2Q91A

Structure of the ca2+-bound activated form of the s100a4 metastasis factor
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
96
structure length
96
Chain Sequence
ACPLEKALDVMVSTFHKYSGKEGDKFKLNKSELKELLTRELPSFLGKRTDEAAFQKLMSNLDSNRDNEVDFQEYCVFLSCIAMMCNEFFEGFPDKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords S100A4 Metastasis Factor
publication title Structure of Ca(2+)-Bound S100A4 and Its Interaction with Peptides Derived from Nonmuscle Myosin-IIA.
pubmed doi rcsb
source organism Homo sapiens
total genus 36
structure length 96
sequence length 96
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-06-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2q91A00
1PRWA 1BODA 2AAOA 4GUKA 2M29A 2F33A 1SYMA 1DGVA 3PFVA 4ETOA 1J55A 1FPWA 3JVTB 3BUOB 1QVIZ 4OR9B 3CGAA 4P5OE 4ZCVA 1WRZA 1ALVA 2MA2A 3ZNIA 3VRPA 4AOMA 1AHRA 1UWOA 1S6IA 3BYAA 4PHJA 5AEQA 4C0JA 1IKUA 2M49B 2OS8C 1JBAA 3SG4A 2WOSA 1NCZA 1QJTA 1YR5A 3RM1A 5HKYA 1BOCA 5B8IB 2KYCA 3DVKA 3A8RA 2M3WA 2GGMA 2L51A 4NDBA 4A4BA 4CFQA 2K0JA 3ZWHA 1R2UA 2KYFA 1B8RA 3BUXB 5D69A 1K9PA 1S1EA 3TDZA 4MRYA 2CNPA 1LKJA 3LK1A 1PVAA 4BY5A 4C0LA 4PHNA 2JULA 1AJ5A 2KBIA 2M8UA 4MEWA 4D1EA 2BL0B 1KCYA 3I5HC 1GGZA 1KSMA 3C1VA 1CFPA 1JC2A 1KK8B 1CDNA 2LHLA 2QACA 1S6CA 1TRFA 1XA5A 1DJXA 2LLUA 1YTZC 4ORBB 4GAOA 2K2AA 2O60A 3AAJA 4P2YB 3FWBA 2P6BB 1MF8B 2KI4C 1WDCB 3LK0A 1MHOA 1UHNA 1Y1XA 5CSFA 2MHHA 2KOTA 2JT8A 1KQMC 4YGAA 4HSZA 1EG3A 1DJIA 3JTDB 2F8PA 1NX1A 5HKZA 3HCMA 4YGBB 2FJUB 4ZCUA 5D7FA 2L5XB 1BF5A 1DJWA 1OZOA 1RECA 1HQVA 3TZ1A 1UHIA 1V1FA 2ZNDA 3BOWB 3TDIA 3GOFA 1DGUA 1IQ3A 1KQVA 4OV2A 1PULA 3BOWA 1JFKA 4I5KA 5HKWA 1DVIA 1ODBA 5AANA 1B4CA 2BKIB 2BKHB 2K2FA 2FCEA 1E8AA 1KWOC 4MBEA 1DTLA 2RGIA 2L50A 1K2HA 2PRUA 1H8BA 2EGDA 1PALA 5AXIA 2KSPA 3BXKA 3VGOA 4YI9A 3SJSA 2L98A 3GK4X 1RJVA 2MLFC 3WXAA 4DCKA 1SW8A 2KQYA 1GQMA 1QIVA 3E3RA 4PE7A 1LINA 3PN7C 2HETA 3VROA 3I5IC 1DJZA 1NSHA 3I5FB 2KFGA 3IF7A 1J1DA 2NLNA 3O6BA 4CLNA 3KF9A 4GGFC 2BECA 1KFXS 2K7CA 3IQOA 1HT9A 1XFXO 2CTNA 3EVVA 5FYXA 5I8NA 2PSRA 1YRTB 5KSZA 1XFYO 2FCDA 4N1GA 1ZMZA 4CIDA 1RROA 1MQ1A 3EK7A 1DJHA 1NX3A 1CMFA 1OE9B 1JFJA 2LM5A 1C7WA 2NCOA 1OMRA 2LVJA 3SG7A 1M45A 1QVIY 1R6PA 3HX4A 1G4YR 5GQQC 3PM8A 2OPOA 1QIWA 2PMYA 1IG5A 2OS8B 3CR4X 1AUIB 4WRIA 3TS5C 1A29A 1CDLA 2L2EA 3OP0A 3A4UB 3NSLA 1KK7Z 2PASA 4NQGA 2MLEC 4YRUA 4WQ2A 1F71A 4YGDB 2L4IA 4HRHA 1SBJA 3OX6A 2WCBA 1S36A 2I18A 1W7JB 4I5NB 3BUMB 2IS9A 3RLZA 1K93D 1U5IA 1SR6B 4YGCB 3WHTB 1QV1A 1QTXA 1ZUZA 3I5HB 3SIAA 3O78A 1XK4C 1QV0A 1K8UA 3D10A 1K90D 1IWQA 1YVHA 3AKBA 5HYDA 1NX0A 3AKAA 1QX2A 4A4CA 3MSEB 5KU1A 2LMTA 1WRLA 2LE9B 1LA0A 1F8HA 1CDMA 1F70A 2Y4QA 2V53A 1SPYA 3EVUA 4UPGA 1JF0A 3PSRA 1SNLA 3AAKA 1M63B 3GK1A 4N5XA 1SL7A 2JRFA 2ZRTA 5K89A 1CFDA 1YURA 1EJ3A 1B7TZ 1S6JA 1K96A 1KQMB 2ZFDA 2TN4A 2K8MB 3KHEA 2M1KB 3DF0B 3DVMA 5AFPA 3DF0A 4YBHB 2LUCA 3EK4A 2F2OA 3O2PA 3KO0A 3DVJA 2H2KA 1YUTA 4ICBA 1PK0D 1SCMC 2KQ6A 1FBVA 3JVTC 2I7AA 1L7ZA 4U8DA 1OQPA 2M0RA 2LCPA 4MZJA 2L4HA 4M2QA 3CS1A 4MZLA 2NCPA 1TCFA 4CPVA 1KWOB 3OHMB 1QS7A 1V1GA 1XVJA 1F4OA 1TN4A 1IRJA 1K9KA 3SIBA 3CTNA 2KAVA 4WQ3A 4NDDA 1YUUA 1CTRA 2F2PA 3O4YA 4C0KA 4FQOA 1M46A 4MSPA 2D8NA 1SKTA 4GNKB 3CR2A 2LVKA 4MVFA 2LC5A 4AQIA 2MRDA 1CDPA 5JJGA 3FS7A 2M97A 2LMVA 3NSIA 1IJ6A 1TNQA 1FI6A 2O5GA 1CM1A 3I5IB 5BPJA 5IBWA 1ZACA 2K61A 5HLVA 2KDHA 2E30A 2WNDA 3I5GC 1F4QA 4GFTA 3KPXA 1LA3A 2LLSA 2Y1NA 1IQ5A 3EKJA 3NSOA 3LCPC 2I94A 2K7OA 2LV7A 2LANA 4JQ0D 2ZKMX 5JOLA 2ZN9A 2Q4UA 4QJ4B 1KK8C 1MWNA 3OX5A 4PALA 1SL9A 3TUYB 2K7DA 5CSJA 1L2OC 3F45A 2CBLA 4PCWA 1YX8A 1CM4A 1A75A 3EKHA 1WDCC 5HLOA 1OMDA 2GV5A 2HPSA 2KI6C 1LVCD 4OKHA 1AK8A 3BQ3A 1QX5B 3NSKA 2H61C 3GK2A 3WHUB 1LXFC 1K94A 1RTP1 5CSIA 2LVVA 1IGVA 2JT0A 1QASA 2KHNA 1B47A 1NP8A 1QXPA 2KNEA 1Y1AA 1KK7Y 4M2PA 1TCOB 2KBMA 1K95A 1QX7A 4IL1A 2M7LA 2JTTA 5CSNA 2DOQA 2LHIA 1JSAA 4R1EA 2JXLA 2HQWA 1M31A 2CT9A 2LMUA 1J1EA 1XFWO 2WC8A 