2Q91A

Structure of the ca2+-bound activated form of the s100a4 metastasis factor
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
96
structure length
96
Chain Sequence
b'ACPLEKALDVMVSTFHKYSGKEGDKFKLNKSELKELLTRELPSFLGKRTDEAAFQKLMSNLDSNRDNEVDFQEYCVFLSCIAMMCNEFFEGFPDKQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords S100A4 Metastasis Factor
publication title Structure of Ca(2+)-Bound S100A4 and Its Interaction with Peptides Derived from Nonmuscle Myosin-IIA.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal binding protein
total genus 36
structure length 96
sequence length 96
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-06-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2q91A00
1OMDA 3PSRA 3TDIA 1A75A 1NX1A 1KFXL 3TUYC 2Q4UA 1QASA 2Q91A 1QS7A 1KQMB 3CGAA 3EK7A 4M2QA 4CLNA 1A29A 4HRHA 5AFPA 1B1GA 1TNPA 2L4IA 2JXCA 1YUSA 3BUNB 4MEWA 4XJKB 1OE9B 1F4QA 2KAXA 2F3ZA 1LA0A 2F3YA 2JZIA 2ZRSA 3FWBA 5KTYA 2WC8A 1N65A 2LAPA 1F70A 1XK4A 1SL7A 4MRYA 3A4UB 4OCIA 1MWNA 2L2EA 2MAZA 3BYAA 2BKHB 3OB2B 1MXLC 5D69A 2L98A 2L5XB 1C7WA 2MLEC 1UWOA 4OVNF 2GV5A 2ZFDA 3VRQA 1NCXA 4TNCA 3CR4X 1QATA 3WHUB 2VRGA 5JJGA 1SPYA 4QJ3B 1YR5A 2KI4C 1C07A 4F0ZB 2LV7A 1RTP1 2M3WA 1W7JB 1E8AA 1WDCB 4IL1A 1LXFC 2JU0A 1W7IB 2K7BA 1S5GZ 1PVAA 5KU1A 4ORBB 1DGVA 3MSEB 3I5GB 4YGAA 4YGEB 1ZACA 2Y4QA 1UHKA 5I8NA 1TNQA 4AQIA 2ZNEA 4CFQA 1K9KA 2KAYA 3LLEA 4XYNA 5BPJA 3PALA 2JNFA 2FOTA 1PULA 4A4BA 5K89A 4NDDA 4MLWA 4ETOA 1KWOB 1G4YR 1Q80A 4OV2A 4YBHB 2BE4A 2LP2A 1SRAA 2KDHA 2R2IA 1KCYA 2PASA 1BR1B 1CDNA 2K8MB 3NSIA 2Y5IA 1K93D 2K2AA 4MZLA 1JSAA 2AUCA 3LK1A 3IQOA 1F71A 1Y1AA 4AOMA 1WRKA 3CR2A 2LNKA 3EKHA 1CB1A 1S36A 1RFJA 1C7VA 2BL0C 1JWDA 3I5FC 1KSMA 4C0KA 2LMVA 2KFGA 3CTNA 2K7DA 2I2RE 3RLZA 3HX4A 2AAOA 3OB1B 1IQ5A 4PHJA 1QV0A 1FI5A 5AERA 4AQJA 2K7CA 4PE7A 1TCFA 3BQ3A 2NZ0A 3IQQA 2LMTA 3KO0A 3ZWHA 1RECA 4QJ5B 1S3PA 3PATA 4P5OE 1J7OA 1B8CA 1XFYO 2KBMA 2O60A 1GJYA 1OMVA 5CSNA 2B1UA 4ZCUA 3SG2A 1DJXA 1MUXA 2HPSA 2M8UA 3CR5X 4D1EA 2AMIA 3JVTB 2LHLA 1IRJA 1N2DA 1MR8A 1DJWA 1QLSA 2JPTA 1PK0D 3KF9A 5CSIA 1X02A 2D8NA 2E6WA 2BBMA 3GK2A 1FW4A 1UHIA 2KI6D 3DVEA 5AXIA 4CIDA 2M9GA 5GQQC 1A75B 5DKNA 3PLFB 4PALA 4BY5A 2FCDA 5KSZA 1SR6B 1SL8A 2V53A 1B7TY 2JQ6A 3NSKA 1M45A 2OPOA 1PSRA 1TOPA 1ODBA 2E30A 2LM5A 4HREE 2GGMA 1AJ5A 4DRWA 1YTZC 1WDCC 1QIVA 4PE0A 1F54A 1S5GY 1UHJA 3BUMB 2M0RA 3FWCA 3GOFA 2PSRA 3I5HC 5B8IB 2KYCA 2M29A 5DKQA 3I5GC 2F2OA 2WORA 2ZN8A 2NCPA 2LCPA 3VRPA 1EL4A 4DIRA 1JFJA 3JTDB 2LUXA 1IJ6A 1GGZA 2JTTA 1ZUZA 2KYFA 1QJTA 1LVCD 1XFZO 5CSJA 1HQVA 2MHHA 3DF0A 1SY9A 2L0PA 1TRFA 1KWOC 1V1GA 1DJIA 4M2OA 1QTXA 4DS7A 3VRRA 4A4CA 1XA5A 2PRUA 2LLTA 1DJZA 1DGUA 3PN7B 3KHEA 1QXPA 3EVRA 5HLOA 5I2QA 1PSBA 1Y6WA 2WCFA 3SG7A 4E68A 1H4BA 2NXQA 1CDPA 4OR9B 1KFUS 2CNPA 4MRXA 1CM4A 2KFFA 2WCBA 1NSHA 1B8LA 2JOJA 1B7TZ 1DJHA 1YX7A 2SASA 3OP0A 1M63B 1JUOA 1BODA 2KAVA 2LUCA 2WNDA 1MHOA 1Y1XA 4CPVA 2FJUB 1GGWA 1NX2A 1M39A 3I5HB 1S6JA 4GNKB 4GGFC 4WQ3A 3VGOA 4GUKA 1QX5B 1NP8A 5HYDA 2KQ6A 2CT9A 1BOCA 2L4HA 5CSFA 2EHBA 4GBAA 1A2XA 1B47A 2LP3A 1K96A 4NQGA 1SNLA 2KBIA 1OQPA 1TN4A 4GAOA 4MSPA 2LVVA 3JVTC 3NXAA 2LANA 3KPXA 2BBNA 3FS7A 3EVVA 1SCMC 2NLNA 1NIWA 3PM8A 3SG5A 1CMGA 2L51A 1SK6D 5JOLA 2F8PA 2ZRTA 2H61C 3BOWA 1YRTB 2A4JA 1S6IA 1CLLA 1YUTA 4I5JA 1JFKA 1BMOA 1S1EA 1WLZA 1AHRA 2G2BA 3BUOB 4GPLB 3E3RA 2QACA 4MN0A 4ORAB 1NPQA 1SR6C 4I5NB 1FPWA 1KFXS 2F2PA 4YGCB 5J3XA 3BUXB 4N1FA 2LHIA 4C0LA 1CFPA 1K95A 4PHNA 3SG3A 1TCOB 1UURA 3D0YA 3CWGA 1QX7A 4JWQA 1AVSA 1N0YA 1YVLA 4PHKA 2G9BA 3EK8A 2ISDA 4HRGA 2BECA 1J7RA 1F4OA 3I5IB 1RWYA 1K9PA 1XK4C 3LL8B 2LE9B 2KI6C 1A4PA 4R1EA 4PCWA 4U8DA 2HQ8A 2M49B 1J1DA 1RROA 1QVIZ 3JTDC 4PE4A 1S6CA 1G33A 2EGDA 1TTXA 2MRDA 3DD4A 1CFCA 4MZJA 1CLBA 2CBLA 2F33A 2Y1MA 1SCMB 5ER4X 4M2PA 1K9UA 3PFVA 5F6TA 2BCXA 4L9MA 3OX6A 1KFUL 2LC5A 1CLMA 3DVMA 3PN7C 2K61A 2LMUA 2MBXA 1FBVA 1LINA 2L50A 3TS5B 5HKYA 4WQ2A 3O4YA 3KEVA 1XFWO 2JULA 1BJFA 1CDLA 3BUWB 1AP4A 3LK0A 1SKTA 1DJGA 4YGBB 1ALVA 1UHHA 3IF7A 2ZNDA 1GQMA 4N5XA 1KK8B 1U5IA 3VROA 4Q04A 2RGIA 5PALA 1AK8A 1UUSA 1PVBA 1DF0A 1RJVA 3CLNA 3K21A 2EC6C 1IJ5A 1SYMA 2KQYA 1DJYA 1Y0VH 3DF0B 2JTZA 2M7NA 4NDCA 1EG3A 3O78A 3C1VA 1B4CA 2SCPA 1NCZA 1TNXA 1SCVA 4GGNA 4NDBA 5ER5A 2LVIA 2MJWB 5AEQA 1G8IA 2JWWA 3AKAA 1BT6A 5D7FA 1FF1A 4HSZA 1K94A 1K2HA 4DUQA 1YRUB 1R2UA 3DVJA 1S26D 3O2PA 2H2KA 1CKKA 3GK4X 2KGBC 5HLVA 3D10A 2TN4A 2KNEA 1HT9A 3BXKA 2FCEA 3CS1A 1D1OA 3TDUA 3AAKA 3ICBA 3HCMA 3WNXB 2Y1NA 1CTRA 2JC2A 1FI6A 2JT3A 2OS8C 1MQ1A 5FYXA 1BU3A 1RK9A 1EJ3A 4YGDB 3SJSA 1XFXO 2O5GA 1XO5A 2QPTA 1A03A 1VRKA 1DTLA 1QV1A 2I7AA 2LLUA 1OOJA 3EKJA 1SBJA 2EC6B 3NSOA 5TNCA 3I5IC 1Y1UA 2JNXA 2OTGB 3CZTX 2KGRA 4WRIA 2COLB 1MF8B 3RM1A 1QIWA 3FIAA 1OSAA 1QVIY 1M46A 3H4SE 3AAJA 4XJKA 4JQ0D 3BOWB 1NYAA 1KSOA 1LKJA 1ALWA 1DVIA 2NCOA 4ORCB 4PDZA 1IWQA 1BR4B 1OZOA 1K90D 2BCAA 3GK1A 1UHNA 1YURA 2BE6A 2KHNA 3D0YB 2KSPA 2CTNA 2GGZA 1CMFA 1TNWA 2MLFC 3DVKA 4MBEA 5DKRA 3TS5C 3TUYB 1V1FA 1BG1A 2IS9A 4P2YB 2K2FA 1R6PA 1CM1A 4MVFA 2JT8A 2M1UA 2OS8B 1IKUA 2BKIB 3ZNIA 1XYDA 2BCBA 1KK8C 1AJ4A 2WOSA 1F55A 2HF5A 2PVBA 3EVUA 5G08A 4N1GA 1CFDA 1YUUA 2P6BB 4FQOA 2PALA 1DMOA 1NUBA 2CXJA 1J7PA 2HQWA 1NX3A 1J7QA 4CFRA 1H8BA 3A8RA 4GFTA 4I5KA 1ZOTB 1BF5A 1WRLA 1JBAA 3LCPC 4YRUA 1BLQA 1PRWA 4JPZB 1NWDA 3SIAA 4OKHA 1IH0A 1DT7B 2KFHA 2MA2A 1CDMA 4C0JA 2LVJA 1UP5A 1KQVA 1QLKA 1IQ3A 1L2OC 3OHMB 3WXAA 2WCEA 1KK7Y 2KI4B 1CFFA 4USLA 5AANA 2ZKMX 3VRNA 1U5IB 2CCMA 4FTGA 1YX8A 1B8RA 2M7LA 1LA3A 4I5LB 2JRFA 1DF0B 1K8UA 2PMYA 3AKBA 1B9AA 2K7OA 1J1EA 3TDZA 1J55A 1KQMC 1YVHA 2HETA 5HKWA 1L7ZA 3SG6A 3F45A 1CNPA 1WLMA 4ZCVA 3SIBA 2LVKA 1TIZA 1IGVA 1F8HA 1OZSA 2M1KB 5I2LA 5I2OA 3M0WA 1ZMZA 1SMGA 5CPVA 2ZN9A 1XVJA 1JF2A 2I18A 5IBWA 1SL9A 1PALA 1QX2A 5HKZA 4ICBA 4GGFA 2I94A 1EG4A 1M31A 3NSLA 4PE1A 1EH2A 4YI8A 2OTGC 2KOTA 2LLSA 3SG4A 1WY9A 3QRXA 1WRZA 4DCKA 1SW8A 3WHTB 2K0JA 3EK4A 4YI9A 1EXRA 1MXEA 1ZFSA 1XFVO 4PHMA 1NCYA 2JXLA 1XFUO 2JT0A 4QJ4B 4MZKA 4UPGA 1L2OB 2M97A 1JC2A 1NX0A 1IG5A 1JF0A 3O6BA 2BL0B 1KK7Z 3TZ1A 3I5FB 2DOQA 4BY4A 3OX5A 1AUIB 1OMRA 2H61A
