2Q91A

Structure of the ca2+-bound activated form of the s100a4 metastasis factor
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
96
structure length
96
Chain Sequence
ACPLEKALDVMVSTFHKYSGKEGDKFKLNKSELKELLTRELPSFLGKRTDEAAFQKLMSNLDSNRDNEVDFQEYCVFLSCIAMMCNEFFEGFPDKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords S100A4 Metastasis Factor
publication title Structure of Ca(2+)-Bound S100A4 and Its Interaction with Peptides Derived from Nonmuscle Myosin-IIA.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal binding protein
total genus 36
structure length 96
sequence length 96
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-06-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2q91A00
1CLMA 2JQ6A 3OB1B 2L5XB 2JT0A 1BR4B 3M0WA 2G9BA 2KQ6A 1IJ5A 1EL4A 4I5KA 2LLSA 1Y1UA 1DVIA 3GK4X 1JWDA 4OV2A 2K61A 2CXJA 4GBAA 1RROA 3VRRA 1QATA 2WC8A 4PE4A 3TS5B 1J55A 1QXPA 2H61C 3EVRA 2JWWA 5J3XA 3TDZA 5D7FA 4ETOA 3AKBA 3O4YA 1SPYA 3BYAA 1QX7A 3CGAA 1B4CA 3I5GB 2JZIA 1IWQA 3LLEA 4FQOA 4M2QA 1PALA 1UWOA 5AERA 1TNQA 1QIWA 3CZTX 2JXLA 1BG1A 4DIRA 4N1FA 1J1EA 1TRFA 1MXEA 2BCBA 5ER4X 4I5LB 3DF0A 1LXFC 2EC6B 4P5OE 1OMRA 3BUMB 4YGAA 1IQ3A 4MRYA 1S6IA 2MLFC 1CMFA 1SR6C 2GV5A 3SJSA 4XYNA 2WCBA 1UHHA 1DF0B 2R2IA 3SG3A 5IBWA 1K93D 1Y6WA 5AANA 1GGZA 5K89A 2F2OA 3BUOB 1KQMB 1DJYA 5I2LA 4DUQA 1TNPA 1YX7A 1K96A 1LVCD 1JSAA 4GFTA 1S1EA 1PSRA 1JBAA 2KI4C 3JTDB 2QACA 2QPTA 4MZJA 4C0JA 1AHRA 2K7DA 1QVIY 2LVJA 4C0LA 4PDZA 5DKQA 3NSKA 3DVJA 2FJUB 1KQVA 1LA0A 1F4QA 1ODBA 4ORAB 5PALA 1TTXA 4FTGA 3AKAA 1LINA 1UHKA 1XFZO 4QJ4B 4MBEA 1A2XA 2K0JA 5CSNA 2AAOA 2KQYA 3CWGA 2MLEC 3KF9A 3ZWHA 2OS8B 5B8IB 1QVIZ 4QJ3B 2M8UA 1WRKA 3EVUA 2LMUA 2PVBA 5F6TA 3PN7C 4NDDA 2F3ZA 1CLBA 1L2OB 1CFDA 2ZRTA 1NWDA 1QLSA 2K8MB 2RGIA 1S36A 2DOQA 1B7TY 1RK9A 1CFCA 1DMOA 1XYDA 1UHIA 4DS7A 1B1GA 4JQ0D 4NDCA 5TNCA 2KSPA 2ZNDA 3O6BA 1QASA 2M7LA 3I5IB 1TIZA 3I5FB 5KU1A 3EVVA 1N65A 3SG7A 2JPTA 1Y1AA 3BUXB 3SG2A 3E3RA 2HPSA 2JU0A 1B7TZ 3H4SE 2LVKA 2LHIA 2OPOA 1CTRA 2KAXA 4OCIA 1K90D 1BU3A 4WRIA 1TCOB 2ZRSA 3F45A 4XJKB 1DJGA 1A75B 1KSOA 1WLMA 2BL0B 3A8RA 2JULA 1SCMC 3DD4A 4NQGA 1JFKA 1PULA 2V53A 1PVBA 3AAKA 2KI6D 3DVEA 4DCKA 1RTP1 1CFPA 4GGFA 5HKWA 1CNPA 1KK8C 3BOWB 3SG4A 3PLFB 2LP2A 1ALVA 2JXCA 2K2FA 2M0RA 1TOPA 3GK1A 1IQ5A 1UHJA 1Y1XA 1TN4A 5I2QA 4D1EA 1KFUL 3TUYB 1FF1A 2BBNA 4QJ5B 2KYFA 3DVKA 3JVTC 4HSZA 3TS5C 2L0PA 2GGMA 2M7NA 4U8DA 1SBJA 4GGNA 1H4BA 1DF0A 1FBVA 2JTZA 3NSLA 1NCZA 3SIBA 2NXQA 4GGFC 2KBMA 1V1GA 2KOTA 3RM1A 4E68A 1SL7A 1BT6A 2P6BB 1PVAA 2PMYA 1BOCA 1DGUA 5HYDA 3I5GC 4PALA 1Y0VH 3VGOA 1XK4C 2WNDA 1JF2A 1B8LA 2LLTA 1XFYO 2I18A 2M3WA 2AUCA 1MUXA 1LA3A 1MF8B 2I7AA 2TN4A 1FI5A 2BKHB 1BMOA 1K9KA 1CM1A 2FCDA 1F55A 5BPJA 1XFVO 3FWBA 1K95A 4DRWA 1DJZA 1A4PA 1TCFA 2KNEA 1GQMA 1KFXL 1BR1B 1SMGA 2B1UA 3VROA 1UHNA 3EK7A 2LANA 1M31A 1A03A 3LK1A 1UP5A 1AVSA 5I8NA 3D0YA 1B9AA 3CS1A 1KQMC 1YTZC 1YX8A 4MSPA 1NX0A 3OX5A 4ZCVA 2CBLA 1YR5A 3SG6A 1J7RA 1CB1A 1IJ6A 1YUSA 1IRJA 4HRGA 1W7IB 2LVVA 3JTDC 3A4UB 2PALA 1XFUO 1DT7B 2OTGB 5CPVA 2KHNA 1WDCB 1F8HA 1SRAA 1WRLA 3HCMA 2EHBA 1BJFA 1S6CA 2KBIA 2ZN9A 5HKYA 1UURA 3K21A 2L4IA 2LP3A 4P2YB 3VRQA 1CKKA 2F3YA 1C7WA 1K9UA 4OVNF 3PALA 1Q80A 4MLWA 1W7JB 4CPVA 1F54A 2ISDA 2K7BA 2LNKA 2M1KB 1M63B 1KWOB 2JT3A 4MRXA 1XFWO 4XJKA 1A75A 2JOJA 3OP0A 4YGEB 4UPGA 1C07A 1L2OC 4YI9A 2L4HA 2LVIA 1MHOA 2KFHA 2Y1MA 4ORBB 4A4CA 1QIVA 3I5HB 3RLZA 1B8RA 1M39A 1YVLA 2FCEA 3D10A 4YI8A 1ZUZA 1CDPA 2HF5A 1J7OA 1YVHA 3BOWA 4TNCA 2CCMA 2M1UA 3I5IC 3I5FC 4M2PA 5DKNA 2Y4QA 1MQ1A 2LE9B 1SYMA 2BKIB 4BY4A 1CM4A 1RECA 4PCWA 1F4OA 2AMIA 2PRUA 1F71A 4HREE 4CIDA 1XVJA 1AJ5A 1XO5A 2BL0C 1JUOA 1YRUB 2NCOA 2GGZA 1VRKA 2JTTA 2IS9A 2M29A 1AUIB 1CFFA 1N2DA 1SNLA 3KO0A 1FW4A 1F70A 4CFRA 1EG4A 3GOFA 1K94A 1WLZA 1C7VA 3VRNA 1OZSA 4YRUA 1M46A 2JC2A 3LL8B 1NCXA 3PFVA 4WQ3A 1K8UA 3KEVA 1PK0D 2FOTA 2MA2A 1U5IB 2KFFA 2Q91A 4GNKB 1B8CA 4OR9B 3OB2B 5DKRA 1GJYA 5JOLA 3LCPC 3TZ1A 1SCVA 1S6JA 2ZN8A 3TUYC 4CLNA 4IL1A 4YGDB 1ZFSA 1K2HA 2G2BA 2LM5A 3BUNB 4AQJA 5HKZA 1JF0A 1NX2A 2SCPA 1NYAA 3IQOA 2SASA 2I94A 1IKUA 4PHKA 1YURA 2F33A 2LHLA 2WCEA 1ALWA 1HQVA 4OKHA 3TDUA 3DVMA 1EXRA 1V1FA 2K2AA 4I5JA 2PASA 1KK7Y 5HLOA 3NSIA 2JNXA 4M2OA 3WNXB 4MVFA 1ZACA 2BBMA 3OHMB 1S5GY 1DJHA 1WY9A 2O60A 1NUBA 1UUSA 3LK0A 4YBHB 3EK8A 2ZNEA 1H8BA 1KCYA 2M9GA 2Y5IA 2LV7A 3PSRA 4PE1A 2L50A 1AP4A 3KHEA 4MZLA 4AOMA 1PRWA 2EC6C 3FIAA 3NSOA 4CFQA 2WORA 1KK7Z 5D69A 3CTNA 5CSIA 3OX6A 1TNWA 3TDIA 1PSBA 1S5GZ 2F2PA 3JVTB 5CSFA 1YUUA 2L98A 2M97A 1QX5B 4YGCB 1A29A 1MWNA 2E6WA 4HRHA 2ZKMX 1EJ3A 1MXLC 2MBXA 3CLNA 5AEQA 3SG5A 1R6PA 2KGRA 5HLVA 1OMVA 3HX4A 1EG3A 4JWQA 1HT9A 4AQIA 5ER5A 1CDMA 2L2EA 1OE9B 2JRFA 1RFJA 1JC2A 1LKJA 2LUXA 2OTGC 4Q04A 1WDCC 4GPLB 3SIAA 1J7PA 2LC5A 4A4BA 1NPQA 4JPZB 2WCFA 1ZMZA 2JNFA 1FPWA 1K9PA 4N5XA 1NSHA 2A4JA 2O5GA 1QV0A 1S3PA 4MEWA 4WQ2A 3IQQA 4NDBA 4PE7A 2BCXA 2Q4UA 1NX1A 4ZCUA 1BLQA 2Y1NA 1M45A 3VRPA 3C1VA 4PHJA 1QTXA 1SR6B 1OMDA 1D1OA 1KWOC 3CR2A 2OS8C 1SL9A 2VRGA 4GAOA 3WHTB 1KFUS 2WOSA 2LUCA 4N1GA 1DGVA 2LCPA 3I5HC 1RJVA 1SY9A 3PM8A 3MSEB 4I5NB 1QV1A 4F0ZB 3O2PA 2KAVA 1AK8A 1CDNA 2BE4A 3CR5X 1QS7A 5CSJA 3O78A 2BECA 4GUKA 2F8PA 2BCAA 4PHMA 1EH2A 5AFPA 2NLNA 3FWCA 1N0YA 1NCYA 2KI4B 3DF0B 1RWYA 1YRTB 1U5IA 1FI6A 3GK2A 5GQQC 5KTYA 2E30A 3ICBA 2K7OA 4YGBB 2I2RE 1CLLA 1QJTA 1OSAA 5AXIA 4MN0A 3WHUB 2ZFDA 1SW8A 1XFXO 3D0YB 4L9MA 4C0KA 4PHNA 3EKHA 2EGDA 2CTNA 1G4YR 1NP8A 1JFJA 1IH0A 5JJGA 2BE6A 1IG5A 3ZNIA 1OZOA 1KFXS 2PSRA 4ICBA 1B47A 5I2OA 2HQ8A 1J1DA 2M49B 2D8NA 1QX2A 1OOJA 2CNPA 1DJXA 2LMTA 1AJ4A 1KSMA 2NZ0A 3PN7B 1X02A 1XA5A 3EKJA 3KPXA 2KAYA 1IGVA 1TNXA 3AAJA 1SL8A 1GGWA 4MZKA 2KFGA 5FYXA 1BODA 4USLA 1L7ZA 1CDLA 2HETA 1BF5A 3BQ3A 3EK4A 1J7QA 3CR4X 3IF7A 1G33A 1CMGA 2KI6C 2K7CA 1DJIA 2LMVA 1SKTA 4ORCB 2MAZA 3BUWB 3FS7A 1YUTA 2JT8A 1OQPA 4R1EA 2L51A 1QLKA 2LLUA 2MJWB 2H2KA 2MHHA 1NX3A 1DJWA 1NIWA 1G8IA 2KGBC 2KYCA 2MRDA 1WRZA 1MR8A 1R2UA 1SCMB 1DTLA 3NXAA 2H61A 2LAPA 2CT9A 2KDHA 5G08A 3QRXA 1ZOTB 3WXAA 1XK4A 1S26D 2NCPA 5KSZA 1KK8B 3BXKA 4BY5A 2HQWA 3PATA 1E8AA 4PE0A 2COLB 1SK6D