3QRXA 4M2OA 1XK4A 1XYDA 4QJ5B 2JWWA 4MZKA 1DMOA 5CPVA 2JC2A 2OTGC 3FIAA 2FOTA 1SK6D 4MLWA 1BG1A 1SRAA 2AMIA 4GGNA 3EK8A 1UUSA 1XFUO 1NUBA 3CR5X 1BR4B 2ZNEA 1UHKA 5I2LA 2CCMA 2R2IA 3CWGA 2BCXA 1U5IB 3CZTX 4E68A 2BBMA 1DF0A 1A4PA 2JNFA 2WORA 3ICBA 1MR8A 1YRUB 3BUNB 4BY4A 1J7OA 1WY9A 1H4BA 4XJKB 1PSRA 1B7TY 1XFVO 2GGZA 2I2RE 1SCVA 2AUCA 2BE4A 2KFHA 2ZN8A 1BR1B 1N0YA 2HF5A 1X02A 1S5GZ 4XJKA 5KTYA 1Y1UA 2EC6C 2MAZA 1CFCA 4N1FA 1YUSA 3I5FC 3FWCA 4HREE 3SG3A 1UHHA 4DS7A 1YX7A 4PE0A 4PE4A 1SCMB 2JOJA 2BBNA 3LL8B 2KI4B 1TTXA 1J7RA 2LVIA 2G9BA 2JNXA 1PVBA 3H4SE 2SCPA 1NYAA 2Y1MA 5G08A 1G8IA 4F0ZB 5I2OA 1TOPA 2L0PA 4QJ3B 1AVSA 1YVLA 2NXQA 2MBXA 4HRGA 2LLTA 4GPLB 4NDCA 4OCIA 1ZFSA 2JQ6A 1EH2A 3VRQA 4CFRA 1XO5A 2VRGA 1WLMA 4DRWA 1C7VA 5ER5A 3BUWB 4DUQA 1RFJA 2PALA 2NZ0A 1NX2A 1IH0A 3EVRA 3LLEA 1DT7B 2JXCA 1B1GA 1D1OA 2KI6D 1WRKA 5I2QA 1A2XA 1GJYA 1NCXA 2HQ8A 2LP2A 1JWDA 3I5GB 2JZIA 2KAXA 2PVBA 2SASA 2M9GA 3DD4A 1NWDA 2ISDA 1SR6C 4DIRA 3WNXB 1BT6A 1VRKA 2CXJA 1M39A 4L9MA 3K21A 1CNPA 1OOJA 3IQQA 4MRXA 1L2OB 4JPZB 1GGWA 1F54A 2KAYA 1C07A 1CLMA 1FI5A 1NIWA 1UP5A 1G33A 1ZOTB 1PSBA 5J3XA 1BLQA 1FW4A 5ER4X 1S26D 3PLFB 1CFFA 1J7PA 3PN7B 2WCFA 5DKNA 2G2BA 2H61A 4TNCA 3VRRA 4PHMA 1B9AA 2E6WA 2A4JA 1RWYA 4MN0A 2BL0C 1CKKA 1KFUS 4GBAA 1NCYA 1KFUL 1CB1A 5DKQA 2LUXA 5AERA 1MXEA 1W7IB 1Y0VH 2M1UA 2EHBA 3DVEA 3TDUA 1B8LA 1A75B 2BCAA 1SMGA 3D0YB 4Q04A 4AQJA 1MUXA 2JT3A 1TNWA 3D0YA 1MXLC 2WCEA 1A03A 1NPQA 4PE1A 2JPTA 5DKRA 1QLKA 2LAPA 1N2DA 3TS5B 1F55A 2OTGB 1ALWA 5TNCA 1CLLA 1WLZA 1EXRA 1FF1A 2LNKA 3JTDC 2BCBA 4I5JA 1CMGA 1TIZA 5F6TA 2KGRA 2K7BA 3SG6A 2KGBC 1JF2A 1Q80A 1RK9A 4FTGA 2QPTA 4XYNA 4I5LB 1IJ5A 1KSOA 5PALA 1JUOA 1AP4A 3NXAA 3PATA 2JTZA 1TNPA 1AJ4A 1QATA 4ORCB 1K9UA 1OZSA 1Y6WA 2M7NA 3OB2B 1TNXA 4USLA 3PALA 4GGFA 2EC6B 4PHKA 3M0WA 1BU3A 1EG4A 2ZRSA 3OB1B 2F3ZA 2KFFA 1KFXL 1S5GY 1S3PA 1CLBA 2Y5IA 4OVNF 1OMVA 1OSAA 2Q91A 1BMOA 2COLB 2MJWB 1BJFA 3VRNA 2JU0A 1UURA 1DJYA 3TUYC 1B8CA 1SL8A 3KEVA 4ORAB 1DF0B 3CLNA 2B1UA 3SG5A 1EL4A 1UHJA 1N65A 2BE6A 2F3YA 4PDZA 1SY9A 4YGEB 3SG2A 1XFZO 1J7QA 2LP3A 4YI8A 4JWQA 1DJGA 1QLSA
chains in the Genus database with same CATH superfamily
3FE8A 3SS5A 1PRWA 1BODA 2AAOA 4GUKA 2M29A 2F33A 2QDIA 1SYMA 1DGVA 3PFVA 4ETOA 1J55A 1FPWA 3JVTB 2P70A 3BUOB 1QVIZ 4OR9B 3CGAA 4P5OE 4ZCVA 5I94A 1WRZA 1ALVA 2MA2A 3ZNIA 3VRPA 4AOMA 1AHRA 1UWOA 1S6IA 3BYAA 4PHJA 5AEQA 3VB1A 2WC6A 3CYZA 4C0JA 1IKUA 2M49B 2OS8C 1JBAA 3SG4A 2WOSA 1NCZA 1QJTA 1YR5A 3CZ0A 3EG5B 3RM1A 5HKYA 1BOCA 5B8IB 2KYCA 3DVKA 3A8RA 2M3WA 2GGMA 2L51A 4NDBA 4A4BA 4CFQA 2K0JA 3ZWHA 1R2UA 2KYFA 1B8RA 3BUXB 5D69A 1K9PA 1S1EA 3TDZA 4MRYA 2CNPA 2YGUA 1LKJA 3LK1A 1PVAA 4BY5A 4C0LA 2WCLA 4PHNA 2JULA 1AJ5A 2KBIA 2M8UA 4MEWA 3UO9A 2BL0B 3SS4A 4D1EA 3I5HC 1KCYA 1GGZA 1KSMA 2K60A 3C1VA 1CFPA 1JC2A 1KK8B 1TUJA 1CDNA 4F7FA 1T14A 2LHLA 4KYNA 2QACA 1S6CA 1TRFA 1XA5A 1DJXA 4JKTA 2LLUA 1YTZC 1GM0A 4ORBB 4GAOA 2K2AA 2O60A 3AAJA 4P2YB 3FWBA 2P6BB 1MF8B 2KI4C 1WDCB 3NHTA 5DICA 3LK0A 1MHOA 1UHNA 3DYEA 1Y1XA 5CSFA 2MHHA 2KOTA 2JT8A 1OOIX 1KQMC 4YGAA 4HSZA 1EG3A 1OOHA 1DJIA 3JTDB 2F8PA 1NX1A 5HKZA 3HCMA 4YGBB 2FJUB 4ZCUA 1DC1A 5D7FA 2L5XB 1BF5A 1DJWA 1OZOA 1RECA 1HQVA 3BFAA 3TZ1A 1UHIA 1V1FA 2ZNDA 3QMEA 3BOWB 3TDIA 3GOFA 1DGUA 1IQ3A 1KQVA 4OV2A 1PULA 3BOWA 1JFKA 4I5KA 5HKWA 1DVIA 1ODBA 5AANA 1B4CA 2BKIB 2BKHB 2GTEA 2K2FA 5EL2A 2FCEA 1E8AA 1KWOC 4MBEA 1DTLA 2RGIA 2L50A 1K2HA 2PRUA 1H8BA 2EGDA 4PT1A 1PALA 5AXIA 2KSPA 3BXKA 3BFBA 4YI9A 3SJSA 2L98A 3GK4X 1P28A 1RJVA 2MLFC 3WXAA 4DCKA 1SW8A 2KQYA 1GQMA 1QIVA 3E3RA 4PE7A 1LINA 3PN7C 2HETA 3VROA 3I5IC 1TUZA 1DJZA 1NSHA 2KPHA 3I5FB 2KFGA 3IF7A 1J1DA 2L5YA 2NLNA 3O6BA 3KF9A 4GGFC 4CLNA 2BECA 1KFXS 2K7CA 3IQOA 1HT9A 1XFXO 2CTNA 3EVVA 5FYXA 5I8NA 2PSRA 3VGOA 1YRTB 5KSZA 1XFYO 2FCDA 4N1GA 1ZMZA 2WCHA 4CIDA 1RROA 1MQ1A 3EK7A 1DJHA 1NX3A 1CMFA 1OE9B 1JFJA 2LM5A 1C7WA 2NCOA 1OMRA 2LVJA 3SG7A 1M45A 1QVIY 1R6PA 3HX4A 1G4YR 