chains in the Genus database with same CATH superfamily
1OMDA 3PSRA 3TDIA 1A75A 1NX1A 1KFXL 3TUYC 2Q4UA 2WCHA 1QASA 2Q91A 1QS7A 1KQMB 3CGAA 3EK7A 3Q8IA 4M2QA 4F7FA 4CLNA 1A29A 4HRHA 4INXA 5AFPA 1TNPA 2L4IA 1B1GA 2JXCA 1YUSA 3BUNB 1LS8A 4MEWA 4XJKB 3UNWA 1OE9B 1F4QA 2KAXA 2F3ZA 1LA0A 2F3YA 2JZIA 2ZRSA 3FWBA 5KTYA 2WC8A 1N65A 2LAPA 1F70A 1XK4A 1SL7A 4MRYA 3A4UB 4OCIA 1MWNA 2L2EA 2MAZA 5F6TA 3BYAA 2BKHB 3OB2B 1MXLC 5D69A 3NHTA 2L98A 2L5XB 1C7WA 2L5YA 1OOFA 2MLEC 1UWOA 4OVNF 2GV5A 2ZFDA 3VRQA 1NCXA 4TNCA 3CR4X 1QATA 3WHUB 2VRGA 5JJGA 1SPYA 4QJ3B 1YR5A 2KI4C 1C07A 4F0ZB 3CYZA 2LV7A 1RTP1 2M3WA 1W7JB 1E8AA 1WDCB 4IL1A 1LXFC 2JU0A 1W7IB 3S0EA 2K7BA 1S5GZ 1PVAA 5KU1A 4ORBB 1DGVA 3DXLA 3MSEB 3DYEA 3UO9A 3I5GB 4YGAA 4YGEB 1ZACA 2Y4QA 1UHKA 5I8NA 1TNQA 4AQIA 2ZNEA 4CFQA 1K9KA 2KAYA 3LLEA 4XYNA 5BPJA 2PQLA 3PALA 5D3OA 2JNFA 2FOTA 1ORGA 1PULA 3B7AA 4A4BA 5K89A 5FI6A 4NDDA 3FE8A 4MLWA 4ETOA 1KWOB 1G4YR 1Q80A 4OV2A 4YBHB 2BE4A 5FI2A 2LP2A 1SRAA 2KDHA 2BAPA 2R2IA 1KCYA 2PASA 1BR1B 1CDNA 2K8MB 3NSIA 2Y5IA 1K93D 2K2AA 4MZLA 1JSAA 2AUCA 3LK1A 3IQOA 1F71A 1Y1AA 4AOMA 1WRKA 3CR2A 2LNKA 3DY9A 3EKHA 1CB1A 1S36A 3S0BA 1RFJA 2K60A 1C7VA 2BL0C 1JWDA 3I5FC 1KSMA 4C0KA 2LMVA 2KFGA 3CTNA 2K7DA 2I2RE 3RLZA 3HX4A 2AAOA 3OB1B 1IQ5A 4PHJA 3NHIA 3V2LA 1QV0A 1FI5A 5AERA 4AQJA 2K7CA 3OGNA 4PE7A 1TCFA 3BQ3A 2NZ0A 3IQQA 2LMTA 3KO0A 3ZWHA 1RECA 4QJ5B 1S3PA 3PATA 4P5OE 1J7OA 1B8CA 1XFYO 2KBMA 2O60A 1GJYA 1OMVA 5CSNA 2B1UA 4ZCUA 3SG2A 1DJXA 1MUXA 1P28A 4PT1A 2HPSA 2M8UA 3CR5X 4D1EA 2AMIA 3JVTB 1QWVA 2LHLA 1IRJA 1N2DA 1MR8A 1DJWA 1QLSA 2JPTA 1GM0A 1PK0D 3KF9A 5CSIA 1X02A 2D8NA 2E6WA 3SS4A 2BBMA 3GK2A 1FW4A 3D77A 4IJ7A 1UHIA 2KI6D 3DVEA 5AXIA 4CIDA 2M9GA 5GQQC 1A75B 5DKNA 1XFRA 3PLFB 4PALA 1SSEB 4BY5A 2WCLA 1OW4A 2FCDA 4INWA 5KSZA 1SR6B 1SL8A 2V53A 1B7TY 2JQ6A 3NSKA 1M45A 2OPOA 1PSRA 1TOPA 1ODBA 2E30A 2LM5A 4HREE 2GGMA 1AJ5A 4DRWA 1YTZC 1WDCC 1QIVA 4PE0A 1F54A 1S5GY 1UHJA 3BUMB 3OBVA 2M0RA 3FWCA 3GOFA 2PSRA 3I5HC 5B8IB 2QEHA 2KYCA 2M29A 5DKQA 3I5GC 2F2OA 2WORA 2ZN8A 2NCPA 2LCPA 3VRPA 1EL4A 4DIRA 2WC6A 1JFJA 3JTDB 2FJYA 1IJ6A 1GGZA 2JTTA 2LUXA 5I94A 1OOHA 1ZUZA 2KYFA 1QJTA 3D75A 1LVCD 1XFZO 5CSJA 1HQVA 2MHHA 3CZ2A 1SY9A 3DF0A 2L0PA 3D73A 1TRFA 1KWOC 1V1GA 1DJIA 4M2OA 1QTXA 4DS7A 3VRRA 1DEKA 4A4CA 1XA5A 2PRUA 2LLTA 1DJZA 1DGUA 3PN7B 3KHEA 3S0FA 1QXPA 3EVRA 5HLOA 5I2QA 1PSBA 1Y6WA 2WCFA 3SG7A 4E68A 1H4BA 2NXQA 1CDPA 4OR9B 2KPHA 1KFUS 2CNPA 4MRXA 1CM4A 2KFFA 2WCBA 4OZDA 1NSHA 1B8LA 2JOJA 3R72A 1B7TZ 1DJHA 1YX7A 2SASA 2WC5A 3OP0A 1M63B 1JUOA 1BODA 2KAVA 2LUCA 2WNDA 1MHOA 1Y1XA 4CPVA 2FJUB 1GGWA 1NX2A 1M39A 3I5HB 1S6JA 4GNKB 4GGFC 4JKTA 4WQ3A 3VGOA 4GUKA 1DELA 1QX5B 1NP8A 4KYNA 2WCJA 5HYDA 2KQ6A 2CT9A 1BOCA 2L4HA 5CSFA 2EHBA 1OOGA 4GBAA 1A2XA 1B47A 2LP3A 1K96A 4NQGA 1SNLA 2KBIA 1OQPA 3BJHA 1TN4A 4GAOA 4MSPA 2LVVA 3JVTC 3NXAA 2LANA 3KPXA 2BBNA 3FS7A 3EVVA 1SCMC 2NLNA 1NIWA 3PM8A 3SG5A 1CMGA 2L51A 1SK6D 5JOLA 2F8PA 2ZRTA 2H61C 3BOWA 1YRTB 1S6IA 2A4JA 1CLLA 1YUTA 4I5JA 1JFKA 1BMOA 1S1EA 1WLZA 1AHRA 2G2BA 3BUOB 4GPLB 3E3RA 2QACA 4MN0A 4ORAB 1NPQA 1SR6C 4I5NB 1FPWA 1KFXS 2F2PA 4YGCB 5J3XA 3BUXB 4N1FA 2LHIA 4C0LA 1CFPA 1K95A 3FE9A 4PHNA 3SG3A 1TCOB 1UURA 3D0YA 3CWGA 1QX7A 4JWQA 1AVSA 1N0YA 1YVLA 3PM2A 3BFHA 4PHKA 2G9BA 3EK8A 2ISDA 4HRGA 4JD9A 2BECA 1J7RA 1F4OA 3I5IB 1RWYA 1K9PA 1XK4C 3LL8B 2LE9B 2KI6C 1A4PA 4R1EA 4PCWA 3S0DA 4U8DA 2HQ8A 2M49B 1J1DA 1RROA 1QVIZ 3JTDC 4PE4A 1S6CA 3S0GA 1G33A 2EGDA 3D74A 1TTXA 2MRDA 3DD4A 1CFCA 4MZJA 1CLBA 2CBLA 2F33A 2Y1MA 1SCMB 3L47A 5ER4X 4M2PA 1K9UA 3CDNA 3PFVA 2BCXA 4L9MA 3CZ0A 3O4XA 1KFUL 2LC5A 1CLMA 3B87A 3DVMA 3OX6A 2K61A 2LMUA 3PN7C 2MBXA 1FBVA 1LINA 2L50A 3TS5B 5HKYA 4WQ2A 3O4YA 3KEVA 1XFWO 2JULA 1BJFA 1CDLA 3BUWB 1AP4A 3SS5A 3LK0A 1SKTA 1DJGA 1C3YA 4YGBB 1ALVA 1UHHA 3IF7A 2ZNDA 1GQMA 4N5XA 1KK8B 1U5IA 3VROA 3R1PA 4Q04A 2RGIA 5PALA 1AK8A 1UUSA 2KLEA 3IVTA 1PVBA 3NGVA 1DF0A 1TUJA 1RJVA 3CLNA 3K21A 2EC6C 1IJ5A 1SYMA 2KQYA 1DJYA 1Y0VH 3DF0B 2ERBA 5HL1A 2JTZA 2M7NA 4NDCA 1EG3A 3O78A 3C1VA 1B4CA 2SCPA 3EG5B 1NCZA 1TNXA 1SCVA 4GGNA 4NDBA 5ER5A 2LVIA 2MJWB 2PYQA 1G8IA 2JWWA 3AKAA 1BT6A 5AEQA 5D7FA 1FF1A 4HSZA 1K94A 1K2HA 4DUQA 1YRUB 1R2UA 3DVJA 1S26D 3O2PA 1W9ZA 2H2KA 1CKKA 2KLDA 3GK4X 2KGBC 5HLVA 3D10A 1TWOA 2TN4A 3R1OA 2KNEA 1HT9A 3BXKA 2FCEA 3CS1A 1D1OA 3TDUA 3AAKA 3ICBA 2BNXA 3HCMA 2QEVA 2Y1NA 3WNXB 3D76A 1CTRA 2JC2A 1FI6A 2JT3A 2OS8C 1MQ1A 5FYXA 1BU3A 1RK9A 3L4AA 1EJ3A 4YGDB 3SJSA 1XFXO 2GTEA 2O5GA 2QEOA 1XO5A 2QPTA 1A03A 1VRKA 1DTLA 1QV1A 2I7AA 2LLUA 1OOJA 3EKJA 1SBJA 2EC6B 3NSOA 3PJIA 5TNCA 3I5IC 1Y1UA 2JNXA 2OTGB 3CZTX 2KGRA 4WRIA 2COLB 1MF8B 3RM1A 1Z4HA 1QIWA 5EL2A 1TUZA 1OSAA 1QVIY 1M46A 3FIAA 3H4SE 3AAJA 4XJKA 4JQ0D 3BOWB 1NYAA 1KSOA 1LKJA 