2Q91A

Structure of the ca2+-bound activated form of the s100a4 metastasis factor
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
96
structure length
96
Chain Sequence
ACPLEKALDVMVSTFHKYSGKEGDKFKLNKSELKELLTRELPSFLGKRTDEAAFQKLMSNLDSNRDNEVDFQEYCVFLSCIAMMCNEFFEGFPDKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of Ca(2+)-Bound S100A4 and Its Interaction with Peptides Derived from Nonmuscle Myosin-IIA.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal binding protein
molecule keywords S100A4 Metastasis Factor
total genus 36
structure length 96
sequence length 96
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-06-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2q91A00
2AMIA 3BYAA 1B4CA 1KK8C 1QX7A 1EG3A 4N1GA 2WC8A 1SMGA 3VRPA 2F8PA 1HT9A 1PSBA 1K96A 3BOWB 1BT6A 1XK4A 2KI6C 5G08A 3SG5A 2GV5A 4MSPA 2KYCA 1OMRA 5D7FA 3SIBA 1D1OA 1K9UA 1XFXO 1S6JA 1DJGA 1YUTA 3SG3A 3DVKA 5BPJA 1NP8A 2FJUB 4NDCA 1CDLA 2BBMA 1CDNA 4OV2A 2KQYA 4MLWA 1G33A 3I5FC 1UWOA 1FI6A 1JBAA 3EKJA 2KAVA 2LVIA 3I5HB 3LL8B 1A03A 1V1FA 1WDCC 4DCKA 2M1KB 4XJKB 2BE6A 1S5GY 5AANA 3ZNIA 2CNPA 2CCMA 1NIWA 1N0YA 1ZUZA 1LA0A 1RJVA 1M31A 3ICBA 2QPTA 3CTNA 5AXIA 1M63B 2JNFA 3IF7A 2PASA 1U5IA 5I8NA 1ALVA 1NX0A 1JFKA 1J7RA 2LMTA 1KSMA 3BQ3A 5I2LA 2K7BA 2JT0A 2LP3A 1B1GA 1OE9B 1EXRA 3SJSA 4YGAA 2L4IA 1LA3A 1MF8B 4I5JA 1DF0B 1KK8B 1K90D 2I7AA 5J3XA 4D1EA 1LVCD 1XFUO 2I18A 2KNEA 4XYNA 1R6PA 2BBNA 1MUXA 2NXQA 3FWCA 4HSZA 2OPOA 1MXLC 1OMVA 4CLNA 5AERA 1QVIZ 3C1VA 2BKHB 1AP4A 1DJHA 2EC6B 3I5IB 1BLQA 1S6IA 2Y1MA 1K9KA 3VRRA 1IWQA 2JTZA 2LP2A 1SR6C 1WLMA 1WLZA 1DJWA 2KSPA 1M46A 3BXKA 1J7PA 3KEVA 5CSJA 2CBLA 5B8IB 4WQ2A 3OX5A 2MLEC 4DS7A 1N2DA 4JQ0D 2JZIA 3SG2A 1CLBA 4E68A 2BE4A 1DGVA 1K95A 2OTGB 2WOSA 3EVVA 1L2OB 3PN7C 2P6BB 4HREE 2Q4UA 2CXJA 3FWBA 1EG4A 1SW8A 2HPSA 5I2QA 1RECA 1SCMB 2ISDA 1CLMA 3CS1A 2M9GA 2M97A 5ER5A 1UP5A 5CSIA 3CZTX 3O6BA 1F71A 1QJTA 4GGFA 4QJ4B 3SG4A 5HKZA 3JTDB 1BG1A 2Y5IA 4QJ3B 1XA5A 3VRQA 1GGWA 2H61C 3PATA 4BY5A 3D10A 3TZ1A 1BR1B 5I2OA 3NSIA 5IBWA 2SCPA 3JVTC 3DVMA 1J1EA 1TNWA 2LCPA 4MBEA 1CFFA 1B8RA 3LK1A 1WRZA 5HLOA 1JC2A 2MAZA 3NSLA 3O78A 2KAXA 3BUXB 3D0YA 5CPVA 1A75B 1WRKA 2L98A 2MBXA 3WHUB 5K89A 1BR4B 1NX3A 2L51A 4DIRA 2K7OA 2V53A 1AJ5A 1OSAA 5F6TA 1DJXA 3TUYB 1CTRA 4YGDB 4OCIA 4AQJA 1S1EA 3A4UB 2AUCA 1JUOA 3GK2A 2LNKA 1J7OA 3MSEB 2M8UA 3PN7B 2NLNA 4NDBA 3CLNA 1ZOTB 1QTXA 1MHOA 2JT3A 2HQ8A 2LLUA 1TTXA 2BCBA 3AKBA 3EVUA 1QASA 3I5GB 4OKHA 2O5GA 2JQ6A 4ETOA 2LE9B 3GK1A 2PRUA 1X02A 2Y4QA 1DTLA 1B7TY 2KI4B 1FF1A 1DMOA 1SNLA 2KBIA 2M7NA 4A4CA 4L9MA 2HF5A 3WHTB 1S36A 1LKJA 1M39A 2PSRA 3NSKA 1C07A 2L4HA 4MEWA 1CNPA 1OQPA 3AAKA 2LLSA 2KGRA 3OP0A 1EJ3A 1YVHA 4C0KA 1QS7A 1CMFA 2F2OA 4I5KA 1BJFA 4CFRA 1ODBA 1DJIA 3EK7A 3IQOA 1B8LA 2H61A 1MWNA 4M2PA 3PSRA 1CDPA 4U8DA 4GGFC 1GQMA 1IKUA 4WRIA 3WXAA 2OS8C 2KOTA 1KK7Z 2MLFC 4PHMA 3LCPC 1ALWA 1L7ZA 5FYXA 2JT8A 1XFZO 3GK4X 5KTYA 1WRLA 1SPYA 1Y1UA 3NXAA 3DF0A 4GBAA 1BODA 1JF0A 1H4BA 3SG7A 1G4YR 3O2PA 2K8MB 1S5GZ 1TCFA 1IJ5A 2G9BA 1MQ1A 3KHEA 3CR5X 3EK4A 1XFWO 1DGUA 1UHJA 1FPWA 1OZOA 4MRYA 2Q91A 1DJZA 1K8UA 2EGDA 2KAYA 2WCEA 3SG6A 4M2OA 1KSOA 1B7TZ 2BCXA 2MRDA 4ORBB 1SK6D 1CMGA 3PFVA 2F2PA 1KQMC 1IRJA 4MN0A 3I5HC 1FBVA 2PMYA 3TDZA 4JPZB 1J1DA 4BY4A 4MZJA 1YX7A 1QLKA 2SASA 4Q04A 2KFHA 1DJYA 1V1GA 4USLA 2M1UA 1IH0A 2F3YA 2BL0C 1UUSA 2GGZA 2TN4A 2ZN8A 4OR9B 4CPVA 3CR2A 2KFGA 2LVVA 2K0JA 1CFPA 2LLTA 1R2UA 1PSRA 4MZLA 1TCOB 1EH2A 1F70A 1IGVA 3OHMB 4FQOA 4JWQA 1PK0D 5HLVA 1M45A 1JF2A 1PVAA 1RROA 2CT9A 1UHIA 1KFXL 2LMVA 2OTGC 5AEQA 3LK0A 3BOWA 1NPQA 5TNCA 1CDMA 1QATA 1YX8A 1Q80A 5GQQC 2AAOA 2DOQA 3QRXA 4TNCA 2I94A 1KQVA 2JTTA 1BMOA 3KPXA 1TOPA 2LV7A 1YR5A 1LXFC 1JSAA 1SCMC 2E6WA 2ZN9A 1UHKA 2EC6C 3I5IC 1JWDA 1EL4A 4XJKA 1KCYA 2LVJA 3PM8A 5CSNA 2JPTA 1FW4A 1ZMZA 4PHKA 1SL8A 1QV0A 4ORCB 1SL9A 4F0ZB 1CB1A 1KFUL 1YURA 4HRGA 2KDHA 2D8NA 3JVTB 2M3WA 1K94A 2K2AA 1F4OA 1U5IB 2QACA 4NQGA 3DVJA 1AHRA 3RM1A 4AOMA 1S6CA 2ZFDA 5HKWA 1K9PA 4DUQA 2JXLA 2BL0B 2LM5A 3HCMA 4PE0A 1IQ5A 2HQWA 4YI8A 1AVSA 1CFDA 3ZWHA 5DKNA 1RTP1 1W7JB 1YTZC 1DF0A 1RK9A 1PALA 1XVJA 2KHNA 1ZFSA 1VRKA 2I2RE 2K2FA 2KQ6A 2A4JA 2VRGA 4WQ3A 1QLSA 3BUNB 4I5NB 1XK4C 1FI5A 3I5FB 1MR8A 2BCAA 3I5GC 3OX6A 2G2BA 2JRFA 1DT7B 2K61A 2BECA 2ZNEA 1KFXS 3NSOA 3TS5C 1QIWA 4YI9A 3EVRA 3DD4A 4GPLB 1IG5A 3LLEA 5DKRA 1N65A 1AK8A 4M2QA 2WCBA 1NUBA 1A4PA 1SBJA 2FOTA 1A2XA 2NCPA 5ER4X 2L5XB 5AFPA 1IQ3A 1YRTB 1PRWA 4GAOA 2IS9A 5HYDA 1G8IA 1A29A 3O4YA 1C7WA 1UHNA 4IL1A 1NWDA 1B9AA 2KYFA 1F4QA 1B8CA 3H4SE 3TDIA 3CWGA 1TNQA 1SYMA 2KFFA 5JOLA 1WDCB 5HKYA 1Y0VH 2CTNA 2ZKMX 1NX1A 1C7VA 3TDUA 1KFUS 4HRHA 2OS8B 4GNKB 1JFJA 4FTGA 2ZRTA 2LC5A 4ORAB 3EKHA 4GFTA 4PDZA 4YGBB 1SRAA 1TNPA 1SY9A 5KU1A 1GGZA 2KBMA 1F55A 1TNXA 1CKKA 2GGMA 3A8RA 3KF9A 4N5XA 2JXCA 3D0YB 5CSFA 4CIDA 1XYDA 1CFCA 1A75A 3OB1B 3AKAA 1CM1A 1BF5A 2BKIB 2L2EA 4P2YB 1TRFA 3TS5B 4PALA 1QXPA 4ZCUA 1CLLA 1ZACA 4YGCB 1LINA 4AQIA 2K7CA 1L2OC 1QX5B 3IQQA 4MRXA 4A4BA 3WNXB 4NDDA 3VGOA 1B47A 4PHNA 1NX2A 1TIZA 2PALA 2LUXA 2COLB 4MVFA 1UURA 2HETA 2WORA 1H8BA 5KSZA 3FS7A 1S3PA 1SR6B 1NCZA 3KO0A 2E30A 2R2IA 1NCXA 2L50A 2KGBC 4PE7A 1TN4A 2M29A 4ICBA 1OMDA 2JC2A 3AAJA 1UHHA 3VRNA 2B1UA 5PALA 3PALA 1KWOC 1QVIY 2FCEA 4GGNA 1KQMB 4C0LA 1QIVA 2LHIA 2Y1NA 4UPGA 2KI6D 1GJYA 1Y1XA 3BUMB 4YBHB 2MHHA 2ZRSA 1K93D 2EHBA 3RLZA 1AUIB 1QV1A 1IJ6A 1SCVA 1J55A 3GOFA 5DKQA 2F33A 3JTDC 1YVLA 2FCDA 4GUKA 1OZSA 3DVEA 1XO5A 2JULA 2LVKA 3CGAA 2LMUA 1NCYA 4DRWA 4I5LB 1F8HA 3SIAA 4PHJA 2JU0A 2WNDA 3BUWB 2RGIA 5JJGA 2WCFA 1E8AA 2JOJA 2K7DA 3DF0B 2M7LA 1SL7A 2KI4C 1SKTA 1XFYO 2MA2A 1YUUA 2LAPA 1RWYA 2PVBA 3M0WA 3TUYC 4C0JA 1YRUB 1DVIA 1BU3A 2ZNDA 1RFJA 1KK7Y 4MZKA 4ZCVA 2LANA 4N1FA 4YRUA 1HQVA 1QX2A 1WY9A 1Y6WA 2F3ZA 3CR4X 3E3RA 1KWOB 1BOCA 1F54A 4PE1A 1PVBA 1NSHA 4PE4A 1CM4A 2NZ0A 2MJWB 2L0PA 2M49B 2LHLA 3PLFB 1OOJA 2M0RA 3F45A 4R1EA 1AJ4A 5D69A 1W7IB 2JWWA 3BUOB 4QJ5B 1Y1AA 2O60A 1XFVO 3K21A 1MXEA 3FIAA 4OVNF 1NYAA 2H2KA 4YGEB 1PULA 1S26D 3OB2B 4CFQA 1YUSA 1K2HA 4P5OE 2NCOA 4PCWA 2JNXA 3VROA 3HX4A 2LUCA 3EK8A 1J7QA