5GQQC 3PM8A 2OPOA 1QIWA 2PMYA 3S0AA 1IG5A 2OS8B 3CR4X 3S0GA 1AUIB 4WRIA 3TS5C 1A29A 1CDLA 2L2EA 3OP0A 3A4UB 3NSLA 4INXA 1KK7Z 3B88A 2PASA 4NQGA 2MLEC 4YRUA 4WQ2A 1F71A 4YGDB 2L4IA 4HRHA 1SBJA 3OX6A 2WCBA 3CZ2A 1S36A 2I18A 1W7JB 4I5NB 3BUMB 2IS9A 3RLZA 1K93D 1U5IA 1SR6B 4YGCB 3WHTB 1QV1A 4FQTA 1QTXA 1ZUZA 3I5HB 3SIAA 3O78A 3B86A 1XK4C 1QV0A 1K8UA 3D10A 1K90D 1IWQA 1YVHA 3AKBA 2KLEA 5HYDA 1NX0A 3AKAA 1QX2A 4A4CA 3MSEB 5KU1A 2LMTA 1WRLA 2LE9B 1LA0A 1F8HA 1CDMA 1F70A 2Y4QA 2V53A 1SPYA 3EVUA 4UPGA 1JF0A 3PSRA 1SNLA 3AAKA 1M63B 3GK1A 2BAPA 2WCKA 1SL7A 4N5XA 2JRFA 2ZRTA 2BNXA 1CFDA 1YURA 1EJ3A 1B7TZ 1S6JA 5K89A 1C3YA 1K96A 1KQMB 3R72A 1LS8A 2ZFDA 2TN4A 2K8MB 1OOFA 1C3ZA 3KHEA 2M1KB 3DF0B 3DVMA 3R1PA 5AFPA 3DF0A 4YBHB 3B87A 2LUCA 3EK4A 3SS3A 2F2OA 3O2PA 3KO0A 3DVJA 3R1OA 2H2KA 1YUTA 4ICBA 1PK0D 1SCMC 1ORGA 2KQ6A 1FBVA 3BJHA 3JVTC 3D78A 2I7AA 1L7ZA 4U8DA 1OQPA 2M0RA 2LCPA 4MZJA 2L4HA 4M2QA 3CS1A 3O4XA 2NCPA 1TCFA 4MZLA 4CPVA 1KWOB 3OHMB 3PM2A 1QS7A 1V1GA 1XVJA 1F4OA 1TN4A 1IRJA 1K9KA 3SIBA 3CTNA 2KAVA 4WQ3A 4NDDA 1YUUA 1CTRA 2F2PA 3O4YA 4C0KA 4FQOA 1M46A 4MSPA 2D8NA 1SKTA 4GNKB 3CR2A 2LVKA 4MVFA 2LC5A 4AQIA 5FI7A 2MRDA 1CDPA 2H8VA 5JJGA 3FS7A 2M97A 2LMVA 3NSIA 1IJ6A 1TNQA 1FI6A 1DQEA 2WC5A 2O5GA 1CM1A 3I5IB 5BPJA 5IBWA 1ZACA 2K61A 5HLVA 1QWVA 2KDHA 2E30A 2FJYA 2WNDA 1F4QA 3I5GC 4GFTA 2PYQA 3KPXA 1LA3A 2LLSA 2Y1NA 1IQ5A 3EKJA 3NSOA 3LCPC 2I94A 3D77A 2K7OA 2LV7A 2LANA 4JQ0D 2ZKMX 5JOLA 2ZN9A 2Q4UA 4QJ4B 1KK8C 1MWNA 3OX5A 4PALA 1SL9A 3TUYB 2K7DA 5CSJA 1L2OC 3F45A 2CBLA 4PCWA 1YX8A 1CM4A 1A75A 3EKHA 1WDCC 5HLOA 1OMDA 2GV5A 2HPSA 2KI6C 1LVCD 4OKHA 1AK8A 3BQ3A 1QX5B 2KLDA 2H61C 3NSKA 3GK2A 3WHUB 1LXFC 1K94A 1RTP1 5CSIA 2LVVA 1IGVA 2JT0A 1QASA 2KHNA 1B47A 2QEHA 1NP8A 3Q8IA 1QXPA 2KNEA 1Y1AA 1KK7Y 4M2PA 1TCOB 2KBMA 1K95A 1QX7A 4IL1A 3BFHA 2M7LA 3CZ1A 2JTTA 5CSNA 2DOQA 2LHIA 3FE9A 1JSAA 2QEVA 4R1EA 2JXLA 1OOGA 2HQWA 1M31A 2CT9A 2LMUA 1J1EA 1XFWO 2WC8A 3QRXA 4M2OA 1XK4A 1XYDA 3UNWA 4QJ5B 1DELA 2JWWA 4MZKA 1DMOA 5CPVA 2JC2A 2OTGC 3FIAA 2FOTA 1SK6D 2WCMA 4MLWA 1SRAA 2AMIA 4GGNA 3EK8A 1BG1A 5FI2A 3FE6A 3CDNA 1XFUO 1UUSA 1W9ZA 1NUBA 3B7AA 3CR5X 1BR4B 3OGNA 4OZDA 2ZNEA 1UHKA 1SSEB 5I2LA 2CCMA 2R2IA 3CWGA 2BCXA 1U5IB 3CZTX 5D3OA 4E68A 3DZTA 2BBMA 1DF0A 1A4PA 2JNFA 2WORA 3ICBA 1MR8A 1YRUB 3BUNB 4BY4A 1J7OA 1WY9A 1H4BA 2QEBA 4XJKB 1PSRA 1B7TY 1XFVO 2GGZA 2I2RE 1SCVA 2AUCA 2BE4A 2KFHA 2ZN8A 1BR1B 1N0YA 2HF5A 1X02A 1S5GZ 4XJKA 5KTYA 1DEKA 1Y1UA 2EC6C 2MAZA 1XFRA 4N1FA 1CFCA 1YUSA 3I5FC 3FWCA 4HREE 3SG3A 1UHHA 4DS7A 1YX7A 4PE0A 4PE4A 1SCMB 2JOJA 2BBNA 3LL8B 3RZSA 2KI4B 1TTXA 1J7RA 2LVIA 2G9BA 3IVTA 2JNXA 1PVBA 3H4SE 2SCPA 1NYAA 2Y1MA 5G08A 1G8IA 4F0ZB 5I2OA 2PQLA 1TOPA 2L0PA 4QJ3B 1AVSA 1YVLA 2NXQA 2MBXA 4HRGA 2LLTA 4GPLB 4NDCA 3B6XA 4OCIA 1ZFSA 1Z2CB 2JQ6A 1EH2A 3VRQA 4CFRA 1XO5A 2VRGA 3S0BA 1WLMA 4DRWA 1C7VA 5ER5A 3BUWB 4DUQA 1RFJA 3NHIA 2PALA 2NZ0A 1NX2A 1IH0A 4JD9A 3V2LA 3EVRA 3LLEA 1DT7B 2JXCA 1B1GA 1D1OA 3S0EA 2KI6D 1WRKA 5I2QA 1A2XA 1GJYA 1NCXA 2HQ8A 2LP2A 5HL1A 1JWDA 2WCJA 4INWA 3I5GB 2JZIA 2KAXA 2PVBA 2SASA 3OBVA 2M9GA 3DD4A 1NWDA 2ISDA 1SR6C 4DIRA 3WNXB 1BT6A 1VRKA 2CXJA 1M39A 4L9MA 3K21A 1CNPA 3D74A 1OOJA 3IQQA 4MRXA 1L2OB 4JPZB 1GGWA 1F54A 2KAYA 1C07A 1CLMA 3L4LA 1NIWA 1UP5A 1FI5A 1G33A 1ZOTB 1PSBA 3D75A 5J3XA 1BLQA 1FW4A 5ER4X 1S26D 1IIOA 3PLFB 1CFFA 1J7PA 3N7HA 3PN7B 2WCFA 5DKNA 3PJIA 2G2BA 2H61A 4TNCA 3VRRA 4PHMA 1B9AA 3L47A 5FI6A 2E6WA 3DY9A 2A4JA 1RWYA 4MN0A 2BL0C 1OW4A 1CKKA 1KFUS 4GBAA 1NCYA 1KFUL 1CB1A 5DKQA 3S0FA 2LUXA 2ERBA 1MXEA 1W7IB 1Y0VH 2L2CA 2M1UA 5AERA 2EHBA 3L4AA 3DVEA 3TDUA 1B8LA 1A75B 2BCAA 1SMGA 3D0YB 4Q04A 4AQJA 3S0DA 1MUXA 2JT3A 1TNWA 3D0YA 1MXLC 2WCEA 1A03A 1NPQA 4PE1A 2JPTA 2P71A 3NGVA 5DKRA 1QLKA 2LAPA 1N2DA 3TS5B 1F55A 2OTGB 1ALWA 5TNCA 1CLLA 1WLZA 3D76A 1EXRA 1FF1A 2LNKA 3JTDC 2BCBA 4I5JA 1CMGA 3K1EA 1TIZA 5F6TA 1TWOA 2KGRA 2JPOA 2K7BA 3SG6A 2KGBC 1JF2A 1Q80A 1RK9A 4FTGA 2QPTA 4XYNA 4I5LB 1IJ5A 1KSOA 3R1VA 5PALA 1JUOA 1AP4A 3NXAA 3PATA 2JTZA 1TNPA 1AJ4A 1QATA 4ORCB 1K9UA 1OZSA 1Y6WA 2M7NA 3OB2B 1TNXA 4USLA 3PALA 4GGFA 3D73A 2EC6B 2QEOA 4PHKA 3M0WA 1BU3A 1EG4A 2ZRSA 3DXLA 1Z4HA 3OB1B 2F3ZA 2KFFA 1KFXL 1S5GY 1S3PA 1CLBA 2Y5IA 4OVNF 1OMVA 1OSAA 2Q91A 1BMOA 2COLB 2MJWB 1BJFA 3VRNA 2JU0A 1UURA 1DJYA 3TUYC 1B8CA 1SL8A 3CABA 3KEVA 4ORAB 1DF0B 3CLNA 4IJ7A 2B1UA 3SG5A 1EL4A 1UHJA 1N65A 2BE6A 2F3YA 4PDZA 1SY9A 4YGEB 3SG2A 1XFZO 1J7QA 2LP3A 4YI8A 4JWQA 1DJGA 1QLSA