1ALWA 1DVIA 2NCOA 4ORCB 4PDZA 1IWQA 1OOIX 3BFBA 1BR4B 1OZOA 3B88A 1K90D 1T14A 2BCAA 3GK1A 3FE6A 1UHNA 1YURA 2BE6A 2KHNA 2H8VA 3D0YB 3DZTA 2KSPA 2CTNA 3K1EA 2GGZA 1CMFA 1TNWA 2MLFC 3CABA 3DVKA 4MBEA 1C3ZA 5DKRA 1V1FA 3TS5C 3TUYB 1BG1A 2IS9A 4P2YB 2K2FA 1R6PA 1CM1A 4MVFA 3B86A 2JT8A 2M1UA 2OS8B 1IKUA 2BKIB 3ZNIA 1XYDA 2BCBA 1KK8C 1AJ4A 2WOSA 1F55A 2HF5A 2PVBA 3EVUA 5G08A 4N1GA 4FQTA 1CFDA 1YUUA 2P6BB 4FQOA 2PALA 1Z2CB 1IIOA 3QMEA 3R1VA 1DMOA 1NUBA 2CXJA 3SS3A 1J7PA 2QEBA 2HQWA 1NX3A 2WCKA 4CFRA 1J7QA 1H8BA 3A8RA 4GFTA 4I5KA 1ZOTB 1BF5A 1WRLA 5FI7A 1JBAA 3LCPC 4YRUA 1BLQA 3VB1A 1PRWA 4JPZB 1NWDA 1DC1A 2YGUA 3SIAA 4OKHA 1IH0A 1DT7B 2KFHA 2L2CA 1CDMA 2MA2A 4C0JA 2LVJA 1UP5A 1KQVA 1QLKA 1IQ3A 1L2OC 3OHMB 3WXAA 2WCEA 3RZSA 1KK7Y 2KI4B 1CFFA 4USLA 5AANA 2ZKMX 3VRNA 1U5IB 2CCMA 4FTGA 1YX8A 1B8RA 2M7LA 1LA3A 4I5LB 2JRFA 1DF0B 3N7HA 1K8UA 2PMYA 3AKBA 1B9AA 2K7OA 1J1EA 3TDZA 3D78A 1J55A 1KQMC 1YVHA 2HETA 5HKWA 1L7ZA 3SG6A 2WCMA 3F45A 1CNPA 1WLMA 4ZCVA 3SIBA 2LVKA 3CZ1A 2QDIA 1TIZA 1IGVA 1F8HA 1OZSA 2M1KB 5I2LA 5I2OA 3M0WA 1ZMZA 1SMGA 5CPVA 2ZN9A 1XVJA 1JF2A 3B6XA 2I18A 5IBWA 1SL9A 1PALA 1DQEA 1QX2A 2JPOA 3L4LA 5HKZA 2P71A 4ICBA 4GGFA 2I94A 1EG4A 1M31A 3NSLA 4PE1A 1EH2A 4YI8A 2OTGC 2KOTA 5DICA 2LLSA 3SG4A 1WY9A 3QRXA 1WRZA 4DCKA 1SW8A 3WHTB 2K0JA 3EK4A 4YI9A 1EXRA 1MXEA 1ZFSA 1XFVO 4PHMA 1NCYA 2JXLA 1XFUO 2JT0A 4QJ4B 4MZKA 4UPGA 1L2OB 2M97A 3S0AA 1JC2A 1NX0A 1IG5A 1JF0A 3O6BA 3BFAA 2BL0B 1KK7Z 3TZ1A 3I5FB 2DOQA 4BY4A 3OX5A 1AUIB 1OMRA 2H61A 2P70A
chains in the Genus database with same CATH topology
1OMDA 3PSRA 3TDIA 1A75A 1NX1A 1KFXL 3TUYC 2Q4UA 1QASA 2Q91A 1QS7A 1KQMB 3CGAA 3EK7A 4M2QA 4CLNA 1A29A 4HRHA 5AFPA 1B1GA 1TNPA 2L4IA 2JXCA 1YUSA 3BUNB 4MEWA 4XJKB 1OE9B 1F4QA 2KAXA 2F3ZA 1LA0A 2F3YA 2JZIA 2ZRSA 3FWBA 5KTYA 2WC8A 1N65A 2LAPA 1F70A 1XK4A 1SL7A 4MRYA 3A4UB 4OCIA 1MWNA 2L2EA 2MAZA 3BYAA 2BKHB 3OB2B 1MXLC 5D69A 2L98A 2L5XB 1C7WA 2MLEC 1UWOA 4OVNF 2GV5A 2ZFDA 3VRQA 1NCXA 4TNCA 3CR4X 1QATA 3WHUB 2VRGA 5JJGA 1SPYA 4QJ3B 1YR5A 2KI4C 1C07A 4F0ZB 2LV7A 1RTP1 2M3WA 1W7JB 1E8AA 1WDCB 4IL1A 1LXFC 2JU0A 1W7IB 2K7BA 1S5GZ 1PVAA 5KU1A 4ORBB 1DGVA 3MSEB 3I5GB 4YGAA 4YGEB 1ZACA 2Y4QA 1UHKA 5I8NA 1TNQA 4AQIA 2ZNEA 4CFQA 1K9KA 2KAYA 3LLEA 4XYNA 5BPJA 3PALA 2JNFA 2FOTA 1PULA 4A4BA 5K89A 4NDDA 4MLWA 4ETOA 1KWOB 1G4YR 1Q80A 4OV2A 4YBHB 2BE4A 2LP2A 1SRAA 2KDHA 2R2IA 1KCYA 2PASA 1BR1B 1CDNA 2K8MB 3NSIA 2Y5IA 1K93D 2K2AA 4MZLA 1JSAA 2AUCA 3LK1A 3IQOA 1F71A 1Y1AA 4AOMA 1WRKA 3CR2A 2LNKA 3EKHA 1CB1A 1S36A 1RFJA 1C7VA 2BL0C 1JWDA 3I5FC 1KSMA 4C0KA 2LMVA 2KFGA 3CTNA 2K7DA 2I2RE 3RLZA 3HX4A 2AAOA 3OB1B 1IQ5A 4PHJA 1QV0A 1FI5A 5AERA 4AQJA 2K7CA 4PE7A 1TCFA 3BQ3A 2NZ0A 3IQQA 2LMTA 3KO0A 3ZWHA 1RECA 4QJ5B 1S3PA 3PATA 4P5OE 1J7OA 1B8CA 1XFYO 2KBMA 2O60A 1GJYA 1OMVA 5CSNA 2B1UA 4ZCUA 3SG2A 1DJXA 1MUXA 2HPSA 2M8UA 3CR5X 4D1EA 2AMIA 3JVTB 2LHLA 1IRJA 1N2DA 1MR8A 1DJWA 1QLSA 2JPTA 1PK0D 3KF9A 5CSIA 1X02A 2D8NA 2E6WA 2BBMA 3GK2A 1FW4A 1UHIA 2KI6D 3DVEA 5AXIA 4CIDA 2M9GA 5GQQC 1A75B 5DKNA 3PLFB 4PALA 4BY5A 2FCDA 5KSZA 1SR6B 1SL8A 2V53A 1B7TY 2JQ6A 3NSKA 1M45A 2OPOA 1PSRA 1TOPA 1ODBA 2E30A 2LM5A 4HREE 2GGMA 1AJ5A 4DRWA 1YTZC 1WDCC 1QIVA 4PE0A 1F54A 1S5GY 1UHJA 3BUMB 2M0RA 3FWCA 3GOFA 2PSRA 3I5HC 5B8IB 2KYCA 2M29A 5DKQA 3I5GC 2F2OA 2WORA 2ZN8A 2NCPA 2LCPA 3VRPA 1EL4A 4DIRA 1JFJA 3JTDB 2LUXA 1IJ6A 1GGZA 2JTTA 1ZUZA 2KYFA 1QJTA 1LVCD 1XFZO 5CSJA 1HQVA 2MHHA 3DF0A 1SY9A 2L0PA 1TRFA 1KWOC 1V1GA 1DJIA 4M2OA 1QTXA 4DS7A 3VRRA 4A4CA 1XA5A 2PRUA 2LLTA 1DJZA 1DGUA 3PN7B 3KHEA 1QXPA 3EVRA 5HLOA 5I2QA 1PSBA 1Y6WA 2WCFA 3SG7A 4E68A 1H4BA 2NXQA 1CDPA 4OR9B 1KFUS 2CNPA 4MRXA 1CM4A 2KFFA 2WCBA 1NSHA 1B8LA 2JOJA 1B7TZ 1DJHA 1YX7A 2SASA 3OP0A 1M63B 1JUOA 1BODA 2KAVA 2LUCA 2WNDA 1MHOA 1Y1XA 4CPVA 2FJUB 1GGWA 1NX2A 1M39A 3I5HB 1S6JA 4GNKB 4GGFC 4WQ3A 3VGOA 4GUKA 1QX5B 1NP8A 5HYDA 2KQ6A 2CT9A 1BOCA 2L4HA 5CSFA 2EHBA 4GBAA 1A2XA 1B47A 2LP3A 1K96A 4NQGA 1SNLA 2KBIA 1OQPA 1TN4A 4GAOA 4MSPA 2LVVA 3JVTC 3NXAA 2LANA 3KPXA 2BBNA 3FS7A 3EVVA 1SCMC 2NLNA 1NIWA 3PM8A 3SG5A 1CMGA 2L51A 1SK6D 5JOLA 2F8PA 2ZRTA 2H61C 3BOWA 1YRTB 2A4JA 1S6IA 1CLLA 1YUTA 4I5JA 1JFKA 1BMOA 1S1EA 1WLZA 1AHRA 2G2BA 3BUOB 4GPLB 3E3RA 2QACA 4MN0A 4ORAB 1NPQA 1SR6C 4I5NB 1FPWA 1KFXS 2F2PA 4YGCB 5J3XA 3BUXB 4N1FA 2LHIA 4C0LA 1CFPA 1K95A 4PHNA 3SG3A 1TCOB 1UURA 3D0YA 3CWGA 1QX7A 4JWQA 1AVSA 1N0YA 1YVLA 4PHKA 2G9BA 3EK8A 2ISDA 4HRGA 2BECA 1J7RA 1F4OA 3I5IB 1RWYA 1K9PA 1XK4C 3LL8B 2LE9B 2KI6C 1A4PA 4R1EA 4PCWA 4U8DA 2HQ8A 2M49B 1J1DA 1RROA 1QVIZ 3JTDC 4PE4A 1S6CA 1G33A 2EGDA 1TTXA 2MRDA 3DD4A 1CFCA 4MZJA 1CLBA 2CBLA 2F33A 2Y1MA 1SCMB 5ER4X 4M2PA 1K9UA 3PFVA 5F6TA 2BCXA 4L9MA 3OX6A 1KFUL 2LC5A 1CLMA 3DVMA 3PN7C 2K61A 2LMUA 2MBXA 1FBVA 1LINA 2L50A 3TS5B 5HKYA 4WQ2A 3O4YA 3KEVA 1XFWO 2JULA 1BJFA 1CDLA 3BUWB 1AP4A 3LK0A 1SKTA 1DJGA 4YGBB 1ALVA 1UHHA 3IF7A 2ZNDA 1GQMA 4N5XA 1KK8B 1U5IA 3VROA 4Q04A 2RGIA 5PALA 1AK8A 1UUSA 1PVBA 1DF0A 1RJVA 3CLNA 3K21A 2EC6C 1IJ5A 1SYMA 2KQYA 1DJYA 1Y0VH 3DF0B 2JTZA 2M7NA 4NDCA 1EG3A 3O78A 3C1VA 1B4CA 2SCPA 1NCZA 1TNXA 1SCVA 4GGNA 4NDBA 5ER5A 2LVIA 2MJWB 5AEQA 1G8IA 2JWWA 3AKAA 1BT6A 5D7FA 1FF1A 4HSZA 1K94A 1K2HA 4DUQA 1YRUB 1R2UA 3DVJA 1S26D 3O2PA 2H2KA 1CKKA 3GK4X 2KGBC 5HLVA 3D10A 2TN4A 2KNEA 1HT9A 3BXKA 2FCEA 3CS1A 1D1OA 3TDUA 3AAKA 3ICBA 3HCMA 3WNXB 2Y1NA 1CTRA 2JC2A 1FI6A 2JT3A 2OS8C 1MQ1A 5FYXA 1BU3A 1RK9A 1EJ3A 4YGDB 3SJSA 1XFXO 2O5GA 