chains in the Genus database with same CATH superfamily
2AMIA 3BYAA 1B4CA 3N7HA 1KK8C 1QX7A 1EG3A 4N1GA 2WC8A 1SMGA 3VRPA 2F8PA 1HT9A 1PSBA 1K96A 3BOWB 4FQTA 1BT6A 1XK4A 2KI6C 5G08A 3SG5A 2GV5A 4MSPA 2KYCA 1OMRA 3DYEA 5D7FA 5FI6A 3SIBA 1D1OA 1K9UA 1XFXO 1S6JA 1DJGA 1YUTA 3SG3A 3DVKA 5BPJA 1NP8A 3SS3A 2FJUB 4NDCA 1CDLA 2BBMA 1CDNA 4OV2A 2KQYA 4MLWA 1G33A 3I5FC 1UWOA 1FI6A 1JBAA 3EKJA 2KAVA 3S0FA 2LVIA 3I5HB 3LL8B 1A03A 3NHIA 5I94A 1V1FA 3CZ1A 1WDCC 4DCKA 2M1KB 4XJKB 2BE6A 1S5GY 5AANA 3ZNIA 2CNPA 3FE6A 2CCMA 1NIWA 1ZUZA 1N0YA 1LA0A 1TUZA 1RJVA 1M31A 3ICBA 2QPTA 3DY9A 2L5YA 3CTNA 5AXIA 1M63B 2JNFA 3IF7A 2PASA 1U5IA 5D3OA 1ALVA 3B7AA 5I8NA 1NX0A 1JFKA 1J7RA 2LMTA 1KSMA 3BQ3A 5I2LA 2K7BA 2JT0A 2LP3A 1B1GA 1OE9B 1EXRA 3SJSA 4YGAA 2L4IA 1LA3A 1MF8B 4I5JA 1DF0B 1KK8B 1K90D 2I7AA 5J3XA 4D1EA 1LVCD 1XFUO 2I18A 2KNEA 1LS8A 4XYNA 1R6PA 2BBNA 1MUXA 2NXQA 1OW4A 2QEOA 3FWCA 2OPOA 1MXLC 4HSZA 2QEBA 1OMVA 2PYQA 5HLVA 1QVIZ 4CLNA 5AERA 3C1VA 2BKHB 1AP4A 1DJHA 2EC6B 3I5IB 1BLQA 1S6IA 2Y1MA 1K9KA 3VRRA 1IWQA 2JTZA 2LP2A 1SR6C 1WLMA 1WLZA 1DJWA 2KSPA 1M46A 3BXKA 1J7PA 3KEVA 5CSJA 2CBLA 3BFAA 5B8IB 2L2CA 4WQ2A 1TWOA 3OX5A 2MLEC 4DS7A 1N2DA 4JQ0D 2JZIA 3SG2A 1CLBA 3S0EA 3R1PA 1OOGA 4E68A 2BE4A 1DGVA 1K95A 2KPHA 2OTGB 2WOSA 1L2OB 2H8VA 2P6BB 3EVVA 3PN7C 4HREE 2Q4UA 2CXJA 3FWBA 1EG4A 1SW8A 2HPSA 5I2QA 1RECA 1SCMB 2ISDA 1CLMA 3CS1A 2M9GA 2M97A 5ER5A 1UP5A 5CSIA 3CZTX 3O6BA 1F71A 1QJTA 4GGFA 4QJ4B 3SG4A 5HKZA 3JTDB 1BG1A 2Y5IA 4QJ3B 3L4AA 1XA5A 3VRQA 1GGWA 2H61C 3PATA 4BY5A 3D10A 3TZ1A 1BR1B 3D75A 5I2OA 3NSIA 5IBWA 2SCPA 3JVTC 3DVMA 1J1EA 1TNWA 2LCPA 4MBEA 1CFFA 4JD9A 1B8RA 3LK1A 1WRZA 1DEKA 5HLOA 1JC2A 2MAZA 3NSLA 3O78A 2KAXA 3BUXB 3D0YA 5CPVA 1A75B 1WRKA 2L98A 2MBXA 3WHUB 5K89A 1BR4B 1NX3A 2L51A 4DIRA 2K7OA 2V53A 1AJ5A 1OSAA 5F6TA 1DJXA 3TUYB 1CTRA 4YGDB 4OCIA 4AQJA 1S1EA 2WCJA 3A4UB 1GM0A 2AUCA 1JUOA 3PJIA 3GK2A 2LNKA 1J7OA 3MSEB 2M8UA 3PN7B 3L4LA 2NLNA 4NDBA 3CLNA 1ZOTB 1QTXA 1MHOA 2JT3A 2HQ8A 2LLUA 1TTXA 2BCBA 3AKBA 3EVUA 1QASA 3I5GB 4OKHA 2O5GA 2JQ6A 4ETOA 2LE9B 3GK1A 2PRUA 1X02A 5HL1A 2Y4QA 1DTLA 1OOFA 3SS4A 1B7TY 2KI4B 1FF1A 1DMOA 1SNLA 2P71A 2KBIA 2M7NA 4A4CA 4L9MA 1W9ZA 2HF5A 3WHTB 1S36A 1LKJA 1M39A 2PSRA 3CZ2A 3NSKA 2L4HA 1C07A 4MEWA 3PM2A 1CNPA 1OQPA 3AAKA 2LLSA 2KGRA 3OP0A 1EJ3A 1YVHA 4C0KA 1QS7A 1CMFA 2F2OA 4I5KA 1BJFA 4CFRA 1ODBA 1DJIA 3EK7A 3IQOA 1B8LA 2H61A 3K1EA 1MWNA 4M2PA 3PSRA 1CDPA 4U8DA 2BNXA 4GGFC 1GQMA 1IKUA 4WRIA 3WXAA 2OS8C 2KOTA 1KK7Z 2MLFC 3S0DA 4PHMA 3LCPC 1ALWA 1L7ZA 5FYXA 3R72A 2JT8A 1XFZO 3GK4X 5KTYA 1WRLA 1SPYA 1C3ZA 1Y1UA 3NXAA 3DF0A 4GBAA 1BODA 1JF0A 1H4BA 3D77A 1IIOA 3B86A 1G4YR 3SG7A 3O2PA 1Z2CB 2K8MB 1S5GZ 1TCFA 1IJ5A 2G9BA 1MQ1A 3KHEA 3CR5X 3EK4A 1XFWO 1DGUA 1UHJA 1FPWA 1SSEB 1OZOA 4MRYA 2Q91A 1DJZA 1K8UA 2QEHA 3D74A 2EGDA 2KAYA 2WCEA 4INXA 4M2OA 1KSOA 3SG6A 5FI7A 1B7TZ 2BCXA 2MRDA 2QEVA 1SK6D 4ORBB 1CMGA 3PFVA 3SS5A 1TUJA 2F2PA 1KQMC 1IRJA 4MN0A 3I5HC 1FBVA 2KLEA 4PT1A 2PMYA 3TDZA 3NHTA 1J1DA 3NGVA 4JPZB 1OOIX 1YX7A 4MZJA 4BY4A 1QLKA 2SASA 4Q04A 2KFHA 1DJYA 1V1GA 4USLA 2M1UA 1IH0A 2F3YA 2BL0C 1UUSA 2GGZA 2TN4A 2ZN8A 4OR9B 4CPVA 3CR2A 2KFGA 2LVVA 2K0JA 1CFPA 2LLTA 1R2UA 1PSRA 4MZLA 1TCOB 1EH2A 1F70A 2BAPA 4OZDA 1IGVA 3OHMB 4FQOA 4JWQA 1PK0D 3B87A 1M45A 1JF2A 1PVAA 1RROA 2CT9A 1UHIA 1KFXL 2LMVA 2OTGC 2WCMA 5AEQA 3LK0A 3BOWA 1NPQA 5TNCA 1CDMA 1QATA 1YX8A 1Q80A 3UNWA 5GQQC 2AAOA 2DOQA 3QRXA 4TNCA 2I94A 2K60A 2JTTA 1KQVA 1BMOA 3KPXA 1TOPA 3S0GA 2LV7A 1YR5A 1LXFC 1JSAA 3RZSA 1SCMC 2E6WA 2ZN9A 1UHKA 2EC6C 3I5IC 1JWDA 1EL4A 4F7FA 4XJKA 3VB1A 1KCYA 2LVJA 3PM8A 5CSNA 2JPTA 1FW4A 1ZMZA 4PHKA 1SL8A 1QV0A 4ORCB 1SL9A 4F0ZB 1CB1A 1KFUL 1YURA 4HRGA 2KDHA 2JPOA 3CZ0A 2D8NA 3JVTB 2M3WA 1K94A 2K2AA 1F4OA 1U5IB 2QACA 4NQGA 3DVJA 5EL2A 1AHRA 5FI2A 3RM1A 4AOMA 1S6CA 2GTEA 2ZFDA 1K9PA 4JKTA 5HKWA 4DUQA 3B6XA 2JXLA 2BL0B 2LM5A 3HCMA 4PE0A 1IQ5A 2HQWA 3D76A 4YI8A 1AVSA 1CFDA 3ZWHA 3S0BA 5DKNA 1RTP1 1W7JB 1YTZC 1DF0A 1RK9A 1PALA 1XVJA 2KHNA 1ZFSA 1VRKA 2I2RE 2K2FA 2PQLA 2KQ6A 2A4JA 2VRGA 4WQ3A 1QLSA 4INWA 2YGUA 3BUNB 4I5NB 3CDNA 1XK4C 2WC5A 1FI5A 3I5FB 1MR8A 2BCAA 3I5GC 3OX6A 2G2BA 2JRFA 1DT7B 2K61A 2BECA 1DQEA 4KYNA 2ZNEA 1KFXS 3NSOA 3TS5C 1QIWA 4YI9A 3EVRA 3DD4A 4GPLB 1IG5A 3LLEA 5DKRA 3QMEA 1N65A 1AK8A 4M2QA 2WCBA 1NUBA 3BFBA 1A4PA 1SBJA 2FOTA 1A2XA 2NCPA 5ER4X 2L5XB 5AFPA 1IQ3A 1YRTB 1PRWA 4GAOA 2IS9A 5HYDA 1G8IA 1A29A 3O4YA 1C7WA 5DICA 1UHNA 3Q8IA 4IL1A 1NWDA 1B9AA 2KYFA 1F4QA 3CYZA 1B8CA 3H4SE 3TDIA 1DC1A 3CWGA 1TNQA 1SYMA 2KFFA 5JOLA 1WDCB 5HKYA 1Y0VH 2CTNA 2ZKMX 1NX1A 1C7VA 3TDUA 1KFUS 4HRHA 2OS8B 4GNKB 1OOHA 4FTGA 1JFJA 3OBVA 2ZRTA 2LC5A 4ORAB 3EKHA 4GFTA 4PDZA 4YGBB 1SRAA 4IJ7A 1TNPA 1C3YA 3UO9A 1SY9A 5KU1A 1GGZA 2KBMA 1F55A 3DZTA 1TNXA 1CKKA 