1Y1X A;  2LHI A;  5K89 A;  1CB1 A;  2PSR A;  2WCF A;  1R6P A;  3SJS A;  5IBW A;  1H8B A;  3JVT B;  1S1E A;  4AQJ A;  1KFX S;  4CFR A;  2K0J A;  2CBL A;  3ZNI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...