chains in the Genus database with same CATH superfamily
1CLMA 2JQ6A 3OB1B 1IIOA 2L5XB 2JT0A 1BR4B 3M0WA 1T14A 2G9BA 2KQ6A 1IJ5A 1EL4A 4I5KA 2LLSA 1Y1UA 1DVIA 3BFAA 3GK4X 1JWDA 3CYZA 2H8VA 4OV2A 2K61A 2CXJA 4GBAA 3S0GA 1RROA 3VRRA 1QATA 2WC8A 4PE4A 3TS5B 1J55A 1TWOA 1QXPA 2H61C 3EVRA 2JWWA 5J3XA 3TDZA 5D7FA 4ETOA 3AKBA 3O4YA 1SPYA 3BYAA 1QX7A 3PM2A 3CGAA 1B4CA 3I5GB 2JZIA 1IWQA 2QEOA 3LLEA 4FQOA 4M2QA 1PALA 1UWOA 5AERA 1TNQA 1QIWA 3CZTX 2JXLA 3OGNA 1BG1A 4DIRA 4N1FA 2P70A 1J1EA 1TRFA 1MXEA 2BCBA 5ER4X 4F7FA 4I5LB 3DF0A 1LXFC 2EC6B 4P5OE 1OMRA 3BUMB 2ERBA 4YGAA 1IQ3A 4MRYA 1S6IA 2KLEA 2MLFC 1CMFA 1SR6C 2GV5A 3SJSA 4XYNA 4IJ7A 2WCBA 1UHHA 2PQLA 1DF0B 2R2IA 3SG3A 3PJIA 5IBWA 1K93D 1Y6WA 5AANA 1GGZA 5K89A 2F2OA 1DQEA 3BUOB 1KQMB 1DJYA 5I94A 1P28A 5I2LA 4DUQA 1TNPA 1YX7A 1K96A 1LVCD 2L2CA 4GFTA 1JSAA 1S1EA 1PSRA 1JBAA 2QEHA 2KI4C 3JTDB 2QACA 2QPTA 4MZJA 2WC6A 4C0JA 1AHRA 2K7DA 3D78A 1QVIY 2LVJA 4C0LA 4PDZA 5DKQA 3NSKA 3DVJA 2FJUB 1KQVA 1LA0A 1F4QA 1ODBA 4ORAB 5PALA 1TTXA 4FTGA 3AKAA 1LINA 1UHKA 1XFZO 4QJ4B 4MBEA 1A2XA 2K0JA 5CSNA 2AAOA 2KQYA 3CWGA 2MLEC 3KF9A 3ZWHA 2OS8B 1Z2CB 5B8IB 1QVIZ 1XFRA 4QJ3B 3B6XA 2M8UA 1WRKA 3EVUA 2LMUA 2PVBA 5F6TA 3PN7C 4NDDA 2F3ZA 1CLBA 1L2OB 1CFDA 2ZRTA 1NWDA 1QLSA 2K8MB 2RGIA 1S36A 2DOQA 1B7TY 1RK9A 1CFCA 3V2LA 1DMOA 1XYDA 1UHIA 4DS7A 4JD9A 1B1GA 4JQ0D 4NDCA 3B88A 5TNCA 2KSPA 2ZNDA 3CZ1A 3O6BA 3OBVA 1QASA 2M7LA 3I5IB 4OZDA 1TIZA 2BNXA 3I5FB 5KU1A 3EVVA 1N65A 3O4XA 3SG7A 2JPTA 1Y1AA 3DY9A 3BUXB 3IVTA 3SG2A 3E3RA 2HPSA 2JU0A 1B7TZ 3CABA 3H4SE 2LVKA 2LHIA 2OPOA 1CTRA 2KAXA 4OCIA 1K90D 1BU3A 4WRIA 1TCOB 2ZRSA 3F45A 4XJKB 1DJGA 1A75B 1KSOA 1WLMA 2BL0B 3A8RA 2JULA 1SCMC 3DD4A 4NQGA 5FI2A 1JFKA 1PULA 2V53A 1PVBA 3AAKA 3NHIA 2KI6D 3DVEA 4DCKA 1RTP1 1CFPA 4GGFA 3UO9A 5HKWA 1CNPA 1DELA 1KK8C 4PE0A 3BOWB 3SG4A 3PLFB 2LP2A 1ALVA 1GM0A 2JXCA 2K2FA 2M0RA 1TOPA 3GK1A 1IQ5A 1UHJA 1Y1XA 1TN4A 2QDIA 5I2QA 5D3OA 4D1EA 1KFUL 3TUYB 1FF1A 2BBNA 4QJ5B 2KYFA 3DVKA 3JVTC 4HSZA 3TS5C 2L0PA 2GGMA 2M7NA 3L4AA 4U8DA 1SBJA 4GGNA 1H4BA 1DF0A 1FBVA 2JTZA 5DICA 3NSLA 1NCZA 3SIBA 2NXQA 4GGFC 2KBMA 1V1GA 2KOTA 3RM1A 4E68A 1SL7A 1BT6A 2P6BB 1PVAA 2PMYA 1BOCA 1DGUA 5HYDA 3R1VA 3Q8IA 3I5GC 3SS4A 4PALA 1Y0VH 3VGOA 1XK4C 2WNDA 1JF2A 1B8LA 2LLTA 1XFYO 2I18A 2M3WA 2AUCA 1MUXA 1LA3A 1MF8B 2I7AA 2TN4A 1FI5A 1K9KA 1BMOA 2BKHB 1CM1A 2FCDA 1F55A 5BPJA 1XFVO 2WCKA 3FWBA 1K95A 4DRWA 1DJZA 1A4PA 1TCFA 1LS8A 2KNEA 1GQMA 1KFXL 1BR1B 1SMGA 2B1UA 3NHTA 3VROA 1UHNA 3EK7A 2LANA 1M31A 3CDNA 1A03A 3LK1A 1UP5A 1AVSA 5I8NA 3D0YA 1B9AA 3CS1A 4PT1A 3QMEA 1KQMC 1YTZC 1YX8A 4MSPA 3S0FA 1NX0A 3OX5A 4ZCVA 2QEBA 2CBLA 1YR5A 3SG6A 1J7RA 3B7AA 1IJ6A 1YUSA 4JKTA 1CB1A 1IRJA 4HRGA 1W7IB 2LVVA 3JTDC 3A4UB 2PALA 1XFUO 1DT7B 1DEKA 2OTGB 5CPVA 2KHNA 1WDCB 1F8HA 1SRAA 1WRLA 3HCMA 1QWVA 2EHBA 1BJFA 1S6CA 2KBIA 2ZN9A 5HKYA 1UURA 3K21A 2L4IA 2LP3A 4P2YB 3VRQA 1CKKA 2F3YA 1C7WA 1K9UA 4OVNF 3SS5A 3PALA 1Q80A 4MLWA 1W7JB 4CPVA 1F54A 2ISDA 2K7BA 3RZSA 2LNKA 3R1OA 2M1KB 1M63B 1KWOB 2JT3A 4MRXA 1XFWO 4XJKA 1A75A 2JOJA 2KLDA 3DZTA 3OP0A 4YGEB 1L2OC 4YI9A 4UPGA 1C07A 3SS3A 2L4HA 2LVIA 1MHOA 2KFHA 2Y1MA 4ORBB 4A4CA 1QIVA 3I5HB 3RLZA 3FE9A 1B8RA 1M39A 1YVLA 2FCEA 3D10A 4YI8A 1ZUZA 1CDPA 1OOHA 2HF5A 1J7OA 1YVHA 3BOWA 4TNCA 2CCMA 2M1UA 3I5IC 1TUJA 3I5FC 4M2PA 5DKNA 2Y4QA 1MQ1A 2LE9B 1SYMA 2BKIB 4BY4A 1CM4A 1RECA 4PCWA 4INWA 1F4OA 2AMIA 2PRUA 1OW4A 2WCJA 1F71A 4HREE 4CIDA 1XVJA 1AJ5A 1XO5A 2BL0C 1JUOA 1YRUB 2NCOA 2GGZA 1VRKA 2JTTA 2IS9A 2M29A 1AUIB 1CFFA 1N2DA 1SNLA 3D74A 3KO0A 1FW4A 1F70A 4CFRA 1EG4A 3GOFA 1K94A 3S0AA 1WLZA 1C7VA 3VRNA 1OZSA 3D73A 4YRUA 1M46A 2JC2A 2BAPA 3LL8B 1NCXA 3PFVA 4WQ3A 1K8UA 3KEVA 1PK0D 2FOTA 2MA2A 1U5IB 2KFFA 2Q91A 4GNKB 1B8CA 4OR9B 3OB2B 5DKRA 1GJYA 3CZ2A 5JOLA 2KPHA 2WCMA 3LCPC 3TZ1A 1SCVA 1S6JA 2ZN8A 3TUYC 4CLNA 1W9ZA 2FJYA 3BFBA 4IL1A 1ZFSA 4YGDB 1K2HA 2G2BA 2LM5A 3BUNB 4AQJA 5HKZA 1JF0A 1NX2A 2SCPA 1NYAA 3IQOA 2SASA 2I94A 1IKUA 4PHKA 1YURA 2F33A 2LHLA 2WCEA 1ALWA 1HQVA 4OKHA 3TDUA 3DVMA 1EXRA 1V1FA 2K2AA 4I5JA 2PASA 1KK7Y 5HLOA 3NSIA 2JNXA 3D75A 3DXLA 3K1EA 4M2OA 4MVFA 3WNXB 1ZACA 2BBMA 3OHMB 1S5GY 1DJHA 3UNWA 1WY9A 2O60A 1NUBA 1UUSA 3LK0A 1OOIX 4YBHB 3EK8A 2ZNEA 1H8BA 1KCYA 2M9GA 4FQTA 2Y5IA 2LV7A 3PSRA 4PE1A 1Z4HA 2L50A 3R1PA 3KHEA 1AP4A 3CZ0A 4MZLA 4AOMA 1PRWA 2EC6C 3FIAA 3NSOA 4CFQA 2WORA 1KK7Z 1OOFA 3CTNA 3NGVA 5CSIA 3OX6A 1TNWA 2WCHA 4KYNA 5D69A 3TDIA 1PSBA 1S5GZ 2F2PA 3JVTB 5CSFA 1YUUA 2L98A 2M97A 1QX5B 4YGCB 1A29A 1MWNA 2E6WA 3L47A 4HRHA 2ZKMX 1EJ3A 1MXLC 3S0EA 2MBXA 3CLNA 5AEQA 1OOGA 3SG5A 1R6PA 2KGRA 5HLVA 1OMVA 3HX4A 1EG3A 4JWQA 1HT9A 5FI7A 5ER5A 1CDMA 4AQIA 2L2EA 1OE9B 2QEVA 3FE6A 2JRFA 1RFJA 1JC2A 1LKJA 2LUXA 2OTGC 4Q04A 1WDCC 4GPLB 3SIAA 1J7PA 2L5YA 