2GGMA 3A8RA 3KF9A 2QDIA 4N5XA 2JXCA 3D0YB 5CSFA 4CIDA 1XYDA 1CFCA 1A75A 3OB1B 3AKAA 1CM1A 2WCLA 2BKIB 1BF5A 2L2EA 2WC6A 4P2YB 3R1VA 1TRFA 3TS5B 4PALA 1QXPA 4ZCUA 3FE8A 1CLLA 1ZACA 4YGCB 1LINA 3V2LA 4AQIA 2K7CA 1L2OC 1QX5B 2WCKA 3IQQA 4MRXA 4A4BA 3WNXB 4NDDA 2FJYA 3D78A 2P70A 3VGOA 1B47A 4PHNA 1NX2A 1TIZA 2PALA 2LUXA 3L47A 2COLB 4MVFA 1UURA 2HETA 2WORA 1H8BA 5KSZA 3FS7A 1S3PA 1SR6B 1NCZA 3KO0A 2E30A 2R2IA 1NCXA 2L50A 2KGBC 4PE7A 1TN4A 2M29A 4ICBA 1OMDA 3R1OA 2WCHA 2JC2A 3AAJA 3S0AA 1UHHA 3VRNA 2B1UA 5PALA 3PALA 1KWOC 1QVIY 2FCEA 3O4XA 4GGNA 1KQMB 4C0LA 1QIVA 1P28A 2LHIA 2Y1NA 4UPGA 2KI6D 1GJYA 1Y1XA 3BUMB 3CABA 2KLDA 2MHHA 2ZRSA 1K93D 2EHBA 4YBHB 3RLZA 1AUIB 1QV1A 1IJ6A 1SCVA 1J55A 3GOFA 3D73A 5DKQA 2F33A 3JTDC 1YVLA 2FCDA 4GUKA 1OZSA 3DVEA 1XO5A 2JULA 2LVKA 3CGAA 2LMUA 1ORGA 1NCYA 4DRWA 4I5LB 1F8HA 3SIAA 4PHJA 1Z4HA 2JU0A 2WNDA 3BUWB 2RGIA 5JJGA 2WCFA 1XFRA 1E8AA 2JOJA 2K7DA 3DF0B 2ERBA 2M7LA 1SL7A 2KI4C 1SKTA 1XFYO 2MA2A 1YUUA 2LAPA 1RWYA 2PVBA 3EG5B 3M0WA 4C0JA 3TUYC 1YRUB 1DVIA 1BU3A 2ZNDA 1RFJA 1KK7Y 4MZKA 4ZCVA 2LANA 4N1FA 4YRUA 1HQVA 1QX2A 3IVTA 1WY9A 1Y6WA 2F3ZA 3CR4X 3E3RA 1KWOB 1BOCA 1F54A 4PE1A 1PVBA 1NSHA 4PE4A 1CM4A 2NZ0A 2MJWB 2L0PA 2M49B 2LHLA 3PLFB 1OOJA 2M0RA 3F45A 3BFHA 4R1EA 1AJ4A 5D69A 3OGNA 1W7IB 2JWWA 3BUOB 4QJ5B 1Y1AA 2O60A 1XFVO 3K21A 1MXEA 3FIAA 3FE9A 4OVNF 1NYAA 1QWVA 1DELA 2H2KA 1PULA 1S26D 4YGEB 3OB2B 4CFQA 1T14A 1YUSA 1K2HA 3B88A 4P5OE 2NCOA 4PCWA 3DXLA 2JNXA 3VROA 3HX4A 2LUCA 3BJHA 3EK8A 1J7QA
chains in the Genus database with same CATH topology
2AMIA 3BYAA 1B4CA 1KK8C 1QX7A 1EG3A 4N1GA 2WC8A 1SMGA 3VRPA 2F8PA 1HT9A 1PSBA 1K96A 3BOWB 1BT6A 1XK4A 2KI6C 5G08A 3SG5A 2GV5A 4MSPA 2KYCA 1OMRA 5D7FA 3SIBA 1D1OA 1K9UA 1XFXO 1S6JA 1DJGA 1YUTA 3SG3A 3DVKA 5BPJA 1NP8A 2FJUB 4NDCA 1CDLA 2BBMA 1CDNA 4OV2A 2KQYA 4MLWA 1G33A 3I5FC 1UWOA 1FI6A 1JBAA 3EKJA 2KAVA 2LVIA 3I5HB 3LL8B 1A03A 1V1FA 1WDCC 4DCKA 2M1KB 4XJKB 2BE6A 1S5GY 5AANA 3ZNIA 2CNPA 2CCMA 1NIWA 1N0YA 1ZUZA 1LA0A 1RJVA 1M31A 3ICBA 2QPTA 3CTNA 5AXIA 1M63B 2JNFA 3IF7A 2PASA 1U5IA 5I8NA 1ALVA 1NX0A 1JFKA 1J7RA 2LMTA 1KSMA 3BQ3A 5I2LA 2K7BA 2JT0A 2LP3A 1B1GA 1OE9B 1EXRA 3SJSA 4YGAA 2L4IA 1LA3A 1MF8B 4I5JA 1DF0B 1KK8B 1K90D 2I7AA 5J3XA 4D1EA 1LVCD 1XFUO 2I18A 2KNEA 4XYNA 1R6PA 2BBNA 1MUXA 2NXQA 3FWCA 4HSZA 2OPOA 1MXLC 1OMVA 4CLNA 5AERA 1QVIZ 3C1VA 2BKHB 1AP4A 1DJHA 2EC6B 3I5IB 1BLQA 1S6IA 2Y1MA 1K9KA 3VRRA 1IWQA 2JTZA 2LP2A 1SR6C 1WLMA 1WLZA 1DJWA 2KSPA 1M46A 3BXKA 1J7PA 3KEVA 5CSJA 2CBLA 5B8IB 4WQ2A 3OX5A 2MLEC 4DS7A 1N2DA 4JQ0D 2JZIA 3SG2A 1CLBA 4E68A 2BE4A 1DGVA 1K95A 2OTGB 2WOSA 3EVVA 1L2OB 3PN7C 2P6BB 4HREE 2Q4UA 2CXJA 3FWBA 1EG4A 1SW8A 2HPSA 5I2QA 1RECA 1SCMB 2ISDA 1CLMA 3CS1A 2M9GA 2M97A 5ER5A 1UP5A 5CSIA 3CZTX 3O6BA 1F71A 1QJTA 4GGFA 4QJ4B 3SG4A 5HKZA 3JTDB 1BG1A 2Y5IA 4QJ3B 1XA5A 3VRQA 1GGWA 2H61C 3PATA 4BY5A 3D10A 3TZ1A 1BR1B 5I2OA 3NSIA 5IBWA 2SCPA 3JVTC 3DVMA 1J1EA 1TNWA 2LCPA 4MBEA 1CFFA 1B8RA 3LK1A 1WRZA 5HLOA 1JC2A 2MAZA 3NSLA 3O78A 2KAXA 3BUXB 3D0YA 5CPVA 1A75B 1WRKA 2L98A 2MBXA 3WHUB 5K89A 1BR4B 1NX3A 2L51A 4DIRA 2K7OA 2V53A 1AJ5A 1OSAA 5F6TA 1DJXA 3TUYB 1CTRA 4YGDB 4OCIA 4AQJA 1S1EA 3A4UB 2AUCA 1JUOA 3GK2A 2LNKA 1J7OA 3MSEB 2M8UA 3PN7B 2NLNA 4NDBA 3CLNA 1ZOTB 1QTXA 1MHOA 2JT3A 2HQ8A 2LLUA 1TTXA 2BCBA 3AKBA 3EVUA 1QASA 3I5GB 4OKHA 2O5GA 2JQ6A 4ETOA 2LE9B 3GK1A 2PRUA 1X02A 2Y4QA 1DTLA 1B7TY 2KI4B 1FF1A 1DMOA 1SNLA 2KBIA 2M7NA 4A4CA 4L9MA 2HF5A 3WHTB 1S36A 1LKJA 1M39A 2PSRA 3NSKA 1C07A 2L4HA 4MEWA 1CNPA 1OQPA 3AAKA 2LLSA 2KGRA 3OP0A 1EJ3A 1YVHA 4C0KA 1QS7A 1CMFA 2F2OA 4I5KA 1BJFA 4CFRA 1ODBA 1DJIA 3EK7A 3IQOA 1B8LA 2H61A 1MWNA 4M2PA 3PSRA 1CDPA 4U8DA 4GGFC 1GQMA 1IKUA 4WRIA 3WXAA 2OS8C 2KOTA 1KK7Z 2MLFC 4PHMA 3LCPC 1ALWA 1L7ZA 5FYXA 2JT8A 1XFZO 3GK4X 5KTYA 1WRLA 1SPYA 1Y1UA 3NXAA 3DF0A 4GBAA 1BODA 1JF0A 1H4BA 3SG7A 1G4YR 3O2PA 2K8MB 1S5GZ 1TCFA 1IJ5A 2G9BA 1MQ1A 3KHEA 3CR5X 3EK4A 1XFWO 1DGUA 1UHJA 1FPWA 1OZOA 4MRYA 2Q91A 1DJZA 1K8UA 2EGDA 2KAYA 2WCEA 3SG6A 4M2OA 1KSOA 1B7TZ 2BCXA 2MRDA 4ORBB 1SK6D 1CMGA 3PFVA 2F2PA 1KQMC 1IRJA 4MN0A 3I5HC 1FBVA 2PMYA 3TDZA 4JPZB 1J1DA 4BY4A 4MZJA 1YX7A 1QLKA 2SASA 4Q04A 2KFHA 1DJYA 1V1GA 4USLA 2M1UA 1IH0A 2F3YA 2BL0C 1UUSA 2GGZA 2TN4A 2ZN8A 4OR9B 4CPVA 3CR2A 2KFGA 2LVVA 2K0JA 1CFPA 2LLTA 1R2UA 1PSRA 4MZLA 1TCOB 1EH2A 1F70A 1IGVA 3OHMB 4FQOA 4JWQA 1PK0D 5HLVA 1M45A 1JF2A 1PVAA 1RROA 2CT9A 1UHIA 1KFXL 2LMVA 2OTGC 5AEQA 3LK0A 3BOWA 1NPQA 5TNCA 1CDMA 1QATA 1YX8A 1Q80A 5GQQC 2AAOA 2DOQA 3QRXA 4TNCA 2I94A 1KQVA 2JTTA 1BMOA 3KPXA 1TOPA 2LV7A 1YR5A 1LXFC 1JSAA 1SCMC 2E6WA 2ZN9A 1UHKA 2EC6C 3I5IC 1JWDA 1EL4A 4XJKA 1KCYA 2LVJA 3PM8A 5CSNA 2JPTA 1FW4A 1ZMZA 4PHKA 1SL8A 1QV0A 4ORCB 1SL9A 4F0ZB 1CB1A 1KFUL 1YURA 4HRGA 2KDHA 2D8NA 3JVTB 2M3WA 1K94A 2K2AA 1F4OA 1U5IB 2QACA 4NQGA 3DVJA 1AHRA 3RM1A 4AOMA 1S6CA 2ZFDA 5HKWA 1K9PA 4DUQA 2JXLA 2BL0B 2LM5A 3HCMA 4PE0A 1IQ5A 2HQWA 4YI8A 1AVSA 1CFDA 3ZWHA 5DKNA 1RTP1 1W7JB 1YTZC 1DF0A 1RK9A 1PALA 1XVJA 2KHNA 1ZFSA 1VRKA 2I2RE 2K2FA 2KQ6A 2A4JA 2VRGA 4WQ3A 1QLSA 3BUNB 4I5NB 1XK4C 1FI5A 3I5FB 1MR8A 2BCAA 3I5GC 3OX6A 2G2BA 2JRFA 1DT7B 2K61A 2BECA 2ZNEA 1KFXS 3NSOA 3TS5C 1QIWA 4YI9A 3EVRA 3DD4A 4GPLB 1IG5A 3LLEA 5DKRA 1N65A 1AK8A 4M2QA 2WCBA 1NUBA 1A4PA 1SBJA 2FOTA 1A2XA 2NCPA 5ER4X 2L5XB 5AFPA 1IQ3A 1YRTB 1PRWA 4GAOA 2IS9A 5HYDA 1G8IA 1A29A 3O4YA 1C7WA 1UHNA 4IL1A 1NWDA 1B9AA 2KYFA 1F4QA 1B8CA 3H4SE 3TDIA 3CWGA 1TNQA 1SYMA 