chains in the Genus database with same CATH topology
1PRWA 1BODA 2AAOA 4GUKA 2M29A 2F33A 1SYMA 1DGVA 3PFVA 4ETOA 1J55A 1FPWA 3JVTB 3BUOB 1QVIZ 4OR9B 3CGAA 4P5OE 4ZCVA 1WRZA 1ALVA 2MA2A 3ZNIA 3VRPA 4AOMA 1AHRA 1UWOA 1S6IA 3BYAA 4PHJA 5AEQA 4C0JA 1IKUA 2M49B 2OS8C 1JBAA 3SG4A 2WOSA 1NCZA 1QJTA 1YR5A 3RM1A 5HKYA 1BOCA 5B8IB 2KYCA 3DVKA 3A8RA 2M3WA 2GGMA 2L51A 4NDBA 4A4BA 4CFQA 2K0JA 3ZWHA 1R2UA 2KYFA 1B8RA 3BUXB 5D69A 1K9PA 1S1EA 3TDZA 4MRYA 2CNPA 1LKJA 3LK1A 1PVAA 4BY5A 4C0LA 4PHNA 2JULA 1AJ5A 2KBIA 2M8UA 4MEWA 4D1EA 2BL0B 1KCYA 3I5HC 1GGZA 1KSMA 3C1VA 1CFPA 1JC2A 1KK8B 1CDNA 2LHLA 2QACA 1S6CA 1TRFA 1XA5A 1DJXA 2LLUA 1YTZC 4ORBB 4GAOA 2K2AA 2O60A 3AAJA 4P2YB 3FWBA 2P6BB 1MF8B 2KI4C 1WDCB 3LK0A 1MHOA 1UHNA 1Y1XA 5CSFA 2MHHA 2KOTA 2JT8A 1KQMC 4YGAA 4HSZA 1EG3A 1DJIA 3JTDB 2F8PA 1NX1A 5HKZA 3HCMA 4YGBB 2FJUB 4ZCUA 5D7FA 2L5XB 1BF5A 1DJWA 1OZOA 1RECA 1HQVA 3TZ1A 1UHIA 1V1FA 2ZNDA 3BOWB 3TDIA 3GOFA 1DGUA 1IQ3A 1KQVA 4OV2A 1PULA 3BOWA 1JFKA 4I5KA 5HKWA 1DVIA 1ODBA 5AANA 1B4CA 2BKIB 2BKHB 2K2FA 2FCEA 1E8AA 1KWOC 4MBEA 1DTLA 2RGIA 2L50A 1K2HA 2PRUA 1H8BA 2EGDA 1PALA 5AXIA 2KSPA 3BXKA 3VGOA 4YI9A 3SJSA 2L98A 3GK4X 1RJVA 2MLFC 3WXAA 4DCKA 1SW8A 2KQYA 1GQMA 1QIVA 3E3RA 4PE7A 1LINA 3PN7C 2HETA 3VROA 3I5IC 1DJZA 1NSHA 3I5FB 2KFGA 3IF7A 1J1DA 2NLNA 3O6BA 4CLNA 3KF9A 4GGFC 2BECA 1KFXS 2K7CA 3IQOA 1HT9A 1XFXO 2CTNA 3EVVA 5FYXA 5I8NA 2PSRA 1YRTB 5KSZA 1XFYO 2FCDA 4N1GA 1ZMZA 4CIDA 1RROA 1MQ1A 3EK7A 1DJHA 1NX3A 1CMFA 1OE9B 1JFJA 2LM5A 1C7WA 2NCOA 1OMRA 2LVJA 3SG7A 1M45A 1QVIY 1R6PA 3HX4A 1G4YR 5GQQC 3PM8A 2OPOA 1QIWA 2PMYA 1IG5A 2OS8B 3CR4X 1AUIB 4WRIA 3TS5C 1A29A 1CDLA 2L2EA 3OP0A 3A4UB 3NSLA 1KK7Z 2PASA 4NQGA 2MLEC 4YRUA 4WQ2A 1F71A 4YGDB 2L4IA 4HRHA 1SBJA 3OX6A 2WCBA 1S36A 2I18A 1W7JB 4I5NB 3BUMB 2IS9A 3RLZA 1K93D 1U5IA 1SR6B 4YGCB 3WHTB 1QV1A 1QTXA 1ZUZA 3I5HB 3SIAA 3O78A 1XK4C 1QV0A 1K8UA 3D10A 1K90D 1IWQA 1YVHA 3AKBA 5HYDA 1NX0A 3AKAA 1QX2A 4A4CA 3MSEB 5KU1A 2LMTA 1WRLA 2LE9B 1LA0A 1F8HA 1CDMA 1F70A 2Y4QA 2V53A 1SPYA 3EVUA 4UPGA 1JF0A 3PSRA 1SNLA 3AAKA 1M63B 3GK1A 4N5XA 1SL7A 2JRFA 2ZRTA 5K89A 1CFDA 1YURA 1EJ3A 1B7TZ 1S6JA 1K96A 1KQMB 2ZFDA 2TN4A 2K8MB 3KHEA 2M1KB 3DF0B 3DVMA 5AFPA 3DF0A 4YBHB 2LUCA 3EK4A 2F2OA 3O2PA 3KO0A 3DVJA 2H2KA 1YUTA 4ICBA 1PK0D 1SCMC 2KQ6A 1FBVA 3JVTC 2I7AA 1L7ZA 4U8DA 1OQPA 2M0RA 2LCPA 4MZJA 2L4HA 4M2QA 3CS1A 4MZLA 2NCPA 1TCFA 4CPVA 1KWOB 3OHMB 1QS7A 1V1GA 1XVJA 1F4OA 1TN4A 1IRJA 1K9KA 3SIBA 3CTNA 2KAVA 4WQ3A 4NDDA 1YUUA 1CTRA 2F2PA 3O4YA 4C0KA 4FQOA 1M46A 4MSPA 2D8NA 1SKTA 4GNKB 3CR2A 2LVKA 4MVFA 2LC5A 4AQIA 2MRDA 1CDPA 5JJGA 3FS7A 2M97A 2LMVA 3NSIA 1IJ6A 1TNQA 1FI6A 2O5GA 1CM1A 3I5IB 5BPJA 5IBWA 1ZACA 2K61A 5HLVA 2KDHA 2E30A 2WNDA 3I5GC 1F4QA 4GFTA 3KPXA 1LA3A 2LLSA 2Y1NA 1IQ5A 3EKJA 3NSOA 3LCPC 2I94A 2K7OA 2LV7A 2LANA 4JQ0D 2ZKMX 5JOLA 2ZN9A 2Q4UA 4QJ4B 1KK8C 1MWNA 3OX5A 4PALA 1SL9A 3TUYB 2K7DA 5CSJA 1L2OC 3F45A 2CBLA 4PCWA 1YX8A 1CM4A 1A75A 3EKHA 1WDCC 5HLOA 1OMDA 2GV5A 2HPSA 2KI6C 1LVCD 4OKHA 1AK8A 3BQ3A 1QX5B 3NSKA 2H61C 3GK2A 3WHUB 1LXFC 1K94A 1RTP1 5CSIA 2LVVA 1IGVA 2JT0A 1QASA 2KHNA 1B47A 1NP8A 1QXPA 2KNEA 1Y1AA 1KK7Y 4M2PA 1TCOB 2KBMA 1K95A 1QX7A 4IL1A 2M7LA 2JTTA 5CSNA 2DOQA 2LHIA 1JSAA 4R1EA 2JXLA 2HQWA 1M31A 2CT9A 2LMUA 1J1EA 1XFWO 2WC8A 3QRXA 4M2OA 1XK4A 1XYDA 4QJ5B 2JWWA 4MZKA 1DMOA 5CPVA 2JC2A 2OTGC 3FIAA 2FOTA 1SK6D 4MLWA 1BG1A 1SRAA 2AMIA 4GGNA 3EK8A 1UUSA 1XFUO 1NUBA 3CR5X 1BR4B 