2LC5A 4A4BA 3BJHA 1NPQA 4JPZB 2WCFA 3B87A 1ZMZA 2JNFA 2JPOA 1FPWA 1K9PA 4N5XA 1NSHA 2A4JA 2O5GA 1QV0A 1S3PA 4MEWA 4WQ2A 3IQQA 4NDBA 5FI6A 4PE7A 2BCXA 2Q4UA 1NX1A 4ZCUA 1BLQA 2Y1NA 1M45A 3VRPA 3C1VA 4PHJA 1QTXA 1SR6B 1OMDA 1D1OA 1KWOC 3CR2A 2OS8C 1SL9A 2VRGA 4GAOA 3WHTB 1KFUS 2WOSA 2LUCA 4N1GA 1DGVA 2LCPA 3I5HC 1RJVA 1SY9A 3PM8A 3MSEB 4I5NB 1QV1A 4F0ZB 3O2PA 2KAVA 1AK8A 1CDNA 2BE4A 3CR5X 2YGUA 1QS7A 3N7HA 5CSJA 2GTEA 2K60A 2BECA 3O78A 2F8PA 4GUKA 2BCAA 4PHMA 1EH2A 5AFPA 3FE8A 2NLNA 3FWCA 3D77A 1N0YA 1NCYA 2KI4B 1TUZA 3DF0B 1RWYA 1SSEB 1YRTB 1U5IA 1FI6A 3GK2A 5GQQC 5KTYA 2E30A 3ICBA 2K7OA 4YGBB 2I2RE 1CLLA 1QJTA 1OSAA 5AXIA 4MN0A 3WHUB 2ZFDA 1SW8A 1XFXO 3D0YB 4L9MA 4C0KA 4PHNA 3EKHA 2EGDA 2CTNA 1G4YR 1NP8A 1JFJA 1IH0A 5JJGA 2WCLA 2BE6A 1IG5A 3ZNIA 3B86A 1OZOA 1KFXS 2PSRA 4ICBA 1B47A 5I2OA 3BFHA 2HQ8A 2WC5A 1J1DA 3S0BA 5HL1A 2M49B 2D8NA 1QX2A 1OOJA 2CNPA 1DJXA 2LMTA 1AJ4A 1KSMA 2NZ0A 3PN7B 1X02A 1XA5A 3EKJA 3KPXA 2KAYA 1IGVA 1TNXA 3AAJA 3DYEA 1SL8A 1GGWA 4MZKA 2KFGA 3L4LA 5FYXA 1BODA 1C3YA 4USLA 1L7ZA 1CDLA 2HETA 1BF5A 3BQ3A 3EK4A 1J7QA 3CR4X 3IF7A 1G33A 1CMGA 2KI6C 2K7CA 1DJIA 2LMVA 1SKTA 3EG5B 3D76A 4ORCB 2MAZA 3BUWB 3FS7A 1YUTA 1DC1A 2JT8A 3R72A 5EL2A 1OQPA 2P71A 4R1EA 2L51A 1QLKA 1C3ZA 2LLUA 3S0DA 2MJWB 2H2KA 2MHHA 1NX3A 1DJWA 4INXA 1NIWA 1G8IA 2KGBC 2KYCA 2MRDA 1WRZA 1MR8A 1R2UA 1SCMB 1DTLA 3NXAA 2H61A 2LAPA 2CT9A 2KDHA 5G08A 3QRXA 1ORGA 1ZOTB 3WXAA 1XK4A 1S26D 2NCPA 5KSZA 1KK8B 3BXKA 3VB1A 2HQWA 2PYQA 1E8AA 3PATA 2COLB 4BY5A 1SK6D
chains in the Genus database with same CATH topology
1CLMA 2JQ6A 3OB1B 2L5XB 2JT0A 1BR4B 3M0WA 2G9BA 2KQ6A 1IJ5A 1EL4A 4I5KA 2LLSA 1Y1UA 1DVIA 3GK4X 1JWDA 4OV2A 2K61A 2CXJA 4GBAA 1RROA 3VRRA 1QATA 2WC8A 4PE4A 3TS5B 1J55A 1QXPA 2H61C 3EVRA 2JWWA 5J3XA 3TDZA 5D7FA 4ETOA 3AKBA 3O4YA 1SPYA 3BYAA 1QX7A 3CGAA 1B4CA 3I5GB 2JZIA 1IWQA 3LLEA 4FQOA 4M2QA 1PALA 1UWOA 5AERA 1TNQA 1QIWA 3CZTX 2JXLA 1BG1A 4DIRA 4N1FA 1J1EA 1TRFA 1MXEA 2BCBA 5ER4X 4I5LB 3DF0A 1LXFC 2EC6B 4P5OE 1OMRA 3BUMB 4YGAA 1IQ3A 4MRYA 1S6IA 2MLFC 1CMFA 1SR6C 2GV5A 3SJSA 4XYNA 2WCBA 1UHHA 1DF0B 2R2IA 3SG3A 5IBWA 1K93D 1Y6WA 5AANA 1GGZA 5K89A 2F2OA 3BUOB 1KQMB 1DJYA 5I2LA 4DUQA 1TNPA 1YX7A 1K96A 1LVCD 1JSAA 4GFTA 1S1EA 1PSRA 1JBAA 2KI4C 3JTDB 2QACA 2QPTA 4MZJA 4C0JA 1AHRA 2K7DA 1QVIY 2LVJA 4C0LA 4PDZA 5DKQA 3NSKA 3DVJA 2FJUB 1KQVA 1LA0A 1F4QA 1ODBA 4ORAB 5PALA 1TTXA 4FTGA 3AKAA 1LINA 1UHKA 1XFZO 4QJ4B 4MBEA 1A2XA 2K0JA 5CSNA 2AAOA 2KQYA 3CWGA 2MLEC 3KF9A 3ZWHA 2OS8B 5B8IB 1QVIZ 4QJ3B 2M8UA 1WRKA 3EVUA 2LMUA 2PVBA 5F6TA 3PN7C 4NDDA 2F3ZA 1CLBA 1L2OB 1CFDA 2ZRTA 1NWDA 1QLSA 2K8MB 2RGIA 1S36A 2DOQA 1B7TY 1RK9A 1CFCA 1DMOA 1XYDA 1UHIA 4DS7A 1B1GA 4JQ0D 4NDCA 5TNCA 2KSPA 2ZNDA 3O6BA 1QASA 2M7LA 3I5IB 1TIZA 3I5FB 5KU1A 3EVVA 1N65A 3SG7A 2JPTA 1Y1AA 3BUXB 3SG2A 3E3RA 2HPSA 2JU0A 1B7TZ 3H4SE 2LVKA 2LHIA 2OPOA 1CTRA 2KAXA 4OCIA 1K90D 1BU3A 4WRIA 1TCOB 2ZRSA 3F45A 4XJKB 1DJGA 1A75B 1KSOA 1WLMA 2BL0B 3A8RA 2JULA 1SCMC 3DD4A 4NQGA 1JFKA 1PULA 2V53A 1PVBA 3AAKA 2KI6D 3DVEA 4DCKA 1RTP1 1CFPA 4GGFA 5HKWA 1CNPA 1KK8C 3BOWB 3SG4A 3PLFB 2LP2A 1ALVA 2JXCA 2K2FA 2M0RA 1TOPA 3GK1A 1IQ5A 1UHJA 1Y1XA 1TN4A 5I2QA 4D1EA 1KFUL 3TUYB 1FF1A 2BBNA 4QJ5B 2KYFA 3DVKA 3JVTC 4HSZA 3TS5C 2L0PA 2GGMA 2M7NA 4U8DA 1SBJA 4GGNA 1H4BA 1DF0A 1FBVA 2JTZA 3NSLA 1NCZA 3SIBA 2NXQA 4GGFC 2KBMA 1V1GA 2KOTA 3RM1A 4E68A 1SL7A 1BT6A 2P6BB 1PVAA 2PMYA 1BOCA 1DGUA 5HYDA 3I5GC 4PALA 1Y0VH 3VGOA 1XK4C 2WNDA 1JF2A 1B8LA 2LLTA 1XFYO 2I18A 2M3WA 2AUCA 1MUXA 1LA3A 1MF8B 2I7AA 2TN4A 1FI5A 2BKHB 1BMOA 1K9KA 1CM1A 2FCDA 1F55A 5BPJA 1XFVO 3FWBA 1K95A 4DRWA 1DJZA 1A4PA 1TCFA 2KNEA 1GQMA 1KFXL 1BR1B 1SMGA 2B1UA 3VROA 1UHNA 3EK7A 2LANA 1M31A 1A03A 3LK1A 1UP5A 1AVSA 5I8NA 3D0YA 1B9AA 3CS1A 1KQMC 1YTZC 1YX8A 4MSPA 1NX0A 3OX5A 4ZCVA 2CBLA 1YR5A 3SG6A 1J7RA 1CB1A 1IJ6A 1YUSA 1IRJA 4HRGA 1W7IB 2LVVA 3JTDC 3A4UB 2PALA 1XFUO 1DT7B 2OTGB 5CPVA 2KHNA 1WDCB 1F8HA 1SRAA 1WRLA 3HCMA 2EHBA 1BJFA 1S6CA 2KBIA 2ZN9A 5HKYA 1UURA 3K21A 2L4IA 2LP3A 4P2YB 3VRQA 1CKKA 2F3YA 1C7WA 1K9UA 4OVNF 3PALA 1Q80A 4MLWA 1W7JB 4CPVA 1F54A 2ISDA 2K7BA 2LNKA 2M1KB 1M63B 1KWOB 2JT3A 4MRXA 1XFWO 4XJKA 1A75A 2JOJA 3OP0A 4YGEB 4UPGA 1C07A 1L2OC 4YI9A 2L4HA 2LVIA 1MHOA 2KFHA 2Y1MA 4ORBB 4A4CA 1QIVA 3I5HB 3RLZA 1B8RA 1M39A 1YVLA 2FCEA 3D10A 4YI8A 1ZUZA 1CDPA 2HF5A 1J7OA 1YVHA 3BOWA 4TNCA 2CCMA 2M1UA 3I5IC 3I5FC 4M2PA 5DKNA 2Y4QA 1MQ1A 2LE9B 1SYMA 2BKIB 4BY4A 1CM4A 1RECA 4PCWA 1F4OA 2AMIA 2PRUA 1F71A 4HREE 4CIDA 1XVJA 1AJ5A 1XO5A 2BL0C 1JUOA 1YRUB 2NCOA 2GGZA 1VRKA 2JTTA 2IS9A 2M29A 1AUIB 1CFFA 1N2DA 1SNLA 3KO0A 1FW4A 1F70A 4CFRA 1EG4A 3GOFA 1K94A 1WLZA 1C7VA 3VRNA 1OZSA 4YRUA 1M46A 2JC2A 3LL8B 1NCXA 3PFVA 4WQ3A 1K8UA 3KEVA 1PK0D 2FOTA 2MA2A 1U5IB 2KFFA 2Q91A 4GNKB 1B8CA 4OR9B 3OB2B 5DKRA 1GJYA 5JOLA 3LCPC 3TZ1A 1SCVA 1S6JA 2ZN8A 3TUYC 4CLNA 4IL1A 4YGDB 1ZFSA 1K2HA 2G2BA 2LM5A 3BUNB 4AQJA 5HKZA 1JF0A 1NX2A 2SCPA 1NYAA 3IQOA 2SASA 2I94A 1IKUA 4PHKA 1YURA 2F33A 2LHLA 2WCEA 1ALWA 1HQVA 4OKHA 3TDUA 3DVMA 1EXRA 1V1FA 2K2AA 4I5JA 2PASA 1KK7Y 5HLOA 3NSIA 2JNXA 4M2OA 3WNXB 4MVFA 1ZACA 2BBMA 3OHMB 1S5GY 1DJHA 1WY9A 2O60A 1NUBA 1UUSA 3LK0A 4YBHB 3EK8A 2ZNEA 1H8BA 1KCYA 2M9GA 2Y5IA 2LV7A 3PSRA 4PE1A 2L50A 1AP4A 3KHEA 4MZLA 4AOMA 1PRWA 2EC6C 3FIAA 3NSOA 4CFQA 2WORA 1KK7Z 5D69A 3CTNA 5CSIA 3OX6A 1TNWA 3TDIA 1PSBA 1S5GZ 2F2PA 3JVTB 5CSFA 1YUUA 2L98A 2M97A 1QX5B 4YGCB 1A29A 1MWNA 2E6WA 4HRHA 2ZKMX 1EJ3A 