2KFFA 5JOLA 1WDCB 5HKYA 1Y0VH 2CTNA 2ZKMX 1NX1A 1C7VA 3TDUA 1KFUS 4HRHA 2OS8B 4GNKB 1JFJA 4FTGA 2ZRTA 2LC5A 4ORAB 3EKHA 4GFTA 4PDZA 4YGBB 1SRAA 1TNPA 1SY9A 5KU1A 1GGZA 2KBMA 1F55A 1TNXA 1CKKA 2GGMA 3A8RA 3KF9A 4N5XA 2JXCA 3D0YB 5CSFA 4CIDA 1XYDA 1CFCA 1A75A 3OB1B 3AKAA 1CM1A 1BF5A 2BKIB 2L2EA 4P2YB 1TRFA 3TS5B 4PALA 1QXPA 4ZCUA 1CLLA 1ZACA 4YGCB 1LINA 4AQIA 2K7CA 1L2OC 1QX5B 3IQQA 4MRXA 4A4BA 3WNXB 4NDDA 3VGOA 1B47A 4PHNA 1NX2A 1TIZA 2PALA 2LUXA 2COLB 4MVFA 1UURA 2HETA 2WORA 1H8BA 5KSZA 3FS7A 1S3PA 1SR6B 1NCZA 3KO0A 2E30A 2R2IA 1NCXA 2L50A 2KGBC 4PE7A 1TN4A 2M29A 4ICBA 1OMDA 2JC2A 3AAJA 1UHHA 3VRNA 2B1UA 5PALA 3PALA 1KWOC 1QVIY 2FCEA 4GGNA 1KQMB 4C0LA 1QIVA 2LHIA 2Y1NA 4UPGA 2KI6D 1GJYA 1Y1XA 3BUMB 4YBHB 2MHHA 2ZRSA 1K93D 2EHBA 3RLZA 1AUIB 1QV1A 1IJ6A 1SCVA 1J55A 3GOFA 5DKQA 2F33A 3JTDC 1YVLA 2FCDA 4GUKA 1OZSA 3DVEA 1XO5A 2JULA 2LVKA 3CGAA 2LMUA 1NCYA 4DRWA 4I5LB 1F8HA 3SIAA 4PHJA 2JU0A 2WNDA 3BUWB 2RGIA 5JJGA 2WCFA 1E8AA 2JOJA 2K7DA 3DF0B 2M7LA 1SL7A 2KI4C 1SKTA 1XFYO 2MA2A 1YUUA 2LAPA 1RWYA 2PVBA 3M0WA 3TUYC 4C0JA 1YRUB 1DVIA 1BU3A 2ZNDA 1RFJA 1KK7Y 4MZKA 4ZCVA 2LANA 4N1FA 4YRUA 1HQVA 1QX2A 1WY9A 1Y6WA 2F3ZA 3CR4X 3E3RA 1KWOB 1BOCA 1F54A 4PE1A 1PVBA 1NSHA 4PE4A 1CM4A 2NZ0A 2MJWB 2L0PA 2M49B 2LHLA 3PLFB 1OOJA 2M0RA 3F45A 4R1EA 1AJ4A 5D69A 1W7IB 2JWWA 3BUOB 4QJ5B 1Y1AA 2O60A 1XFVO 3K21A 1MXEA 3FIAA 4OVNF 1NYAA 2H2KA 4YGEB 1PULA 1S26D 3OB2B 4CFQA 1YUSA 1K2HA 4P5OE 2NCOA 4PCWA 2JNXA 3VROA 3HX4A 2LUCA 3EK8A 1J7QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AMI A;  3BYA A;  1B4C A;  1KK8 C;  1QX7 A;  1EG3 A;  4N1G A;  2WC8 A;  1SMG A;  3VRP A;  2F8P A;  1HT9 A;  1PSB A;  1K96 A;  3BOW B;  1BT6 A;  1XK4 A;  2KI6 C;  5G08 A;  3SG5 A;  2GV5 A;  4MSP A;  2KYC A;  1OMR A;  5D7F A;  3SIB A;  1D1O A;  1K9U A;  1XFX O;  1S6J A;  1DJG A;  1YUT A;  3SG3 A;  3DVK A;  5BPJ A;  1NP8 A;  2FJU B;  4NDC A;  1CDL A;  2BBM A;  1CDN A;  4OV2 A;  2KQY A;  4MLW A;  1G33 A;  3I5F C;  1UWO A;  1FI6 A;  1JBA A;  3EKJ A;  2KAV A;  2LVI A;  3I5H B;  3LL8 B;  1A03 A;  1V1F A;  1WDC C;  4DCK A;  2M1K B;  4XJK B;  2BE6 A;  1S5G Y;  5AAN A;  3ZNI A;  2CNP A;  2CCM A;  1NIW A;  1N0Y A;  1ZUZ A;  1LA0 A;  1RJV A;  1M31 A;  3ICB A;  2QPT A;  3CTN A;  5AXI A;  1M63 B;  2JNF A;  3IF7 A;  2PAS A;  1U5I A;  5I8N A;  1ALV A;  1NX0 A;  1JFK A;  1J7R A;  2LMT A;  1KSM A;  3BQ3 A;  5I2L A;  2K7B A;  2JT0 A;  2LP3 A;  1B1G A;  1OE9 B;  1EXR A;  3SJS A;  4YGA A;  2L4I A;  1LA3 A;  1MF8 B;  4I5J A;  1DF0 B;  1KK8 B;  1K90 D;  2I7A A;  5J3X A;  4D1E A;  1LVC D;  1XFU O;  2I18 A;  2KNE A;  4XYN A;  1R6P A;  2BBN A;  1MUX A;  2NXQ A;  3FWC A;  4HSZ A;  2OPO A;  1MXL C;  1OMV A;  4CLN A;  5AER A;  1QVI Z;  3C1V A;  2BKH B;  1AP4 A;  1DJH A;  2EC6 B;  3I5I B;  1BLQ A;  1S6I A;  2Y1M A;  1K9K A;  3VRR A;  1IWQ A;  2JTZ A;  2LP2 A;  1SR6 C;  1WLM A;  1WLZ A;  1DJW A;  2KSP A;  1M46 A;  3BXK A;  1J7P A;  3KEV A;  5CSJ A;  2CBL A;  5B8I B;  4WQ2 A;  3OX5 A;  2MLE C;  4DS7 A;  1N2D A;  4JQ0 D;  2JZI A;  3SG2 A;  1CLB A;  4E68 A;  2BE4 A;  1DGV A;  1K95 A;  2OTG B;  2WOS A;  3EVV A;  1L2O B;  3PN7 C;  2P6B B;  4HRE E;  2Q4U A;  2CXJ A;  3FWB A;  1EG4 A;  1SW8 A;  2HPS A;  5I2Q A;  1REC A;  1SCM B;  2ISD A;  1CLM A;  3CS1 A;  2M9G A;  2M97 A;  5ER5 A;  1UP5 A;  5CSI A;  3CZT X;  3O6B A;  1F71 A;  1QJT A;  4GGF A;  4QJ4 B;  3SG4 A;  5HKZ A;  3JTD B;  1BG1 A;  2Y5I A;  4QJ3 B;  1XA5 A;  3VRQ A;  1GGW A;  2H61 C;  3PAT A;  4BY5 A;  3D10 A;  3TZ1 A;  1BR1 B;  5I2O A;  3NSI A;  5IBW A;  2SCP A;  3JVT C;  3DVM A;  1J1E A;  1TNW A;  2LCP A;  4MBE A;  1CFF A;  1B8R A;  3LK1 A;  1WRZ A;  5HLO A;  1JC2 A;  2MAZ A;  3NSL A;  3O78 A;  2KAX A;  3BUX B;  3D0Y A;  5CPV A;  1A75 B;  1WRK A;  2L98 A;  2MBX A;  3WHU B;  5K89 A;  1BR4 B;  1NX3 A;  2L51 A;  4DIR A;  2K7O A;  2V53 A;  1AJ5 A;  1OSA A;  5F6T A;  1DJX A;  3TUY B;  1CTR A;  4YGD B;  4OCI A;  4AQJ A;  1S1E A;  3A4U B;  2AUC A;  1JUO A;  3GK2 A;  2LNK A;  1J7O A;  3MSE B;  2M8U A;  3PN7 B;  2NLN A;  4NDB A;  3CLN A;  1ZOT B;  1QTX A;  1MHO A;  2JT3 A;  2HQ8 A;  2LLU A;  1TTX A;  2BCB A;  3AKB A;  3EVU A;  1QAS A;  3I5G B;  4OKH A;  2O5G A;  2JQ6 A;  4ETO A;  2LE9 B;  3GK1 A;  2PRU A;  1X02 A;  2Y4Q A;  1DTL A;  1B7T Y;  2KI4 B;  1FF1 A;  1DMO A;  1SNL A;  2KBI A;  2M7N A;  4A4C A;  4L9M A;  2HF5 A;  3WHT B;  1S36 A;  1LKJ A;  1M39 A;  2PSR A;  3NSK A;  1C07 A;  2L4H A;  4MEW A;  1CNP A;  1OQP A;  3AAK A;  2LLS A;  2KGR A;  3OP0 A;  1EJ3 A;  1YVH A;  4C0K A;  1QS7 A;  1CMF A;  2F2O A;  4I5K A;  1BJF A;  4CFR A;  1ODB A;  1DJI A;  3EK7 A;  3IQO A;  1B8L A;  2H61 A;  1MWN A;  4M2P A;  3PSR A;  1CDP A;  4U8D A;  4GGF C;  1GQM A;  1IKU A;  4WRI A;  3WXA A;  2OS8 C;  2KOT A;  1KK7 Z;  2MLF C;  4PHM A;  3LCP C;  1ALW A;  1L7Z A;  5FYX A;  2JT8 A;  1XFZ O;  3GK4 X;  5KTY A;  1WRL A;  1SPY A;  1Y1U A;  3NXA A;  3DF0 A;  4GBA A;  1BOD A;  1JF0 A;  1H4B A;  3SG7 A;  1G4Y R;  3O2P A;  2K8M B;  1S5G Z;  1TCF A;  1IJ5 A;  2G9B A;  1MQ1 A;  3KHE A;  3CR5 X;  3EK4 A;  1XFW O;  1DGU A;  1UHJ A;  1FPW A;  1OZO A;  4MRY A;  2Q91 A;  1DJZ A;  1K8U A;  2EGD A;  2KAY A;  2WCE A;  3SG6 A;  4M2O A;  1KSO A;  1B7T Z;  2BCX A;  2MRD A;  4ORB B;  1SK6 D;  1CMG A;  3PFV A;  2F2P A;  1KQM C;  1IRJ A;  4MN0 A;  3I5H C;  1FBV A;  2PMY A;  3TDZ A;  4JPZ B;  1J1D A;  4BY4 A;  4MZJ A;  1YX7 A;  1QLK A;  2SAS