2ZNEA 1UHKA 5I2LA 2CCMA 2R2IA 3CWGA 2BCXA 1U5IB 3CZTX 4E68A 2BBMA 1DF0A 1A4PA 2JNFA 2WORA 3ICBA 1MR8A 1YRUB 3BUNB 4BY4A 1J7OA 1WY9A 1H4BA 4XJKB 1PSRA 1B7TY 1XFVO 2GGZA 2I2RE 1SCVA 2AUCA 2BE4A 2KFHA 2ZN8A 1BR1B 1N0YA 2HF5A 1X02A 1S5GZ 4XJKA 5KTYA 1Y1UA 2EC6C 2MAZA 1CFCA 4N1FA 1YUSA 3I5FC 3FWCA 4HREE 3SG3A 1UHHA 4DS7A 1YX7A 4PE0A 4PE4A 1SCMB 2JOJA 2BBNA 3LL8B 2KI4B 1TTXA 1J7RA 2LVIA 2G9BA 2JNXA 1PVBA 3H4SE 2SCPA 1NYAA 2Y1MA 5G08A 1G8IA 4F0ZB 5I2OA 1TOPA 2L0PA 4QJ3B 1AVSA 1YVLA 2NXQA 2MBXA 4HRGA 2LLTA 4GPLB 4NDCA 4OCIA 1ZFSA 2JQ6A 1EH2A 3VRQA 4CFRA 1XO5A 2VRGA 1WLMA 4DRWA 1C7VA 5ER5A 3BUWB 4DUQA 1RFJA 2PALA 2NZ0A 1NX2A 1IH0A 3EVRA 3LLEA 1DT7B 2JXCA 1B1GA 1D1OA 2KI6D 1WRKA 5I2QA 1A2XA 1GJYA 1NCXA 2HQ8A 2LP2A 1JWDA 3I5GB 2JZIA 2KAXA 2PVBA 2SASA 2M9GA 3DD4A 1NWDA 2ISDA 1SR6C 4DIRA 3WNXB 1BT6A 1VRKA 2CXJA 1M39A 4L9MA 3K21A 1CNPA 1OOJA 3IQQA 4MRXA 1L2OB 4JPZB 1GGWA 1F54A 2KAYA 1C07A 1CLMA 1FI5A 1NIWA 1UP5A 1G33A 1ZOTB 1PSBA 5J3XA 1BLQA 1FW4A 5ER4X 1S26D 3PLFB 1CFFA 1J7PA 3PN7B 2WCFA 5DKNA 2G2BA 2H61A 4TNCA 3VRRA 4PHMA 1B9AA 2E6WA 2A4JA 1RWYA 4MN0A 2BL0C 1CKKA 1KFUS 4GBAA 1NCYA 1KFUL 1CB1A 5DKQA 2LUXA 5AERA 1MXEA 1W7IB 1Y0VH 2M1UA 2EHBA 3DVEA 3TDUA 1B8LA 1A75B 2BCAA 1SMGA 3D0YB 4Q04A 4AQJA 1MUXA 2JT3A 1TNWA 3D0YA 1MXLC 2WCEA 1A03A 1NPQA 4PE1A 2JPTA 5DKRA 1QLKA 2LAPA 1N2DA 3TS5B 1F55A 2OTGB 1ALWA 5TNCA 1CLLA 1WLZA 1EXRA 1FF1A 2LNKA 3JTDC 2BCBA 4I5JA 1CMGA 1TIZA 5F6TA 2KGRA 2K7BA 3SG6A 2KGBC 1JF2A 1Q80A 1RK9A 4FTGA 2QPTA 4XYNA 4I5LB 1IJ5A 1KSOA 5PALA 1JUOA 1AP4A 3NXAA 3PATA 2JTZA 1TNPA 1AJ4A 1QATA 4ORCB 1K9UA 1OZSA 1Y6WA 2M7NA 3OB2B 1TNXA 4USLA 3PALA 4GGFA 2EC6B 4PHKA 3M0WA 1BU3A 1EG4A 2ZRSA 3OB1B 2F3ZA 2KFFA 1KFXL 1S5GY 1S3PA 1CLBA 2Y5IA 4OVNF 1OMVA 1OSAA 2Q91A 1BMOA 2COLB 2MJWB 1BJFA 3VRNA 2JU0A 1UURA 1DJYA 3TUYC 1B8CA 1SL8A 3KEVA 4ORAB 1DF0B 3CLNA 2B1UA 3SG5A 1EL4A 1UHJA 1N65A 2BE6A 2F3YA 4PDZA 1SY9A 4YGEB 3SG2A 1XFZO 1J7QA 2LP3A 4YI8A 4JWQA 1DJGA 1QLSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PRW A;  1BOD A;  2AAO A;  4GUK A;  2M29 A;  2F33 A;  1SYM A;  1DGV A;  3PFV A;  4ETO A;  1J55 A;  1FPW A;  3JVT B;  3BUO B;  1QVI Z;  4OR9 B;  3CGA A;  4P5O E;  4ZCV A;  1WRZ A;  1ALV A;  2MA2 A;  3ZNI A;  3VRP A;  4AOM A;  1AHR A;  1UWO A;  1S6I A;  3BYA A;  4PHJ A;  5AEQ A;  4C0J A;  1IKU A;  2M49 B;  2OS8 C;  1JBA A;  3SG4 A;  2WOS A;  1NCZ A;  1QJT A;  1YR5 A;  3RM1 A;  5HKY A;  1BOC A;  5B8I B;  2KYC A;  3DVK A;  3A8R A;  2M3W A;  2GGM A;  2L51 A;  4NDB A;  4A4B A;  4CFQ A;  2K0J A;  3ZWH A;  1R2U A;  2KYF A;  1B8R A;  3BUX B;  5D69 A;  1K9P A;  1S1E A;  3TDZ A;  4MRY A;  2CNP A;  1LKJ A;  3LK1 A;  1PVA A;  4BY5 A;  4C0L A;  4PHN A;  2JUL A;  1AJ5 A;  2KBI A;  2M8U A;  4MEW A;  4D1E A;  2BL0 B;  1KCY A;  3I5H C;  1GGZ A;  1KSM A;  3C1V A;  1CFP A;  1JC2 A;  1KK8 B;  1CDN A;  2LHL A;  2QAC A;  1S6C A;  1TRF A;  1XA5 A;  1DJX A;  2LLU A;  1YTZ C;  4ORB B;  4GAO A;  2K2A A;  2O60 A;  3AAJ A;  4P2Y B;  3FWB A;  2P6B B;  1MF8 B;  2KI4 C;  1WDC B;  3LK0 A;  1MHO A;  1UHN A;  1Y1X A;  5CSF A;  2MHH A;  2KOT A;  2JT8 A;  1KQM C;  4YGA A;  4HSZ A;  1EG3 A;  1DJI A;  3JTD B;  2F8P A;  1NX1 A;  5HKZ A;  3HCM A;  4YGB B;  2FJU B;  4ZCU A;  5D7F A;  2L5X B;  1BF5 A;  1DJW A;  1OZO A;  1REC A;  1HQV A;  3TZ1 A;  1UHI A;  1V1F A;  2ZND A;  3BOW B;  3TDI A;  3GOF A;  1DGU A;  1IQ3 A;  1KQV A;  4OV2 A;  1PUL A;  3BOW A;  1JFK A;  4I5K A;  5HKW A;  1DVI A;  1ODB A;  5AAN A;  1B4C A;  2BKI B;  2BKH B;  2K2F A;  2FCE A;  1E8A A;  1KWO C;  4MBE A;  1DTL A;  2RGI A;  2L50 A;  1K2H A;  2PRU A;  1H8B A;  2EGD A;  1PAL A;  5AXI A;  2KSP A;  3BXK A;  3VGO A;  4YI9 A;  3SJS A;  2L98 A;  3GK4 X;  1RJV A;  2MLF C;  3WXA A;  4DCK A;  1SW8 A;  2KQY A;  1GQM A;  1QIV A;  3E3R A;  4PE7 A;  1LIN A;  3PN7 C;  2HET A;  3VRO A;  3I5I C;  1DJZ A;  1NSH A;  3I5F B;  2KFG A;  3IF7 A;  1J1D A;  2NLN A;  3O6B A;  4CLN A;  3KF9 A;  4GGF