1MXLC 2MBXA 3CLNA 5AEQA 3SG5A 1R6PA 2KGRA 5HLVA 1OMVA 3HX4A 1EG3A 4JWQA 1HT9A 4AQIA 5ER5A 1CDMA 2L2EA 1OE9B 2JRFA 1RFJA 1JC2A 1LKJA 2LUXA 2OTGC 4Q04A 1WDCC 4GPLB 3SIAA 1J7PA 2LC5A 4A4BA 1NPQA 4JPZB 2WCFA 1ZMZA 2JNFA 1FPWA 1K9PA 4N5XA 1NSHA 2A4JA 2O5GA 1QV0A 1S3PA 4MEWA 4WQ2A 3IQQA 4NDBA 4PE7A 2BCXA 2Q4UA 1NX1A 4ZCUA 1BLQA 2Y1NA 1M45A 3VRPA 3C1VA 4PHJA 1QTXA 1SR6B 1OMDA 1D1OA 1KWOC 3CR2A 2OS8C 1SL9A 2VRGA 4GAOA 3WHTB 1KFUS 2WOSA 2LUCA 4N1GA 1DGVA 2LCPA 3I5HC 1RJVA 1SY9A 3PM8A 3MSEB 4I5NB 1QV1A 4F0ZB 3O2PA 2KAVA 1AK8A 1CDNA 2BE4A 3CR5X 1QS7A 5CSJA 3O78A 2BECA 4GUKA 2F8PA 2BCAA 4PHMA 1EH2A 5AFPA 2NLNA 3FWCA 1N0YA 1NCYA 2KI4B 3DF0B 1RWYA 1YRTB 1U5IA 1FI6A 3GK2A 5GQQC 5KTYA 2E30A 3ICBA 2K7OA 4YGBB 2I2RE 1CLLA 1QJTA 1OSAA 5AXIA 4MN0A 3WHUB 2ZFDA 1SW8A 1XFXO 3D0YB 4L9MA 4C0KA 4PHNA 3EKHA 2EGDA 2CTNA 1G4YR 1NP8A 1JFJA 1IH0A 5JJGA 2BE6A 1IG5A 3ZNIA 1OZOA 1KFXS 2PSRA 4ICBA 1B47A 5I2OA 2HQ8A 1J1DA 2M49B 2D8NA 1QX2A 1OOJA 2CNPA 1DJXA 2LMTA 1AJ4A 1KSMA 2NZ0A 3PN7B 1X02A 1XA5A 3EKJA 3KPXA 2KAYA 1IGVA 1TNXA 3AAJA 1SL8A 1GGWA 4MZKA 2KFGA 5FYXA 1BODA 4USLA 1L7ZA 1CDLA 2HETA 1BF5A 3BQ3A 3EK4A 1J7QA 3CR4X 3IF7A 1G33A 1CMGA 2KI6C 2K7CA 1DJIA 2LMVA 1SKTA 4ORCB 2MAZA 3BUWB 3FS7A 1YUTA 2JT8A 1OQPA 4R1EA 2L51A 1QLKA 2LLUA 2MJWB 2H2KA 2MHHA 1NX3A 1DJWA 1NIWA 1G8IA 2KGBC 2KYCA 2MRDA 1WRZA 1MR8A 1R2UA 1SCMB 1DTLA 3NXAA 2H61A 2LAPA 2CT9A 2KDHA 5G08A 3QRXA 1ZOTB 3WXAA 1XK4A 1S26D 2NCPA 5KSZA 1KK8B 3BXKA 4BY5A 2HQWA 3PATA 1E8AA 4PE0A 2COLB 1SK6D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CLM A;  2JQ6 A;  3OB1 B;  2L5X B;  2JT0 A;  1BR4 B;  3M0W A;  2G9B A;  2KQ6 A;  1IJ5 A;  1EL4 A;  4I5K A;  2LLS A;  1Y1U A;  1DVI A;  3GK4 X;  1JWD A;  4OV2 A;  2K61 A;  2CXJ A;  4GBA A;  1RRO A;  3VRR A;  1QAT A;  2WC8 A;  4PE4 A;  3TS5 B;  1J55 A;  1QXP A;  2H61 C;  3EVR A;  2JWW A;  5J3X A;  3TDZ A;  5D7F A;  4ETO A;  3AKB A;  3O4Y A;  1SPY A;  3BYA A;  1QX7 A;  3CGA A;  1B4C A;  3I5G B;  2JZI A;  1IWQ A;  3LLE A;  4FQO A;  4M2Q A;  1PAL A;  1UWO A;  5AER A;  1TNQ A;  1QIW A;  3CZT X;  2JXL A;  1BG1 A;  4DIR A;  4N1F A;  1J1E A;  1TRF A;  1MXE A;  2BCB A;  5ER4 X;  4I5L B;  3DF0 A;  1LXF C;  2EC6 B;  4P5O E;  1OMR A;  3BUM B;  4YGA A;  1IQ3 A;  4MRY A;  1S6I A;  2MLF C;  1CMF A;  1SR6 C;  2GV5 A;  3SJS A;  4XYN A;  2WCB A;  1UHH A;  1DF0 B;  2R2I A;  3SG3 A;  5IBW A;  1K93 D;  1Y6W A;  5AAN A;  1GGZ A;  5K89 A;  2F2O A;  3BUO B;  1KQM B;  1DJY A;  5I2L A;  4DUQ A;  1TNP A;  1YX7 A;  1K96 A;  1LVC D;  1JSA A;  4GFT A;  1S1E A;  1PSR A;  1JBA A;  2KI4 C;  3JTD B;  2QAC A;  2QPT A;  4MZJ A;  4C0J A;  1AHR A;  2K7D A;  1QVI Y;  2LVJ A;  4C0L A;  4PDZ A;  5DKQ A;  3NSK A;  3DVJ A;  2FJU B;  1KQV A;  1LA0 A;  1F4Q A;  1ODB A;  4ORA B;  5PAL A;  1TTX A;  4FTG A;  3AKA A;  1LIN A;  1UHK A;  1XFZ O;  4QJ4 B;  4MBE A;  1A2X A;  2K0J A;  5CSN A;  2AAO A;  2KQY A;  3CWG A;  2MLE C;  3KF9 A;  3ZWH A;  2OS8 B;  5B8I B;  1QVI Z;  4QJ3 B;  2M8U A;  1WRK A;  3EVU A;  2LMU A;  2PVB A;  5F6T A;  3PN7 C;  4NDD A;  2F3Z A;  1CLB A;  1L2O B;  1CFD A;  2ZRT A;  1NWD A;  1QLS A;  2K8M B;  2RGI A;  1S36 A;  2DOQ A;  1B7T Y;  1RK9 A;  1CFC A;  1DMO A;  1XYD A;  1UHI A;  4DS7 A;  1B1G A;  4JQ0 D;  4NDC A;  5TNC A;  2KSP A;  2ZND A;  3O6B A;  1QAS A;  2M7L A;  3I5I B;  1TIZ A;  3I5F B;  5KU1 A;  3EVV A;  1N65 A;  3SG7 A;  2JPT A;  1Y1A A;  3BUX B;  3SG2 A;  3E3R A;  2HPS A;  2JU0 A;  1B7T Z;  3H4S E;  2LVK A;  2LHI A;  2OPO A;  1CTR A;  2KAX A;  4OCI A;  1K90 D;  1BU3 A;  4WRI A;  1TCO B;  2ZRS A;  3F45 A;  4XJK B;  1DJG A;  1A75 B;  1KSO A;  1WLM A;  2BL0 B;  3A8R A;  2JUL A;  1SCM C;  3DD4 A;  4NQG A;  1JFK A;  1PUL A;  2V53 A;  1PVB A;  3AAK A;  2KI6 D;  3DVE A;  4DCK A;  1RTP 1;  1CFP A;  4GGF A;  5HKW A;  1CNP A;  1KK8 C;  3BOW B;  3SG4 A;  3PLF B;  2LP2 A;  1ALV A;  2JXC A;  2K2F A;  2M0R A;  1TOP A;  3GK1 A;  1IQ5 A;  1UHJ A;  1Y1X A;  1TN4 A;  5I2Q A;  4D1E A;  1KFU L;  3TUY B;  1FF1 A;  2BBN A;  4QJ5 B;  2KYF A;  3DVK A;  3JVT C;  4HSZ A;  3TS5 C;  2L0P A;  2GGM A;  2M7N A;  4U8D A;  1SBJ A;  4GGN A;  1H4B A;  1DF0 A;  1FBV A;  2JTZ A;  3NSL A;  1NCZ A;  3SIB A;  2NXQ A;  4GGF C;  2KBM A;  1V1G A;  2KOT A;  3RM1 A;  4E68 A;  1SL7 A;  1BT6 A;  2P6B B;  1PVA A;  2PMY A;  1BOC A;  1DGU A;  5HYD A;  3I5G C;  4PAL A;  1Y0V H;  3VGO A;  1XK4 C;  2WND A;  1JF2 A;  1B8L A;  2LLT A;  1XFY O;  2I18 A;  2M3W A;  2AUC A;  1MUX A;  1LA3 A;  1MF8 B;  2I7A A;  2TN4 A;  1FI5 A;  2BKH B;  1BMO A;  1K9K A;  1CM1 A;  2FCD A;  1F55 A;  5BPJ A;  1XFV O;  3FWB A;  1K95 A;  4DRW A;  1DJZ A;  1A4P A;  1TCF A;  2KNE A;  1GQM A;  1KFX L;  1BR1 B;  1SMG A;  2B1U A;  3VRO A;  1UHN A;  3EK7 A;  2LAN A;  1M31 A;  1A03 A;  3LK1 A;  1UP5 A;  1AVS A;  5I8N A;  3D0Y A;  1B9A A;  3CS1 A;  1KQM C;  1YTZ C;  1YX8 A;  4MSP A;  1NX0 A;  3OX5 A;  4ZCV A;  2CBL A;  1YR5 A;  3SG6 A;  1J7R A;  1CB1 A;  1IJ6 A;  1YUS A;  1IRJ A;  4HRG A;  1W7I B;  2LVV A;  3JTD C;  3A4U B;  2PAL A;  1XFU O;  1DT7 B;  2OTG B;  5CPV A;  2KHN A;  1WDC B;  1F8H A;  1SRA A;  1WRL A;  3HCM A;  2EHB A;  1BJF A;  1S6C A;  2KBI A;  2ZN9 A;  5HKY A;  1UUR A;  3K21 A;  2L4I A;  2LP3 A;  4P2Y B;  3VRQ A;  1CKK A;  2F3Y A;  1C7W A;  1K9U A;  4OVN F;  3PAL A;  1Q80 A;  4MLW A;  1W7J B;  4CPV A;  1F54 A;  2ISD A;  2K7B A;  2LNK A;  2M1K B;  1M63 B;  1KWO B;  2JT3 A;  4MRX A;  1XFW O;  4XJK