1XO5A 2QPTA 1A03A 1VRKA 1DTLA 1QV1A 2I7AA 2LLUA 1OOJA 3EKJA 1SBJA 2EC6B 3NSOA 5TNCA 3I5IC 1Y1UA 2JNXA 2OTGB 3CZTX 2KGRA 4WRIA 2COLB 1MF8B 3RM1A 1QIWA 3FIAA 1OSAA 1QVIY 1M46A 3H4SE 3AAJA 4XJKA 4JQ0D 3BOWB 1NYAA 1KSOA 1LKJA 1ALWA 1DVIA 2NCOA 4ORCB 4PDZA 1IWQA 1BR4B 1OZOA 1K90D 2BCAA 3GK1A 1UHNA 1YURA 2BE6A 2KHNA 3D0YB 2KSPA 2CTNA 2GGZA 1CMFA 1TNWA 2MLFC 3DVKA 4MBEA 5DKRA 3TS5C 3TUYB 1V1FA 1BG1A 2IS9A 4P2YB 2K2FA 1R6PA 1CM1A 4MVFA 2JT8A 2M1UA 2OS8B 1IKUA 2BKIB 3ZNIA 1XYDA 2BCBA 1KK8C 1AJ4A 2WOSA 1F55A 2HF5A 2PVBA 3EVUA 5G08A 4N1GA 1CFDA 1YUUA 2P6BB 4FQOA 2PALA 1DMOA 1NUBA 2CXJA 1J7PA 2HQWA 1NX3A 1J7QA 4CFRA 1H8BA 3A8RA 4GFTA 4I5KA 1ZOTB 1BF5A 1WRLA 1JBAA 3LCPC 4YRUA 1BLQA 1PRWA 4JPZB 1NWDA 3SIAA 4OKHA 1IH0A 1DT7B 2KFHA 2MA2A 1CDMA 4C0JA 2LVJA 1UP5A 1KQVA 1QLKA 1IQ3A 1L2OC 3OHMB 3WXAA 2WCEA 1KK7Y 2KI4B 1CFFA 4USLA 5AANA 2ZKMX 3VRNA 1U5IB 2CCMA 4FTGA 1YX8A 1B8RA 2M7LA 1LA3A 4I5LB 2JRFA 1DF0B 1K8UA 2PMYA 3AKBA 1B9AA 2K7OA 1J1EA 3TDZA 1J55A 1KQMC 1YVHA 2HETA 5HKWA 1L7ZA 3SG6A 3F45A 1CNPA 1WLMA 4ZCVA 3SIBA 2LVKA 1TIZA 1IGVA 1F8HA 1OZSA 2M1KB 5I2LA 5I2OA 3M0WA 1ZMZA 1SMGA 5CPVA 2ZN9A 1XVJA 1JF2A 2I18A 5IBWA 1SL9A 1PALA 1QX2A 5HKZA 4ICBA 4GGFA 2I94A 1EG4A 1M31A 3NSLA 4PE1A 1EH2A 4YI8A 2OTGC 2KOTA 2LLSA 3SG4A 1WY9A 3QRXA 1WRZA 4DCKA 1SW8A 3WHTB 2K0JA 3EK4A 4YI9A 1EXRA 1MXEA 1ZFSA 1XFVO 4PHMA 1NCYA 2JXLA 1XFUO 2JT0A 4QJ4B 4MZKA 4UPGA 1L2OB 2M97A 1JC2A 1NX0A 1IG5A 1JF0A 3O6BA 2BL0B 1KK7Z 3TZ1A 3I5FB 2DOQA 4BY4A 3OX5A 1AUIB 1OMRA 2H61A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OMD A;  3PSR A;  3TDI A;  1A75 A;  1NX1 A;  1KFX L;  3TUY C;  2Q4U A;  1QAS A;  2Q91 A;  1QS7 A;  1KQM B;  3CGA A;  3EK7 A;  4M2Q A;  4CLN A;  1A29 A;  4HRH A;  5AFP A;  1B1G A;  1TNP A;  2L4I A;  2JXC A;  1YUS A;  3BUN B;  4MEW A;  4XJK B;  1OE9 B;  1F4Q A;  2KAX A;  2F3Z A;  1LA0 A;  2F3Y A;  2JZI A;  2ZRS A;  3FWB A;  5KTY A;  2WC8 A;  1N65 A;  2LAP A;  1F70 A;  1XK4 A;  1SL7 A;  4MRY A;  3A4U B;  4OCI A;  1MWN A;  2L2E A;  2MAZ A;  3BYA A;  2BKH B;  3OB2 B;  1MXL C;  5D69 A;  2L98 A;  2L5X B;  1C7W A;  2MLE C;  1UWO A;  4OVN F;  2GV5 A;  2ZFD A;  3VRQ A;  1NCX A;  4TNC A;  3CR4 X;  1QAT A;  3WHU B;  2VRG A;  5JJG A;  1SPY A;  4QJ3 B;  1YR5 A;  2KI4 C;  1C07 A;  4F0Z B;  2LV7 A;  1RTP 1;  2M3W A;  1W7J B;  1E8A A;  1WDC B;  4IL1 A;  1LXF C;  2JU0 A;  1W7I B;  2K7B A;  1S5G Z;  1PVA A;  5KU1 A;  4ORB B;  1DGV A;  3MSE B;  3I5G B;  4YGA A;  4YGE B;  1ZAC A;  2Y4Q A;  1UHK A;  5I8N A;  1TNQ A;  4AQI A;  2ZNE A;  4CFQ A;  1K9K A;  2KAY A;  3LLE A;  4XYN A;  5BPJ A;  3PAL A;  2JNF A;  2FOT A;  1PUL A;  4A4B A;  5K89 A;  4NDD A;  4MLW A;  4ETO A;  1KWO B;  1G4Y R;  1Q80 A;  4OV2 A;  4YBH B;  2BE4 A;  2LP2 A;  1SRA A;  2KDH A;  2R2I A;  1KCY A;  2PAS A;  1BR1 B;  1CDN A;  2K8M B;  3NSI A;  2Y5I A;  1K93 D;  2K2A A;  4MZL A;  1JSA A;  2AUC A;  3LK1 A;  3IQO A;  1F71 A;  1Y1A A;  4AOM A;  1WRK A;  3CR2 A;  2LNK A;  3EKH A;  1CB1 A;  1S36 A;  1RFJ A;  1C7V A;  2BL0 C;  1JWD A;  3I5F C;  1KSM A;  4C0K A;  2LMV A;  2KFG A;  3CTN A;  2K7D A;  2I2R E;  3RLZ A;  3HX4 A;  2AAO A;  3OB1 B;  1IQ5 A;  4PHJ A;  1QV0 A;  1FI5 A;  5AER A;  4AQJ A;  2K7C A;  4PE7 A;  1TCF A;  3BQ3 A;  2NZ0 A;  3IQQ A;  2LMT A;  3KO0 A;  3ZWH A;  1REC A;  4QJ5 B;  1S3P A;  3PAT A;  4P5O E;  1J7O A;  1B8C A;  1XFY O;  2KBM A;  2O60 A;  1GJY A;  1OMV A;  5CSN A;  2B1U A;  4ZCU A;  3SG2 A;  1DJX A;  1MUX A;  2HPS A;  2M8U A;  3CR5 X;  4D1E A;  2AMI A;  3JVT B;  2LHL A;  1IRJ A;  1N2D A;  1MR8 A;  1DJW A;  1QLS A;  2JPT A;  1PK0 D;  3KF9 A;  5CSI A;  1X02 A;  2D8N A;  2E6W A;  2BBM A;  3GK2 A;  1FW4 A;  1UHI A;  2KI6 D;  3DVE A;  5AXI A;  4CID A;  2M9G A;  5GQQ C;  1A75 B;  5DKN A;  3PLF B;  4PAL A;  4BY5 A;  2FCD A;  5KSZ A;  1SR6 B;  1SL8 A;  2V53 A;  1B7T Y;  2JQ6 A;  3NSK A;  1M45 A;  2OPO A;  1PSR A;  1TOP A;  1ODB A;  2E30 A;  2LM5 A;  4HRE E;  2GGM A;  1AJ5 A;  4DRW A;  1YTZ C;  1WDC C;  1QIV A;  4PE0 A;  1F54 A;  1S5G Y;  1UHJ A;  3BUM B;  2M0R A;  3FWC A;  3GOF A;  2PSR A;  3I5H C;  5B8I B;  2KYC A;  2M29 A;  5DKQ A;  3I5G C;  2F2O A;  2WOR A;  2ZN8 A;  2NCP A;  2LCP A;  3VRP A;  1EL4 A;  4DIR A;  1JFJ A;  3JTD B;  2LUX A;  1IJ6 A;  1GGZ A;  2JTT A;  1ZUZ A;  2KYF A;  1QJT A;  1LVC D;  1XFZ O;  5CSJ A;  1HQV A;  2MHH A;  3DF0 A;  1SY9 A;  2L0P A;  1TRF A;  1KWO C;  1V1G A;  1DJI A;  4M2O A;  1QTX A;  4DS7 A;  3VRR A;  4A4C A;  1XA5 A;  2PRU A;  2LLT A;  1DJZ A;  1DGU A;  3PN7 B;  3KHE A;  1QXP A;  3EVR A;  5HLO A;  5I2Q A;  1PSB A;  1Y6W A;  2WCF A;  3SG7 A;  4E68 A;  1H4B A;  2NXQ A;  1CDP A;  4OR9 B;  1KFU S;  2CNP A;  4MRX A;  1CM4 A;  2KFF A;  2WCB A;  1NSH A;  1B8L A;  2JOJ A;  1B7T Z;  1DJH A;  1YX7 A;  2SAS A;  3OP0 A;  1M63 B;  1JUO A;  1BOD A;  2KAV A;  2LUC A;  2WND A;  1MHO A;  1Y1X A;  4CPV A;  2FJU B;  1GGW A;  1NX2 A;  1M39 A;  3I5H B;  1S6J A;  4GNK B;  4GGF C;  4WQ3 A;  3VGO A;  4GUK A;  1QX5 B;  1NP8 A;  5HYD A;  2KQ6 A;  2CT9 A;  1BOC A;  2L4H A;  5CSF A;  2EHB A;  4GBA A;  1A2X A;  1B47 A;  2LP3 A;  1K96 A;  4NQG A;  1SNL A;  2KBI A;  1OQP A;  1TN4 A;  4GAO A;  4MSP A;  2LVV A;  3JVT C;  3NXA A;  2LAN A;  3KPX A;  2BBN A;  3FS7 A;  3EVV A;  1SCM C;  2NLN A;  1NIW A;  3PM8 A;  3SG5 A;  1CMG A;  2L51 A;  1SK6 D;  5JOL A;  2F8P A;  2ZRT A;  2H61 C;  3BOW A;  1YRT B;  2A4J A;  1S6I A;  1CLL A;  1YUT A;  4I5J A;  1JFK