C;  2BEC A;  1KFX S;  2K7C A;  3IQO A;  1HT9 A;  1XFX O;  2CTN A;  3EVV A;  5FYX A;  5I8N A;  2PSR A;  1YRT B;  5KSZ A;  1XFY O;  2FCD A;  4N1G A;  1ZMZ A;  4CID A;  1RRO A;  1MQ1 A;  3EK7 A;  1DJH A;  1NX3 A;  1CMF A;  1OE9 B;  1JFJ A;  2LM5 A;  1C7W A;  2NCO A;  1OMR A;  2LVJ A;  3SG7 A;  1M45 A;  1QVI Y;  1R6P A;  3HX4 A;  1G4Y R;  5GQQ C;  3PM8 A;  2OPO A;  1QIW A;  2PMY A;  1IG5 A;  2OS8 B;  3CR4 X;  1AUI B;  4WRI A;  3TS5 C;  1A29 A;  1CDL A;  2L2E A;  3OP0 A;  3A4U B;  3NSL A;  1KK7 Z;  2PAS A;  4NQG A;  2MLE C;  4YRU A;  4WQ2 A;  1F71 A;  4YGD B;  2L4I A;  4HRH A;  1SBJ A;  3OX6 A;  2WCB A;  1S36 A;  2I18 A;  1W7J B;  4I5N B;  3BUM B;  2IS9 A;  3RLZ A;  1K93 D;  1U5I A;  1SR6 B;  4YGC B;  3WHT B;  1QV1 A;  1QTX A;  1ZUZ A;  3I5H B;  3SIA A;  3O78 A;  1XK4 C;  1QV0 A;  1K8U A;  3D10 A;  1K90 D;  1IWQ A;  1YVH A;  3AKB A;  5HYD A;  1NX0 A;  3AKA A;  1QX2 A;  4A4C A;  3MSE B;  5KU1 A;  2LMT A;  1WRL A;  2LE9 B;  1LA0 A;  1F8H A;  1CDM A;  1F70 A;  2Y4Q A;  2V53 A;  1SPY A;  3EVU A;  4UPG A;  1JF0 A;  3PSR A;  1SNL A;  3AAK A;  1M63 B;  3GK1 A;  4N5X A;  1SL7 A;  2JRF A;  2ZRT A;  5K89 A;  1CFD A;  1YUR A;  1EJ3 A;  1B7T Z;  1S6J A;  1K96 A;  1KQM B;  2ZFD A;  2TN4 A;  2K8M B;  3KHE A;  2M1K B;  3DF0 B;  3DVM A;  5AFP A;  3DF0 A;  4YBH B;  2LUC A;  3EK4 A;  2F2O A;  3O2P A;  3KO0 A;  3DVJ A;  2H2K A;  1YUT A;  4ICB A;  1PK0 D;  1SCM C;  2KQ6 A;  1FBV A;  3JVT C;  2I7A A;  1L7Z A;  4U8D A;  1OQP A;  2M0R A;  2LCP A;  4MZJ A;  2L4H A;  4M2Q A;  3CS1 A;  4MZL A;  2NCP A;  1TCF A;  4CPV A;  1KWO B;  3OHM B;  1QS7 A;  1V1G A;  1XVJ A;  1F4O A;  1TN4 A;  1IRJ A;  1K9K A;  3SIB A;  3CTN A;  2KAV A;  4WQ3 A;  4NDD A;  1YUU A;  1CTR A;  2F2P A;  3O4Y A;  4C0K A;  4FQO A;  1M46 A;  4MSP A;  2D8N A;  1SKT A;  4GNK B;  3CR2 A;  2LVK A;  4MVF A;  2LC5 A;  4AQI A;  2MRD A;  1CDP A;  5JJG A;  3FS7 A;  2M97 A;  2LMV A;  3NSI A;  1IJ6 A;  1TNQ A;  1FI6 A;  2O5G A;  1CM1 A;  3I5I B;  5BPJ A;  5IBW A;  1ZAC A;  2K61 A;  5HLV A;  2KDH A;  2E30 A;  2WND A;  3I5G C;  1F4Q A;  4GFT A;  3KPX A;  1LA3 A;  2LLS A;  2Y1N A;  1IQ5 A;  3EKJ A;  3NSO A;  3LCP C;  2I94 A;  2K7O A;  2LV7 A;  2LAN A;  4JQ0 D;  2ZKM X;  5JOL A;  2ZN9 A;  2Q4U A;  4QJ4 B;  1KK8 C;  1MWN A;  3OX5 A;  4PAL A;  1SL9 A;  3TUY B;  2K7D A;  5CSJ A;  1L2O C;  3F45 A;  2CBL A;  4PCW A;  1YX8 A;  1CM4 A;  1A75 A;  3EKH A;  1WDC C;  5HLO A;  1OMD A;  2GV5 A;  2HPS A;  2KI6 C;  1LVC D;  4OKH A;  1AK8 A;  3BQ3 A;  1QX5 B;  3NSK A;  2H61 C;  3GK2 A;  3WHU B;  1LXF C;  1K94 A;  1RTP 1;  5CSI A;  2LVV A;  1IGV A;  2JT0 A;  1QAS A;  2KHN A;  1B47 A;  1NP8 A;  1QXP A;  2KNE A;  1Y1A A;  1KK7 Y;  4M2P A;  1TCO B;  2KBM A;  1K95 A;  1QX7 A;  4IL1 A;  2M7L A;  2JTT A;  5CSN A;  2DOQ A;  2LHI A;  1JSA A;  4R1E A;  2JXL A;  2HQW A;  1M31 A;  2CT9 A;  2LMU A;  1J1E A;  1XFW O;  2WC8 A;  3QRX A;  4M2O A;  1XK4 A;  1XYD A;  4QJ5 B;  2JWW A;  4MZK A;  1DMO A;  5CPV A;  2JC2 A;  2OTG C;  3FIA A;  2FOT A;  1SK6 D;  4MLW A;  1BG1 A;  1SRA A;  2AMI A;  4GGN A;  3EK8 A;  1UUS A;  1XFU O;  1NUB A;  3CR5 X;  1BR4 B;  2ZNE A;  1UHK A;  5I2L A;  2CCM A;  2R2I A;  3CWG A;  2BCX A;  1U5I B;  3CZT X;  4E68 A;  2BBM A;  1DF0 A;  1A4P A;  2JNF A;  2WOR A;  3ICB A;  1MR8 A;  1YRU B;  3BUN B;  4BY4 A;  1J7O A;  1WY9 A;  1H4B A;  4XJK B;  1PSR A;  1B7T Y;  1XFV O;  2GGZ A;  2I2R E;  1SCV A;  2AUC A;  2BE4 A;  2KFH A;  2ZN8 A;  1BR1 B;  1N0Y A;  2HF5 A;  1X02 A;  1S5G Z;  4XJK A;  5KTY A;  1Y1U A;  2EC6 C;  2MAZ A;  1CFC A;  4N1F A;  1YUS A;  3I5F C;  3FWC A;  4HRE E;  3SG3 A;  1UHH A;  4DS7 A;  1YX7 A;  4PE0 A;  4PE4 A;  1SCM B;  2JOJ A;  2BBN A;  3LL8 B;  2KI4 B;  1TTX A;  1J7R A;  2LVI A;  2G9B A;  2JNX A;  1PVB A;  3H4S E;  2SCP A;  1NYA A;  2Y1M A;  5G08 A;  1G8I A;  4F0Z B;  5I2O A;  1TOP A;  2L0P A;  4QJ3 B;  1AVS A;  1YVL A;  2NXQ A;  2MBX A;  4HRG A;  2LLT A;  4GPL