A;  4Q04 A;  2KFH A;  1DJY A;  1V1G A;  4USL A;  2M1U A;  1IH0 A;  2F3Y A;  2BL0 C;  1UUS A;  2GGZ A;  2TN4 A;  2ZN8 A;  4OR9 B;  4CPV A;  3CR2 A;  2KFG A;  2LVV A;  2K0J A;  1CFP A;  2LLT A;  1R2U A;  1PSR A;  4MZL A;  1TCO B;  1EH2 A;  1F70 A;  1IGV A;  3OHM B;  4FQO A;  4JWQ A;  1PK0 D;  5HLV A;  1M45 A;  1JF2 A;  1PVA A;  1RRO A;  2CT9 A;  1UHI A;  1KFX L;  2LMV A;  2OTG C;  5AEQ A;  3LK0 A;  3BOW A;  1NPQ A;  5TNC A;  1CDM A;  1QAT A;  1YX8 A;  1Q80 A;  5GQQ C;  2AAO A;  2DOQ A;  3QRX A;  4TNC A;  2I94 A;  1KQV A;  2JTT A;  1BMO A;  3KPX A;  1TOP A;  2LV7 A;  1YR5 A;  1LXF C;  1JSA A;  1SCM C;  2E6W A;  2ZN9 A;  1UHK A;  2EC6 C;  3I5I C;  1JWD A;  1EL4 A;  4XJK A;  1KCY A;  2LVJ A;  3PM8 A;  5CSN A;  2JPT A;  1FW4 A;  1ZMZ A;  4PHK A;  1SL8 A;  1QV0 A;  4ORC B;  1SL9 A;  4F0Z B;  1CB1 A;  1KFU L;  1YUR A;  4HRG A;  2KDH A;  2D8N A;  3JVT B;  2M3W A;  1K94 A;  2K2A A;  1F4O A;  1U5I B;  2QAC A;  4NQG A;  3DVJ A;  1AHR A;  3RM1 A;  4AOM A;  1S6C A;  2ZFD A;  5HKW A;  1K9P A;  4DUQ A;  2JXL A;  2BL0 B;  2LM5 A;  3HCM A;  4PE0 A;  1IQ5 A;  2HQW A;  4YI8 A;  1AVS A;  1CFD A;  3ZWH A;  5DKN A;  1RTP 1;  1W7J B;  1YTZ C;  1DF0 A;  1RK9 A;  1PAL A;  1XVJ A;  2KHN A;  1ZFS A;  1VRK A;  2I2R E;  2K2F A;  2KQ6 A;  2A4J A;  2VRG A;  4WQ3 A;  1QLS A;  3BUN B;  4I5N B;  1XK4 C;  1FI5 A;  3I5F B;  1MR8 A;  2BCA A;  3I5G C;  3OX6 A;  2G2B A;  2JRF A;  1DT7 B;  2K61 A;  2BEC A;  2ZNE A;  1KFX S;  3NSO A;  3TS5 C;  1QIW A;  4YI9 A;  3EVR A;  3DD4 A;  4GPL B;  1IG5 A;  3LLE A;  5DKR A;  1N65 A;  1AK8 A;  4M2Q A;  2WCB A;  1NUB A;  1A4P A;  1SBJ A;  2FOT A;  1A2X A;  2NCP A;  5ER4 X;  2L5X B;  5AFP A;  1IQ3 A;  1YRT B;  1PRW A;  4GAO A;  2IS9 A;  5HYD A;  1G8I A;  1A29 A;  3O4Y A;  1C7W A;  1UHN A;  4IL1 A;  1NWD A;  1B9A A;  2KYF A;  1F4Q A;  1B8C A;  3H4S E;  3TDI A;  3CWG A;  1TNQ A;  1SYM A;  2KFF A;  5JOL A;  1WDC B;  5HKY A;  1Y0V H;  2CTN A;  2ZKM X;  1NX1 A;  1C7V A;  3TDU A;  1KFU S;  4HRH A;  2OS8 B;  4GNK B;  1JFJ A;  4FTG A;  2ZRT A;  2LC5 A;  4ORA B;  3EKH A;  4GFT A;  4PDZ A;  4YGB B;  1SRA A;  1TNP A;  1SY9 A;  5KU1 A;  1GGZ A;  2KBM A;  1F55 A;  1TNX A;  1CKK A;  2GGM A;  3A8R A;  3KF9 A;  4N5X A;  2JXC A;  3D0Y B;  5CSF A;  4CID A;  1XYD A;  1CFC A;  1A75 A;  3OB1 B;  3AKA A;  1CM1 A;  1BF5 A;  2BKI B;  2L2E A;  4P2Y B;  1TRF A;  3TS5 B;  4PAL A;  1QXP A;  4ZCU A;  1CLL A;  1ZAC A;  4YGC B;  1LIN A;  4AQI A;  2K7C A;  1L2O C;  1QX5 B;  3IQQ A;  4MRX A;  4A4B A;  3WNX B;  4NDD A;  3VGO A;  1B47 A;  4PHN A;  1NX2 A;  1TIZ A;  2PAL A;  2LUX A;  2COL B;  4MVF A;  1UUR A;  2HET A;  2WOR A;  1H8B A;  5KSZ A;  3FS7 A;  1S3P A;  1SR6 B;  1NCZ A;  3KO0 A;  2E30 A;  2R2I A;  1NCX A;  2L50 A;  2KGB C;  4PE7 A;  1TN4 A;  2M29 A;  4ICB A;  1OMD A;  2JC2 A;  3AAJ A;  1UHH A;  3VRN A;  2B1U A;  5PAL A;  3PAL A;  1KWO C;  1QVI Y;  2FCE A;  4GGN A;  1KQM B;  4C0L A;  1QIV A;  2LHI A;  2Y1N A;  4UPG A;  2KI6 D;  1GJY A;  1Y1X A;  3BUM B;  4YBH B;  2MHH A;  2ZRS A;  1K93 D;  2EHB A;  3RLZ A;  1AUI B;  1QV1 A;  1IJ6 A;  1SCV A;  1J55 A;  3GOF A;  5DKQ A;  2F33 A;  3JTD C;  1YVL A;  2FCD A;  4GUK A;  1OZS A;  3DVE A;  1XO5 A;  2JUL A;  2LVK A;  3CGA A;  2LMU A;  1NCY A;  4DRW A;  4I5L B;  1F8H A;  3SIA A;  4PHJ A;  2JU0 A;  2WND A;  3BUW B;  2RGI A;  5JJG A;  2WCF A;  1E8A A;  2JOJ A;  2K7D A;  3DF0 B;  2M7L A;  1SL7 A;  2KI4 C;  1SKT A;  1XFY O;  2MA2 A;  1YUU A;  2LAP A;  1RWY A;  2PVB A;  3M0W A;  3TUY C;  4C0J A;  1YRU B;  1DVI A;  1BU3 A;  2ZND A;  1RFJ A;  1KK7 Y;  4MZK A;  4ZCV A;  2LAN A;  4N1F A;  4YRU A;  1HQV A;  1QX2 A;  1WY9 A;  1Y6W A;  2F3Z A;  3CR4 X;  3E3R A;  1KWO B;  1BOC A;  1F54 A;  4PE1 A;  1PVB A;  1NSH A;  4PE4 A;  1CM4 A;  2NZ0 A;  2MJW B;  2L0P A;  2M49 B;  2LHL A;  3PLF B;  1OOJ A;  2M0R A;  3F45 A;  4R1E A;  1AJ4 A;  5D69 A;  1W7I B;  2JWW A;  3BUO B;  4QJ5 B;  1Y1A A;  2O60 A;  1XFV O;  3K21 A;  1MXE A;  3FIA A;  4OVN F;  1NYA A;  2H2K A;  4YGE B;  1PUL A;  1S26 D;  3OB2 B;  4CFQ A;  1YUS A;  1K2H A;  4P5O E;  2NCO A;  4PCW A;  2JNX A;  3VRO A;  3HX4 A;  2LUC A;  3EK8 A;  1J7Q A; 
#chains in the Genus database with same CATH topology
 2AMI A;  3BYA A;  1B4C A;  3N7H A;  1KK8 C;  1QX7 A;  1EG3 A;  4N1G A;  2WC8 A;  1SMG A;  3VRP A;  2F8P A;  1HT9 A;  1PSB A;  1K96 A;  3BOW B;  4FQT A;  1BT6 A;  1XK4 A;  2KI6 C;  5G08 A;  3SG5 A;  2GV5 A;  4MSP A;  2KYC A;  1OMR A;  3DYE A;  5D7F A;  5FI6 A;  3SIB A;  1D1O A;  1K9U A;  1XFX O;  1S6J A;  1DJG A;  1YUT A;  3SG3 A;  3DVK A;  5BPJ A;  1NP8 A;  3SS3 A;  2FJU B;  4NDC A;  1CDL A;  2BBM A;  1CDN A;  4OV2 A;  2KQY A;  4MLW A;  1G33 A;  3I5F C;  1UWO A;  1FI6 A;  1JBA A;  3EKJ A;  2KAV A;  3S0F A;  2LVI A;  3I5H B;  3LL8 B;  1A03 A;  3NHI A;  5I94 A;  1V1F A;  3CZ1 A;  1WDC C;  4DCK A;  2M1K B;  4XJK B;  2BE6 A;  1S5G Y;  5AAN A;  3ZNI A;  2CNP A;  3FE6 A;  2CCM A;  1NIW A;  1ZUZ A;  1N0Y A;  1LA0 A;  1TUZ A;  1RJV A;  1M31 A;  3ICB A;  2QPT A;  3DY9 A;  2L5Y A;  3CTN A;  5AXI A;  1M63 B;  2JNF A;  3IF7 A;  2PAS A;  1U5I A;  5D3O A;  1ALV A;  3B7A A;  5I8N A;  1NX0 A;  1JFK A;  1J7R A;  2LMT A;  1KSM A;  3BQ3 A;  5I2L A;  2K7B A;  2JT0 A;  2LP3 A;  1B1G A;  1OE9 B;  1EXR A;  3SJS A;  4YGA A;  2L4I A;  1LA3 A;  1MF8 B;  4I5J A;  1DF0 B;  1KK8 B;  1K90 D;  2I7A A;  5J3X A;  4D1E A;  1LVC D;  1XFU O;  2I18 A;  2KNE