A;  1BMO A;  1S1E A;  1WLZ A;  1AHR A;  2G2B A;  3BUO B;  4GPL B;  3E3R A;  2QAC A;  4MN0 A;  4ORA B;  1NPQ A;  1SR6 C;  4I5N B;  1FPW A;  1KFX S;  2F2P A;  4YGC B;  5J3X A;  3BUX B;  4N1F A;  2LHI A;  4C0L A;  1CFP A;  1K95 A;  4PHN A;  3SG3 A;  1TCO B;  1UUR A;  3D0Y A;  3CWG A;  1QX7 A;  4JWQ A;  1AVS A;  1N0Y A;  1YVL A;  4PHK A;  2G9B A;  3EK8 A;  2ISD A;  4HRG A;  2BEC A;  1J7R A;  1F4O A;  3I5I B;  1RWY A;  1K9P A;  1XK4 C;  3LL8 B;  2LE9 B;  2KI6 C;  1A4P A;  4R1E A;  4PCW A;  4U8D A;  2HQ8 A;  2M49 B;  1J1D A;  1RRO A;  1QVI Z;  3JTD C;  4PE4 A;  1S6C A;  1G33 A;  2EGD A;  1TTX A;  2MRD A;  3DD4 A;  1CFC A;  4MZJ A;  1CLB A;  2CBL A;  2F33 A;  2Y1M A;  1SCM B;  5ER4 X;  4M2P A;  1K9U A;  3PFV A;  5F6T A;  2BCX A;  4L9M A;  3OX6 A;  1KFU L;  2LC5 A;  1CLM A;  3DVM A;  3PN7 C;  2K61 A;  2LMU A;  2MBX A;  1FBV A;  1LIN A;  2L50 A;  3TS5 B;  5HKY A;  4WQ2 A;  3O4Y A;  3KEV A;  1XFW O;  2JUL A;  1BJF A;  1CDL A;  3BUW B;  1AP4 A;  3LK0 A;  1SKT A;  1DJG A;  4YGB B;  1ALV A;  1UHH A;  3IF7 A;  2ZND A;  1GQM A;  4N5X A;  1KK8 B;  1U5I A;  3VRO A;  4Q04 A;  2RGI A;  5PAL A;  1AK8 A;  1UUS A;  1PVB A;  1DF0 A;  1RJV A;  3CLN A;  3K21 A;  2EC6 C;  1IJ5 A;  1SYM A;  2KQY A;  1DJY A;  1Y0V H;  3DF0 B;  2JTZ A;  2M7N A;  4NDC A;  1EG3 A;  3O78 A;  3C1V A;  1B4C A;  2SCP A;  1NCZ A;  1TNX A;  1SCV A;  4GGN A;  4NDB A;  5ER5 A;  2LVI A;  2MJW B;  5AEQ A;  1G8I A;  2JWW A;  3AKA A;  1BT6 A;  5D7F A;  1FF1 A;  4HSZ A;  1K94 A;  1K2H A;  4DUQ A;  1YRU B;  1R2U A;  3DVJ A;  1S26 D;  3O2P A;  2H2K A;  1CKK A;  3GK4 X;  2KGB C;  5HLV A;  3D10 A;  2TN4 A;  2KNE A;  1HT9 A;  3BXK A;  2FCE A;  3CS1 A;  1D1O A;  3TDU A;  3AAK A;  3ICB A;  3HCM A;  3WNX B;  2Y1N A;  1CTR A;  2JC2 A;  1FI6 A;  2JT3 A;  2OS8 C;  1MQ1 A;  5FYX A;  1BU3 A;  1RK9 A;  1EJ3 A;  4YGD B;  3SJS A;  1XFX O;  2O5G A;  1XO5 A;  2QPT A;  1A03 A;  1VRK A;  1DTL A;  1QV1 A;  2I7A A;  2LLU A;  1OOJ A;  3EKJ A;  1SBJ A;  2EC6 B;  3NSO A;  5TNC A;  3I5I C;  1Y1U A;  2JNX A;  2OTG B;  3CZT X;  2KGR A;  4WRI A;  2COL B;  1MF8 B;  3RM1 A;  1QIW A;  3FIA A;  1OSA A;  1QVI Y;  1M46 A;  3H4S E;  3AAJ A;  4XJK A;  4JQ0 D;  3BOW B;  1NYA A;  1KSO A;  1LKJ A;  1ALW A;  1DVI A;  2NCO A;  4ORC B;  4PDZ A;  1IWQ A;  1BR4 B;  1OZO A;  1K90 D;  2BCA A;  3GK1 A;  1UHN A;  1YUR A;  2BE6 A;  2KHN A;  3D0Y B;  2KSP A;  2CTN A;  2GGZ A;  1CMF A;  1TNW A;  2MLF C;  3DVK A;  4MBE A;  5DKR A;  3TS5 C;  3TUY B;  1V1F A;  1BG1 A;  2IS9 A;  4P2Y B;  2K2F A;  1R6P A;  1CM1 A;  4MVF A;  2JT8 A;  2M1U A;  2OS8 B;  1IKU A;  2BKI B;  3ZNI A;  1XYD A;  2BCB A;  1KK8 C;  1AJ4 A;  2WOS A;  1F55 A;  2HF5 A;  2PVB A;  3EVU A;  5G08 A;  4N1G A;  1CFD A;  1YUU A;  2P6B B;  4FQO A;  2PAL A;  1DMO A;  1NUB A;  2CXJ A;  1J7P A;  2HQW A;  1NX3 A;  1J7Q A;  4CFR A;  1H8B A;  3A8R A;  4GFT A;  4I5K A;  1ZOT B;  1BF5 A;  1WRL A;  1JBA A;  3LCP C;  4YRU A;  1BLQ A;  1PRW A;  4JPZ B;  1NWD A;  3SIA A;  4OKH A;  1IH0 A;  1DT7 B;  2KFH A;  2MA2 A;  1CDM A;  4C0J A;  2LVJ A;  1UP5 A;  1KQV A;  1QLK A;  1IQ3 A;  1L2O C;  3OHM B;  3WXA A;  2WCE A;  1KK7 Y;  2KI4 B;  1CFF A;  4USL A;  5AAN A;  2ZKM X;  3VRN A;  1U5I B;  2CCM A;  4FTG A;  1YX8 A;  1B8R A;  2M7L A;  1LA3 A;  4I5L B;  2JRF A;  1DF0 B;  1K8U A;  2PMY A;  3AKB A;  1B9A A;  2K7O A;  1J1E A;  3TDZ A;  1J55 A;  1KQM C;  1YVH A;  2HET A;  5HKW A;  1L7Z A;  3SG6 A;  3F45 A;  1CNP A;  1WLM A;  4ZCV A;  3SIB A;  2LVK A;  1TIZ A;  1IGV A;  1F8H A;  1OZS A;  2M1K B;  5I2L A;  5I2O A;  3M0W A;  1ZMZ A;  1SMG A;  5CPV A;  2ZN9 A;  1XVJ A;  1JF2 A;  2I18 A;  5IBW A;  1SL9 A;  1PAL A;  1QX2 A;  5HKZ A;  4ICB A;  4GGF A;  2I94 A;  1EG4 A;  1M31 A;  3NSL A;  4PE1 A;  1EH2 A;  4YI8 A;  2OTG C;  2KOT A;  2LLS A;  3SG4 A;  1WY9 A;  3QRX A;  1WRZ A;  4DCK A;  1SW8 A;  3WHT B;  2K0J A;  3EK4 A;  4YI9 A;  1EXR A;  1MXE A;  1ZFS A;  1XFV O;  4PHM A;  1NCY A;  2JXL A;  1XFU O;  2JT0 A;  4QJ4 B;  4MZK A;  4UPG A;  1L2O B;  2M97 A;  1JC2 A;  1NX0 A;  1IG5 A;  1JF0 A;  3O6B A;  2BL0 B;  1KK7 Z;  3TZ1 A;  3I5F B;  2DOQ A;  4BY4 A;  3OX5 A;  1AUI B;  1OMR A;  2H61 A; 
#chains in the Genus database with same CATH topology
 1OMD A;  3PSR A;  3TDI A;  1A75 A;  1NX1 A;  1KFX L;  3TUY C;  2Q4U A;  2WCH A;  1QAS A;  2Q91 A;  1QS7 A;  1KQM B;  3CGA A;  3EK7 A;  3Q8I A;  4M2Q A;  4F7F A;  4CLN A;  1A29 A;  4HRH A;  4INX A;  5AFP A;  1TNP A;  2L4I A;  1B1G A;  2JXC A;  1YUS A;  3BUN B;  1LS8 A;  4MEW A;  4XJK B;  3UNW A;  1OE9 B;  1F4Q A;  2KAX A;  2F3Z A;  1LA0 A;  2F3Y A;  2JZI A;  2ZRS A;  3FWB A;  5KTY A;  2WC8 A;  1N65 A;  2LAP A;  1F70 A;  1XK4 A;  1SL7 A;  4MRY A;  3A4U B;  4OCI A;  1MWN A;  2L2E A;  2MAZ A;  5F6T A;  3BYA A;  2BKH B;  3OB2 B;  1MXL C;  5D69 A;  3NHT A;  2L98 A;  2L5X B;  1C7W A;  2L5Y A;  1OOF A;  2MLE C;  1UWO A;  4OVN F;  2GV5 A;  2ZFD A;  3VRQ A;  1NCX A;  4TNC A;  3CR4 X;  1QAT A;  3WHU B;  2VRG A;  5JJG A;  1SPY A;  4QJ3 B;  1YR5 A;  2KI4 C;  1C07 A;  4F0Z B;  3CYZ A;  2LV7 A;  1RTP 1;  2M3W A;  1W7J B;  1E8A A;  1WDC B;  4IL1 A;  1LXF C;  2JU0 A;  1W7I B;  3S0E A;  2K7B A;  1S5G Z;  1PVA A;  5KU1 A;  4ORB B;  1DGV A;  3DXL A;  3MSE B;  3DYE A;  3UO9 A;  3I5G B;  4YGA A;  4YGE B;  1ZAC A;  2Y4Q A;  1UHK A;  5I8N A;  1TNQ A;  4AQI A;  2ZNE A;  4CFQ A;  1K9K A;  2KAY A;  3LLE A;  4XYN A;  5BPJ A;  2PQL A;  3PAL A;  