A;  1A75 A;  2JOJ A;  3OP0 A;  4YGE B;  4UPG A;  1C07 A;  1L2O C;  4YI9 A;  2L4H A;  2LVI A;  1MHO A;  2KFH A;  2Y1M A;  4ORB B;  4A4C A;  1QIV A;  3I5H B;  3RLZ A;  1B8R A;  1M39 A;  1YVL A;  2FCE A;  3D10 A;  4YI8 A;  1ZUZ A;  1CDP A;  2HF5 A;  1J7O A;  1YVH A;  3BOW A;  4TNC A;  2CCM A;  2M1U A;  3I5I C;  3I5F C;  4M2P A;  5DKN A;  2Y4Q A;  1MQ1 A;  2LE9 B;  1SYM A;  2BKI B;  4BY4 A;  1CM4 A;  1REC A;  4PCW A;  1F4O A;  2AMI A;  2PRU A;  1F71 A;  4HRE E;  4CID A;  1XVJ A;  1AJ5 A;  1XO5 A;  2BL0 C;  1JUO A;  1YRU B;  2NCO A;  2GGZ A;  1VRK A;  2JTT A;  2IS9 A;  2M29 A;  1AUI B;  1CFF A;  1N2D A;  1SNL A;  3KO0 A;  1FW4 A;  1F70 A;  4CFR A;  1EG4 A;  3GOF A;  1K94 A;  1WLZ A;  1C7V A;  3VRN A;  1OZS A;  4YRU A;  1M46 A;  2JC2 A;  3LL8 B;  1NCX A;  3PFV A;  4WQ3 A;  1K8U A;  3KEV A;  1PK0 D;  2FOT A;  2MA2 A;  1U5I B;  2KFF A;  2Q91 A;  4GNK B;  1B8C A;  4OR9 B;  3OB2 B;  5DKR A;  1GJY A;  5JOL A;  3LCP C;  3TZ1 A;  1SCV A;  1S6J A;  2ZN8 A;  3TUY C;  4CLN A;  4IL1 A;  4YGD B;  1ZFS A;  1K2H A;  2G2B A;  2LM5 A;  3BUN B;  4AQJ A;  5HKZ A;  1JF0 A;  1NX2 A;  2SCP A;  1NYA A;  3IQO A;  2SAS A;  2I94 A;  1IKU A;  4PHK A;  1YUR A;  2F33 A;  2LHL A;  2WCE A;  1ALW A;  1HQV A;  4OKH A;  3TDU A;  3DVM A;  1EXR A;  1V1F A;  2K2A A;  4I5J A;  2PAS A;  1KK7 Y;  5HLO A;  3NSI A;  2JNX A;  4M2O A;  3WNX B;  4MVF A;  1ZAC A;  2BBM A;  3OHM B;  1S5G Y;  1DJH A;  1WY9 A;  2O60 A;  1NUB A;  1UUS A;  3LK0 A;  4YBH B;  3EK8 A;  2ZNE A;  1H8B A;  1KCY A;  2M9G A;  2Y5I A;  2LV7 A;  3PSR A;  4PE1 A;  2L50 A;  1AP4 A;  3KHE A;  4MZL A;  4AOM A;  1PRW A;  2EC6 C;  3FIA A;  3NSO A;  4CFQ A;  2WOR A;  1KK7 Z;  5D69 A;  3CTN A;  5CSI A;  3OX6 A;  1TNW A;  3TDI A;  1PSB A;  1S5G Z;  2F2P A;  3JVT B;  5CSF A;  1YUU A;  2L98 A;  2M97 A;  1QX5 B;  4YGC B;  1A29 A;  1MWN A;  2E6W A;  4HRH A;  2ZKM X;  1EJ3 A;  1MXL C;  2MBX A;  3CLN A;  5AEQ A;  3SG5 A;  1R6P A;  2KGR A;  5HLV A;  1OMV A;  3HX4 A;  1EG3 A;  4JWQ A;  1HT9 A;  4AQI A;  5ER5 A;  1CDM A;  2L2E A;  1OE9 B;  2JRF A;  1RFJ A;  1JC2 A;  1LKJ A;  2LUX A;  2OTG C;  4Q04 A;  1WDC C;  4GPL B;  3SIA A;  1J7P A;  2LC5 A;  4A4B A;  1NPQ A;  4JPZ B;  2WCF A;  1ZMZ A;  2JNF A;  1FPW A;  1K9P A;  4N5X A;  1NSH A;  2A4J A;  2O5G A;  1QV0 A;  1S3P A;  4MEW A;  4WQ2 A;  3IQQ A;  4NDB A;  4PE7 A;  2BCX A;  2Q4U A;  1NX1 A;  4ZCU A;  1BLQ A;  2Y1N A;  1M45 A;  3VRP A;  3C1V A;  4PHJ A;  1QTX A;  1SR6 B;  1OMD A;  1D1O A;  1KWO C;  3CR2 A;  2OS8 C;  1SL9 A;  2VRG A;  4GAO A;  3WHT B;  1KFU S;  2WOS A;  2LUC A;  4N1G A;  1DGV A;  2LCP A;  3I5H C;  1RJV A;  1SY9 A;  3PM8 A;  3MSE B;  4I5N B;  1QV1 A;  4F0Z B;  3O2P A;  2KAV A;  1AK8 A;  1CDN A;  2BE4 A;  3CR5 X;  1QS7 A;  5CSJ A;  3O78 A;  2BEC A;  4GUK A;  2F8P A;  2BCA A;  4PHM A;  1EH2 A;  5AFP A;  2NLN A;  3FWC A;  1N0Y A;  1NCY A;  2KI4 B;  3DF0 B;  1RWY A;  1YRT B;  1U5I A;  1FI6 A;  3GK2 A;  5GQQ C;  5KTY A;  2E30 A;  3ICB A;  2K7O A;  4YGB B;  2I2R E;  1CLL A;  1QJT A;  1OSA A;  5AXI A;  4MN0 A;  3WHU B;  2ZFD A;  1SW8 A;  1XFX O;  3D0Y B;  4L9M A;  4C0K A;  4PHN A;  3EKH A;  2EGD A;  2CTN A;  1G4Y R;  1NP8 A;  1JFJ A;  1IH0 A;  5JJG A;  2BE6 A;  1IG5 A;  3ZNI A;  1OZO A;  1KFX S;  2PSR A;  4ICB A;  1B47 A;  5I2O A;  2HQ8 A;  1J1D A;  2M49 B;  2D8N A;  1QX2 A;  1OOJ A;  2CNP A;  1DJX A;  2LMT A;  1AJ4 A;  1KSM A;  2NZ0 A;  3PN7 B;  1X02 A;  1XA5 A;  3EKJ A;  3KPX A;  2KAY A;  1IGV A;  1TNX A;  3AAJ A;  1SL8 A;  1GGW A;  4MZK A;  2KFG A;  5FYX A;  1BOD A;  4USL A;  1L7Z A;  1CDL A;  2HET A;  1BF5 A;  3BQ3 A;  3EK4 A;  1J7Q A;  3CR4 X;  3IF7 A;  1G33 A;  1CMG A;  2KI6 C;  2K7C A;  1DJI A;  2LMV A;  1SKT A;  4ORC B;  2MAZ A;  3BUW B;  3FS7 A;  1YUT A;  2JT8 A;  1OQP A;  4R1E A;  2L51 A;  1QLK A;  2LLU A;  2MJW B;  2H2K A;  2MHH A;  1NX3 A;  1DJW A;  1NIW A;  1G8I A;  2KGB C;  2KYC A;  2MRD A;  1WRZ A;  1MR8 A;  1R2U A;  1SCM B;  1DTL A;  3NXA A;  2H61 A;  2LAP A;  2CT9 A;  2KDH A;  5G08 A;  3QRX A;  1ZOT B;  3WXA A;  1XK4 A;  1S26 D;  2NCP A;  5KSZ A;  1KK8 B;  3BXK A;  4BY5 A;  2HQW A;  3PAT A;  1E8A A;  4PE0 A;  2COL B;  1SK6 D; 
#chains in the Genus database with same CATH topology
 1CLM A;  2JQ6 A;  3OB1 B;  1IIO A;  2L5X B;  2JT0 A;  1BR4 B;  3M0W A;  1T14 A;  2G9B A;  2KQ6 A;  1IJ5 A;  1EL4 A;  4I5K A;  2LLS A;  1Y1U A;  1DVI A;  3BFA A;  3GK4 X;  1JWD A;  3CYZ A;  2H8V A;  4OV2 A;  2K61 A;  2CXJ A;  4GBA A;  3S0G A;  1RRO A;  3VRR A;  1QAT A;  2WC8 A;  4PE4 A;  3TS5 B;  1J55 A;  1TWO A;  1QXP A;  2H61 C;  3EVR A;  2JWW A;  5J3X A;  3TDZ A;  5D7F A;  4ETO A;  3AKB A;  3O4Y A;  1SPY A;  3BYA A;  1QX7 A;  3PM2 A;  3CGA A;  1B4C A;  3I5G B;  2JZI A;  1IWQ A;  2QEO A;  3LLE A;  4FQO A;  4M2Q A;  1PAL A;  1UWO A;  5AER A;  1TNQ A;  1QIW A;  3CZT X;  2JXL A;  3OGN A;  1BG1 A;  4DIR A;  4N1F A;  2P70 A;  1J1E A;  1TRF A;  1MXE A;  2BCB A;  5ER4 X;  4F7F A;  4I5L B;  3DF0 A;  1LXF C;  2EC6 B;  4P5O E;  1OMR A;  3BUM B;  2ERB A;  4YGA A;  1IQ3 A;  4MRY A;  1S6I A;  2KLE A;  2MLF C;  1CMF A;  1SR6 C;  2GV5 A;  3SJS A;  4XYN A;  4IJ7 A;  2WCB A;  1UHH A;  2PQL A;  1DF0 B;  2R2I A;  3SG3 A;  3PJI A;  5IBW A;  1K93 D;  1Y6W A;  5AAN A;  1GGZ A;  5K89 A;  2F2O A;  1DQE A;  3BUO B;  1KQM B;  1DJY A;  5I94 A;  1P28 A;  5I2L A;  4DUQ A;  1TNP A;  1YX7 A;  1K96 A;  1LVC D;  2L2C A;  4GFT A;  1JSA A;  1S1E A;  