4BY5A

Crystal structure of drosophila frq2
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
178
structure length
171
Chain Sequence
NSKLKQDTIDRLTTDTYFTEKEIRQWHKGFLKDCPNGLLTEQGFIKIYKQFFPDGDPSKFASLVFRVFDENNDGAIEFEEFIRALSITSRGNLDEKLHWAFRLYDVDNDGYITREEMYNIVDAIYQMVGQNTPQKRVDKIFDQMDKNHDDRLTLEEFREGSKADPRMVQAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FI18190P1
publication title The Guanine-Exchange Factor Ric8A Binds the Calcium Sensor Ncs-1 to Regulate Synapse Number and Probability of Release.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Calcium-binding protein
total genus 63
structure length 171
sequence length 178
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-07-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4by5A01
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4by5A02
4ORBB 1WDCC 1CDMA 5AANA 1F70A 1NPQA 1XK4C 1IGVA 1NX0A 1AJ5A 1GGWA 1PALA 1SR6C 1NCYA 1SKTA 2PASA 1SMGA 4I5KA 2LMTA 1UHNA 2E6WA 1QV1A 1UWOA 1F71A 5BPJA 1BU3A 4ORAB 2BKIB 1GQMA 2KQYA 4OV2A 1SYMA 3LK0A 4MN0A 3BQ3A 1M46A 2FCEA 3I5FC 1N0YA 2FOTA 2F3YA 1WRZA 4D1EA 4OVNF 3SIAA 3VRPA 1OZSA 1BJFA 1QX2A 1K95A 4ETOA 5AERA 1PK0D 1XK4A 1SNLA 2MJWB 1KFUL 3NSIA 2BBMA 3EK4A 1MUXA 1LVCD 2O5GA 3EVUA 4GPLB 1NSHA 2JNFA 2L5XB 1K94A 1CMGA 2LC5A 2KI4B 1ALWA 2KYCA 1F54A 2WC8A 1J7QA 1EL4A 5IBWA 1DF0A 3LLEA 3EKJA 2G9BA 1DTLA 1B7TY 3CS1A 1UHJA 3E3RA 3JVTC 2I18A 3TS5C 4M2QA 1BG1A 4AOMA 1NYAA 1S6IA 5I2LA 1PVBA 2HQ8A 2JU0A 1CDLA 2JXLA 2LUXA 4MSPA 5DKNA 2PALA 4FQOA 1NCZA 3GK4X 2BCAA 2PRUA 1BLQA 1S1EA 1EH2A 4JPZB 1W7IB 1L2OC 2PSRA 1DJZA 1RFJA 3DVKA 3I5GB 1Q80A 1CTRA 4GUKA 5AFPA 1J1DA 4QJ5B 1BF5A 1ODBA 1YURA 2Q4UA 1HQVA 2KAVA 4M2PA 4N1FA 3CWGA 2M1KB 1WDCB 2BE4A 3RM1A 4PDZA 1F8HA 5CSNA 1K9UA 3DF0A 1Y0VH 1FW4A 4GBAA 4IL1A 3SIBA 1QS7A 1MWNA 1QIWA 1SR6B 1UHIA 1K93D 1YRTB 1D1OA 2KQ6A 1XFYO 2LM5A 2KHNA 2JXCA 1YVHA 4FTGA 1B8LA 4HSZA 2KNEA 1IH0A 1A75B 1SY9A 2EHBA 3H4SE 1MXLC 1A29A 3JTDC 3VRNA 3PATA 1OQPA 2KFGA 1JFKA 3I5FB 3TDUA 5ER5A 1UP5A 1SW8A 2LVIA 1J7RA 1XFVO 4PCWA 4ZCVA 3SG5A 4YRUA 1BR1B 1TN4A 1AUIB 2JTTA 1EXRA 3PALA 4N5XA 3DD4A 3TDIA 1CLMA 2LCPA 3HX4A 1H4BA 3BXKA 3VRRA 1QVIY 5B8IB 4MZKA 3VGOA 5HKYA 1M45A 2JC2A 3I5IC 4YGDB 2JT0A 3LCPC 4PHJA 4N1GA 1B8RA 1GJYA 1ALVA 3BUNB 2JT3A 3WHTB 1S6JA 2ZNEA 1B9AA 1SK6D 1KWOC 1S3PA 3JVTB 2LHLA 1JUOA 3TS5B 4C0JA 2ZN8A 2OPOA 5I2QA 1JFJA 4PHMA 4PHKA 1OMRA 1R6PA 2F8PA 1QX7A 5DKRA 1YTZC 4PE7A 4QJ3B 1DJIA 3KEVA 2P6BB 1L2OB 5I2OA 3CLNA 4L9MA 2HETA 2NZ0A 1NIWA 1IJ6A 1DGVA 3F45A 2F2OA 1QLSA 1CFDA 3EKHA 3FIAA 1H8BA 1S6CA 2OS8C 3WNXB 4YGCB 5ER4X 2EC6C 2KBMA 4ICBA 4DRWA 2OTGC 2M29A 4DS7A 5GQQC 3NSOA 1TIZA 3BOWB 3I5HC 2ZN9A 3CR2A 3KF9A 3JTDB 1A03A 5FYXA 1DJYA 1DJHA 2WNDA 2K7OA 1KFXS 1A4PA 1AJ4A 5AEQA 2COLB 4MVFA 1U5IA 1HT9A 3HCMA 4CFRA 2JQ6A 1KSOA 1IRJA 3KPXA 2MBXA 1B47A 1YUUA 3GK2A 1BMOA 2A4JA 2K7BA 5HYDA 1N65A 1OE9B 4GAOA 2KI6C 1Y1XA 2LAPA 4YGBB 1MXEA 4HRHA 4CPVA 4MZJA 4Q04A 2LMUA 1G8IA 4P5OE 3I5IB 4NDBA 2DOQA 1YVLA 5F6TA 1PVAA 2G2BA 2L51A 2SASA 2ZRTA 1PSBA 3IQQA 3WXAA 4BY4A 1CNPA 2JPTA 4P2YB 3AAJA 1G33A 5AXIA 3CGAA 2KBIA 4HRGA 5HLVA 2Y1NA 4YGAA 1C07A 1KWOB 3A4UB 1TCFA 2KAXA 1BOCA 2CXJA 2F2PA 3FS7A 1DGUA 2L4IA 1LA0A 2LANA 2KI6D 1F55A 2K7DA 1TCOB 1Y1AA 1YUSA 2F33A 2V53A 2GGMA 3AKAA 2I7AA 3MSEB 4MEWA 2BL0C 2KFFA 3EVVA 3RLZA 1B4CA 1DVIA 1TNQA 1QIVA 3DVMA 1S5GZ 2K2AA 2LP2A 1CB1A 4C0LA 3TUYC 1ZACA 2BE6A 1UHKA 2Y1MA 1OSAA 1QATA 4I5JA 1CM1A 1CM4A 2GGZA 4R1EA 2LVKA 2MLFC 2MAZA 2PMYA 2BBNA 1KK7Y 1SCMC 2AUCA 1FI5A 2OS8B 2KYFA 2AMIA 2M49B 3BUXB 1V1GA 4PE0A 1CKKA 1IG5A 2CTNA 2JT8A 4U8DA 2GV5A 1DF0B 1W7JB 2EC6B 2WCEA 5CPVA 1KQVA 2KOTA 3A8RA 2OTGB 1E8AA 1K96A 1QTXA 2SCPA 4GGNA 4TNCA 2AAOA 1BODA 2CNPA 2M8UA 3CTNA 3I5HB 2JNXA 2IS9A 1SCVA 1KFXL 1DJWA 1TTXA 2LVVA 1UUSA 5HLOA 2H61C 3EVRA 1NP8A 2MHHA 1NX3A 1SL8A 2FCDA 2KGBC 3AAKA 1XFWO 3NXAA 2WCBA 3SG7A 1JF0A 1KK8C 2LLUA 4CIDA 3EK8A 2LE9B 2M97A 4AQIA 4GGFC 1BT6A 1K9KA 4QJ4B 2FJUB 1AK8A 1YX7A 4PALA 1TNPA 3OX5A 4BY5A 1J7OA 4NDDA 5KTYA 1QLKA 4HREE 3OP0A 4OKHA 3DF0B 3O2PA 1YX8A 5D69A 1CFPA 2CCMA 4WRIA 1YRUB 1QV0A 1UHHA 4YI8A 1TNWA 1OMVA 2M0RA 2H61A 3GOFA 2LNKA 4MRYA 5CSFA 3DVJA 3EK7A 3LL8B 2LLTA 1GGZA 1A2XA 1PULA 1MF8B 1TOPA 2LLSA 4GNKB 4USLA 1UURA 4WQ3A 1CFFA 1KQMC 3VROA 2KAYA 2Y5IA 3CR4X 2VRGA 2K0JA 1WY9A 2BL0B 3PN7C 4GGFA 1XA5A 1M63B 1RWYA 1MQ1A 4DIRA 1B1GA 3CR5X 4XYNA 4OCIA 5KU1A 4I5LB 4YI9A 3SG2A 1G4YR 1S36A 1LA3A 3TUYB 1Y1UA 2JWWA 4M2OA 1NCXA 1QXPA 2TN4A 3PLFB 4PE1A 5TNCA 1DT7B 1LKJA 2JTZA 1DMOA 1PSRA 4YGEB 4I5NB 3NSKA 1NUBA 1SCMB 4XJKA 1WLZA 3IQOA 1JF2A 5KSZA 2EGDA 2LVJA 1RK9A 1K8UA 2LMVA 2HQWA 2JULA 3D0YA 3OB2B 2M1UA 1B8CA 2K61A 4AQJA 2O60A 1QVIZ 1FF1A 5CSJA 1L7ZA 2ZRSA 1S26D 2M3WA 3M0WA 1PRWA 2L98A 1FI6A 1NX2A 1MHOA 4UPGA 1K9PA 2CBLA 2KDHA 1S5GY 4PE4A 4JQ0D 1IQ3A 1XFZO 3LK1A 5I8NA 2NLNA 2M7NA 2CT9A 4DCKA 4F0ZB 2E30A 3OB1B 2NXQA 3BUOB 3BUWB 2MRDA 4CFQA 3OHMB 2F3ZA 2MLEC 1KK8B 3VRQA 1ZUZA 3FWBA 1JWDA 2KFHA 1F4QA 5CSIA 3PM8A 1AVSA 1OZOA 3O6BA 1WLMA 3BYAA 3GK1A 2JRFA 4PHNA 2L4HA 3TZ1A 2PVBA 2JZIA 2WORA 3NSLA 2Y4QA 2L0PA 1VRKA 4NDCA 1Y6WA 2H2KA 2NCOA 2BECA 2WOSA 4XJKB 1KCYA 1FBVA 2ZKMX 2BCXA 5HKZA 2BKHB 1A75A 2L2EA 4YBHB 1XFUO 3D0YB 2KGRA 3IF7A 1AHRA 5DKQA 2Q91A 2ISDA 2NCPA 2HF5A 3TDZA 1SL7A 1KQMB 1TRFA 1OMDA 3SG6A 3SG3A 4OR9B 4A4BA 4MLWA 2QPTA 1ZOTB 4WQ2A 4ZCUA 3PN7B 2HPSA 1U5IB 1J1EA 4MBEA 5HKWA 1WRLA 2KSPA 2RGIA 2WCFA 3PFVA 3CZTX 1MR8A 1V1FA 5D7FA 2I2RE 1XO5A 1SPYA 4C0KA 4GFTA 1CDPA 1EJ3A 1K2HA 2L50A 5PALA 4E68A 1M39A 1DJXA 3BUMB 3D10A 3SJSA 2BCBA 2ZNDA 2K7CA 2R2IA 1M31A 3PSRA 1WRKA 1C7VA 1EG4A 2LP3A 1XYDA 1QASA 1ZFSA 4MRXA 4DUQA 5JJGA 3ZWHA 3OX6A 2K8MB 1K90D 2M9GA 1X02A 1KSMA 1CMFA 2LHIA 2MA2A 2QACA 1NX1A 4JWQA 1B7TZ 1QJTA 1FPWA 4ORCB 1JBAA 3SG4A 1BR4B 1SRAA 1RECA 1J55A 1C7WA 1IJ5A 1JSAA 1QX5B 1CDNA 1KFUS 1RJVA 2KI4C 2LV7A 5G08A 3DVEA 5K89A 3ICBA 3WHUB 1XFXO 1NWDA 3O78A 1LINA 2B1UA 3C1VA 3FWCA 3KO0A 4CLNA 2D8NA 2ZFDA 1YR5A 3O4YA 2M7LA 1SL9A 3QRXA 1LXFC 1IWQA 1EG3A 3BOWA 3K21A 1F4OA 3KHEA 1YUTA 1AP4A 1SBJA 2I94A 1KK7Z 4MZLA 4NQGA 5JOLA 1XVJA 2LUCA 4A4CA 1RROA 2K2FA 1TNXA 1J7PA 1CLLA 2JOJA 1RTP1 1N2DA 1CFCA 3ZNIA 3AKBA 1R2UA 1ZMZA 1DJGA 1CLBA 1IQ5A 1OOJA 3I5GC 5J3XA 1IKUA 1JC2A