5D3O A;  2JNF A;  2FOT A;  1ORG A;  1PUL A;  3B7A A;  4A4B A;  5K89 A;  5FI6 A;  4NDD A;  3FE8 A;  4MLW A;  4ETO A;  1KWO B;  1G4Y R;  1Q80 A;  4OV2 A;  4YBH B;  2BE4 A;  5FI2 A;  2LP2 A;  1SRA A;  2KDH A;  2BAP A;  2R2I A;  1KCY A;  2PAS A;  1BR1 B;  1CDN A;  2K8M B;  3NSI A;  2Y5I A;  1K93 D;  2K2A A;  4MZL A;  1JSA A;  2AUC A;  3LK1 A;  3IQO A;  1F71 A;  1Y1A A;  4AOM A;  1WRK A;  3CR2 A;  2LNK A;  3DY9 A;  3EKH A;  1CB1 A;  1S36 A;  3S0B A;  1RFJ A;  2K60 A;  1C7V A;  2BL0 C;  1JWD A;  3I5F C;  1KSM A;  4C0K A;  2LMV A;  2KFG A;  3CTN A;  2K7D A;  2I2R E;  3RLZ A;  3HX4 A;  2AAO A;  3OB1 B;  1IQ5 A;  4PHJ A;  3NHI A;  3V2L A;  1QV0 A;  1FI5 A;  5AER A;  4AQJ A;  2K7C A;  3OGN A;  4PE7 A;  1TCF A;  3BQ3 A;  2NZ0 A;  3IQQ A;  2LMT A;  3KO0 A;  3ZWH A;  1REC A;  4QJ5 B;  1S3P A;  3PAT A;  4P5O E;  1J7O A;  1B8C A;  1XFY O;  2KBM A;  2O60 A;  1GJY A;  1OMV A;  5CSN A;  2B1U A;  4ZCU A;  3SG2 A;  1DJX A;  1MUX A;  1P28 A;  4PT1 A;  2HPS A;  2M8U A;  3CR5 X;  4D1E A;  2AMI A;  3JVT B;  1QWV A;  2LHL A;  1IRJ A;  1N2D A;  1MR8 A;  1DJW A;  1QLS A;  2JPT A;  1GM0 A;  1PK0 D;  3KF9 A;  5CSI A;  1X02 A;  2D8N A;  2E6W A;  3SS4 A;  2BBM A;  3GK2 A;  1FW4 A;  3D77 A;  4IJ7 A;  1UHI A;  2KI6 D;  3DVE A;  5AXI A;  4CID A;  2M9G A;  5GQQ C;  1A75 B;  5DKN A;  1XFR A;  3PLF B;  4PAL A;  1SSE B;  4BY5 A;  2WCL A;  1OW4 A;  2FCD A;  4INW A;  5KSZ A;  1SR6 B;  1SL8 A;  2V53 A;  1B7T Y;  2JQ6 A;  3NSK A;  1M45 A;  2OPO A;  1PSR A;  1TOP A;  1ODB A;  2E30 A;  2LM5 A;  4HRE E;  2GGM A;  1AJ5 A;  4DRW A;  1YTZ C;  1WDC C;  1QIV A;  4PE0 A;  1F54 A;  1S5G Y;  1UHJ A;  3BUM B;  3OBV A;  2M0R A;  3FWC A;  3GOF A;  2PSR A;  3I5H C;  5B8I B;  2QEH A;  2KYC A;  2M29 A;  5DKQ A;  3I5G C;  2F2O A;  2WOR A;  2ZN8 A;  2NCP A;  2LCP A;  3VRP A;  1EL4 A;  4DIR A;  2WC6 A;  1JFJ A;  3JTD B;  2FJY A;  1IJ6 A;  1GGZ A;  2JTT A;  2LUX A;  5I94 A;  1OOH A;  1ZUZ A;  2KYF A;  1QJT A;  3D75 A;  1LVC D;  1XFZ O;  5CSJ A;  1HQV A;  2MHH A;  3CZ2 A;  1SY9 A;  3DF0 A;  2L0P A;  3D73 A;  1TRF A;  1KWO C;  1V1G A;  1DJI A;  4M2O A;  1QTX A;  4DS7 A;  3VRR A;  1DEK A;  4A4C A;  1XA5 A;  2PRU A;  2LLT A;  1DJZ A;  1DGU A;  3PN7 B;  3KHE A;  3S0F A;  1QXP A;  3EVR A;  5HLO A;  5I2Q A;  1PSB A;  1Y6W A;  2WCF A;  3SG7 A;  4E68 A;  1H4B A;  2NXQ A;  1CDP A;  4OR9 B;  2KPH A;  1KFU S;  2CNP A;  4MRX A;  1CM4 A;  2KFF A;  2WCB A;  4OZD A;  1NSH A;  1B8L A;  2JOJ A;  3R72 A;  1B7T Z;  1DJH A;  1YX7 A;  2SAS A;  2WC5 A;  3OP0 A;  1M63 B;  1JUO A;  1BOD A;  2KAV A;  2LUC A;  2WND A;  1MHO A;  1Y1X A;  4CPV A;  2FJU B;  1GGW A;  1NX2 A;  1M39 A;  3I5H B;  1S6J A;  4GNK B;  4GGF C;  4JKT A;  4WQ3 A;  3VGO A;  4GUK A;  1DEL A;  1QX5 B;  1NP8 A;  4KYN A;  2WCJ A;  5HYD A;  2KQ6 A;  2CT9 A;  1BOC A;  2L4H A;  5CSF A;  2EHB A;  1OOG A;  4GBA A;  1A2X A;  1B47 A;  2LP3 A;  1K96 A;  4NQG A;  1SNL A;  2KBI A;  1OQP A;  3BJH A;  1TN4 A;  4GAO A;  4MSP A;  2LVV A;  3JVT C;  3NXA A;  2LAN A;  3KPX A;  2BBN A;  3FS7 A;  3EVV A;  1SCM C;  2NLN A;  1NIW A;  3PM8 A;  3SG5 A;  1CMG A;  2L51 A;  1SK6 D;  5JOL A;  2F8P A;  2ZRT A;  2H61 C;  3BOW A;  1YRT B;  1S6I A;  2A4J A;  1CLL A;  1YUT A;  4I5J A;  1JFK A;  1BMO A;  1S1E A;  1WLZ A;  1AHR A;  2G2B A;  3BUO B;  4GPL B;  3E3R A;  2QAC A;  4MN0 A;  4ORA B;  1NPQ A;  1SR6 C;  4I5N B;  1FPW A;  1KFX S;  2F2P A;  4YGC B;  5J3X A;  3BUX B;  4N1F A;  2LHI A;  4C0L A;  1CFP A;  1K95 A;  3FE9 A;  4PHN A;  3SG3 A;  1TCO B;  1UUR A;  3D0Y A;  3CWG A;  1QX7 A;  4JWQ A;  1AVS A;  1N0Y A;  1YVL A;  3PM2 A;  3BFH A;  4PHK A;  2G9B A;  3EK8 A;  2ISD A;  4HRG A;  4JD9 A;  2BEC A;  1J7R A;  1F4O A;  3I5I B;  1RWY A;  1K9P A;  1XK4 C;  3LL8 B;  2LE9 B;  2KI6 C;  1A4P A;  4R1E A;  4PCW A;  3S0D A;  4U8D A;  2HQ8 A;  2M49 B;  1J1D A;  1RRO A;  1QVI Z;  3JTD C;  4PE4 A;  1S6C A;  3S0G A;  1G33 A;  2EGD A;  3D74 A;  1TTX A;  2MRD A;  3DD4 A;  1CFC A;  4MZJ A;  1CLB A;  2CBL A;  2F33 A;  2Y1M A;  1SCM B;  3L47 A;  5ER4 X;  4M2P A;  1K9U A;  3CDN A;  3PFV A;  2BCX A;  4L9M A;  3CZ0 A;  3O4X A;  1KFU L;  2LC5 A;  1CLM A;  3B87 A;  3DVM A;  3OX6 A;  2K61 A;  2LMU A;  3PN7 C;  2MBX A;  1FBV A;  1LIN A;  2L50 A;  3TS5 B;  5HKY A;  4WQ2 A;  3O4Y A;  3KEV A;  1XFW O;  2JUL A;  1BJF A;  1CDL A;  3BUW B;  1AP4 A;  3SS5 A;  3LK0 A;  1SKT A;  1DJG A;  1C3Y A;  4YGB B;  1ALV A;  1UHH A;  3IF7 A;  2ZND A;  1GQM A;  4N5X A;  1KK8 B;  1U5I A;  3VRO A;  3R1P A;  4Q04 A;  2RGI A;  5PAL A;  1AK8 A;  1UUS A;  2KLE A;  3IVT A;  1PVB A;  3NGV A;  1DF0 A;  1TUJ A;  1RJV A;  3CLN A;  3K21 A;  2EC6 C;  1IJ5 A;  1SYM A;  2KQY A;  1DJY A;  1Y0V H;  3DF0 B;  2ERB A;  5HL1 A;  2JTZ A;  2M7N A;  4NDC A;  1EG3 A;  3O78 A;  3C1V A;  1B4C A;  2SCP A;  3EG5 B;  1NCZ A;  1TNX A;  1SCV A;  4GGN A;  4NDB A;  5ER5 A;  2LVI A;  2MJW B;  2PYQ A;  1G8I A;  2JWW A;  3AKA A;  1BT6 A;  5AEQ A;  5D7F A;  1FF1 A;  4HSZ A;  1K94 A;  1K2H A;  4DUQ A;  1YRU B;  1R2U A;  3DVJ A;  1S26 D;  3O2P A;  1W9Z A;  2H2K A;  1CKK A;  2KLD A;  3GK4 X;  2KGB C;  5HLV A;  3D10 A;  1TWO A;  2TN4 A;  3R1O A;  2KNE A;  1HT9 A;  3BXK A;  2FCE A;  3CS1 A;  1D1O A;  3TDU A;  3AAK A;  3ICB A;  2BNX A;  3HCM A;  2QEV A;  2Y1N A;  3WNX B;  3D76 A;  1CTR A;  2JC2 A;  1FI6 A;  2JT3 A;  2OS8 C;  1MQ1 A;  5FYX A;  1BU3 A;  1RK9 A;  3L4A A;  1EJ3 A;  4YGD B;  3SJS A;  1XFX O;  2GTE