1PSR A;  1JBA A;  2QEH A;  2KI4 C;  3JTD B;  2QAC A;  2QPT A;  4MZJ A;  2WC6 A;  4C0J A;  1AHR A;  2K7D A;  3D78 A;  1QVI Y;  2LVJ A;  4C0L A;  4PDZ A;  5DKQ A;  3NSK A;  3DVJ A;  2FJU B;  1KQV A;  1LA0 A;  1F4Q A;  1ODB A;  4ORA B;  5PAL A;  1TTX A;  4FTG A;  3AKA A;  1LIN A;  1UHK A;  1XFZ O;  4QJ4 B;  4MBE A;  1A2X A;  2K0J A;  5CSN A;  2AAO A;  2KQY A;  3CWG A;  2MLE C;  3KF9 A;  3ZWH A;  2OS8 B;  1Z2C B;  5B8I B;  1QVI Z;  1XFR A;  4QJ3 B;  3B6X A;  2M8U A;  1WRK A;  3EVU A;  2LMU A;  2PVB A;  5F6T A;  3PN7 C;  4NDD A;  2F3Z A;  1CLB A;  1L2O B;  1CFD A;  2ZRT A;  1NWD A;  1QLS A;  2K8M B;  2RGI A;  1S36 A;  2DOQ A;  1B7T Y;  1RK9 A;  1CFC A;  3V2L A;  1DMO A;  1XYD A;  1UHI A;  4DS7 A;  4JD9 A;  1B1G A;  4JQ0 D;  4NDC A;  3B88 A;  5TNC A;  2KSP A;  2ZND A;  3CZ1 A;  3O6B A;  3OBV A;  1QAS A;  2M7L A;  3I5I B;  4OZD A;  1TIZ A;  2BNX A;  3I5F B;  5KU1 A;  3EVV A;  1N65 A;  3O4X A;  3SG7 A;  2JPT A;  1Y1A A;  3DY9 A;  3BUX B;  3IVT A;  3SG2 A;  3E3R A;  2HPS A;  2JU0 A;  1B7T Z;  3CAB A;  3H4S E;  2LVK A;  2LHI A;  2OPO A;  1CTR A;  2KAX A;  4OCI A;  1K90 D;  1BU3 A;  4WRI A;  1TCO B;  2ZRS A;  3F45 A;  4XJK B;  1DJG A;  1A75 B;  1KSO A;  1WLM A;  2BL0 B;  3A8R A;  2JUL A;  1SCM C;  3DD4 A;  4NQG A;  5FI2 A;  1JFK A;  1PUL A;  2V53 A;  1PVB A;  3AAK A;  3NHI A;  2KI6 D;  3DVE A;  4DCK A;  1RTP 1;  1CFP A;  4GGF A;  3UO9 A;  5HKW A;  1CNP A;  1DEL A;  1KK8 C;  4PE0 A;  3BOW B;  3SG4 A;  3PLF B;  2LP2 A;  1ALV A;  1GM0 A;  2JXC A;  2K2F A;  2M0R A;  1TOP A;  3GK1 A;  1IQ5 A;  1UHJ A;  1Y1X A;  1TN4 A;  2QDI A;  5I2Q A;  5D3O A;  4D1E A;  1KFU L;  3TUY B;  1FF1 A;  2BBN A;  4QJ5 B;  2KYF A;  3DVK A;  3JVT C;  4HSZ A;  3TS5 C;  2L0P A;  2GGM A;  2M7N A;  3L4A A;  4U8D A;  1SBJ A;  4GGN A;  1H4B A;  1DF0 A;  1FBV A;  2JTZ A;  5DIC A;  3NSL A;  1NCZ A;  3SIB A;  2NXQ A;  4GGF C;  2KBM A;  1V1G A;  2KOT A;  3RM1 A;  4E68 A;  1SL7 A;  1BT6 A;  2P6B B;  1PVA A;  2PMY A;  1BOC A;  1DGU A;  5HYD A;  3R1V A;  3Q8I A;  3I5G C;  3SS4 A;  4PAL A;  1Y0V H;  3VGO A;  1XK4 C;  2WND A;  1JF2 A;  1B8L A;  2LLT A;  1XFY O;  2I18 A;  2M3W A;  2AUC A;  1MUX A;  1LA3 A;  1MF8 B;  2I7A A;  2TN4 A;  1FI5 A;  1K9K A;  1BMO A;  2BKH B;  1CM1 A;  2FCD A;  1F55 A;  5BPJ A;  1XFV O;  2WCK A;  3FWB A;  1K95 A;  4DRW A;  1DJZ A;  1A4P A;  1TCF A;  1LS8 A;  2KNE A;  1GQM A;  1KFX L;  1BR1 B;  1SMG A;  2B1U A;  3NHT A;  3VRO A;  1UHN A;  3EK7 A;  2LAN A;  1M31 A;  3CDN A;  1A03 A;  3LK1 A;  1UP5 A;  1AVS A;  5I8N A;  3D0Y A;  1B9A A;  3CS1 A;  4PT1 A;  3QME A;  1KQM C;  1YTZ C;  1YX8 A;  4MSP A;  3S0F A;  1NX0 A;  3OX5 A;  4ZCV A;  2QEB A;  2CBL A;  1YR5 A;  3SG6 A;  1J7R A;  3B7A A;  1IJ6 A;  1YUS A;  4JKT A;  1CB1 A;  1IRJ A;  4HRG A;  1W7I B;  2LVV A;  3JTD C;  3A4U B;  2PAL A;  1XFU O;  1DT7 B;  1DEK A;  2OTG B;  5CPV A;  2KHN A;  1WDC B;  1F8H A;  1SRA A;  1WRL A;  3HCM A;  1QWV A;  2EHB A;  1BJF A;  1S6C A;  2KBI A;  2ZN9 A;  5HKY A;  1UUR A;  3K21 A;  2L4I A;  2LP3 A;  4P2Y B;  3VRQ A;  1CKK A;  2F3Y A;  1C7W A;  1K9U A;  4OVN F;  3SS5 A;  3PAL A;  1Q80 A;  4MLW A;  1W7J B;  4CPV A;  1F54 A;  2ISD A;  2K7B A;  3RZS A;  2LNK A;  3R1O A;  2M1K B;  1M63 B;  1KWO B;  2JT3 A;  4MRX A;  1XFW O;  4XJK A;  1A75 A;  2JOJ A;  2KLD A;  3DZT A;  3OP0 A;  4YGE B;  1L2O C;  4YI9 A;  4UPG A;  1C07 A;  3SS3 A;  2L4H A;  2LVI A;  1MHO A;  2KFH A;  2Y1M A;  4ORB B;  4A4C A;  1QIV A;  3I5H B;  3RLZ A;  3FE9 A;  1B8R A;  1M39 A;  1YVL A;  2FCE A;  3D10 A;  4YI8 A;  1ZUZ A;  1CDP A;  1OOH A;  2HF5 A;  1J7O A;  1YVH A;  3BOW A;  4TNC A;  2CCM A;  2M1U A;  3I5I C;  1TUJ A;  3I5F C;  4M2P A;  5DKN A;  2Y4Q A;  1MQ1 A;  2LE9 B;  1SYM A;  2BKI B;  4BY4 A;  1CM4 A;  1REC A;  4PCW A;  4INW A;  1F4O A;  2AMI A;  2PRU A;  1OW4 A;  2WCJ A;  1F71 A;  4HRE E;  4CID A;  1XVJ A;  1AJ5 A;  1XO5 A;  2BL0 C;  1JUO A;  1YRU B;  2NCO A;  2GGZ A;  1VRK A;  2JTT A;  2IS9 A;  2M29 A;  1AUI B;  1CFF A;  1N2D A;  1SNL A;  3D74 A;  3KO0 A;  1FW4 A;  1F70 A;  4CFR A;  1EG4 A;  3GOF A;  1K94 A;  3S0A A;  1WLZ A;  1C7V A;  3VRN A;  1OZS A;  3D73 A;  4YRU A;  1M46 A;  2JC2 A;  2BAP A;  3LL8 B;  1NCX A;  3PFV A;  4WQ3 A;  1K8U A;  3KEV A;  1PK0 D;  2FOT A;  2MA2 A;  1U5I B;  2KFF A;  2Q91 A;  4GNK B;  1B8C A;  4OR9 B;  3OB2 B;  5DKR A;  1GJY A;  3CZ2 A;  5JOL A;  2KPH A;  2WCM A;  3LCP C;  3TZ1 A;  1SCV A;  1S6J A;  2ZN8 A;  3TUY C;  4CLN A;  1W9Z A;  2FJY A;  3BFB A;  4IL1 A;  1ZFS A;  4YGD B;  1K2H A;  2G2B A;  2LM5 A;  3BUN B;  4AQJ A;  5HKZ A;  1JF0 A;  1NX2 A;  2SCP A;  1NYA A;  3IQO A;  2SAS A;  2I94 A;  1IKU A;  4PHK A;  1YUR A;  2F33 A;  2LHL A;  2WCE A;  1ALW A;  1HQV A;  4OKH A;  3TDU A;  3DVM A;  1EXR A;  1V1F A;  2K2A A;  4I5J A;  2PAS A;  1KK7 Y;  5HLO A;  3NSI A;  2JNX A;  3D75 A;  3DXL A;  3K1E A;  4M2O A;  4MVF A;  3WNX B;  1ZAC A;  2BBM A;  3OHM B;  1S5G Y;  1DJH A;  3UNW A;  1WY9 A;  2O60 A;  1NUB A;  1UUS A;  3LK0 A;  1OOI X;  4YBH B;  3EK8 A;  2ZNE A;  1H8B A;  1KCY A;  2M9G A;  4FQT A;  2Y5I A;  2LV7 A;  3PSR A;  4PE1 A;  1Z4H A;  2L50 A;  3R1P A;  3KHE A;  1AP4 A;  3CZ0 A;  4MZL A;  4AOM A;  1PRW A;  2EC6 C;  3FIA A;  3NSO A;  4CFQ A;  2WOR A;  1KK7 Z;  1OOF A;  3CTN A;  3NGV A;  5CSI A;  3OX6 A;  1TNW A;  2WCH A;  4KYN A;  5D69 A;  3TDI A;  1PSB A;  1S5G Z;  2F2P A;  3JVT B;  5CSF A;  1YUU A;  2L98 A;  2M97 A;  1QX5 