A;  1LS8 A;  4XYN A;  1R6P A;  2BBN A;  1MUX A;  2NXQ A;  1OW4 A;  2QEO A;  3FWC A;  2OPO A;  1MXL C;  4HSZ A;  2QEB A;  1OMV A;  2PYQ A;  5HLV A;  1QVI Z;  4CLN A;  5AER A;  3C1V A;  2BKH B;  1AP4 A;  1DJH A;  2EC6 B;  3I5I B;  1BLQ A;  1S6I A;  2Y1M A;  1K9K A;  3VRR A;  1IWQ A;  2JTZ A;  2LP2 A;  1SR6 C;  1WLM A;  1WLZ A;  1DJW A;  2KSP A;  1M46 A;  3BXK A;  1J7P A;  3KEV A;  5CSJ A;  2CBL A;  3BFA A;  5B8I B;  2L2C A;  4WQ2 A;  1TWO A;  3OX5 A;  2MLE C;  4DS7 A;  1N2D A;  4JQ0 D;  2JZI A;  3SG2 A;  1CLB A;  3S0E A;  3R1P A;  1OOG A;  4E68 A;  2BE4 A;  1DGV A;  1K95 A;  2KPH A;  2OTG B;  2WOS A;  1L2O B;  2H8V A;  2P6B B;  3EVV A;  3PN7 C;  4HRE E;  2Q4U A;  2CXJ A;  3FWB A;  1EG4 A;  1SW8 A;  2HPS A;  5I2Q A;  1REC A;  1SCM B;  2ISD A;  1CLM A;  3CS1 A;  2M9G A;  2M97 A;  5ER5 A;  1UP5 A;  5CSI A;  3CZT X;  3O6B A;  1F71 A;  1QJT A;  4GGF A;  4QJ4 B;  3SG4 A;  5HKZ A;  3JTD B;  1BG1 A;  2Y5I A;  4QJ3 B;  3L4A A;  1XA5 A;  3VRQ A;  1GGW A;  2H61 C;  3PAT A;  4BY5 A;  3D10 A;  3TZ1 A;  1BR1 B;  3D75 A;  5I2O A;  3NSI A;  5IBW A;  2SCP A;  3JVT C;  3DVM A;  1J1E A;  1TNW A;  2LCP A;  4MBE A;  1CFF A;  4JD9 A;  1B8R A;  3LK1 A;  1WRZ A;  1DEK A;  5HLO A;  1JC2 A;  2MAZ A;  3NSL A;  3O78 A;  2KAX A;  3BUX B;  3D0Y A;  5CPV A;  1A75 B;  1WRK A;  2L98 A;  2MBX A;  3WHU B;  5K89 A;  1BR4 B;  1NX3 A;  2L51 A;  4DIR A;  2K7O A;  2V53 A;  1AJ5 A;  1OSA A;  5F6T A;  1DJX A;  3TUY B;  1CTR A;  4YGD B;  4OCI A;  4AQJ A;  1S1E A;  2WCJ A;  3A4U B;  1GM0 A;  2AUC A;  1JUO A;  3PJI A;  3GK2 A;  2LNK A;  1J7O A;  3MSE B;  2M8U A;  3PN7 B;  3L4L A;  2NLN A;  4NDB A;  3CLN A;  1ZOT B;  1QTX A;  1MHO A;  2JT3 A;  2HQ8 A;  2LLU A;  1TTX A;  2BCB A;  3AKB A;  3EVU A;  1QAS A;  3I5G B;  4OKH A;  2O5G A;  2JQ6 A;  4ETO A;  2LE9 B;  3GK1 A;  2PRU A;  1X02 A;  5HL1 A;  2Y4Q A;  1DTL A;  1OOF A;  3SS4 A;  1B7T Y;  2KI4 B;  1FF1 A;  1DMO A;  1SNL A;  2P71 A;  2KBI A;  2M7N A;  4A4C A;  4L9M A;  1W9Z A;  2HF5 A;  3WHT B;  1S36 A;  1LKJ A;  1M39 A;  2PSR A;  3CZ2 A;  3NSK A;  2L4H A;  1C07 A;  4MEW A;  3PM2 A;  1CNP A;  1OQP A;  3AAK A;  2LLS A;  2KGR A;  3OP0 A;  1EJ3 A;  1YVH A;  4C0K A;  1QS7 A;  1CMF A;  2F2O A;  4I5K A;  1BJF A;  4CFR A;  1ODB A;  1DJI A;  3EK7 A;  3IQO A;  1B8L A;  2H61 A;  3K1E A;  1MWN A;  4M2P A;  3PSR A;  1CDP A;  4U8D A;  2BNX A;  4GGF C;  1GQM A;  1IKU A;  4WRI A;  3WXA A;  2OS8 C;  2KOT A;  1KK7 Z;  2MLF C;  3S0D A;  4PHM A;  3LCP C;  1ALW A;  1L7Z A;  5FYX A;  3R72 A;  2JT8 A;  1XFZ O;  3GK4 X;  5KTY A;  1WRL A;  1SPY A;  1C3Z A;  1Y1U A;  3NXA A;  3DF0 A;  4GBA A;  1BOD A;  1JF0 A;  1H4B A;  3D77 A;  1IIO A;  3B86 A;  1G4Y R;  3SG7 A;  3O2P A;  1Z2C B;  2K8M B;  1S5G Z;  1TCF A;  1IJ5 A;  2G9B A;  1MQ1 A;  3KHE A;  3CR5 X;  3EK4 A;  1XFW O;  1DGU A;  1UHJ A;  1FPW A;  1SSE B;  1OZO A;  4MRY A;  2Q91 A;  1DJZ A;  1K8U A;  2QEH A;  3D74 A;  2EGD A;  2KAY A;  2WCE A;  4INX A;  4M2O A;  1KSO A;  3SG6 A;  5FI7 A;  1B7T Z;  2BCX A;  2MRD A;  2QEV A;  1SK6 D;  4ORB B;  1CMG A;  3PFV A;  3SS5 A;  1TUJ A;  2F2P A;  1KQM C;  1IRJ A;  4MN0 A;  3I5H C;  1FBV A;  2KLE A;  4PT1 A;  2PMY A;  3TDZ A;  3NHT A;  1J1D A;  3NGV A;  4JPZ B;  1OOI X;  1YX7 A;  4MZJ A;  4BY4 A;  1QLK A;  2SAS A;  4Q04 A;  2KFH A;  1DJY A;  1V1G A;  4USL A;  2M1U A;  1IH0 A;  2F3Y A;  2BL0 C;  1UUS A;  2GGZ A;  2TN4 A;  2ZN8 A;  4OR9 B;  4CPV A;  3CR2 A;  2KFG A;  2LVV A;  2K0J A;  1CFP A;  2LLT A;  1R2U A;  1PSR A;  4MZL A;  1TCO B;  1EH2 A;  1F70 A;  2BAP A;  4OZD A;  1IGV A;  3OHM B;  4FQO A;  4JWQ A;  1PK0 D;  3B87 A;  1M45 A;  1JF2 A;  1PVA A;  1RRO A;  2CT9 A;  1UHI A;  1KFX L;  2LMV A;  2OTG C;  2WCM A;  5AEQ A;  3LK0 A;  3BOW A;  1NPQ A;  5TNC A;  1CDM A;  1QAT A;  1YX8 A;  1Q80 A;  3UNW A;  5GQQ C;  2AAO A;  2DOQ A;  3QRX A;  4TNC A;  2I94 A;  2K60 A;  2JTT A;  1KQV A;  1BMO A;  3KPX A;  1TOP A;  3S0G A;  2LV7 A;  1YR5 A;  1LXF C;  1JSA A;  3RZS A;  1SCM C;  2E6W A;  2ZN9 A;  1UHK A;  2EC6 C;  3I5I C;  1JWD A;  1EL4 A;  4F7F A;  4XJK A;  3VB1 A;  1KCY A;  2LVJ A;  3PM8 A;  5CSN A;  2JPT A;  1FW4 A;  1ZMZ A;  4PHK A;  1SL8 A;  1QV0 A;  4ORC B;  1SL9 A;  4F0Z B;  1CB1 A;  1KFU L;  1YUR A;  4HRG A;  2KDH A;  2JPO A;  3CZ0 A;  2D8N A;  3JVT B;  2M3W A;  1K94 A;  2K2A A;  1F4O A;  1U5I B;  2QAC A;  4NQG A;  3DVJ A;  5EL2 A;  1AHR A;  5FI2 A;  3RM1 A;  4AOM A;  1S6C A;  2GTE A;  2ZFD A;  1K9P A;  4JKT A;  5HKW A;  4DUQ A;  3B6X A;  2JXL A;  2BL0 B;  2LM5 A;  3HCM A;  4PE0 A;  1IQ5 A;  2HQW A;  3D76 A;  4YI8 A;  1AVS A;  1CFD A;  3ZWH A;  3S0B A;  5DKN A;  1RTP 1;  1W7J B;  1YTZ C;  1DF0 A;  1RK9 A;  1PAL A;  1XVJ A;  2KHN A;  1ZFS A;  1VRK A;  2I2R E;  2K2F A;  2PQL A;  2KQ6 A;  2A4J A;  2VRG A;  4WQ3 A;  1QLS A;  4INW A;  2YGU A;  3BUN B;  4I5N B;  3CDN A;  1XK4 C;  2WC5 A;  1FI5 A;  3I5F B;  1MR8 A;  2BCA A;  3I5G C;  3OX6 A;  2G2B A;  2JRF A;  1DT7 B;  2K61 A;  2BEC A;  1DQE A;  4KYN A;  2ZNE A;  1KFX S;  3NSO A;  3TS5 C;  1QIW A;  4YI9 A;  3EVR A;  3DD4 A;  4GPL B;  1IG5 A;  3LLE A;  5DKR A;  3QME A;  1N65 A;  1AK8 A;  4M2Q A;  2WCB A;  1NUB A;  3BFB A;  1A4P A;  1SBJ A;  2FOT A;  1A2X A;  2NCP A;  5ER4 X;  2L5X B;  5AFP A;  1IQ3 A;  1YRT B;  1PRW A;  4GAO A;  2IS9 A;  5HYD A;  1G8I A;  1A29 A;  3O4Y A;  1C7W A;  5DIC A;  1UHN A;  3Q8I A;  4IL1 A;  1NWD A;  1B9A A;  2KYF A;  1F4Q A;  3CYZ A;  