chains in the Genus database with same CATH superfamily
1DC1A 4ORBB 1WDCC 1CDMA 5AANA 1F70A 1NPQA 1XK4C 1IGVA 1NX0A 1AJ5A 3B86A 3PM2A 1GGWA 1PALA 1SR6C 1NCYA 1SKTA 2PASA 3UO9A 1SMGA 2WCKA 4I5KA 2LMTA 1UHNA 1GM0A 2E6WA 1QV1A 1UWOA 1F71A 4OZDA 5BPJA 1BU3A 4ORAB 2BKIB 1GQMA 2KQYA 4OV2A 1SYMA 3LK0A 4MN0A 3BQ3A 1M46A 2FCEA 3I5FC 1N0YA 2FOTA 2F3YA 1WRZA 4D1EA 4OVNF 3SIAA 3VRPA 1OZSA 1BJFA 1TWOA 1QX2A 1K95A 4ETOA 4JKTA 5AERA 1PK0D 1XK4A 1SNLA 2MJWB 1KFUL 3NSIA 2BBMA 3EK4A 1MUXA 1LVCD 2O5GA 3EVUA 1SSEB 1NSHA 2JNFA 2L5XB 2WCHA 1K94A 4GPLB 1CMGA 2LC5A 3IVTA 2KI4B 1ALWA 2KYCA 3EG5B 1F54A 2WC8A 1J7QA 3QMEA 1EL4A 3N7HA 5IBWA 1DF0A 3LLEA 3EKJA 2G9BA 3D74A 2QEVA 1DTLA 1B7TY 3CS1A 1UHJA 3E3RA 2WCMA 2I18A 3JVTC 3TS5C 4IJ7A 4M2QA 1BG1A 4AOMA 1NYAA 1S6IA 5I2LA 4PT1A 1PVBA 2HQ8A 2JU0A 1CDLA 2JXLA 2LUXA 3D77A 4MSPA 2PALA 5DKNA 4FQOA 1NCZA 3GK4X 2BCAA 3FE9A 2PRUA 2PYQA 1S1EA 1BLQA 1EH2A 4JPZB 1W7IB 3CZ2A 1L2OC 1LS8A 2PSRA 1DJZA 1RFJA 3DVKA 3I5GB 1Q80A 1CTRA 4GUKA 5AFPA 1J1DA 4INWA 3SS4A 4QJ5B 1BF5A 2BNXA 1ODBA 3CYZA 5D3OA 1YURA 2Q4UA 1HQVA 2KAVA 4M2PA 4N1FA 3CWGA 2M1KB 1WDCB 2BE4A 3R1PA 3RM1A 4PDZA 1F8HA 5CSNA 1K9UA 3DF0A 1Y0VH 1FW4A 4GBAA 4IL1A 3SIBA 1QS7A 3R1VA 1MWNA 1QIWA 1SR6B 1UHIA 1K93D 1YRTB 1D1OA 3CZ0A 2KQ6A 1XFYO 2LM5A 2KHNA 2JXCA 1YVHA 4FTGA 1B8LA 4HSZA 2KNEA 1IH0A 1A75B 4F7FA 3BFAA 1SY9A 2EHBA 3H4SE 1MXLC 1A29A 3JTDC 3VRNA 3PATA 1OQPA 2KFGA 1JFKA 3I5FB 3TDUA 5ER5A 1UP5A 1SW8A 2LVIA 3RZSA 1J7RA 1XFVO 4PCWA 4ZCVA 3SG5A 4YRUA 1BR1B 1TN4A 1AUIB 2JTTA 1EXRA 3PALA 4N5XA 3DD4A 3TDIA 1CLMA 2LCPA 3HX4A 1H4BA 3BXKA 3VRRA 1QVIY 5B8IB 4MZKA 3VGOA 5HKYA 1M45A 3B88A 2JC2A 3I5IC 4YGDB 3S0EA 2JT0A 3LCPC 4PHJA 4N1GA 1B8RA 1GJYA 4INXA 1ALVA 3BUNB 2JT3A 3WHTB 3L4LA 1S6JA 1XFRA 2ZNEA 2QEBA 1B9AA 1SK6D 1KWOC 1S3PA 3JVTB 2LHLA 3CZ1A 1JUOA 3TS5B 4C0JA 2ZN8A 2OPOA 5I2QA 1JFJA 4PHMA 4PHKA 3NHTA 1OMRA 1R6PA 2F8PA 1QX7A 5DKRA 2H8VA 1YTZC 4PE7A 4QJ3B 1DJIA 3KEVA 2P6BB 1L2OB 2L2CA 3CLNA 5I2OA 4L9MA 2HETA 2NZ0A 1NIWA 1IJ6A 2P71A 1DGVA 3F45A 2F2OA 1QLSA 1CFDA 3EKHA 3FIAA 1H8BA 1S6CA 1OOHA 2OS8C 3NHIA 3WNXB 4YGCB 5ER4X 3DXLA 2EC6C 2KBMA 4ICBA 4DRWA 2OTGC 2M29A 3D76A 4DS7A 5GQQC 2KLDA 3NSOA 1DQEA 1TIZA 3BOWB 3I5HC 2ZN9A 3CR2A 3KF9A 3JTDB 1A03A 5FYXA 1DJYA 1DJHA 2WNDA 2K7OA 1KFXS 2WC5A 1A4PA 1AJ4A 5AEQA 2COLB 4MVFA 1U5IA 1HT9A 3HCMA 1P28A 2JQ6A 4CFRA 1KSOA 1IRJA 3KPXA 2MBXA 1B47A 1YUUA 3GK2A 1BMOA 2A4JA 2K7BA 2PQLA 3R1OA 1N65A 5HYDA 1OW4A 1OE9B 4GAOA 2KI6C 1Y1XA 3B7AA 2LAPA 4YGBB 3DY9A 1MXEA 4HRHA 2K60A 4MZJA 4Q04A 2LMUA 1G8IA 4FQTA 4P5OE 3I5IB 4CPVA 3S0AA 3BFHA 2DOQA 4NDBA 3VB1A 1YVLA 5F6TA 1PVAA 2G2BA 2L51A 2SASA 2ZRTA 1PSBA 3IQQA 3WXAA 4BY4A 1CNPA 2JPTA 4P2YB 5I94A 3AAJA 1G33A 5AXIA 3CGAA 2KPHA 2KBIA 4HRGA 5HLVA 5EL2A 2Y1NA 4YGAA 1C07A 1KWOB 3A4UB 1TCFA 2KAXA 1BOCA 2CXJA 2F2PA 3FS7A 1DGUA 2L4IA 1LA0A 2LANA 2KI6D 1F55A 2K7DA 2JPOA 1TCOB 1Y1AA 1YUSA 2F33A 2V53A 2GGMA 3AKAA 2I7AA 3MSEB 4MEWA 1Z2CB 2BL0C 2KFFA 3EVVA 5FI2A 3RLZA 1B4CA 3D75A 1DVIA 1TNQA 3S0GA 1QIVA 3DVMA 1S5GZ 2K2AA 2LP2A 1CB1A 4C0LA 3TUYC 1ZACA 3SS3A 2BE6A 1UHKA 2Y1MA 1OSAA 1QATA 4I5JA 1CM1A 1CM4A 2GGZA 4R1EA 2LVKA 2MLFC 2MAZA 2PMYA 3OGNA 2BBNA 1KK7Y 1SCMC 2AUCA 1FI5A 2OS8B 2KYFA 2P70A 3SS5A 2AMIA 2M49B 3BUXB 1V1GA 4PE0A 1CKKA 1IG5A 2CTNA 2JT8A 4U8DA 2GV5A 1DF0B 1W7JB 2EC6B 2WCEA 3BJHA 5CPVA 2KOTA 1KQVA 3A8RA 2OTGB 1E8AA 1K96A 1C3YA 1QTXA 2SCPA 4GGNA 4TNCA 2AAOA 1BODA 2CNPA 2M8UA 3CTNA 3I5HB 2JNXA 2IS9A 1SCVA 3O4XA 1KFXL 1DJWA 1TTXA 2LVVA 3BFBA 1UUSA 5HLOA 2H61C 3D73A 2QEOA 3EVRA 1NP8A 2MHHA 1NX3A 1SL8A 2FCDA 2KGBC 3AAKA 1XFWO 3NXAA 2WCBA 3SG7A 1JF0A 1KK8C 2LLUA 4CIDA 3EK8A 2LE9B 2M97A 4AQIA 4GGFC 1BT6A 1K9KA 4QJ4B 2FJUB 1IIOA 1AK8A 1YX7A 4PALA 1TNPA 3OX5A 4BY5A 1J7OA 4NDDA 3L4AA 5KTYA 1QLKA 4HREE 3OP0A 4OKHA 3DF0B 5FI7A 3O2PA 1YX8A 5D69A 1CFPA 1DELA 2CCMA 1YRUB 2QEHA 4WRIA 1QV0A 3S0FA 1UHHA 4YI8A 1TNWA 1OMVA 2ERBA 2H61A 2M0RA 3GOFA 2LNKA 4MRYA 5CSFA 3DVJA 3EK7A 3LL8B 2LLTA 1A2XA 1GGZA 1PULA 1MF8B 1QWVA 1TOPA 2LLSA 2WC6A 1UURA 3CABA 4GNKB 4USLA 4WQ3A 1CFFA 1KQMC 3VROA 2KAYA 2Y5IA 3CR4X 2VRGA 3R72A 2K0JA 1WY9A 2BL0B 3K1EA 3PN7C 3DZTA 4GGFA 1XA5A 1M63B 1RWYA 1MQ1A 4DIRA 1B1GA 3CR5X 3L47A 4XYNA 4OCIA 3DYEA 4I5LB 5KU1A 4YI9A 3SG2A 1G4YR 1S36A 3CDNA 1LA3A 3TUYB 1Y1UA 2JWWA 4M2OA 1NCXA 1QXPA 2TN4A 3PLFB 4PE1A 5TNCA 1DT7B 1LKJA 2JTZA 1DMOA 1PSRA 4YGEB 4I5NB 3NSKA 1NUBA 1SCMB 4XJKA 1WLZA 3IQOA 1JF2A 5KSZA 2EGDA 2LVJA 1RK9A 2BAPA 1K8UA 2LMVA 2HQWA 2JULA 3D0YA 3OB2B 2M1UA 1B8CA 3B6XA 2GTEA 1T14A 2K61A 4AQJA 2O60A 1QVIZ 1TUJA 5HL1A 5CSJA 3PJIA 1FF1A 1L7ZA 2ZRSA 1S26D 2M3WA 3M0WA 1PRWA 2L98A 1FI6A 1NX2A 2QDIA 1MHOA 4UPGA 1K9PA 2CBLA 2KDHA 1Z4HA 