B;  4YGC B;  1A29 A;  1MWN A;  2E6W A;  3L47 A;  4HRH A;  2ZKM X;  1EJ3 A;  1MXL C;  3S0E A;  2MBX A;  3CLN A;  5AEQ A;  1OOG A;  3SG5 A;  1R6P A;  2KGR A;  5HLV A;  1OMV A;  3HX4 A;  1EG3 A;  4JWQ A;  1HT9 A;  5FI7 A;  5ER5 A;  1CDM A;  4AQI A;  2L2E A;  1OE9 B;  2QEV A;  3FE6 A;  2JRF A;  1RFJ A;  1JC2 A;  1LKJ A;  2LUX A;  2OTG C;  4Q04 A;  1WDC C;  4GPL B;  3SIA A;  1J7P A;  2L5Y A;  2LC5 A;  4A4B A;  3BJH A;  1NPQ A;  4JPZ B;  2WCF A;  3B87 A;  1ZMZ A;  2JNF A;  2JPO A;  1FPW A;  1K9P A;  4N5X A;  1NSH A;  2A4J A;  2O5G A;  1QV0 A;  1S3P A;  4MEW A;  4WQ2 A;  3IQQ A;  4NDB A;  5FI6 A;  4PE7 A;  2BCX A;  2Q4U A;  1NX1 A;  4ZCU A;  1BLQ A;  2Y1N A;  1M45 A;  3VRP A;  3C1V A;  4PHJ A;  1QTX A;  1SR6 B;  1OMD A;  1D1O A;  1KWO C;  3CR2 A;  2OS8 C;  1SL9 A;  2VRG A;  4GAO A;  3WHT B;  1KFU S;  2WOS A;  2LUC A;  4N1G A;  1DGV A;  2LCP A;  3I5H C;  1RJV A;  1SY9 A;  3PM8 A;  3MSE B;  4I5N B;  1QV1 A;  4F0Z B;  3O2P A;  2KAV A;  1AK8 A;  1CDN A;  2BE4 A;  3CR5 X;  2YGU A;  1QS7 A;  3N7H A;  5CSJ A;  2GTE A;  2K60 A;  2BEC A;  3O78 A;  2F8P A;  4GUK A;  2BCA A;  4PHM A;  1EH2 A;  5AFP A;  3FE8 A;  2NLN A;  3FWC A;  3D77 A;  1N0Y A;  1NCY A;  2KI4 B;  1TUZ A;  3DF0 B;  1RWY A;  1SSE B;  1YRT B;  1U5I A;  1FI6 A;  3GK2 A;  5GQQ C;  5KTY A;  2E30 A;  3ICB A;  2K7O A;  4YGB B;  2I2R E;  1CLL A;  1QJT A;  1OSA A;  5AXI A;  4MN0 A;  3WHU B;  2ZFD A;  1SW8 A;  1XFX O;  3D0Y B;  4L9M A;  4C0K A;  4PHN A;  3EKH A;  2EGD A;  2CTN A;  1G4Y R;  1NP8 A;  1JFJ A;  1IH0 A;  5JJG A;  2WCL A;  2BE6 A;  1IG5 A;  3ZNI A;  3B86 A;  1OZO A;  1KFX S;  2PSR A;  4ICB A;  1B47 A;  5I2O A;  3BFH A;  2HQ8 A;  2WC5 A;  1J1D A;  3S0B A;  5HL1 A;  2M49 B;  2D8N A;  1QX2 A;  1OOJ A;  2CNP A;  1DJX A;  2LMT A;  1AJ4 A;  1KSM A;  2NZ0 A;  3PN7 B;  1X02 A;  1XA5 A;  3EKJ A;  3KPX A;  2KAY A;  1IGV A;  1TNX A;  3AAJ A;  3DYE A;  1SL8 A;  1GGW A;  4MZK A;  2KFG A;  3L4L A;  5FYX A;  1BOD A;  1C3Y A;  4USL A;  1L7Z A;  1CDL A;  2HET A;  1BF5 A;  3BQ3 A;  3EK4 A;  1J7Q A;  3CR4 X;  3IF7 A;  1G33 A;  1CMG A;  2KI6 C;  2K7C A;  1DJI A;  2LMV A;  1SKT A;  3EG5 B;  3D76 A;  4ORC B;  2MAZ A;  3BUW B;  3FS7 A;  1YUT A;  1DC1 A;  2JT8 A;  3R72 A;  5EL2 A;  1OQP A;  2P71 A;  4R1E A;  2L51 A;  1QLK A;  1C3Z A;  2LLU A;  3S0D A;  2MJW B;  2H2K A;  2MHH A;  1NX3 A;  1DJW A;  4INX A;  1NIW A;  1G8I A;  2KGB C;  2KYC A;  2MRD A;  1WRZ A;  1MR8 A;  1R2U A;  1SCM B;  1DTL A;  3NXA A;  2H61 A;  2LAP A;  2CT9 A;  2KDH A;  5G08 A;  3QRX A;  1ORG A;  1ZOT B;  3WXA A;  1XK4 A;  1S26 D;  2NCP A;  5KSZ A;  1KK8 B;  3BXK A;  3VB1 A;  2HQW A;  2PYQ A;  1E8A A;  3PAT A;  2COL B;  4BY5 A;  1SK6 D; 
#chains in the Genus database with same CATH homology
 1CLM A;  2JQ6 A;  3OB1 B;  2L5X B;  2JT0 A;  1BR4 B;  3M0W A;  2G9B A;  2KQ6 A;  1IJ5 A;  1EL4 A;  4I5K A;  2LLS A;  1Y1U A;  1DVI A;  3GK4 X;  1JWD A;  4OV2 A;  2K61 A;  2CXJ A;  4GBA A;  1RRO A;  3VRR A;  1QAT A;  2WC8 A;  4PE4 A;  3TS5 B;  1J55 A;  1QXP A;  2H61 C;  3EVR A;  2JWW A;  5J3X A;  3TDZ A;  5D7F A;  4ETO A;  3AKB A;  3O4Y A;  1SPY A;  3BYA A;  1QX7 A;  3CGA A;  1B4C A;  3I5G B;  2JZI A;  1IWQ A;  3LLE A;  4FQO A;  4M2Q A;  1PAL A;  1UWO A;  5AER A;  1TNQ A;  1QIW A;  3CZT X;  2JXL A;  1BG1 A;  4DIR A;  4N1F A;  1J1E A;  1TRF A;  1MXE A;  2BCB A;  5ER4 X;  4I5L B;  3DF0 A;  1LXF C;  2EC6 B;  4P5O E;  1OMR A;  3BUM B;  4YGA A;  1IQ3 A;  4MRY A;  1S6I A;  2MLF C;  1CMF A;  1SR6 C;  2GV5 A;  3SJS A;  4XYN A;  2WCB A;  1UHH A;  1DF0 B;  2R2I A;  3SG3 A;  5IBW A;  1K93 D;  1Y6W A;  5AAN A;  1GGZ A;  5K89 A;  2F2O A;  3BUO B;  1KQM B;  1DJY A;  5I2L A;  4DUQ A;  1TNP A;  1YX7 A;  1K96 A;  1LVC D;  1JSA A;  4GFT A;  1S1E A;  1PSR A;  1JBA A;  2KI4 C;  3JTD B;  2QAC A;  2QPT A;  4MZJ A;  4C0J A;  1AHR A;  2K7D A;  1QVI Y;  2LVJ A;  4C0L A;  4PDZ A;  5DKQ A;  3NSK A;  3DVJ A;  2FJU B;  1KQV A;  1LA0 A;  1F4Q A;  1ODB A;  4ORA B;  5PAL A;  1TTX A;  4FTG A;  3AKA A;  1LIN A;  1UHK A;  1XFZ O;  4QJ4 B;  4MBE A;  1A2X A;  2K0J A;  5CSN A;  2AAO A;  2KQY A;  3CWG A;  2MLE C;  3KF9 A;  3ZWH A;  2OS8 B;  5B8I B;  1QVI Z;  4QJ3 B;  2M8U A;  1WRK A;  3EVU A;  2LMU A;  2PVB A;  5F6T A;  3PN7 C;  4NDD A;  2F3Z A;  1CLB A;  1L2O B;  1CFD A;  2ZRT A;  1NWD A;  1QLS A;  2K8M B;  2RGI A;  1S36 A;  2DOQ A;  1B7T Y;  1RK9 A;  1CFC A;  1DMO A;  1XYD A;  1UHI A;  4DS7 A;  1B1G A;  4JQ0 D;  4NDC A;  5TNC A;  2KSP A;  2ZND A;  3O6B A;  1QAS A;  2M7L A;  3I5I B;  1TIZ A;  3I5F B;  5KU1 A;  3EVV A;  1N65 A;  3SG7 A;  2JPT A;  1Y1A A;  3BUX B;  3SG2 A;  3E3R A;  2HPS A;  2JU0 A;  1B7T Z;  3H4S E;  2LVK A;  2LHI A;  2OPO A;  1CTR A;  2KAX A;  4OCI A;  1K90 D;  1BU3 A;  4WRI A;  1TCO B;  2ZRS A;  3F45 A;  4XJK B;  1DJG A;  1A75 B;  1KSO A;  1WLM A;  2BL0 B;  3A8R A;  2JUL A;  1SCM C;  3DD4 A;  4NQG A;  1JFK A;  1PUL A;  2V53 A;  1PVB A;  3AAK A;  2KI6 D;  3DVE A;  4DCK A;  1RTP 1;  1CFP A;  4GGF A;  5HKW A;  1CNP A;  1KK8 C;  3BOW B;  3SG4 A;  3PLF B;  2LP2 A;  1ALV A;  2JXC A;  2K2F A;  2M0R A;  1TOP A;  3GK1 A;  1IQ5 A;  1UHJ A;  1Y1X A;  1TN4 A;  5I2Q A;  4D1E A;  1KFU L;  3TUY B;  1FF1 A;  2BBN A;  4QJ5 B;  2KYF A;  3DVK A;  3JVT C;  4HSZ A;  3TS5 C;  2L0P A;  2GGM A;  2M7N A;  4U8D A;  1SBJ A;  4GGN A;  1H4B A;  1DF0 A;  1FBV A;  2JTZ A;  3NSL A;  1NCZ A;  3SIB A;  2NXQ A;  4GGF C;  2KBM A;  1V1G A;  