1B8C A;  3H4S E;  3TDI A;  1DC1 A;  3CWG A;  1TNQ A;  1SYM A;  2KFF A;  5JOL A;  1WDC B;  5HKY A;  1Y0V H;  2CTN A;  2ZKM X;  1NX1 A;  1C7V A;  3TDU A;  1KFU S;  4HRH A;  2OS8 B;  4GNK B;  1OOH A;  4FTG A;  1JFJ A;  3OBV A;  2ZRT A;  2LC5 A;  4ORA B;  3EKH A;  4GFT A;  4PDZ A;  4YGB B;  1SRA A;  4IJ7 A;  1TNP A;  1C3Y A;  3UO9 A;  1SY9 A;  5KU1 A;  1GGZ A;  2KBM A;  1F55 A;  3DZT A;  1TNX A;  1CKK A;  2GGM A;  3A8R A;  3KF9 A;  2QDI A;  4N5X A;  2JXC A;  3D0Y B;  5CSF A;  4CID A;  1XYD A;  1CFC A;  1A75 A;  3OB1 B;  3AKA A;  1CM1 A;  2WCL A;  2BKI B;  1BF5 A;  2L2E A;  2WC6 A;  4P2Y B;  3R1V A;  1TRF A;  3TS5 B;  4PAL A;  1QXP A;  4ZCU A;  3FE8 A;  1CLL A;  1ZAC A;  4YGC B;  1LIN A;  3V2L A;  4AQI A;  2K7C A;  1L2O C;  1QX5 B;  2WCK A;  3IQQ A;  4MRX A;  4A4B A;  3WNX B;  4NDD A;  2FJY A;  3D78 A;  2P70 A;  3VGO A;  1B47 A;  4PHN A;  1NX2 A;  1TIZ A;  2PAL A;  2LUX A;  3L47 A;  2COL B;  4MVF A;  1UUR A;  2HET A;  2WOR A;  1H8B A;  5KSZ A;  3FS7 A;  1S3P A;  1SR6 B;  1NCZ A;  3KO0 A;  2E30 A;  2R2I A;  1NCX A;  2L50 A;  2KGB C;  4PE7 A;  1TN4 A;  2M29 A;  4ICB A;  1OMD A;  3R1O A;  2WCH A;  2JC2 A;  3AAJ A;  3S0A A;  1UHH A;  3VRN A;  2B1U A;  5PAL A;  3PAL A;  1KWO C;  1QVI Y;  2FCE A;  3O4X A;  4GGN A;  1KQM B;  4C0L A;  1QIV A;  1P28 A;  2LHI A;  2Y1N A;  4UPG A;  2KI6 D;  1GJY A;  1Y1X A;  3BUM B;  3CAB A;  2KLD A;  2MHH A;  2ZRS A;  1K93 D;  2EHB A;  4YBH B;  3RLZ A;  1AUI B;  1QV1 A;  1IJ6 A;  1SCV A;  1J55 A;  3GOF A;  3D73 A;  5DKQ A;  2F33 A;  3JTD C;  1YVL A;  2FCD A;  4GUK A;  1OZS A;  3DVE A;  1XO5 A;  2JUL A;  2LVK A;  3CGA A;  2LMU A;  1ORG A;  1NCY A;  4DRW A;  4I5L B;  1F8H A;  3SIA A;  4PHJ A;  1Z4H A;  2JU0 A;  2WND A;  3BUW B;  2RGI A;  5JJG A;  2WCF A;  1XFR A;  1E8A A;  2JOJ A;  2K7D A;  3DF0 B;  2ERB A;  2M7L A;  1SL7 A;  2KI4 C;  1SKT A;  1XFY O;  2MA2 A;  1YUU A;  2LAP A;  1RWY A;  2PVB A;  3EG5 B;  3M0W A;  4C0J A;  3TUY C;  1YRU B;  1DVI A;  1BU3 A;  2ZND A;  1RFJ A;  1KK7 Y;  4MZK A;  4ZCV A;  2LAN A;  4N1F A;  4YRU A;  1HQV A;  1QX2 A;  3IVT A;  1WY9 A;  1Y6W A;  2F3Z A;  3CR4 X;  3E3R A;  1KWO B;  1BOC A;  1F54 A;  4PE1 A;  1PVB A;  1NSH A;  4PE4 A;  1CM4 A;  2NZ0 A;  2MJW B;  2L0P A;  2M49 B;  2LHL A;  3PLF B;  1OOJ A;  2M0R A;  3F45 A;  3BFH A;  4R1E A;  1AJ4 A;  5D69 A;  3OGN A;  1W7I B;  2JWW A;  3BUO B;  4QJ5 B;  1Y1A A;  2O60 A;  1XFV O;  3K21 A;  1MXE A;  3FIA A;  3FE9 A;  4OVN F;  1NYA A;  1QWV A;  1DEL A;  2H2K A;  1PUL A;  1S26 D;  4YGE B;  3OB2 B;  4CFQ A;  1T14 A;  1YUS A;  1K2H A;  3B88 A;  4P5O E;  2NCO A;  4PCW A;  3DXL A;  2JNX A;  3VRO A;  3HX4 A;  2LUC A;  3BJH A;  3EK8 A;  1J7Q A; 
#chains in the Genus database with same CATH homology
 2AMI A;  3BYA A;  1B4C A;  1KK8 C;  1QX7 A;  1EG3 A;  4N1G A;  2WC8 A;  1SMG A;  3VRP A;  2F8P A;  1HT9 A;  1PSB A;  1K96 A;  3BOW B;  1BT6 A;  1XK4 A;  2KI6 C;  5G08 A;  3SG5 A;  2GV5 A;  4MSP A;  2KYC A;  1OMR A;  5D7F A;  3SIB A;  1D1O A;  1K9U A;  1XFX O;  1S6J A;  1DJG A;  1YUT A;  3SG3 A;  3DVK A;  5BPJ A;  1NP8 A;  2FJU B;  4NDC A;  1CDL A;  2BBM A;  1CDN A;  4OV2 A;  2KQY A;  4MLW A;  1G33 A;  3I5F C;  1UWO A;  1FI6 A;  1JBA A;  3EKJ A;  2KAV A;  2LVI A;  3I5H B;  3LL8 B;  1A03 A;  1V1F A;  1WDC C;  4DCK A;  2M1K B;  4XJK B;  2BE6 A;  1S5G Y;  5AAN A;  3ZNI A;  2CNP A;  2CCM A;  1NIW A;  1N0Y A;  1ZUZ A;  1LA0 A;  1RJV A;  1M31 A;  3ICB A;  2QPT A;  3CTN A;  5AXI A;  1M63 B;  2JNF A;  3IF7 A;  2PAS A;  1U5I A;  5I8N A;  1ALV A;  1NX0 A;  1JFK A;  1J7R A;  2LMT A;  1KSM A;  3BQ3 A;  5I2L A;  2K7B A;  2JT0 A;  2LP3 A;  1B1G A;  1OE9 B;  1EXR A;  3SJS A;  4YGA A;  2L4I A;  1LA3 A;  1MF8 B;  4I5J A;  1DF0 B;  1KK8 B;  1K90 D;  2I7A A;  5J3X A;  4D1E A;  1LVC D;  1XFU O;  2I18 A;  2KNE A;  4XYN A;  1R6P A;  2BBN A;  1MUX A;  2NXQ A;  3FWC A;  4HSZ A;  2OPO A;  1MXL C;  1OMV A;  4CLN A;  5AER A;  1QVI Z;  3C1V A;  2BKH B;  1AP4 A;  1DJH A;  2EC6 B;  3I5I B;  1BLQ A;  1S6I A;  2Y1M A;  1K9K A;  3VRR A;  1IWQ A;  2JTZ A;  2LP2 A;  1SR6 C;  1WLM A;  1WLZ A;  1DJW A;  2KSP A;  1M46 A;  3BXK A;  1J7P A;  3KEV A;  5CSJ A;  2CBL A;  5B8I B;  4WQ2 A;  3OX5 A;  2MLE C;  4DS7 A;  1N2D A;  4JQ0 D;  2JZI A;  3SG2 A;  1CLB A;  4E68 A;  2BE4 A;  1DGV A;  1K95 A;  2OTG B;  2WOS A;  3EVV A;  1L2O B;  3PN7 C;  2P6B B;  4HRE E;  2Q4U A;  2CXJ A;  3FWB A;  1EG4 A;  1SW8 A;  2HPS A;  5I2Q A;  1REC A;  1SCM B;  2ISD A;  1CLM A;  3CS1 A;  2M9G A;  2M97 A;  5ER5 A;  1UP5 A;  5CSI A;  3CZT X;  3O6B A;  1F71 A;  1QJT A;  4GGF A;  4QJ4 B;  3SG4 A;  5HKZ A;  3JTD B;  1BG1 A;  2Y5I A;  4QJ3 B;  1XA5 A;  3VRQ A;  1GGW A;  2H61 C;  3PAT A;  4BY5 A;  3D10 A;  3TZ1 A;  1BR1 B;  5I2O A;  3NSI A;  5IBW A;  2SCP A;  3JVT C;  3DVM A;  1J1E A;  1TNW A;  2LCP A;  4MBE A;  1CFF A;  1B8R A;  3LK1 A;  1WRZ A;  5HLO A;  1JC2 A;  2MAZ A;  3NSL A;  3O78 A;  2KAX A;  3BUX B;  3D0Y A;  5CPV A;  1A75 B;  1WRK A;  2L98 A;  2MBX A;  3WHU B;  5K89 A;  1BR4 B;  1NX3 A;  2L51 A;  4DIR A;  2K7O A;  2V53 A;  1AJ5 A;  1OSA A;  5F6T A;  1DJX A;  3TUY B;  1CTR A;  4YGD B;  4OCI A;  4AQJ A;  1S1E A;  3A4U B;  2AUC A;  1JUO A;  3GK2 A;  2LNK A;  1J7O A;  3MSE B;  2M8U A;  3PN7 B;  2NLN A;  4NDB A;  3CLN A;  1ZOT B;  1QTX A;  1MHO A;  2JT3 A;  2HQ8 A;  2LLU A;  1TTX A;  2BCB A;  3AKB A;  3EVU A;  1QAS A;  3I5G B;  4OKH A;  2O5G A;  2JQ6 A;  