1S5GY 4PE4A 4JQ0D 1IQ3A 2L5YA 1XFZO 3LK1A 5I8NA 2NLNA 2M7NA 2CT9A 4DCKA 4F0ZB 2E30A 3OB1B 2NXQA 3BUOB 2YGUA 3BUWB 2MRDA 4CFQA 3OHMB 2F3ZA 2MLEC 1KK8B 3VRQA 1ZUZA 3FWBA 1JWDA 2KFHA 1F4QA 5CSIA 3PM8A 1AVSA 1OZOA 3O6BA 1WLMA 1DEKA 3BYAA 3GK1A 2JRFA 4KYNA 1OOGA 1W9ZA 4PHNA 2L4HA 3TZ1A 2PVBA 2JZIA 2WORA 3NSLA 2Y4QA 2L0PA 1VRKA 4NDCA 1Y6WA 2H2KA 2NCOA 2BECA 2WOSA 4XJKB 1KCYA 1FBVA 2ZKMX 2BCXA 5HKZA 2BKHB 1A75A 2FJYA 2L2EA 4YBHB 1XFUO 3D0YB 1OOIX 2KGRA 1AHRA 3IF7A 5DKQA 2Q91A 2ISDA 2NCPA 2HF5A 3TDZA 1SL7A 1KQMB 1TRFA 1OMDA 3SG6A 3SG3A 4OR9B 4A4BA 4MLWA 2QPTA 1ZOTB 3B87A 4WQ2A 4ZCUA 3PN7B 2HPSA 1U5IB 3FE8A 1J1EA 4MBEA 5HKWA 5FI6A 1WRLA 2KSPA 2RGIA 2WCFA 3PFVA 3CZTX 1MR8A 1V1FA 5D7FA 2I2RE 1OOFA 1XO5A 1SPYA 4C0KA 3Q8IA 4GFTA 1CDPA 1EJ3A 2WCLA 1K2HA 2L50A 5PALA 1TUZA 4E68A 1M39A 1DJXA 3BUMB 3D10A 3SJSA 2BCBA 2ZNDA 3OBVA 2K7CA 2R2IA 1M31A 3PSRA 1WRKA 1C7VA 1EG4A 2LP3A 1XYDA 1QASA 1ZFSA 4MRXA 4DUQA 5JJGA 3ZWHA 3OX6A 2K8MB 1K90D 2M9GA 1X02A 1KSMA 3S0DA 1CMFA 2LHIA 2MA2A 2QACA 1NX1A 4JWQA 1B7TZ 1QJTA 1FPWA 3D78A 4ORCB 3NGVA 1JBAA 3SG4A 1BR4B 1SRAA 1RECA 3FE6A 1J55A 1ORGA 1C7WA 1IJ5A 1JSAA 1QX5B 1CDNA 1KFUS 1RJVA 2KI4C 2LV7A 5G08A 4JD9A 3DVEA 3V2LA 5K89A 3ICBA 3WHUB 1XFXO 1NWDA 3O78A 1LINA 2B1UA 3C1VA 3FWCA 3KO0A 4CLNA 2D8NA 5DICA 2ZFDA 1C3ZA 2KLEA 1YR5A 3O4YA 2M7LA 1SL9A 3QRXA 1LXFC 1IWQA 1EG3A 3BOWA 3K21A 1F4OA 3KHEA 1YUTA 1AP4A 1SBJA 2I94A 1KK7Z 4MZLA 4NQGA 5JOLA 1XVJA 2LUCA 4A4CA 1RROA 2K2FA 1TNXA 1J7PA 1CLLA 2JOJA 1RTP1 1N2DA 1CFCA 3ZNIA 3AKBA 1R2UA 1ZMZA 3UNWA 1DJGA 2WCJA 1CLBA 1IQ5A 1OOJA 3I5GC 5J3XA 1IKUA 1JC2A 3S0BA
chains in the Genus database with same CATH topology
4ORBB 1WDCC 1CDMA 5AANA 1F70A 1NPQA 1XK4C 1IGVA 1NX0A 1AJ5A 1GGWA 1PALA 1SR6C 1NCYA 1SKTA 2PASA 1SMGA 4I5KA 2LMTA 1UHNA 2E6WA 1QV1A 1UWOA 1F71A 5BPJA 1BU3A 4ORAB 2BKIB 1GQMA 2KQYA 4OV2A 1SYMA 3LK0A 4MN0A 3BQ3A 1M46A 2FCEA 3I5FC 1N0YA 2FOTA 2F3YA 1WRZA 4D1EA 4OVNF 3SIAA 3VRPA 1OZSA 1BJFA 1QX2A 1K95A 4ETOA 5AERA 1PK0D 1XK4A 1SNLA 2MJWB 1KFUL 3NSIA 2BBMA 3EK4A 1MUXA 1LVCD 2O5GA 3EVUA 4GPLB 1NSHA 2JNFA 2L5XB 1K94A 1CMGA 2LC5A 2KI4B 1ALWA 2KYCA 1F54A 2WC8A 1J7QA 1EL4A 5IBWA 1DF0A 3LLEA 3EKJA 2G9BA 1DTLA 1B7TY 3CS1A 1UHJA 3E3RA 3JVTC 2I18A 3TS5C 4M2QA 1BG1A 4AOMA 1NYAA 1S6IA 5I2LA 1PVBA 2HQ8A 2JU0A 1CDLA 2JXLA 2LUXA 4MSPA 5DKNA 2PALA 4FQOA 1NCZA 3GK4X 2BCAA 2PRUA 1BLQA 1S1EA 1EH2A 4JPZB 1W7IB 1L2OC 2PSRA 1DJZA 1RFJA 3DVKA 3I5GB 1Q80A 1CTRA 4GUKA 5AFPA 1J1DA 4QJ5B 1BF5A 1ODBA 1YURA 2Q4UA 1HQVA 2KAVA 4M2PA 4N1FA 3CWGA 2M1KB 1WDCB 2BE4A 3RM1A 4PDZA 1F8HA 5CSNA 1K9UA 3DF0A 1Y0VH 1FW4A 4GBAA 4IL1A 3SIBA 1QS7A 1MWNA 1QIWA 1SR6B 1UHIA 1K93D 1YRTB 1D1OA 2KQ6A 1XFYO 2LM5A 2KHNA 2JXCA 1YVHA 4FTGA 1B8LA 4HSZA 2KNEA 1IH0A 1A75B 1SY9A 2EHBA 3H4SE 1MXLC 1A29A 3JTDC 3VRNA 3PATA 1OQPA 2KFGA 1JFKA 3I5FB 3TDUA 5ER5A 1UP5A 1SW8A 2LVIA 1J7RA 1XFVO 4PCWA 4ZCVA 3SG5A 4YRUA 1BR1B 1TN4A 1AUIB 2JTTA 1EXRA 3PALA 4N5XA 3DD4A 3TDIA 1CLMA 2LCPA 3HX4A 1H4BA 3BXKA 3VRRA 1QVIY 5B8IB 4MZKA 3VGOA 5HKYA 1M45A 2JC2A 3I5IC 4YGDB 2JT0A 3LCPC 4PHJA 4N1GA 1B8RA 1GJYA 1ALVA 3BUNB 2JT3A 3WHTB 1S6JA 2ZNEA 1B9AA 1SK6D 1KWOC 1S3PA 3JVTB 2LHLA 1JUOA 3TS5B 4C0JA 2ZN8A 2OPOA 5I2QA 1JFJA 4PHMA 4PHKA 1OMRA 1R6PA 2F8PA 1QX7A 5DKRA 1YTZC 4PE7A 4QJ3B 1DJIA 3KEVA 2P6BB 1L2OB 5I2OA 3CLNA 4L9MA 2HETA 2NZ0A 1NIWA 1IJ6A 1DGVA 3F45A 2F2OA 1QLSA 1CFDA 3EKHA 3FIAA 1H8BA 1S6CA 2OS8C 3WNXB 4YGCB 5ER4X 2EC6C 2KBMA 4ICBA 4DRWA 2OTGC 2M29A 4DS7A 5GQQC 3NSOA 1TIZA 3BOWB 3I5HC 2ZN9A 3CR2A 3KF9A 3JTDB 1A03A 5FYXA 1DJYA 1DJHA 2WNDA 2K7OA 1KFXS 1A4PA 1AJ4A 5AEQA 2COLB 4MVFA 1U5IA 1HT9A 3HCMA 4CFRA 2JQ6A 1KSOA 1IRJA 3KPXA 2MBXA 1B47A 1YUUA 3GK2A 1BMOA 2A4JA 2K7BA 5HYDA 1N65A 1OE9B 4GAOA 2KI6C 1Y1XA 2LAPA 4YGBB 1MXEA 4HRHA 4CPVA 4MZJA 4Q04A 2LMUA 1G8IA 4P5OE 3I5IB 4NDBA 2DOQA 1YVLA 5F6TA 1PVAA 2G2BA 2L51A 2SASA 2ZRTA 1PSBA 3IQQA 3WXAA 4BY4A 1CNPA 2JPTA 4P2YB 3AAJA 1G33A 5AXIA 3CGAA 2KBIA 4HRGA 5HLVA 2Y1NA 4YGAA 1C07A 1KWOB 3A4UB 1TCFA 2KAXA 1BOCA 2CXJA 2F2PA 3FS7A 1DGUA 2L4IA 1LA0A 2LANA 2KI6D 1F55A 2K7DA 1TCOB 1Y1AA 1YUSA 2F33A 2V53A 2GGMA 3AKAA 2I7AA 3MSEB 4MEWA 2BL0C 2KFFA 3EVVA 3RLZA 1B4CA 1DVIA 1TNQA 1QIVA 3DVMA 1S5GZ 2K2AA 2LP2A 1CB1A 4C0LA 3TUYC 1ZACA 2BE6A 1UHKA 2Y1MA 1OSAA 1QATA 4I5JA 1CM1A 1CM4A 2GGZA 4R1EA 2LVKA 2MLFC 2MAZA 2PMYA 2BBNA 1KK7Y 1SCMC 2AUCA 1FI5A 2OS8B 2KYFA 2AMIA 2M49B 3BUXB 1V1GA 4PE0A 1CKKA 1IG5A 2CTNA 2JT8A 4U8DA 2GV5A 1DF0B 1W7JB 2EC6B 2WCEA 5CPVA 1KQVA 2KOTA 3A8RA 2OTGB 1E8AA 1K96A 1QTXA 2SCPA 4GGNA 4TNCA 2AAOA 1BODA 2CNPA 2M8UA 3CTNA 3I5HB 2JNXA 2IS9A 1SCVA 1KFXL 1DJWA 1TTXA 2LVVA 1UUSA 5HLOA 2H61C 3EVRA 1NP8A 2MHHA 1NX3A 1SL8A 2FCDA 2KGBC 3AAKA 1XFWO 3NXAA 2WCBA 3SG7A 1JF0A 1KK8C 2LLUA 4CIDA 3EK8A 2LE9B 2M97A 4AQIA 4GGFC 1BT6A 1K9KA 4QJ4B 2FJUB 1AK8A 1YX7A 4PALA 1TNPA 3OX5A 4BY5A 1J7OA 4NDDA 5KTYA 1QLKA 4HREE 3OP0A 4OKHA 3DF0B 3O2PA 1YX8A 5D69A 1CFPA 2CCMA 4WRIA 1YRUB 1QV0A 1UHHA 4YI8A 1TNWA 1OMVA 2M0RA 2H61A 3GOFA 2LNKA 4MRYA 5CSFA 3DVJA 3EK7A 3LL8B 2LLTA 1GGZA 1A2XA 1PULA 1MF8B 1TOPA 2LLSA 4GNKB 4USLA 1UURA 4WQ3A 1CFFA 1KQMC 3VROA 2KAYA 2Y5IA 3CR4X 2VRGA 2K0JA 1WY9A 2BL0B 3PN7C 4GGFA 1XA5A 1M63B 1RWYA 1MQ1A 4DIRA 1B1GA 3CR5X 4XYNA 4OCIA 5KU1A 4I5LB 4YI9A 3SG2A 1G4YR 1S36A 1LA3A 3TUYB 1Y1UA 2JWWA 4M2OA 1NCXA 1QXPA 2TN4A 3PLFB 4PE1A 5TNCA 1DT7B 1LKJA 2JTZA 1DMOA 1PSRA 4YGEB 4I5NB 3NSKA 1NUBA 1SCMB 4XJKA 1WLZA 3IQOA 1JF2A 5KSZA 2EGDA 2LVJA 1RK9A 1K8UA 2LMVA 2HQWA 2JULA 