B;  4NDC A;  4OCI A;  1ZFS A;  2JQ6 A;  1EH2 A;  3VRQ A;  4CFR A;  1XO5 A;  2VRG A;  1WLM A;  4DRW A;  1C7V A;  5ER5 A;  3BUW B;  4DUQ A;  1RFJ A;  2PAL A;  2NZ0 A;  1NX2 A;  1IH0 A;  3EVR A;  3LLE A;  1DT7 B;  2JXC A;  1B1G A;  1D1O A;  2KI6 D;  1WRK A;  5I2Q A;  1A2X A;  1GJY A;  1NCX A;  2HQ8 A;  2LP2 A;  1JWD A;  3I5G B;  2JZI A;  2KAX A;  2PVB A;  2SAS A;  2M9G A;  3DD4 A;  1NWD A;  2ISD A;  1SR6 C;  4DIR A;  3WNX B;  1BT6 A;  1VRK A;  2CXJ A;  1M39 A;  4L9M A;  3K21 A;  1CNP A;  1OOJ A;  3IQQ A;  4MRX A;  1L2O B;  4JPZ B;  1GGW A;  1F54 A;  2KAY A;  1C07 A;  1CLM A;  1FI5 A;  1NIW A;  1UP5 A;  1G33 A;  1ZOT B;  1PSB A;  5J3X A;  1BLQ A;  1FW4 A;  5ER4 X;  1S26 D;  3PLF B;  1CFF A;  1J7P A;  3PN7 B;  2WCF A;  5DKN A;  2G2B A;  2H61 A;  4TNC A;  3VRR A;  4PHM A;  1B9A A;  2E6W A;  2A4J A;  1RWY A;  4MN0 A;  2BL0 C;  1CKK A;  1KFU S;  4GBA A;  1NCY A;  1KFU L;  1CB1 A;  5DKQ A;  2LUX A;  5AER A;  1MXE A;  1W7I B;  1Y0V H;  2M1U A;  2EHB A;  3DVE A;  3TDU A;  1B8L A;  1A75 B;  2BCA A;  1SMG A;  3D0Y B;  4Q04 A;  4AQJ A;  1MUX A;  2JT3 A;  1TNW A;  3D0Y A;  1MXL C;  2WCE A;  1A03 A;  1NPQ A;  4PE1 A;  2JPT A;  5DKR A;  1QLK A;  2LAP A;  1N2D A;  3TS5 B;  1F55 A;  2OTG B;  1ALW A;  5TNC A;  1CLL A;  1WLZ A;  1EXR A;  1FF1 A;  2LNK A;  3JTD C;  2BCB A;  4I5J A;  1CMG A;  1TIZ A;  5F6T A;  2KGR A;  2K7B A;  3SG6 A;  2KGB C;  1JF2 A;  1Q80 A;  1RK9 A;  4FTG A;  2QPT A;  4XYN A;  4I5L B;  1IJ5 A;  1KSO A;  5PAL A;  1JUO A;  1AP4 A;  3NXA A;  3PAT A;  2JTZ A;  1TNP A;  1AJ4 A;  1QAT A;  4ORC B;  1K9U A;  1OZS A;  1Y6W A;  2M7N A;  3OB2 B;  1TNX A;  4USL A;  3PAL A;  4GGF A;  2EC6 B;  4PHK A;  3M0W A;  1BU3 A;  1EG4 A;  2ZRS A;  3OB1 B;  2F3Z A;  2KFF A;  1KFX L;  1S5G Y;  1S3P A;  1CLB A;  2Y5I A;  4OVN F;  1OMV A;  1OSA A;  2Q91 A;  1BMO A;  2COL B;  2MJW B;  1BJF A;  3VRN A;  2JU0 A;  1UUR A;  1DJY A;  3TUY C;  1B8C A;  1SL8 A;  3KEV A;  4ORA B;  1DF0 B;  3CLN A;  2B1U A;  3SG5 A;  1EL4 A;  1UHJ A;  1N65 A;  2BE6 A;  2F3Y A;  4PDZ A;  1SY9 A;  4YGE B;  3SG2 A;  1XFZ O;  1J7Q A;  2LP3 A;  4YI8 A;  4JWQ A;  1DJG A;  1QLS A; 
#chains in the Genus database with same CATH topology
 3FE8 A;  3SS5 A;  1PRW A;  1BOD A;  2AAO A;  4GUK A;  2M29 A;  2F33 A;  2QDI A;  1SYM A;  1DGV A;  3PFV A;  4ETO A;  1J55 A;  1FPW A;  3JVT B;  2P70 A;  3BUO B;  1QVI Z;  4OR9 B;  3CGA A;  4P5O E;  4ZCV A;  5I94 A;  1WRZ A;  1ALV A;  2MA2 A;  3ZNI A;  3VRP A;  4AOM A;  1AHR A;  1UWO A;  1S6I A;  3BYA A;  4PHJ A;  5AEQ A;  3VB1 A;  2WC6 A;  3CYZ A;  4C0J A;  1IKU A;  2M49 B;  2OS8 C;  1JBA A;  3SG4 A;  2WOS A;  1NCZ A;  1QJT A;  1YR5 A;  3CZ0 A;  3EG5 B;  3RM1 A;  5HKY A;  1BOC A;  5B8I B;  2KYC A;  3DVK A;  3A8R A;  2M3W A;  2GGM A;  2L51 A;  4NDB A;  4A4B A;  4CFQ A;  2K0J A;  3ZWH A;  1R2U A;  2KYF A;  1B8R A;  3BUX B;  5D69 A;  1K9P A;  1S1E A;  3TDZ A;  4MRY A;  2CNP A;  2YGU A;  1LKJ A;  3LK1 A;  1PVA A;  4BY5 A;  4C0L A;  2WCL A;  4PHN A;  2JUL A;  1AJ5 A;  2KBI A;  2M8U A;  4MEW A;  3UO9 A;  2BL0 B;  3SS4 A;  4D1E A;  3I5H C;  1KCY A;  1GGZ A;  1KSM A;  2K60 A;  3C1V A;  1CFP A;  1JC2 A;  1KK8 B;  1TUJ A;  1CDN A;  4F7F A;  1T14 A;  2LHL A;  4KYN A;  2QAC A;  1S6C A;  1TRF A;  1XA5 A;  1DJX A;  4JKT A;  2LLU A;  1YTZ C;  1GM0 A;  4ORB B;  4GAO A;  2K2A A;  2O60 A;  3AAJ A;  4P2Y B;  3FWB A;  2P6B B;  1MF8 B;  2KI4 C;  1WDC B;  3NHT A;  5DIC A;  3LK0 A;  1MHO A;  1UHN A;  3DYE A;  1Y1X A;  5CSF A;  2MHH A;  2KOT A;  2JT8 A;  1OOI X;  1KQM C;  4YGA A;  4HSZ A;  1EG3 A;  1OOH A;  1DJI A;  3JTD B;  2F8P A;  1NX1 A;  5HKZ A;  3HCM A;  4YGB B;  2FJU B;  4ZCU A;  1DC1 A;  5D7F A;  2L5X B;  1BF5 A;  1DJW A;  1OZO A;  1REC A;  1HQV A;  3BFA A;  3TZ1 A;  1UHI A;  1V1F A;  2ZND A;  3QME A;  3BOW B;  3TDI A;  3GOF A;  1DGU A;  1IQ3 A;  1KQV A;  4OV2 A;  1PUL A;  3BOW A;  1JFK A;  4I5K A;  5HKW A;  1DVI A;  1ODB A;  5AAN A;  