2KOT A;  3RM1 A;  4E68 A;  1SL7 A;  1BT6 A;  2P6B B;  1PVA A;  2PMY A;  1BOC A;  1DGU A;  5HYD A;  3I5G C;  4PAL A;  1Y0V H;  3VGO A;  1XK4 C;  2WND A;  1JF2 A;  1B8L A;  2LLT A;  1XFY O;  2I18 A;  2M3W A;  2AUC A;  1MUX A;  1LA3 A;  1MF8 B;  2I7A A;  2TN4 A;  1FI5 A;  2BKH B;  1BMO A;  1K9K A;  1CM1 A;  2FCD A;  1F55 A;  5BPJ A;  1XFV O;  3FWB A;  1K95 A;  4DRW A;  1DJZ A;  1A4P A;  1TCF A;  2KNE A;  1GQM A;  1KFX L;  1BR1 B;  1SMG A;  2B1U A;  3VRO A;  1UHN A;  3EK7 A;  2LAN A;  1M31 A;  1A03 A;  3LK1 A;  1UP5 A;  1AVS A;  5I8N A;  3D0Y A;  1B9A A;  3CS1 A;  1KQM C;  1YTZ C;  1YX8 A;  4MSP A;  1NX0 A;  3OX5 A;  4ZCV A;  2CBL A;  1YR5 A;  3SG6 A;  1J7R A;  1CB1 A;  1IJ6 A;  1YUS A;  1IRJ A;  4HRG A;  1W7I B;  2LVV A;  3JTD C;  3A4U B;  2PAL A;  1XFU O;  1DT7 B;  2OTG B;  5CPV A;  2KHN A;  1WDC B;  1F8H A;  1SRA A;  1WRL A;  3HCM A;  2EHB A;  1BJF A;  1S6C A;  2KBI A;  2ZN9 A;  5HKY A;  1UUR A;  3K21 A;  2L4I A;  2LP3 A;  4P2Y B;  3VRQ A;  1CKK A;  2F3Y A;  1C7W A;  1K9U A;  4OVN F;  3PAL A;  1Q80 A;  4MLW A;  1W7J B;  4CPV A;  1F54 A;  2ISD A;  2K7B A;  2LNK A;  2M1K B;  1M63 B;  1KWO B;  2JT3 A;  4MRX A;  1XFW O;  4XJK A;  1A75 A;  2JOJ A;  3OP0 A;  4YGE B;  4UPG A;  1C07 A;  1L2O C;  4YI9 A;  2L4H A;  2LVI A;  1MHO A;  2KFH A;  2Y1M A;  4ORB B;  4A4C A;  1QIV A;  3I5H B;  3RLZ A;  1B8R A;  1M39 A;  1YVL A;  2FCE A;  3D10 A;  4YI8 A;  1ZUZ A;  1CDP A;  2HF5 A;  1J7O A;  1YVH A;  3BOW A;  4TNC A;  2CCM A;  2M1U A;  3I5I C;  3I5F C;  4M2P A;  5DKN A;  2Y4Q A;  1MQ1 A;  2LE9 B;  1SYM A;  2BKI B;  4BY4 A;  1CM4 A;  1REC A;  4PCW A;  1F4O A;  2AMI A;  2PRU A;  1F71 A;  4HRE E;  4CID A;  1XVJ A;  1AJ5 A;  1XO5 A;  2BL0 C;  1JUO A;  1YRU B;  2NCO A;  2GGZ A;  1VRK A;  2JTT A;  2IS9 A;  2M29 A;  1AUI B;  1CFF A;  1N2D A;  1SNL A;  3KO0 A;  1FW4 A;  1F70 A;  4CFR A;  1EG4 A;  3GOF A;  1K94 A;  1WLZ A;  1C7V A;  3VRN A;  1OZS A;  4YRU A;  1M46 A;  2JC2 A;  3LL8 B;  1NCX A;  3PFV A;  4WQ3 A;  1K8U A;  3KEV A;  1PK0 D;  2FOT A;  2MA2 A;  1U5I B;  2KFF A;  2Q91 A;  4GNK B;  1B8C A;  4OR9 B;  3OB2 B;  5DKR A;  1GJY A;  5JOL A;  3LCP C;  3TZ1 A;  1SCV A;  1S6J A;  2ZN8 A;  3TUY C;  4CLN A;  4IL1 A;  4YGD B;  1ZFS A;  1K2H A;  2G2B A;  2LM5 A;  3BUN B;  4AQJ A;  5HKZ A;  1JF0 A;  1NX2 A;  2SCP A;  1NYA A;  3IQO A;  2SAS A;  2I94 A;  1IKU A;  4PHK A;  1YUR A;  2F33 A;  2LHL A;  2WCE A;  1ALW A;  1HQV A;  4OKH A;  3TDU A;  3DVM A;  1EXR A;  1V1F A;  2K2A A;  4I5J A;  2PAS A;  1KK7 Y;  5HLO A;  3NSI A;  2JNX A;  4M2O A;  3WNX B;  4MVF A;  1ZAC A;  2BBM A;  3OHM B;  1S5G Y;  1DJH A;  1WY9 A;  2O60 A;  1NUB A;  1UUS A;  3LK0 A;  4YBH B;  3EK8 A;  2ZNE A;  1H8B A;  1KCY A;  2M9G A;  2Y5I A;  2LV7 A;  3PSR A;  4PE1 A;  2L50 A;  1AP4 A;  3KHE A;  4MZL A;  4AOM A;  1PRW A;  2EC6 C;  3FIA A;  3NSO A;  4CFQ A;  2WOR A;  1KK7 Z;  5D69 A;  3CTN A;  5CSI A;  3OX6 A;  1TNW A;  3TDI A;  1PSB A;  1S5G Z;  2F2P A;  3JVT B;  5CSF A;  1YUU A;  2L98 A;  2M97 A;  1QX5 B;  4YGC B;  1A29 A;  1MWN A;  2E6W A;  4HRH A;  2ZKM X;  1EJ3 A;  1MXL C;  2MBX A;  3CLN A;  5AEQ A;  3SG5 A;  1R6P A;  2KGR A;  5HLV A;  1OMV A;  3HX4 A;  1EG3 A;  4JWQ A;  1HT9 A;  4AQI A;  5ER5 A;  1CDM A;  2L2E A;  1OE9 B;  2JRF A;  1RFJ A;  1JC2 A;  1LKJ A;  2LUX A;  2OTG C;  4Q04 A;  1WDC C;  4GPL B;  3SIA A;  1J7P A;  2LC5 A;  4A4B A;  1NPQ A;  4JPZ B;  2WCF A;  1ZMZ A;  2JNF A;  1FPW A;  1K9P A;  4N5X A;  1NSH A;  2A4J A;  2O5G A;  1QV0 A;  1S3P A;  4MEW A;  4WQ2 A;  3IQQ A;  4NDB A;  4PE7 A;  2BCX A;  2Q4U A;  1NX1 A;  4ZCU A;  1BLQ A;  2Y1N A;  1M45 A;  3VRP A;  3C1V A;  4PHJ A;  1QTX A;  1SR6 B;  1OMD A;  1D1O A;  1KWO C;  3CR2 A;  2OS8 C;  1SL9 A;  2VRG A;  4GAO A;  3WHT B;  1KFU S;  2WOS A;  2LUC A;  4N1G A;  1DGV A;  2LCP A;  3I5H C;  1RJV A;  1SY9 A;  3PM8 A;  3MSE B;  4I5N B;  1QV1 A;  4F0Z B;  3O2P A;  2KAV A;  1AK8 A;  1CDN A;  2BE4 A;  3CR5 X;  1QS7 A;  5CSJ A;  3O78 A;  2BEC A;  4GUK A;  2F8P A;  2BCA A;  4PHM A;  1EH2 A;  5AFP A;  2NLN A;  3FWC A;  1N0Y A;  1NCY A;  2KI4 B;  3DF0 B;  1RWY A;  1YRT B;  1U5I A;  1FI6 A;  3GK2 A;  5GQQ C;  5KTY A;  2E30 A;  3ICB A;  2K7O A;  4YGB B;  2I2R E;  1CLL A;  1QJT A;  1OSA A;  5AXI A;  4MN0 A;  3WHU B;  2ZFD A;  1SW8 A;  1XFX O;  3D0Y B;  4L9M A;  4C0K A;  4PHN A;  3EKH A;  2EGD A;  2CTN A;  1G4Y R;  1NP8 A;  1JFJ A;  1IH0 A;  5JJG A;  2BE6 A;  1IG5 A;  3ZNI A;  1OZO A;  1KFX S;  2PSR A;  4ICB A;  1B47 A;  5I2O A;  2HQ8 A;  1J1D A;  2M49 B;  2D8N A;  1QX2 A;  1OOJ A;  2CNP A;  1DJX A;  2LMT A;  1AJ4 A;  1KSM A;  2NZ0 A;  3PN7 B;  1X02 A;  1XA5 A;  3EKJ A;  3KPX A;  2KAY A;  1IGV A;  1TNX A;  3AAJ A;  1SL8 A;  1GGW A;  4MZK A;  2KFG A;  5FYX A;  1BOD A;  4USL A;  1L7Z A;  1CDL A;  2HET A;  1BF5 A;  3BQ3 A;  3EK4 A;  1J7Q A;  3CR4 X;  3IF7 A;  1G33 A;  1CMG A;  2KI6 C;  2K7C A;  1DJI A;  2LMV A;  1SKT A;  4ORC B;  2MAZ A;  3BUW B;  3FS7 A;  1YUT A;  2JT8 A;  1OQP A;  4R1E A;  2L51 A;  1QLK A;  2LLU A;  2MJW B;  2H2K A;  2MHH A;  1NX3 A;  1DJW A;  1NIW A;  1G8I A;  2KGB C;  2KYC A;  2MRD A;  1WRZ A;  1MR8 A;  1R2U A;  1SCM B;  1DTL A;  3NXA A;  2H61 A;  2LAP A;  2CT9 A;  2KDH A;  5G08 A;  3QRX A;  1ZOT B;  3WXA A;  1XK4 A;  1S26 D;  2NCP A;  5KSZ A;  1KK8 B;  3BXK A;  4BY5 A;  2HQW A;  3PAT A;  1E8A A;  4PE0 A;  2COL B;  1SK6 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...