3D0YA 3OB2B 2M1UA 1B8CA 2K61A 4AQJA 2O60A 1QVIZ 1FF1A 5CSJA 1L7ZA 2ZRSA 1S26D 2M3WA 3M0WA 1PRWA 2L98A 1FI6A 1NX2A 1MHOA 4UPGA 1K9PA 2CBLA 2KDHA 1S5GY 4PE4A 4JQ0D 1IQ3A 1XFZO 3LK1A 5I8NA 2NLNA 2M7NA 2CT9A 4DCKA 4F0ZB 2E30A 3OB1B 2NXQA 3BUOB 3BUWB 2MRDA 4CFQA 3OHMB 2F3ZA 2MLEC 1KK8B 3VRQA 1ZUZA 3FWBA 1JWDA 2KFHA 1F4QA 5CSIA 3PM8A 1AVSA 1OZOA 3O6BA 1WLMA 3BYAA 3GK1A 2JRFA 4PHNA 2L4HA 3TZ1A 2PVBA 2JZIA 2WORA 3NSLA 2Y4QA 2L0PA 1VRKA 4NDCA 1Y6WA 2H2KA 2NCOA 2BECA 2WOSA 4XJKB 1KCYA 1FBVA 2ZKMX 2BCXA 5HKZA 2BKHB 1A75A 2L2EA 4YBHB 1XFUO 3D0YB 2KGRA 3IF7A 1AHRA 5DKQA 2Q91A 2ISDA 2NCPA 2HF5A 3TDZA 1SL7A 1KQMB 1TRFA 1OMDA 3SG6A 3SG3A 4OR9B 4A4BA 4MLWA 2QPTA 1ZOTB 4WQ2A 4ZCUA 3PN7B 2HPSA 1U5IB 1J1EA 4MBEA 5HKWA 1WRLA 2KSPA 2RGIA 2WCFA 3PFVA 3CZTX 1MR8A 1V1FA 5D7FA 2I2RE 1XO5A 1SPYA 4C0KA 4GFTA 1CDPA 1EJ3A 1K2HA 2L50A 5PALA 4E68A 1M39A 1DJXA 3BUMB 3D10A 3SJSA 2BCBA 2ZNDA 2K7CA 2R2IA 1M31A 3PSRA 1WRKA 1C7VA 1EG4A 2LP3A 1XYDA 1QASA 1ZFSA 4MRXA 4DUQA 5JJGA 3ZWHA 3OX6A 2K8MB 1K90D 2M9GA 1X02A 1KSMA 1CMFA 2LHIA 2MA2A 2QACA 1NX1A 4JWQA 1B7TZ 1QJTA 1FPWA 4ORCB 1JBAA 3SG4A 1BR4B 1SRAA 1RECA 1J55A 1C7WA 1IJ5A 1JSAA 1QX5B 1CDNA 1KFUS 1RJVA 2KI4C 2LV7A 5G08A 3DVEA 5K89A 3ICBA 3WHUB 1XFXO 1NWDA 3O78A 1LINA 2B1UA 3C1VA 3FWCA 3KO0A 4CLNA 2D8NA 2ZFDA 1YR5A 3O4YA 2M7LA 1SL9A 3QRXA 1LXFC 1IWQA 1EG3A 3BOWA 3K21A 1F4OA 3KHEA 1YUTA 1AP4A 1SBJA 2I94A 1KK7Z 4MZLA 4NQGA 5JOLA 1XVJA 2LUCA 4A4CA 1RROA 2K2FA 1TNXA 1J7PA 1CLLA 2JOJA 1RTP1 1N2DA 1CFCA 3ZNIA 3AKBA 1R2UA 1ZMZA 1DJGA 1CLBA 1IQ5A 1OOJA 3I5GC 5J3XA 1IKUA 1JC2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ORB B;  1WDC C;  1CDM A;  5AAN A;  1F70 A;  1NPQ A;  1XK4 C;  1IGV A;  1NX0 A;  1AJ5 A;  1GGW A;  1PAL A;  1SR6 C;  1NCY A;  1SKT A;  2PAS A;  1SMG A;  4I5K A;  2LMT A;  1UHN A;  2E6W A;  1QV1 A;  1UWO A;  1F71 A;  5BPJ A;  1BU3 A;  4ORA B;  2BKI B;  1GQM A;  2KQY A;  4OV2 A;  1SYM A;  3LK0 A;  4MN0 A;  3BQ3 A;  1M46 A;  2FCE A;  3I5F C;  1N0Y A;  2FOT A;  2F3Y A;  1WRZ A;  4D1E A;  4OVN F;  3SIA A;  3VRP A;  1OZS A;  1BJF A;  1QX2 A;  1K95 A;  4ETO A;  5AER A;  1PK0 D;  1XK4 A;  1SNL A;  2MJW B;  1KFU L;  3NSI A;  2BBM A;  3EK4 A;  1MUX A;  1LVC D;  2O5G A;  3EVU A;  4GPL B;  1NSH A;  2JNF A;  2L5X B;  1K94 A;  1CMG A;  2LC5 A;  2KI4 B;  1ALW A;  2KYC A;  1F54 A;  2WC8 A;  1J7Q A;  1EL4 A;  5IBW A;  1DF0 A;  3LLE A;  3EKJ A;  2G9B A;  1DTL A;  1B7T Y;  3CS1 A;  1UHJ A;  3E3R A;  3JVT C;  2I18 A;  3TS5 C;  4M2Q A;  1BG1 A;  4AOM A;  1NYA A;  1S6I A;  5I2L A;  1PVB A;  2HQ8 A;  2JU0 A;  1CDL A;  2JXL A;  2LUX A;  4MSP A;  5DKN A;  2PAL A;  4FQO A;  1NCZ A;  3GK4 X;  2BCA A;  2PRU A;  1BLQ A;  1S1E A;  1EH2 A;  4JPZ B;  1W7I B;  1L2O C;  2PSR A;  1DJZ A;  1RFJ A;  3DVK A;  3I5G B;  1Q80 A;  1CTR A;  4GUK A;  5AFP A;  1J1D A;  4QJ5 B;  1BF5 A;  1ODB A;  1YUR A;  2Q4U A;  1HQV A;  2KAV A;  4M2P A;  4N1F A;  3CWG A;  2M1K B;  1WDC B;  2BE4 A;  3RM1 A;  4PDZ A;  1F8H A;  5CSN A;  1K9U A;  3DF0 A;  1Y0V H;  1FW4 A;  4GBA A;  4IL1 A;  3SIB A;  1QS7 A;  1MWN A;  1QIW A;  1SR6 B;  1UHI A;  1K93 D;  1YRT B;  1D1O A;  2KQ6 A;  1XFY O;  2LM5 A;  2KHN A;  2JXC A;  1YVH A;  4FTG A;  1B8L A;  4HSZ A;  2KNE A;  1IH0 A;  1A75 B;  1SY9 A;  2EHB A;  3H4S E;  1MXL C;  1A29 A;  3JTD C;  3VRN A;  3PAT A;  1OQP A;  2KFG A;  1JFK A;  3I5F B;  3TDU A;  5ER5 A;  1UP5 A;  1SW8 A;  2LVI A;  1J7R A;  1XFV O;  4PCW A;  4ZCV A;  3SG5 A;  4YRU A;  1BR1 B;  1TN4 A;  1AUI B;  2JTT A;  1EXR A;  3PAL A;  4N5X A;  3DD4 A;  3TDI A;  1CLM A;  2LCP A;  3HX4 A;  1H4B A;  3BXK A;  3VRR A;  1QVI Y;  5B8I B;  4MZK A;  3VGO A;  5HKY A;  1M45 A;  2JC2 A;  3I5I C;  4YGD B;  2JT0 A;  3LCP C;  4PHJ A;  4N1G A;  1B8R A;  1GJY A;  1ALV A;  3BUN B;  2JT3 A;  3WHT B;  1S6J A;  2ZNE A;  1B9A A;  1SK6 D;  1KWO C;  1S3P A;  3JVT B;  2LHL A;  1JUO A;  3TS5 B;  4C0J A;  2ZN8 A;  2OPO A;  5I2Q A;  1JFJ A;  4PHM A;  4PHK A;  1OMR A;  1R6P A;  2F8P A;  1QX7 A;  5DKR A;  1YTZ C;  4PE7 A;  4QJ3 B;  1DJI A;  3KEV A;  2P6B B;  1L2O B;  5I2O A;  3CLN A;  4L9M A;  2HET A;  2NZ0 A;  1NIW A;  1IJ6 A;  1DGV A;  3F45 A;  2F2O A;  1QLS A;  1CFD A;  3EKH A;  3FIA A;  1H8B A;  1S6C A;  2OS8 C;  3WNX B;  4YGC B;  5ER4 X;  2EC6 C;  2KBM A;  4ICB A;  4DRW A;  2OTG C;  2M29 A;  4DS7 A;  5GQQ C;  3NSO A;  1TIZ A;  3BOW B;  3I5H C;  2ZN9 A;  3CR2 A;  3KF9 A;  3JTD B;  1A03 A;  5FYX A;  1DJY A;  1DJH A;  2WND A;  2K7O A;  1KFX S;  1A4P A;  1AJ4 A;  5AEQ A;  2COL B;  4MVF A;  1U5I A;  1HT9 A;  3HCM A;  4CFR A;  2JQ6 A;  1KSO A;  1IRJ A;  3KPX A;  2MBX A;  1B47 A;  1YUU A;  3GK2 A;  1BMO A;  2A4J A;  2K7B A;  5HYD A;  1N65 A;  1OE9 B;  4GAO A;  2KI6 C;  1Y1X A;  2LAP A;  4YGB B;  1MXE A;  4HRH A;  4CPV A;  4MZJ A;  4Q04 A;  2LMU A;  1G8I A;  4P5O E;  3I5I B;  4NDB A;  2DOQ A;  1YVL A;  5F6T A;  1PVA A;  2G2B A;  2L51 A;  2SAS A;  2ZRT A;  1PSB A;  3IQQ A;  3WXA A;  4BY4 A;  1CNP A;  2JPT A;  4P2Y B;  3AAJ A;  1G33 A;  5AXI A;  3CGA A;  2KBI A;  4HRG A;  5HLV A;  2Y1N A;  4YGA A;  1C07 A;  1KWO B;  3A4U B;  1TCF A;  2KAX A;  1BOC A;  2CXJ A;  2F2P A;  3FS7 A;  1DGU A;  2L4I A;  1LA0 A;  2LAN A;  2KI6 D;  1F55 A;  2K7D A;  1TCO B;  1Y1A A;  1YUS A;  2F33 A;  2V53 A;  2GGM A;  3AKA A;  2I7A A;  3MSE B;  4MEW A;  2BL0 C;  2KFF A;  3EVV A;  3RLZ A;  1B4C A;  1DVI A;  1TNQ A;  1QIV A;  3DVM A;  1S5G Z;  2K2A A;  2LP2 A;  1CB1 A;  4C0L A;  