A;  2O5G A;  2QEO A;  1XO5 A;  2QPT A;  1A03 A;  1VRK A;  1DTL A;  1QV1 A;  2I7A A;  2LLU A;  1OOJ A;  3EKJ A;  1SBJ A;  2EC6 B;  3NSO A;  3PJI A;  5TNC A;  3I5I C;  1Y1U A;  2JNX A;  2OTG B;  3CZT X;  2KGR A;  4WRI A;  2COL B;  1MF8 B;  3RM1 A;  1Z4H A;  1QIW A;  5EL2 A;  1TUZ A;  1OSA A;  1QVI Y;  1M46 A;  3FIA A;  3H4S E;  3AAJ A;  4XJK A;  4JQ0 D;  3BOW B;  1NYA A;  1KSO A;  1LKJ A;  1ALW A;  1DVI A;  2NCO A;  4ORC B;  4PDZ A;  1IWQ A;  1OOI X;  3BFB A;  1BR4 B;  1OZO A;  3B88 A;  1K90 D;  1T14 A;  2BCA A;  3GK1 A;  3FE6 A;  1UHN A;  1YUR A;  2BE6 A;  2KHN A;  2H8V A;  3D0Y B;  3DZT A;  2KSP A;  2CTN A;  3K1E A;  2GGZ A;  1CMF A;  1TNW A;  2MLF C;  3CAB A;  3DVK A;  4MBE A;  1C3Z A;  5DKR A;  1V1F A;  3TS5 C;  3TUY B;  1BG1 A;  2IS9 A;  4P2Y B;  2K2F A;  1R6P A;  1CM1 A;  4MVF A;  3B86 A;  2JT8 A;  2M1U A;  2OS8 B;  1IKU A;  2BKI B;  3ZNI A;  1XYD A;  2BCB A;  1KK8 C;  1AJ4 A;  2WOS A;  1F55 A;  2HF5 A;  2PVB A;  3EVU A;  5G08 A;  4N1G A;  4FQT A;  1CFD A;  1YUU A;  2P6B B;  4FQO A;  2PAL A;  1Z2C B;  1IIO A;  3QME A;  3R1V A;  1DMO A;  1NUB A;  2CXJ A;  3SS3 A;  1J7P A;  2QEB A;  2HQW A;  1NX3 A;  2WCK A;  4CFR A;  1J7Q A;  1H8B A;  3A8R A;  4GFT A;  4I5K A;  1ZOT B;  1BF5 A;  1WRL A;  5FI7 A;  1JBA A;  3LCP C;  4YRU A;  1BLQ A;  3VB1 A;  1PRW A;  4JPZ B;  1NWD A;  1DC1 A;  2YGU A;  3SIA A;  4OKH A;  1IH0 A;  1DT7 B;  2KFH A;  2L2C A;  1CDM A;  2MA2 A;  4C0J A;  2LVJ A;  1UP5 A;  1KQV A;  1QLK A;  1IQ3 A;  1L2O C;  3OHM B;  3WXA A;  2WCE A;  3RZS A;  1KK7 Y;  2KI4 B;  1CFF A;  4USL A;  5AAN A;  2ZKM X;  3VRN A;  1U5I B;  2CCM A;  4FTG A;  1YX8 A;  1B8R A;  2M7L A;  1LA3 A;  4I5L B;  2JRF A;  1DF0 B;  3N7H A;  1K8U A;  2PMY A;  3AKB A;  1B9A A;  2K7O A;  1J1E A;  3TDZ A;  3D78 A;  1J55 A;  1KQM C;  1YVH A;  2HET A;  5HKW A;  1L7Z A;  3SG6 A;  2WCM A;  3F45 A;  1CNP A;  1WLM A;  4ZCV A;  3SIB A;  2LVK A;  3CZ1 A;  2QDI A;  1TIZ A;  1IGV A;  1F8H A;  1OZS A;  2M1K B;  5I2L A;  5I2O A;  3M0W A;  1ZMZ A;  1SMG A;  5CPV A;  2ZN9 A;  1XVJ A;  1JF2 A;  3B6X A;  2I18 A;  5IBW A;  1SL9 A;  1PAL A;  1DQE A;  1QX2 A;  2JPO A;  3L4L A;  5HKZ A;  2P71 A;  4ICB A;  4GGF A;  2I94 A;  1EG4 A;  1M31 A;  3NSL A;  4PE1 A;  1EH2 A;  4YI8 A;  2OTG C;  2KOT A;  5DIC A;  2LLS A;  3SG4 A;  1WY9 A;  3QRX A;  1WRZ A;  4DCK A;  1SW8 A;  3WHT B;  2K0J A;  3EK4 A;  4YI9 A;  1EXR A;  1MXE A;  1ZFS A;  1XFV O;  4PHM A;  1NCY A;  2JXL A;  1XFU O;  2JT0 A;  4QJ4 B;  4MZK A;  4UPG A;  1L2O B;  2M97 A;  3S0A A;  1JC2 A;  1NX0 A;  1IG5 A;  1JF0 A;  3O6B A;  3BFA A;  2BL0 B;  1KK7 Z;  3TZ1 A;  3I5F B;  2DOQ A;  4BY4 A;  3OX5 A;  1AUI B;  1OMR A;  2H61 A;  2P70 A; 
#chains in the Genus database with same CATH homology
 1OMD A;  3PSR A;  3TDI A;  1A75 A;  1NX1 A;  1KFX L;  3TUY C;  2Q4U A;  1QAS A;  2Q91 A;  1QS7 A;  1KQM B;  3CGA A;  3EK7 A;  4M2Q A;  4CLN A;  1A29 A;  4HRH A;  5AFP A;  1B1G A;  1TNP A;  2L4I A;  2JXC A;  1YUS A;  3BUN B;  4MEW A;  4XJK B;  1OE9 B;  1F4Q A;  2KAX A;  2F3Z A;  1LA0 A;  2F3Y A;  2JZI A;  2ZRS A;  3FWB A;  5KTY A;  2WC8 A;  1N65 A;  2LAP A;  1F70 A;  1XK4 A;  1SL7 A;  4MRY A;  3A4U B;  4OCI A;  1MWN A;  2L2E A;  2MAZ A;  3BYA A;  2BKH B;  3OB2 B;  1MXL C;  5D69 A;  2L98 A;  2L5X B;  1C7W A;  2MLE C;  1UWO A;  4OVN F;  2GV5 A;  2ZFD A;  3VRQ A;  1NCX A;  4TNC A;  3CR4 X;  1QAT A;  3WHU B;  2VRG A;  5JJG A;  1SPY A;  4QJ3 B;  1YR5 A;  2KI4 C;  1C07 A;  4F0Z B;  2LV7 A;  1RTP 1;  2M3W A;  1W7J B;  1E8A A;  1WDC B;  4IL1 A;  1LXF C;  2JU0 A;  1W7I B;  2K7B A;  1S5G Z;  1PVA A;  5KU1 A;  4ORB B;  1DGV A;  3MSE B;  3I5G B;  4YGA A;  4YGE B;  1ZAC A;  2Y4Q A;  1UHK A;  5I8N A;  1TNQ A;  4AQI A;  2ZNE A;  4CFQ A;  1K9K A;  2KAY A;  3LLE A;  4XYN A;  5BPJ A;  3PAL A;  2JNF A;  2FOT A;  1PUL A;  4A4B A;  5K89 A;  4NDD A;  4MLW A;  4ETO A;  1KWO B;  1G4Y R;  1Q80 A;  4OV2 A;  4YBH B;  2BE4 A;  2LP2 A;  1SRA A;  2KDH A;  2R2I A;  1KCY A;  2PAS A;  1BR1 B;  1CDN A;  2K8M B;  3NSI A;  2Y5I A;  1K93 D;  2K2A A;  4MZL A;  1JSA A;  2AUC A;  3LK1 A;  3IQO A;  1F71 A;  1Y1A A;  4AOM A;  1WRK A;  3CR2 A;  2LNK A;  3EKH A;  1CB1 A;  1S36 A;  1RFJ A;  1C7V A;  2BL0 C;  1JWD A;  3I5F C;  1KSM A;  4C0K A;  2LMV A;  2KFG A;  3CTN A;  2K7D A;  2I2R E;  3RLZ A;  3HX4 A;  2AAO A;  3OB1 B;  1IQ5 A;  4PHJ A;  1QV0 A;  1FI5 A;  5AER A;  4AQJ A;  2K7C A;  4PE7 A;  1TCF A;  3BQ3 A;  2NZ0 A;  3IQQ A;  2LMT A;  3KO0 A;  3ZWH A;  1REC A;  4QJ5 B;  1S3P A;  3PAT A;  4P5O E;  1J7O A;  1B8C A;  1XFY O;  2KBM A;  2O60 A;  1GJY A;  1OMV A;  5CSN A;  2B1U A;  4ZCU A;  3SG2 A;  1DJX A;  1MUX A;  2HPS A;  2M8U A;  3CR5 X;  4D1E A;  2AMI A;  3JVT B;  2LHL A;  1IRJ A;  1N2D A;  1MR8 A;  1DJW A;  1QLS A;  2JPT A;  1PK0 D;  3KF9 A;  5CSI A;  1X02 A;  2D8N A;  2E6W A;  2BBM A;  3GK2 A;  1FW4 A;  1UHI A;  2KI6 D;  3DVE A;  5AXI A;  4CID A;  2M9G A;  5GQQ C;  1A75 B;  5DKN A;  3PLF B;  4PAL A;  4BY5 A;  2FCD A;  5KSZ A;  1SR6 B;  1SL8 A;  2V53 A;  1B7T Y;  2JQ6 A;  3NSK A;  1M45 A;  2OPO A;  1PSR A;  1TOP A;  1ODB A;  2E30 A;  2LM5 A;  4HRE E;  2GGM A;  1AJ5 A;  4DRW A;  1YTZ C;  1WDC C;  1QIV A;  4PE0 A;  1F54 A;  1S5G Y;  1UHJ A;  3BUM B;  2M0R A;  3FWC A;  3GOF A;  2PSR A;  3I5H C;  5B8I B;  2KYC A;  2M29 A;  5DKQ A;  3I5G C;  2F2O A;  2WOR A;  2ZN8 A;  2NCP A;  2LCP A;  3VRP A;  1EL4 A;  4DIR A;  1JFJ A;  3JTD B;  