4ETO A;  2LE9 B;  3GK1 A;  2PRU A;  1X02 A;  2Y4Q A;  1DTL A;  1B7T Y;  2KI4 B;  1FF1 A;  1DMO A;  1SNL A;  2KBI A;  2M7N A;  4A4C A;  4L9M A;  2HF5 A;  3WHT B;  1S36 A;  1LKJ A;  1M39 A;  2PSR A;  3NSK A;  1C07 A;  2L4H A;  4MEW A;  1CNP A;  1OQP A;  3AAK A;  2LLS A;  2KGR A;  3OP0 A;  1EJ3 A;  1YVH A;  4C0K A;  1QS7 A;  1CMF A;  2F2O A;  4I5K A;  1BJF A;  4CFR A;  1ODB A;  1DJI A;  3EK7 A;  3IQO A;  1B8L A;  2H61 A;  1MWN A;  4M2P A;  3PSR A;  1CDP A;  4U8D A;  4GGF C;  1GQM A;  1IKU A;  4WRI A;  3WXA A;  2OS8 C;  2KOT A;  1KK7 Z;  2MLF C;  4PHM A;  3LCP C;  1ALW A;  1L7Z A;  5FYX A;  2JT8 A;  1XFZ O;  3GK4 X;  5KTY A;  1WRL A;  1SPY A;  1Y1U A;  3NXA A;  3DF0 A;  4GBA A;  1BOD A;  1JF0 A;  1H4B A;  3SG7 A;  1G4Y R;  3O2P A;  2K8M B;  1S5G Z;  1TCF A;  1IJ5 A;  2G9B A;  1MQ1 A;  3KHE A;  3CR5 X;  3EK4 A;  1XFW O;  1DGU A;  1UHJ A;  1FPW A;  1OZO A;  4MRY A;  2Q91 A;  1DJZ A;  1K8U A;  2EGD A;  2KAY A;  2WCE A;  3SG6 A;  4M2O A;  1KSO A;  1B7T Z;  2BCX A;  2MRD A;  4ORB B;  1SK6 D;  1CMG A;  3PFV A;  2F2P A;  1KQM C;  1IRJ A;  4MN0 A;  3I5H C;  1FBV A;  2PMY A;  3TDZ A;  4JPZ B;  1J1D A;  4BY4 A;  4MZJ A;  1YX7 A;  1QLK A;  2SAS A;  4Q04 A;  2KFH A;  1DJY A;  1V1G A;  4USL A;  2M1U A;  1IH0 A;  2F3Y A;  2BL0 C;  1UUS A;  2GGZ A;  2TN4 A;  2ZN8 A;  4OR9 B;  4CPV A;  3CR2 A;  2KFG A;  2LVV A;  2K0J A;  1CFP A;  2LLT A;  1R2U A;  1PSR A;  4MZL A;  1TCO B;  1EH2 A;  1F70 A;  1IGV A;  3OHM B;  4FQO A;  4JWQ A;  1PK0 D;  5HLV A;  1M45 A;  1JF2 A;  1PVA A;  1RRO A;  2CT9 A;  1UHI A;  1KFX L;  2LMV A;  2OTG C;  5AEQ A;  3LK0 A;  3BOW A;  1NPQ A;  5TNC A;  1CDM A;  1QAT A;  1YX8 A;  1Q80 A;  5GQQ C;  2AAO A;  2DOQ A;  3QRX A;  4TNC A;  2I94 A;  1KQV A;  2JTT A;  1BMO A;  3KPX A;  1TOP A;  2LV7 A;  1YR5 A;  1LXF C;  1JSA A;  1SCM C;  2E6W A;  2ZN9 A;  1UHK A;  2EC6 C;  3I5I C;  1JWD A;  1EL4 A;  4XJK A;  1KCY A;  2LVJ A;  3PM8 A;  5CSN A;  2JPT A;  1FW4 A;  1ZMZ A;  4PHK A;  1SL8 A;  1QV0 A;  4ORC B;  1SL9 A;  4F0Z B;  1CB1 A;  1KFU L;  1YUR A;  4HRG A;  2KDH A;  2D8N A;  3JVT B;  2M3W A;  1K94 A;  2K2A A;  1F4O A;  1U5I B;  2QAC A;  4NQG A;  3DVJ A;  1AHR A;  3RM1 A;  4AOM A;  1S6C A;  2ZFD A;  5HKW A;  1K9P A;  4DUQ A;  2JXL A;  2BL0 B;  2LM5 A;  3HCM A;  4PE0 A;  1IQ5 A;  2HQW A;  4YI8 A;  1AVS A;  1CFD A;  3ZWH A;  5DKN A;  1RTP 1;  1W7J B;  1YTZ C;  1DF0 A;  1RK9 A;  1PAL A;  1XVJ A;  2KHN A;  1ZFS A;  1VRK A;  2I2R E;  2K2F A;  2KQ6 A;  2A4J A;  2VRG A;  4WQ3 A;  1QLS A;  3BUN B;  4I5N B;  1XK4 C;  1FI5 A;  3I5F B;  1MR8 A;  2BCA A;  3I5G C;  3OX6 A;  2G2B A;  2JRF A;  1DT7 B;  2K61 A;  2BEC A;  2ZNE A;  1KFX S;  3NSO A;  3TS5 C;  1QIW A;  4YI9 A;  3EVR A;  3DD4 A;  4GPL B;  1IG5 A;  3LLE A;  5DKR A;  1N65 A;  1AK8 A;  4M2Q A;  2WCB A;  1NUB A;  1A4P A;  1SBJ A;  2FOT A;  1A2X A;  2NCP A;  5ER4 X;  2L5X B;  5AFP A;  1IQ3 A;  1YRT B;  1PRW A;  4GAO A;  2IS9 A;  5HYD A;  1G8I A;  1A29 A;  3O4Y A;  1C7W A;  1UHN A;  4IL1 A;  1NWD A;  1B9A A;  2KYF A;  1F4Q A;  1B8C A;  3H4S E;  3TDI A;  3CWG A;  1TNQ A;  1SYM A;  2KFF A;  5JOL A;  1WDC B;  5HKY A;  1Y0V H;  2CTN A;  2ZKM X;  1NX1 A;  1C7V A;  3TDU A;  1KFU S;  4HRH A;  2OS8 B;  4GNK B;  1JFJ A;  4FTG A;  2ZRT A;  2LC5 A;  4ORA B;  3EKH A;  4GFT A;  4PDZ A;  4YGB B;  1SRA A;  1TNP A;  1SY9 A;  5KU1 A;  1GGZ A;  2KBM A;  1F55 A;  1TNX A;  1CKK A;  2GGM A;  3A8R A;  3KF9 A;  4N5X A;  2JXC A;  3D0Y B;  5CSF A;  4CID A;  1XYD A;  1CFC A;  1A75 A;  3OB1 B;  3AKA A;  1CM1 A;  1BF5 A;  2BKI B;  2L2E A;  4P2Y B;  1TRF A;  3TS5 B;  4PAL A;  1QXP A;  4ZCU A;  1CLL A;  1ZAC A;  4YGC B;  1LIN A;  4AQI A;  2K7C A;  1L2O C;  1QX5 B;  3IQQ A;  4MRX A;  4A4B A;  3WNX B;  4NDD A;  3VGO A;  1B47 A;  4PHN A;  1NX2 A;  1TIZ A;  2PAL A;  2LUX A;  2COL B;  4MVF A;  1UUR A;  2HET A;  2WOR A;  1H8B A;  5KSZ A;  3FS7 A;  1S3P A;  1SR6 B;  1NCZ A;  3KO0 A;  2E30 A;  2R2I A;  1NCX A;  2L50 A;  2KGB C;  4PE7 A;  1TN4 A;  2M29 A;  4ICB A;  1OMD A;  2JC2 A;  3AAJ A;  1UHH A;  3VRN A;  2B1U A;  5PAL A;  3PAL A;  1KWO C;  1QVI Y;  2FCE A;  4GGN A;  1KQM B;  4C0L A;  1QIV A;  2LHI A;  2Y1N A;  4UPG A;  2KI6 D;  1GJY A;  1Y1X A;  3BUM B;  4YBH B;  2MHH A;  2ZRS A;  1K93 D;  2EHB A;  3RLZ A;  1AUI B;  1QV1 A;  1IJ6 A;  1SCV A;  1J55 A;  3GOF A;  5DKQ A;  2F33 A;  3JTD C;  1YVL A;  2FCD A;  4GUK A;  1OZS A;  3DVE A;  1XO5 A;  2JUL A;  2LVK A;  3CGA A;  2LMU A;  1NCY A;  4DRW A;  4I5L B;  1F8H A;  3SIA A;  4PHJ A;  2JU0 A;  2WND A;  3BUW B;  2RGI A;  5JJG A;  2WCF A;  1E8A A;  2JOJ A;  2K7D A;  3DF0 B;  2M7L A;  1SL7 A;  2KI4 C;  1SKT A;  1XFY O;  2MA2 A;  1YUU A;  2LAP A;  1RWY A;  2PVB A;  3M0W A;  3TUY C;  4C0J A;  1YRU B;  1DVI A;  1BU3 A;  2ZND A;  1RFJ A;  1KK7 Y;  4MZK A;  4ZCV A;  2LAN A;  4N1F A;  4YRU A;  1HQV A;  1QX2 A;  1WY9 A;  1Y6W A;  2F3Z A;  3CR4 X;  3E3R A;  1KWO B;  1BOC A;  1F54 A;  4PE1 A;  1PVB A;  1NSH A;  4PE4 A;  1CM4 A;  2NZ0 A;  2MJW B;  2L0P A;  2M49 B;  2LHL A;  3PLF B;  1OOJ A;  2M0R A;  3F45 A;  4R1E A;  1AJ4 A;  5D69 A;  1W7I B;  2JWW A;  3BUO B;  4QJ5 B;  1Y1A A;  2O60 A;  1XFV O;  3K21 A;  1MXE A;  3FIA A;  4OVN F;  1NYA A;  2H2K A;  4YGE B;  1PUL A;  1S26 D;  3OB2 B;  4CFQ A;  1YUS A;  1K2H A;  4P5O E;  2NCO A;  4PCW A;  2JNX A;  3VRO A;  3HX4 A;  2LUC A;  3EK8 A;  1J7Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...