3TUY C;  1ZAC A;  2BE6 A;  1UHK A;  2Y1M A;  1OSA A;  1QAT A;  4I5J A;  1CM1 A;  1CM4 A;  2GGZ A;  4R1E A;  2LVK A;  2MLF C;  2MAZ A;  2PMY A;  2BBN A;  1KK7 Y;  1SCM C;  2AUC A;  1FI5 A;  2OS8 B;  2KYF A;  2AMI A;  2M49 B;  3BUX B;  1V1G A;  4PE0 A;  1CKK A;  1IG5 A;  2CTN A;  2JT8 A;  4U8D A;  2GV5 A;  1DF0 B;  1W7J B;  2EC6 B;  2WCE A;  5CPV A;  1KQV A;  2KOT A;  3A8R A;  2OTG B;  1E8A A;  1K96 A;  1QTX A;  2SCP A;  4GGN A;  4TNC A;  2AAO A;  1BOD A;  2CNP A;  2M8U A;  3CTN A;  3I5H B;  2JNX A;  2IS9 A;  1SCV A;  1KFX L;  1DJW A;  1TTX A;  2LVV A;  1UUS A;  5HLO A;  2H61 C;  3EVR A;  1NP8 A;  2MHH A;  1NX3 A;  1SL8 A;  2FCD A;  2KGB C;  3AAK A;  1XFW O;  3NXA A;  2WCB A;  3SG7 A;  1JF0 A;  1KK8 C;  2LLU A;  4CID A;  3EK8 A;  2LE9 B;  2M97 A;  4AQI A;  4GGF C;  1BT6 A;  1K9K A;  4QJ4 B;  2FJU B;  1AK8 A;  1YX7 A;  4PAL A;  1TNP A;  3OX5 A;  4BY5 A;  1J7O A;  4NDD A;  5KTY A;  1QLK A;  4HRE E;  3OP0 A;  4OKH A;  3DF0 B;  3O2P A;  1YX8 A;  5D69 A;  1CFP A;  2CCM A;  4WRI A;  1YRU B;  1QV0 A;  1UHH A;  4YI8 A;  1TNW A;  1OMV A;  2M0R A;  2H61 A;  3GOF A;  2LNK A;  4MRY A;  5CSF A;  3DVJ A;  3EK7 A;  3LL8 B;  2LLT A;  1GGZ A;  1A2X A;  1PUL A;  1MF8 B;  1TOP A;  2LLS A;  4GNK B;  4USL A;  1UUR A;  4WQ3 A;  1CFF A;  1KQM C;  3VRO A;  2KAY A;  2Y5I A;  3CR4 X;  2VRG A;  2K0J A;  1WY9 A;  2BL0 B;  3PN7 C;  4GGF A;  1XA5 A;  1M63 B;  1RWY A;  1MQ1 A;  4DIR A;  1B1G A;  3CR5 X;  4XYN A;  4OCI A;  5KU1 A;  4I5L B;  4YI9 A;  3SG2 A;  1G4Y R;  1S36 A;  1LA3 A;  3TUY B;  1Y1U A;  2JWW A;  4M2O A;  1NCX A;  1QXP A;  2TN4 A;  3PLF B;  4PE1 A;  5TNC A;  1DT7 B;  1LKJ A;  2JTZ A;  1DMO A;  1PSR A;  4YGE B;  4I5N B;  3NSK A;  1NUB A;  1SCM B;  4XJK A;  1WLZ A;  3IQO A;  1JF2 A;  5KSZ A;  2EGD A;  2LVJ A;  1RK9 A;  1K8U A;  2LMV A;  2HQW A;  2JUL A;  3D0Y A;  3OB2 B;  2M1U A;  1B8C A;  2K61 A;  4AQJ A;  2O60 A;  1QVI Z;  1FF1 A;  5CSJ A;  1L7Z A;  2ZRS A;  1S26 D;  2M3W A;  3M0W A;  1PRW A;  2L98 A;  1FI6 A;  1NX2 A;  1MHO A;  4UPG A;  1K9P A;  2CBL A;  2KDH A;  1S5G Y;  4PE4 A;  4JQ0 D;  1IQ3 A;  1XFZ O;  3LK1 A;  5I8N A;  2NLN A;  2M7N A;  2CT9 A;  4DCK A;  4F0Z B;  2E30 A;  3OB1 B;  2NXQ A;  3BUO B;  3BUW B;  2MRD A;  4CFQ A;  3OHM B;  2F3Z A;  2MLE C;  1KK8 B;  3VRQ A;  1ZUZ A;  3FWB A;  1JWD A;  2KFH A;  1F4Q A;  5CSI A;  3PM8 A;  1AVS A;  1OZO A;  3O6B A;  1WLM A;  3BYA A;  3GK1 A;  2JRF A;  4PHN A;  2L4H A;  3TZ1 A;  2PVB A;  2JZI A;  2WOR A;  3NSL A;  2Y4Q A;  2L0P A;  1VRK A;  4NDC A;  1Y6W A;  2H2K A;  2NCO A;  2BEC A;  2WOS A;  4XJK B;  1KCY A;  1FBV A;  2ZKM X;  2BCX A;  5HKZ A;  2BKH B;  1A75 A;  2L2E A;  4YBH B;  1XFU O;  3D0Y B;  2KGR A;  3IF7 A;  1AHR A;  5DKQ A;  2Q91 A;  2ISD A;  2NCP A;  2HF5 A;  3TDZ A;  1SL7 A;  1KQM B;  1TRF A;  1OMD A;  3SG6 A;  3SG3 A;  4OR9 B;  4A4B A;  4MLW A;  2QPT A;  1ZOT B;  4WQ2 A;  4ZCU A;  3PN7 B;  2HPS A;  1U5I B;  1J1E A;  4MBE A;  5HKW A;  1WRL A;  2KSP A;  2RGI A;  2WCF A;  3PFV A;  3CZT X;  1MR8 A;  1V1F A;  5D7F A;  2I2R E;  1XO5 A;  1SPY A;  4C0K A;  4GFT A;  1CDP A;  1EJ3 A;  1K2H A;  2L50 A;  5PAL A;  4E68 A;  1M39 A;  1DJX A;  3BUM B;  3D10 A;  3SJS A;  2BCB A;  2ZND A;  2K7C A;  2R2I A;  1M31 A;  3PSR A;  1WRK A;  1C7V A;  1EG4 A;  2LP3 A;  1XYD A;  1QAS A;  1ZFS A;  4MRX A;  4DUQ A;  5JJG A;  3ZWH A;  3OX6 A;  2K8M B;  1K90 D;  2M9G A;  1X02 A;  1KSM A;  1CMF A;  2LHI A;  2MA2 A;  2QAC A;  1NX1 A;  4JWQ A;  1B7T Z;  1QJT A;  1FPW A;  4ORC B;  1JBA A;  3SG4 A;  1BR4 B;  1SRA A;  1REC A;  1J55 A;  1C7W A;  1IJ5 A;  1JSA A;  1QX5 B;  1CDN A;  1KFU S;  1RJV A;  2KI4 C;  2LV7 A;  5G08 A;  3DVE A;  5K89 A;  3ICB A;  3WHU B;  1XFX O;  1NWD A;  3O78 A;  1LIN A;  2B1U A;  3C1V A;  3FWC A;  3KO0 A;  4CLN A;  2D8N A;  2ZFD A;  1YR5 A;  3O4Y A;  2M7L A;  1SL9 A;  3QRX A;  1LXF C;  1IWQ A;  1EG3 A;  3BOW A;  3K21 A;  1F4O A;  3KHE A;  1YUT A;  1AP4 A;  1SBJ A;  2I94 A;  1KK7 Z;  4MZL A;  4NQG A;  5JOL A;  1XVJ A;  2LUC A;  4A4C A;  1RRO A;  2K2F A;  1TNX A;  1J7P A;  1CLL A;  2JOJ A;  1RTP 1;  1N2D A;  1CFC A;  3ZNI A;  3AKB A;  1R2U A;  1ZMZ A;  1DJG A;  1CLB A;  1IQ5 A;  1OOJ A;  3I5G C;  5J3X A;  1IKU A;  1JC2 A; 
#chains in the Genus database with same CATH topology
 1DC1 A;  4ORB B;  1WDC C;  1CDM A;  5AAN A;  1F70 A;  1NPQ A;  1XK4 C;  1IGV A;  1NX0 A;  1AJ5 A;  3B86 A;  3PM2 A;  1GGW A;  1PAL A;  1SR6 C;  1NCY A;  1SKT A;  2PAS A;  3UO9 A;  1SMG A;  2WCK A;  4I5K A;  2LMT A;  1UHN A;  1GM0 A;  2E6W A;  1QV1 A;  1UWO A;  1F71 A;  4OZD A;  5BPJ A;  1BU3 A;  4ORA B;  2BKI B;  1GQM A;  2KQY A;  4OV2 A;  1SYM A;  3LK0 A;  4MN0 A;  3BQ3 A;  1M46 A;  2FCE A;  3I5F C;  1N0Y A;  2FOT A;  2F3Y A;  1WRZ A;  4D1E A;  4OVN F;  3SIA A;  3VRP A;  1OZS A;  1BJF A;  1TWO A;  1QX2 A;  1K95 A;  4ETO A;  4JKT A;  5AER A;  1PK0 D;  1XK4 A;  1SNL A;  2MJW B;  1KFU L;  3NSI A;  2BBM A;  3EK4 A;  1MUX A;  1LVC D;  2O5G A;  3EVU A;  1SSE B;  1NSH A;  2JNF A;  2L5X B;  2WCH A;  1K94 A;  4GPL B;  1CMG A;  2LC5 A;  3IVT A;  2KI4 B;  1ALW A;  2KYC A;  3EG5 B;  1F54 A;  2WC8 A;  1J7Q A;  3QME A;  1EL4 A;  3N7H A;  5IBW A;  1DF0 A;  3LLE A;  3EKJ A;  2G9B A;  3D74 A;  2QEV A;  1DTL A;  1B7T Y;  3CS1 A;  1UHJ A;  3E3R A;  2WCM A;  2I18 A;  3JVT C;  3TS5 C;  4IJ7 A;  4M2Q A;  1BG1 A;  4AOM A;  1NYA A;  1S6I A;  5I2L A;  4PT1 A;  1PVB A;  2HQ8 A;  2JU0 A;  1CDL A;  2JXL