2LUX A;  1IJ6 A;  1GGZ A;  2JTT A;  1ZUZ A;  2KYF A;  1QJT A;  1LVC D;  1XFZ O;  5CSJ A;  1HQV A;  2MHH A;  3DF0 A;  1SY9 A;  2L0P A;  1TRF A;  1KWO C;  1V1G A;  1DJI A;  4M2O A;  1QTX A;  4DS7 A;  3VRR A;  4A4C A;  1XA5 A;  2PRU A;  2LLT A;  1DJZ A;  1DGU A;  3PN7 B;  3KHE A;  1QXP A;  3EVR A;  5HLO A;  5I2Q A;  1PSB A;  1Y6W A;  2WCF A;  3SG7 A;  4E68 A;  1H4B A;  2NXQ A;  1CDP A;  4OR9 B;  1KFU S;  2CNP A;  4MRX A;  1CM4 A;  2KFF A;  2WCB A;  1NSH A;  1B8L A;  2JOJ A;  1B7T Z;  1DJH A;  1YX7 A;  2SAS A;  3OP0 A;  1M63 B;  1JUO A;  1BOD A;  2KAV A;  2LUC A;  2WND A;  1MHO A;  1Y1X A;  4CPV A;  2FJU B;  1GGW A;  1NX2 A;  1M39 A;  3I5H B;  1S6J A;  4GNK B;  4GGF C;  4WQ3 A;  3VGO A;  4GUK A;  1QX5 B;  1NP8 A;  5HYD A;  2KQ6 A;  2CT9 A;  1BOC A;  2L4H A;  5CSF A;  2EHB A;  4GBA A;  1A2X A;  1B47 A;  2LP3 A;  1K96 A;  4NQG A;  1SNL A;  2KBI A;  1OQP A;  1TN4 A;  4GAO A;  4MSP A;  2LVV A;  3JVT C;  3NXA A;  2LAN A;  3KPX A;  2BBN A;  3FS7 A;  3EVV A;  1SCM C;  2NLN A;  1NIW A;  3PM8 A;  3SG5 A;  1CMG A;  2L51 A;  1SK6 D;  5JOL A;  2F8P A;  2ZRT A;  2H61 C;  3BOW A;  1YRT B;  2A4J A;  1S6I A;  1CLL A;  1YUT A;  4I5J A;  1JFK A;  1BMO A;  1S1E A;  1WLZ A;  1AHR A;  2G2B A;  3BUO B;  4GPL B;  3E3R A;  2QAC A;  4MN0 A;  4ORA B;  1NPQ A;  1SR6 C;  4I5N B;  1FPW A;  1KFX S;  2F2P A;  4YGC B;  5J3X A;  3BUX B;  4N1F A;  2LHI A;  4C0L A;  1CFP A;  1K95 A;  4PHN A;  3SG3 A;  1TCO B;  1UUR A;  3D0Y A;  3CWG A;  1QX7 A;  4JWQ A;  1AVS A;  1N0Y A;  1YVL A;  4PHK A;  2G9B A;  3EK8 A;  2ISD A;  4HRG A;  2BEC A;  1J7R A;  1F4O A;  3I5I B;  1RWY A;  1K9P A;  1XK4 C;  3LL8 B;  2LE9 B;  2KI6 C;  1A4P A;  4R1E A;  4PCW A;  4U8D A;  2HQ8 A;  2M49 B;  1J1D A;  1RRO A;  1QVI Z;  3JTD C;  4PE4 A;  1S6C A;  1G33 A;  2EGD A;  1TTX A;  2MRD A;  3DD4 A;  1CFC A;  4MZJ A;  1CLB A;  2CBL A;  2F33 A;  2Y1M A;  1SCM B;  5ER4 X;  4M2P A;  1K9U A;  3PFV A;  5F6T A;  2BCX A;  4L9M A;  3OX6 A;  1KFU L;  2LC5 A;  1CLM A;  3DVM A;  3PN7 C;  2K61 A;  2LMU A;  2MBX A;  1FBV A;  1LIN A;  2L50 A;  3TS5 B;  5HKY A;  4WQ2 A;  3O4Y A;  3KEV A;  1XFW O;  2JUL A;  1BJF A;  1CDL A;  3BUW B;  1AP4 A;  3LK0 A;  1SKT A;  1DJG A;  4YGB B;  1ALV A;  1UHH A;  3IF7 A;  2ZND A;  1GQM A;  4N5X A;  1KK8 B;  1U5I A;  3VRO A;  4Q04 A;  2RGI A;  5PAL A;  1AK8 A;  1UUS A;  1PVB A;  1DF0 A;  1RJV A;  3CLN A;  3K21 A;  2EC6 C;  1IJ5 A;  1SYM A;  2KQY A;  1DJY A;  1Y0V H;  3DF0 B;  2JTZ A;  2M7N A;  4NDC A;  1EG3 A;  3O78 A;  3C1V A;  1B4C A;  2SCP A;  1NCZ A;  1TNX A;  1SCV A;  4GGN A;  4NDB A;  5ER5 A;  2LVI A;  2MJW B;  5AEQ A;  1G8I A;  2JWW A;  3AKA A;  1BT6 A;  5D7F A;  1FF1 A;  4HSZ A;  1K94 A;  1K2H A;  4DUQ A;  1YRU B;  1R2U A;  3DVJ A;  1S26 D;  3O2P A;  2H2K A;  1CKK A;  3GK4 X;  2KGB C;  5HLV A;  3D10 A;  2TN4 A;  2KNE A;  1HT9 A;  3BXK A;  2FCE A;  3CS1 A;  1D1O A;  3TDU A;  3AAK A;  3ICB A;  3HCM A;  3WNX B;  2Y1N A;  1CTR A;  2JC2 A;  1FI6 A;  2JT3 A;  2OS8 C;  1MQ1 A;  5FYX A;  1BU3 A;  1RK9 A;  1EJ3 A;  4YGD B;  3SJS A;  1XFX O;  2O5G A;  1XO5 A;  2QPT A;  1A03 A;  1VRK A;  1DTL A;  1QV1 A;  2I7A A;  2LLU A;  1OOJ A;  3EKJ A;  1SBJ A;  2EC6 B;  3NSO A;  5TNC A;  3I5I C;  1Y1U A;  2JNX A;  2OTG B;  3CZT X;  2KGR A;  4WRI A;  2COL B;  1MF8 B;  3RM1 A;  1QIW A;  3FIA A;  1OSA A;  1QVI Y;  1M46 A;  3H4S E;  3AAJ A;  4XJK A;  4JQ0 D;  3BOW B;  1NYA A;  1KSO A;  1LKJ A;  1ALW A;  1DVI A;  2NCO A;  4ORC B;  4PDZ A;  1IWQ A;  1BR4 B;  1OZO A;  1K90 D;  2BCA A;  3GK1 A;  1UHN A;  1YUR A;  2BE6 A;  2KHN A;  3D0Y B;  2KSP A;  2CTN A;  2GGZ A;  1CMF A;  1TNW A;  2MLF C;  3DVK A;  4MBE A;  5DKR A;  3TS5 C;  3TUY B;  1V1F A;  1BG1 A;  2IS9 A;  4P2Y B;  2K2F A;  1R6P A;  1CM1 A;  4MVF A;  2JT8 A;  2M1U A;  2OS8 B;  1IKU A;  2BKI B;  3ZNI A;  1XYD A;  2BCB A;  1KK8 C;  1AJ4 A;  2WOS A;  1F55 A;  2HF5 A;  2PVB A;  3EVU A;  5G08 A;  4N1G A;  1CFD A;  1YUU A;  2P6B B;  4FQO A;  2PAL A;  1DMO A;  1NUB A;  2CXJ A;  1J7P A;  2HQW A;  1NX3 A;  1J7Q A;  4CFR A;  1H8B A;  3A8R A;  4GFT A;  4I5K A;  1ZOT B;  1BF5 A;  1WRL A;  1JBA A;  3LCP C;  4YRU A;  1BLQ A;  1PRW A;  4JPZ B;  1NWD A;  3SIA A;  4OKH A;  1IH0 A;  1DT7 B;  2KFH A;  2MA2 A;  1CDM A;  4C0J A;  2LVJ A;  1UP5 A;  1KQV A;  1QLK A;  1IQ3 A;  1L2O C;  3OHM B;  3WXA A;  2WCE A;  1KK7 Y;  2KI4 B;  1CFF A;  4USL A;  5AAN A;  2ZKM X;  3VRN A;  1U5I B;  2CCM A;  4FTG A;  1YX8 A;  1B8R A;  2M7L A;  1LA3 A;  4I5L B;  2JRF A;  1DF0 B;  1K8U A;  2PMY A;  3AKB A;  1B9A A;  2K7O A;  1J1E A;  3TDZ A;  1J55 A;  1KQM C;  1YVH A;  2HET A;  5HKW A;  1L7Z A;  3SG6 A;  3F45 A;  1CNP A;  1WLM A;  4ZCV A;  3SIB A;  2LVK A;  1TIZ A;  1IGV A;  1F8H A;  1OZS A;  2M1K B;  5I2L A;  5I2O A;  3M0W A;  1ZMZ A;  1SMG A;  5CPV A;  2ZN9 A;  1XVJ A;  1JF2 A;  2I18 A;  5IBW A;  1SL9 A;  1PAL A;  1QX2 A;  5HKZ A;  4ICB A;  4GGF A;  2I94 A;  1EG4 A;  1M31 A;  3NSL A;  4PE1 A;  1EH2 A;  4YI8 A;  2OTG C;  2KOT A;  2LLS A;  3SG4 A;  1WY9 A;  3QRX A;  1WRZ A;  4DCK A;  1SW8 A;  3WHT B;  2K0J A;  3EK4 A;  4YI9 A;  1EXR A;  1MXE A;  1ZFS A;  1XFV O;  4PHM A;  1NCY A;  2JXL A;  1XFU O;  2JT0 A;  4QJ4 B;  4MZK A;  4UPG A;  1L2O B;  2M97 A;  1JC2 A;  1NX0 A;  1IG5 A;  1JF0 A;  3O6B A;  2BL0 B;  1KK7 Z;  3TZ1 A;  3I5F B;  2DOQ A;  4BY4 A;  3OX5 A;  1AUI B;  1OMR A;  2H61 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...