A;  2LUX A;  3D77 A;  4MSP A;  2PAL A;  5DKN A;  4FQO A;  1NCZ A;  3GK4 X;  2BCA A;  3FE9 A;  2PRU A;  2PYQ A;  1S1E A;  1BLQ A;  1EH2 A;  4JPZ B;  1W7I B;  3CZ2 A;  1L2O C;  1LS8 A;  2PSR A;  1DJZ A;  1RFJ A;  3DVK A;  3I5G B;  1Q80 A;  1CTR A;  4GUK A;  5AFP A;  1J1D A;  4INW A;  3SS4 A;  4QJ5 B;  1BF5 A;  2BNX A;  1ODB A;  3CYZ A;  5D3O A;  1YUR A;  2Q4U A;  1HQV A;  2KAV A;  4M2P A;  4N1F A;  3CWG A;  2M1K B;  1WDC B;  2BE4 A;  3R1P A;  3RM1 A;  4PDZ A;  1F8H A;  5CSN A;  1K9U A;  3DF0 A;  1Y0V H;  1FW4 A;  4GBA A;  4IL1 A;  3SIB A;  1QS7 A;  3R1V A;  1MWN A;  1QIW A;  1SR6 B;  1UHI A;  1K93 D;  1YRT B;  1D1O A;  3CZ0 A;  2KQ6 A;  1XFY O;  2LM5 A;  2KHN A;  2JXC A;  1YVH A;  4FTG A;  1B8L A;  4HSZ A;  2KNE A;  1IH0 A;  1A75 B;  4F7F A;  3BFA A;  1SY9 A;  2EHB A;  3H4S E;  1MXL C;  1A29 A;  3JTD C;  3VRN A;  3PAT A;  1OQP A;  2KFG A;  1JFK A;  3I5F B;  3TDU A;  5ER5 A;  1UP5 A;  1SW8 A;  2LVI A;  3RZS A;  1J7R A;  1XFV O;  4PCW A;  4ZCV A;  3SG5 A;  4YRU A;  1BR1 B;  1TN4 A;  1AUI B;  2JTT A;  1EXR A;  3PAL A;  4N5X A;  3DD4 A;  3TDI A;  1CLM A;  2LCP A;  3HX4 A;  1H4B A;  3BXK A;  3VRR A;  1QVI Y;  5B8I B;  4MZK A;  3VGO A;  5HKY A;  1M45 A;  3B88 A;  2JC2 A;  3I5I C;  4YGD B;  3S0E A;  2JT0 A;  3LCP C;  4PHJ A;  4N1G A;  1B8R A;  1GJY A;  4INX A;  1ALV A;  3BUN B;  2JT3 A;  3WHT B;  3L4L A;  1S6J A;  1XFR A;  2ZNE A;  2QEB A;  1B9A A;  1SK6 D;  1KWO C;  1S3P A;  3JVT B;  2LHL A;  3CZ1 A;  1JUO A;  3TS5 B;  4C0J A;  2ZN8 A;  2OPO A;  5I2Q A;  1JFJ A;  4PHM A;  4PHK A;  3NHT A;  1OMR A;  1R6P A;  2F8P A;  1QX7 A;  5DKR A;  2H8V A;  1YTZ C;  4PE7 A;  4QJ3 B;  1DJI A;  3KEV A;  2P6B B;  1L2O B;  2L2C A;  3CLN A;  5I2O A;  4L9M A;  2HET A;  2NZ0 A;  1NIW A;  1IJ6 A;  2P71 A;  1DGV A;  3F45 A;  2F2O A;  1QLS A;  1CFD A;  3EKH A;  3FIA A;  1H8B A;  1S6C A;  1OOH A;  2OS8 C;  3NHI A;  3WNX B;  4YGC B;  5ER4 X;  3DXL A;  2EC6 C;  2KBM A;  4ICB A;  4DRW A;  2OTG C;  2M29 A;  3D76 A;  4DS7 A;  5GQQ C;  2KLD A;  3NSO A;  1DQE A;  1TIZ A;  3BOW B;  3I5H C;  2ZN9 A;  3CR2 A;  3KF9 A;  3JTD B;  1A03 A;  5FYX A;  1DJY A;  1DJH A;  2WND A;  2K7O A;  1KFX S;  2WC5 A;  1A4P A;  1AJ4 A;  5AEQ A;  2COL B;  4MVF A;  1U5I A;  1HT9 A;  3HCM A;  1P28 A;  2JQ6 A;  4CFR A;  1KSO A;  1IRJ A;  3KPX A;  2MBX A;  1B47 A;  1YUU A;  3GK2 A;  1BMO A;  2A4J A;  2K7B A;  2PQL A;  3R1O A;  1N65 A;  5HYD A;  1OW4 A;  1OE9 B;  4GAO A;  2KI6 C;  1Y1X A;  3B7A A;  2LAP A;  4YGB B;  3DY9 A;  1MXE A;  4HRH A;  2K60 A;  4MZJ A;  4Q04 A;  2LMU A;  1G8I A;  4FQT A;  4P5O E;  3I5I B;  4CPV A;  3S0A A;  3BFH A;  2DOQ A;  4NDB A;  3VB1 A;  1YVL A;  5F6T A;  1PVA A;  2G2B A;  2L51 A;  2SAS A;  2ZRT A;  1PSB A;  3IQQ A;  3WXA A;  4BY4 A;  1CNP A;  2JPT A;  4P2Y B;  5I94 A;  3AAJ A;  1G33 A;  5AXI A;  3CGA A;  2KPH A;  2KBI A;  4HRG A;  5HLV A;  5EL2 A;  2Y1N A;  4YGA A;  1C07 A;  1KWO B;  3A4U B;  1TCF A;  2KAX A;  1BOC A;  2CXJ A;  2F2P A;  3FS7 A;  1DGU A;  2L4I A;  1LA0 A;  2LAN A;  2KI6 D;  1F55 A;  2K7D A;  2JPO A;  1TCO B;  1Y1A A;  1YUS A;  2F33 A;  2V53 A;  2GGM A;  3AKA A;  2I7A A;  3MSE B;  4MEW A;  1Z2C B;  2BL0 C;  2KFF A;  3EVV A;  5FI2 A;  3RLZ A;  1B4C A;  3D75 A;  1DVI A;  1TNQ A;  3S0G A;  1QIV A;  3DVM A;  1S5G Z;  2K2A A;  2LP2 A;  1CB1 A;  4C0L A;  3TUY C;  1ZAC A;  3SS3 A;  2BE6 A;  1UHK A;  2Y1M A;  1OSA A;  1QAT A;  4I5J A;  1CM1 A;  1CM4 A;  2GGZ A;  4R1E A;  2LVK A;  2MLF C;  2MAZ A;  2PMY A;  3OGN A;  2BBN A;  1KK7 Y;  1SCM C;  2AUC A;  1FI5 A;  2OS8 B;  2KYF A;  2P70 A;  3SS5 A;  2AMI A;  2M49 B;  3BUX B;  1V1G A;  4PE0 A;  1CKK A;  1IG5 A;  2CTN A;  2JT8 A;  4U8D A;  2GV5 A;  1DF0 B;  1W7J B;  2EC6 B;  2WCE A;  3BJH A;  5CPV A;  2KOT A;  1KQV A;  3A8R A;  2OTG B;  1E8A A;  1K96 A;  1C3Y A;  1QTX A;  2SCP A;  4GGN A;  4TNC A;  2AAO A;  1BOD A;  2CNP A;  2M8U A;  3CTN A;  3I5H B;  2JNX A;  2IS9 A;  1SCV A;  3O4X A;  1KFX L;  1DJW A;  1TTX A;  2LVV A;  3BFB A;  1UUS A;  5HLO A;  2H61 C;  3D73 A;  2QEO A;  3EVR A;  1NP8 A;  2MHH A;  1NX3 A;  1SL8 A;  2FCD A;  2KGB C;  3AAK A;  1XFW O;  3NXA A;  2WCB A;  3SG7 A;  1JF0 A;  1KK8 C;  2LLU A;  4CID A;  3EK8 A;  2LE9 B;  2M97 A;  4AQI A;  4GGF C;  1BT6 A;  1K9K A;  4QJ4 B;  2FJU B;  1IIO A;  1AK8 A;  1YX7 A;  4PAL A;  1TNP A;  3OX5 A;  4BY5 A;  1J7O A;  4NDD A;  3L4A A;  5KTY A;  1QLK A;  4HRE E;  3OP0 A;  4OKH A;  3DF0 B;  5FI7 A;  3O2P A;  1YX8 A;  5D69 A;  1CFP A;  1DEL A;  2CCM A;  1YRU B;  2QEH A;  4WRI A;  1QV0 A;  3S0F A;  1UHH A;  4YI8 A;  1TNW A;  1OMV A;  2ERB A;  2H61 A;  2M0R A;  3GOF A;  2LNK A;  4MRY A;  5CSF A;  3DVJ A;  3EK7 A;  3LL8 B;  2LLT A;  1A2X A;  1GGZ A;  1PUL A;  1MF8 B;  1QWV A;  1TOP A;  2LLS A;  2WC6 A;  1UUR A;  3CAB A;  4GNK B;  4USL A;  4WQ3 A;  1CFF A;  1KQM C;  3VRO A;  2KAY A;  2Y5I A;  3CR4 X;  2VRG A;  3R72 A;  2K0J A;  1WY9 A;  2BL0 B;  3K1E A;  3PN7 C;  3DZT A;  4GGF A;  1XA5 A;  1M63 B;  1RWY A;  1MQ1 A;  4DIR A;  1B1G A;  3CR5 X;  3L47 A;  4XYN A;  4OCI A;  3DYE A;  4I5L B;  5KU1 A;  4YI9 A;  3SG2 A;  1G4Y R;  1S36 A;  3CDN A;  1LA3 A;  3TUY B;  1Y1U A;  2JWW A;  4M2O A;  1NCX A;  1QXP A;  2TN4 A;  3PLF B;  4PE1 A;  5TNC A;  1DT7 B;  1LKJ A;  2JTZ A;  1DMO A;  1PSR A;  4YGE B;  4I5N B;  3NSK A;  1NUB A;  1SCM B;  4XJK A;  1WLZ A;  3IQO A;  1JF2 A;  5KSZ A;  2EGD A;  2LVJ A;  1RK9 A;  2BAP A;  1K8U A;  2LMV A;  2HQW A;  2JUL A;  3D0Y A;  3OB2 B;  2M1U A;  1B8C A;  3B6X A;  2GTE A;  1T14 A;  2K61 A;  4AQJ A;  2O60 A;  1QVI Z;  1TUJ A;  5HL1 A;  5CSJ A;  3PJI A;  1FF1 A;  1L7Z A;  2ZRS A;  1S26 D;  2M3W A;  3M0W A;  1PRW A;  2L98 A;  1FI6 A;  1NX2 A;  2QDI A;  1MHO A;  4UPG A;  1K9P A;  2CBL A;  2KDH A;  1Z4H A;  1S5G Y;  4PE4 A;  4JQ0 D;  1IQ3 A;  2L5Y A;  1XFZ O;  3LK1 A;  5I8N A;  2NLN A;  2M7N A;  2CT9 A;  4DCK A;  4F0Z B;  2E30 A;  3OB1 B;  2NXQ A;  3BUO B;  2YGU A;  3BUW B;  2MRD A;  4CFQ A;  3OHM B;  2F3Z A;  2MLE C;  1KK8 B;  3VRQ A;  1ZUZ A;  3FWB A;  1JWD A;  2KFH A;  1F4Q A;  5CSI A;  3PM8 A;  1AVS A;  1OZO A;  3O6B A;  1WLM A;  1DEK A;  3BYA A;  3GK1 A;  2JRF A;  4KYN A;  1OOG A;  1W9Z A;  4PHN A;  2L4H A;  3TZ1 A;  2PVB A;  2JZI A;  2WOR A;  3NSL A;  2Y4Q A;  2L0P A;  1VRK A;  4NDC A;  1Y6W A;  2H2K A;  2NCO A;  2BEC A;  2WOS A;  4XJK B;  1KCY A;  1FBV A;  2ZKM X;  2BCX A;  5HKZ A;  2BKH B;  1A75 A;  2FJY A;  2L2E A;  4YBH B;  1XFU O;  3D0Y B;  1OOI X;  2KGR A;  1AHR A;  3IF7 A;  5DKQ A;  2Q91 A;  2ISD A;  2NCP A;  2HF5 A;  3TDZ A;  1SL7 A;  1KQM B;  1TRF A;  1OMD A;  3SG6 A;  3SG3 A;  4OR9 B;  4A4B A;  4MLW A;  2QPT A;  1ZOT B;  3B87 A;  4WQ2 A;  4ZCU A;  3PN7 B;  2HPS A;  1U5I B;  3FE8 A;  1J1E A;  4MBE A;  5HKW A;  5FI6 A;  1WRL A;  2KSP A;  2RGI A;  2WCF A;  3PFV A;  3CZT X;  1MR8 A;  1V1F A;  5D7F A;  2I2R E;  1OOF A;  1XO5 A;  1SPY A;  4C0K A;  3Q8I A;  4GFT A;  1CDP A;  1EJ3 A;  2WCL A;  1K2H A;  2L50 A;  5PAL A;  1TUZ A;  4E68 A;  1M39 A;  1DJX A;  3BUM B;  3D10 A;  3SJS A;  2BCB A;  2ZND A;  3OBV A;  2K7C A;  2R2I A;  1M31 A;  3PSR A;  1WRK A;  1C7V A;  1EG4 A;  2LP3 A;  1XYD A;  1QAS A;  1ZFS A;  4MRX A;  4DUQ A;  5JJG A;  3ZWH A;  3OX6 A;  2K8M B;  1K90 D;  2M9G A;  1X02 A;  1KSM A;  3S0D A;  1CMF A;  2LHI A;  2MA2 A;  2QAC A;  1NX1 A;  4JWQ A;  1B7T Z;  1QJT A;  1FPW A;  3D78 A;  4ORC B;  3NGV A;  1JBA A;  3SG4 A;  1BR4 B;  1SRA A;  1REC A;  3FE6 A;  1J55 A;  1ORG A;  1C7W A;  1IJ5 A;  1JSA A;  1QX5 B;  1CDN A;  1KFU S;  1RJV A;  2KI4 C;  2LV7 A;  5G08 A;  4JD9 A;  3DVE A;  3V2L A;  5K89 A;  3ICB A;  3WHU B;  1XFX O;  1NWD A;  3O78 A;  1LIN A;  2B1U A;  3C1V A;  3FWC A;  3KO0 A;  4CLN A;  2D8N A;  5DIC A;  2ZFD A;  1C3Z A;  2KLE A;  1YR5 A;  3O4Y A;  2M7L A;  1SL9 A;  3QRX A;  1LXF C;  1IWQ A;  1EG3 A;  3BOW A;  3K21 A;  1F4O A;  3KHE A;  1YUT A;  1AP4 A;  1SBJ A;  2I94 A;  1KK7 Z;  4MZL A;  4NQG A;  5JOL A;  1XVJ A;  2LUC A;  4A4C A;  1RRO A;  2K2F A;  1TNX A;  1J7P A;  1CLL A;  2JOJ A;  1RTP 1;  1N2D A;  1CFC A;  3ZNI A;  3AKB A;  1R2U A;  1ZMZ A;  3UNW A;  1DJG A;  2WCJ A;  1CLB A;  1IQ5 A;  1OOJ A;  3I5G C;  5J3X A;  1IKU A;  1JC2 A;  3S0B A; 
#chains in the Genus database with same CATH homology
 4ORB B;  1WDC C;  1CDM A;  5AAN A;  1F70 A;  1NPQ A;  1XK4 C;  1IGV A;  1NX0 A;  1AJ5 A;  1GGW A;  1PAL A;  1SR6 C;  1NCY A;  1SKT A;  2PAS A;  1SMG A;  4I5K A;  2LMT A;  1UHN A;  2E6W A;  1QV1 A;  1UWO A;  1F71 A;  5BPJ A;  1BU3 A;  4ORA B;  2BKI B;  1GQM A;  2KQY A;  4OV2 A;  1SYM A;  3LK0 A;  4MN0 A;  3BQ3 A;  1M46 A;  2FCE A;  3I5F C;  1N0Y A;  2FOT A;  2F3Y A;  1WRZ A;  4D1E A;  4OVN F;  3SIA A;  3VRP A;  1OZS A;  1BJF A;  1QX2 A;  1K95 A;  4ETO A;  5AER A;  1PK0 D;  1XK4 A;  1SNL A;  2MJW B;  1KFU L;  3NSI A;  2BBM A;  3EK4 A;  1MUX A;  1LVC D;  2O5G A;  3EVU A;  4GPL B;  1NSH A;  2JNF A;  2L5X B;  1K94 A;  1CMG A;  2LC5 A;  2KI4 B;  1ALW A;  2KYC A;  1F54 A;  2WC8 A;  1J7Q A;  1EL4 A;  5IBW A;  1DF0 A;  3LLE A;  3EKJ A;  2G9B A;  1DTL A;  1B7T Y;  3CS1 A;  1UHJ A;  3E3R A;  3JVT C;  2I18 A;  3TS5 C;  4M2Q A;  1BG1 A;  4AOM A;  1NYA A;  1S6I A;  5I2L A;  1PVB A;  2HQ8 A;  2JU0 A;  1CDL A;  2JXL A;  2LUX A;  4MSP A;  5DKN A;  2PAL A;  4FQO A;  1NCZ A;  3GK4 X;  2BCA A;  2PRU A;  1BLQ A;  1S1E A;  1EH2 A;  4JPZ B;  1W7I B;  1L2O C;  2PSR A;  1DJZ A;  1RFJ A;  3DVK A;  3I5G B;  1Q80 A;  1CTR A;  4GUK A;  5AFP A;  1J1D A;  4QJ5 B;  1BF5 A;  1ODB A;  1YUR A;  2Q4U A;  1HQV A;  2KAV A;  4M2P A;  4N1F A;  3CWG A;  2M1K B;  1WDC B;  2BE4 A;  3RM1 A;  4PDZ A;  1F8H A;  5CSN A;  1K9U A;  3DF0 A;  1Y0V H;  1FW4 A;  4GBA A;  4IL1 A;  3SIB A;  1QS7 A;  1MWN A;  1QIW A;  1SR6 B;  1UHI A;  1K93 D;  1YRT B;  1D1O A;  2KQ6 A;  1XFY O;  2LM5 A;  2KHN A;  2JXC A;  1YVH A;  4FTG A;  1B8L A;  4HSZ A;  2KNE A;  1IH0 A;  1A75 B;  1SY9 A;  2EHB A;  3H4S E;  1MXL C;  1A29 A;  3JTD C;  3VRN A;  3PAT A;  1OQP A;  2KFG A;  1JFK A;  3I5F B;  3TDU A;  5ER5 A;  1UP5 A;  1SW8 A;  2LVI A;  1J7R A;  1XFV O;  4PCW A;  4ZCV A;  3SG5 A;  4YRU A;  1BR1 B;  1TN4 A;  1AUI B;  2JTT A;  1EXR A;  3PAL A;  4N5X A;  3DD4 A;  3TDI A;  1CLM A;  2LCP A;  3HX4 A;  1H4B A;  3BXK A;  3VRR A;  1QVI Y;  5B8I B;  4MZK A;  3VGO A;  5HKY A;  1M45 A;  2JC2 A;  3I5I C;  4YGD B;  2JT0 A;  3LCP C;  4PHJ A;  4N1G A;  1B8R A;  1GJY A;  1ALV A;  3BUN B;  2JT3 A;  3WHT B;  1S6J A;  2ZNE A;  1B9A A;  1SK6 D;  1KWO C;  1S3P A;  3JVT B;  2LHL A;  1JUO A;  3TS5 B;  4C0J A;  2ZN8 A;  2OPO A;  5I2Q A;  1JFJ A;  4PHM A;  4PHK A;  1OMR A;  1R6P A;  2F8P A;  1QX7 A;  5DKR A;  1YTZ C;  4PE7 A;  4QJ3 B;  1DJI A;  3KEV A;  2P6B B;  1L2O B;  5I2O A;  3CLN A;  4L9M A;  2HET A;  2NZ0 A;  1NIW A;  1IJ6 A;  1DGV A;  3F45 A;  2F2O A;  1QLS A;  1CFD A;  3EKH A;  3FIA A;  1H8B A;  1S6C A;  2OS8 C;  3WNX B;  4YGC B;  5ER4 X;  2EC6 C;  2KBM A;  4ICB A;  4DRW A;  2OTG C;  2M29 A;  4DS7 A;  5GQQ C;  3NSO A;  1TIZ A;  3BOW B;  3I5H C;  2ZN9 A;  3CR2 A;  3KF9 A;  3JTD B;  1A03 A;  5FYX A;  1DJY A;  1DJH A;  2WND A;  2K7O A;  1KFX S;  1A4P A;  1AJ4 A;  5AEQ A;  2COL B;  4MVF A;  1U5I A;  1HT9 A;  3HCM A;  4CFR A;  2JQ6 A;  1KSO A;  1IRJ A;  3KPX A;  2MBX A;  1B47 A;  1YUU A;  3GK2 A;  1BMO A;  2A4J A;  2K7B A;  5HYD A;  1N65 A;  1OE9 B;  4GAO A;  2KI6 C;  1Y1X A;  2LAP A;  4YGB B;  1MXE A;  4HRH A;  4CPV A;  4MZJ A;  4Q04 A;  2LMU A;  1G8I A;  4P5O E;  3I5I B;  4NDB A;  2DOQ A;  1YVL A;  5F6T A;  1PVA A;  2G2B A;  2L51 A;  2SAS A;  2ZRT A;  1PSB A;  3IQQ A;  3WXA A;  4BY4 A;  1CNP A;  2JPT A;  4P2Y B;  3AAJ A;  1G33 A;  5AXI A;  3CGA A;  2KBI A;  4HRG A;  5HLV A;  2Y1N A;  4YGA A;  1C07 A;  1KWO B;  3A4U B;  1TCF A;  2KAX A;  1BOC A;  2CXJ A;  2F2P A;  3FS7 A;  1DGU A;  2L4I A;  1LA0 A;  2LAN A;  2KI6 D;  1F55 A;  2K7D A;  1TCO B;  1Y1A A;  1YUS A;  2F33 A;  2V53 A;  2GGM A;  3AKA A;  2I7A A;  3MSE B;  4MEW A;  2BL0 C;  2KFF A;  3EVV A;  3RLZ A;  1B4C A;  1DVI A;  1TNQ A;  1QIV A;  3DVM A;  1S5G Z;  2K2A A;  2LP2 A;  1CB1 A;  4C0L A;  3TUY C;  1ZAC A;  2BE6 A;  1UHK A;  2Y1M A;  1OSA A;  1QAT A;  4I5J A;  1CM1 A;  1CM4 A;  2GGZ A;  4R1E A;  2LVK A;  2MLF C;  2MAZ A;  2PMY A;  2BBN A;  1KK7 Y;  1SCM C;  2AUC A;  1FI5 A;  2OS8 B;  2KYF A;  2AMI A;  2M49 B;  3BUX B;  1V1G A;  4PE0 A;  1CKK A;  1IG5 A;  2CTN A;  2JT8 A;  4U8D A;  2GV5 A;  1DF0 B;  1W7J B;  2EC6 B;  2WCE A;  5CPV A;  1KQV A;  2KOT A;  3A8R A;  2OTG B;  1E8A A;  1K96 A;  1QTX A;  2SCP A;  4GGN A;  4TNC A;  2AAO A;  1BOD A;  2CNP A;  2M8U A;  3CTN A;  3I5H B;  2JNX A;  2IS9 A;  1SCV A;  1KFX L;  1DJW A;  1TTX A;  2LVV A;  1UUS A;  5HLO A;  2H61 C;  3EVR A;  1NP8 A;  2MHH A;  1NX3 A;  1SL8 A;  2FCD A;  2KGB C;  3AAK A;  1XFW O;  3NXA A;  2WCB A;  3SG7 A;  1JF0 A;  1KK8 C;  2LLU A;  4CID A;  3EK8 A;  2LE9 B;  2M97 A;  4AQI A;  4GGF C;  1BT6 A;  1K9K A;  4QJ4 B;  2FJU B;  1AK8 A;  1YX7 A;  4PAL A;  1TNP A;  3OX5 A;  4BY5 A;  1J7O A;  4NDD A;  5KTY A;  1QLK A;  4HRE E;  3OP0 A;  4OKH A;  3DF0 B;  3O2P A;  1YX8 A;  5D69 A;  1CFP A;  2CCM A;  4WRI A;  1YRU B;  1QV0 A;  1UHH A;  4YI8 A;  1TNW A;  1OMV A;  2M0R A;  2H61 A;  3GOF A;  2LNK A;  4MRY A;  5CSF A;  3DVJ A;  3EK7 A;  3LL8 B;  2LLT A;  1GGZ A;  1A2X A;  1PUL A;  1MF8 B;  1TOP A;  2LLS A;  4GNK B;  4USL A;  1UUR A;  4WQ3 A;  1CFF A;  1KQM C;  3VRO A;  2KAY A;  2Y5I A;  3CR4 X;  2VRG A;  2K0J A;  1WY9 A;  2BL0 B;  3PN7 C;  4GGF A;  1XA5 A;  1M63 B;  1RWY A;  1MQ1 A;  4DIR A;  1B1G A;  3CR5 X;  4XYN A;  4OCI A;  5KU1 A;  4I5L B;  4YI9 A;  3SG2 A;  1G4Y R;  1S36 A;  1LA3 A;  3TUY B;  1Y1U A;  2JWW A;  4M2O A;  1NCX A;  1QXP A;  2TN4 A;  3PLF B;  4PE1 A;  5TNC A;  1DT7 B;  1LKJ A;  2JTZ A;  1DMO A;  1PSR A;  4YGE B;  4I5N B;  3NSK A;  1NUB A;  1SCM B;  4XJK A;  1WLZ A;  3IQO A;  1JF2 A;  5KSZ A;  2EGD A;  2LVJ A;  1RK9 A;  1K8U A;  2LMV A;  2HQW A;  2JUL A;  3D0Y A;  3OB2 B;  2M1U A;  1B8C A;  2K61 A;  4AQJ A;  2O60 A;  1QVI Z;  1FF1 A;  5CSJ A;  1L7Z A;  2ZRS A;  1S26 D;  2M3W A;  3M0W A;  1PRW A;  2L98 A;  1FI6 A;  1NX2 A;  1MHO A;  4UPG A;  1K9P A;  2CBL A;  2KDH A;  1S5G Y;  4PE4 A;  4JQ0 D;  1IQ3 A;  1XFZ O;  3LK1 A;  5I8N A;  2NLN A;  2M7N A;  2CT9 A;  4DCK A;  4F0Z B;  2E30 A;  3OB1 B;  2NXQ A;  3BUO B;  3BUW B;  2MRD A;  4CFQ A;  3OHM B;  2F3Z A;  2MLE C;  1KK8 B;  3VRQ A;  1ZUZ A;  3FWB A;  1JWD A;  2KFH A;  1F4Q A;  5CSI A;  3PM8 A;  1AVS A;  1OZO A;  3O6B A;  1WLM A;  3BYA A;  3GK1 A;  2JRF A;  4PHN A;  2L4H A;  3TZ1 A;  2PVB A;  2JZI A;  2WOR A;  3NSL A;  2Y4Q A;  2L0P A;  1VRK A;  4NDC A;  1Y6W A;  2H2K A;  2NCO A;  2BEC A;  2WOS A;  4XJK B;  1KCY A;  1FBV A;  2ZKM X;  2BCX A;  5HKZ A;  2BKH B;  1A75 A;  2L2E A;  4YBH B;  1XFU O;  3D0Y B;  2KGR A;  3IF7 A;  1AHR A;  5DKQ A;  2Q91 A;  2ISD A;  2NCP A;  2HF5 A;  3TDZ A;  1SL7 A;  1KQM B;  1TRF A;  1OMD A;  3SG6 A;  3SG3 A;  4OR9 B;  4A4B A;  4MLW A;  2QPT A;  1ZOT B;  4WQ2 A;  4ZCU A;  3PN7 B;  2HPS A;  1U5I B;  1J1E A;  4MBE A;  5HKW A;  1WRL A;  2KSP A;  2RGI A;  2WCF A;  3PFV A;  3CZT X;  1MR8 A;  1V1F A;  5D7F A;  2I2R E;  1XO5 A;  1SPY A;  4C0K A;  4GFT A;  1CDP A;  1EJ3 A;  1K2H A;  2L50 A;  5PAL A;  4E68 A;  1M39 A;  1DJX A;  3BUM B;  3D10 A;  3SJS A;  2BCB A;  2ZND A;  2K7C A;  2R2I A;  1M31 A;  3PSR A;  1WRK A;  1C7V A;  1EG4 A;  2LP3 A;  1XYD A;  1QAS A;  1ZFS A;  4MRX A;  4DUQ A;  5JJG A;  3ZWH A;  3OX6 A;  2K8M B;  1K90 D;  2M9G A;  1X02 A;  1KSM A;  1CMF A;  2LHI A;  2MA2 A;  2QAC A;  1NX1 A;  4JWQ A;  1B7T Z;  1QJT A;  1FPW A;  4ORC B;  1JBA A;  3SG4 A;  1BR4 B;  1SRA A;  1REC A;  1J55 A;  1C7W A;  1IJ5 A;  1JSA A;  1QX5 B;  1CDN A;  1KFU S;  1RJV A;  2KI4 C;  2LV7 A;  5G08 A;  3DVE A;  5K89 A;  3ICB A;  3WHU B;  1XFX O;  1NWD A;  3O78 A;  1LIN A;  2B1U A;  3C1V A;  3FWC A;  3KO0 A;  4CLN A;  2D8N A;  2ZFD A;  1YR5 A;  3O4Y A;  2M7L A;  1SL9 A;  3QRX A;  1LXF C;  1IWQ A;  1EG3 A;  3BOW A;  3K21 A;  1F4O A;  3KHE A;  1YUT A;  1AP4 A;  1SBJ A;  2I94 A;  1KK7 Z;  4MZL A;  4NQG A;  5JOL A;  1XVJ A;  2LUC A;  4A4C A;  1RRO A;  2K2F A;  1TNX A;  1J7P A;  1CLL A;  2JOJ A;  1RTP 1;  1N2D A;  1CFC A;  3ZNI A;  3AKB A;  1R2U A;  1ZMZ A;  1DJG A;  1CLB A;  1IQ5 A;  1OOJ A;  3I5G C;  5J3X A;  1IKU A;  1JC2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...