1B4C A;  2BKI B;  2BKH B;  2GTE A;  2K2F A;  5EL2 A;  2FCE A;  1E8A A;  1KWO C;  4MBE A;  1DTL A;  2RGI A;  2L50 A;  1K2H A;  2PRU A;  1H8B A;  2EGD A;  4PT1 A;  1PAL A;  5AXI A;  2KSP A;  3BXK A;  3BFB A;  4YI9 A;  3SJS A;  2L98 A;  3GK4 X;  1P28 A;  1RJV A;  2MLF C;  3WXA A;  4DCK A;  1SW8 A;  2KQY A;  1GQM A;  1QIV A;  3E3R A;  4PE7 A;  1LIN A;  3PN7 C;  2HET A;  3VRO A;  3I5I C;  1TUZ A;  1DJZ A;  1NSH A;  2KPH A;  3I5F B;  2KFG A;  3IF7 A;  1J1D A;  2L5Y A;  2NLN A;  3O6B A;  3KF9 A;  4GGF C;  4CLN A;  2BEC A;  1KFX S;  2K7C A;  3IQO A;  1HT9 A;  1XFX O;  2CTN A;  3EVV A;  5FYX A;  5I8N A;  2PSR A;  3VGO A;  1YRT B;  5KSZ A;  1XFY O;  2FCD A;  4N1G A;  1ZMZ A;  2WCH A;  4CID A;  1RRO A;  1MQ1 A;  3EK7 A;  1DJH A;  1NX3 A;  1CMF A;  1OE9 B;  1JFJ A;  2LM5 A;  1C7W A;  2NCO A;  1OMR A;  2LVJ A;  3SG7 A;  1M45 A;  1QVI Y;  1R6P A;  3HX4 A;  1G4Y R;  5GQQ C;  3PM8 A;  2OPO A;  1QIW A;  2PMY A;  3S0A A;  1IG5 A;  2OS8 B;  3CR4 X;  3S0G A;  1AUI B;  4WRI A;  3TS5 C;  1A29 A;  1CDL A;  2L2E A;  3OP0 A;  3A4U B;  3NSL A;  4INX A;  1KK7 Z;  3B88 A;  2PAS A;  4NQG A;  2MLE C;  4YRU A;  4WQ2 A;  1F71 A;  4YGD B;  2L4I A;  4HRH A;  1SBJ A;  3OX6 A;  2WCB A;  3CZ2 A;  1S36 A;  2I18 A;  1W7J B;  4I5N B;  3BUM B;  2IS9 A;  3RLZ A;  1K93 D;  1U5I A;  1SR6 B;  4YGC B;  3WHT B;  1QV1 A;  4FQT A;  1QTX A;  1ZUZ A;  3I5H B;  3SIA A;  3O78 A;  3B86 A;  1XK4 C;  1QV0 A;  1K8U A;  3D10 A;  1K90 D;  1IWQ A;  1YVH A;  3AKB A;  2KLE A;  5HYD A;  1NX0 A;  3AKA A;  1QX2 A;  4A4C A;  3MSE B;  5KU1 A;  2LMT A;  1WRL A;  2LE9 B;  1LA0 A;  1F8H A;  1CDM A;  1F70 A;  2Y4Q A;  2V53 A;  1SPY A;  3EVU A;  4UPG A;  1JF0 A;  3PSR A;  1SNL A;  3AAK A;  1M63 B;  3GK1 A;  2BAP A;  2WCK A;  1SL7 A;  4N5X A;  2JRF A;  2ZRT A;  2BNX A;  1CFD A;  1YUR A;  1EJ3 A;  1B7T Z;  1S6J A;  5K89 A;  1C3Y A;  1K96 A;  1KQM B;  3R72 A;  1LS8 A;  2ZFD A;  2TN4 A;  2K8M B;  1OOF A;  1C3Z A;  3KHE A;  2M1K B;  3DF0 B;  3DVM A;  3R1P A;  5AFP A;  3DF0 A;  4YBH B;  3B87 A;  2LUC A;  3EK4 A;  3SS3 A;  2F2O A;  3O2P A;  3KO0 A;  3DVJ A;  3R1O A;  2H2K A;  1YUT A;  4ICB A;  1PK0 D;  1SCM C;  1ORG A;  2KQ6 A;  1FBV A;  3BJH A;  3JVT C;  3D78 A;  2I7A A;  1L7Z A;  4U8D A;  1OQP A;  2M0R A;  2LCP A;  4MZJ A;  2L4H A;  4M2Q A;  3CS1 A;  3O4X A;  2NCP A;  1TCF A;  4MZL A;  4CPV A;  1KWO B;  3OHM B;  3PM2 A;  1QS7 A;  1V1G A;  1XVJ A;  1F4O A;  1TN4 A;  1IRJ A;  1K9K A;  3SIB A;  3CTN A;  2KAV A;  4WQ3 A;  4NDD A;  1YUU A;  1CTR A;  2F2P A;  3O4Y A;  4C0K A;  4FQO A;  1M46 A;  4MSP A;  2D8N A;  1SKT A;  4GNK B;  3CR2 A;  2LVK A;  4MVF A;  2LC5 A;  4AQI A;  5FI7 A;  2MRD A;  1CDP A;  2H8V A;  5JJG A;  3FS7 A;  2M97 A;  2LMV A;  3NSI A;  1IJ6 A;  1TNQ A;  1FI6 A;  1DQE A;  2WC5 A;  2O5G A;  1CM1 A;  3I5I B;  5BPJ A;  5IBW A;  1ZAC A;  2K61 A;  5HLV A;  1QWV A;  2KDH A;  2E30 A;  2FJY A;  2WND A;  1F4Q A;  3I5G C;  4GFT A;  2PYQ A;  3KPX A;  1LA3 A;  2LLS A;  2Y1N A;  1IQ5 A;  3EKJ A;  3NSO A;  3LCP C;  2I94 A;  3D77 A;  2K7O A;  2LV7 A;  2LAN A;  4JQ0 D;  2ZKM X;  5JOL A;  2ZN9 A;  2Q4U A;  4QJ4 B;  1KK8 C;  1MWN A;  3OX5 A;  4PAL A;  1SL9 A;  3TUY B;  2K7D A;  5CSJ A;  1L2O C;  3F45 A;  2CBL A;  4PCW A;  1YX8 A;  1CM4 A;  1A75 A;  3EKH A;  1WDC C;  5HLO A;  1OMD A;  2GV5 A;  2HPS A;  2KI6 C;  1LVC D;  4OKH A;  1AK8 A;  3BQ3 A;  1QX5 B;  2KLD A;  2H61 C;  3NSK A;  3GK2 A;  3WHU B;  1LXF C;  1K94 A;  1RTP 1;  5CSI A;  2LVV A;  1IGV A;  2JT0 A;  1QAS A;  2KHN A;  1B47 A;  2QEH A;  1NP8 A;  3Q8I A;  1QXP A;  2KNE A;  1Y1A A;  1KK7 Y;  4M2P A;  1TCO B;  2KBM A;  1K95 A;  1QX7 A;  4IL1 A;  3BFH A;  2M7L A;  3CZ1 A;  2JTT A;  5CSN A;  2DOQ A;  2LHI A;  3FE9 A;  1JSA A;  2QEV A;  4R1E A;  2JXL A;  1OOG A;  2HQW A;  1M31 A;  2CT9 A;  2LMU A;  1J1E A;  1XFW O;  2WC8 A;  3QRX A;  4M2O A;  1XK4 A;  1XYD A;  3UNW A;  4QJ5 B;  1DEL A;  2JWW A;  4MZK A;  1DMO A;  5CPV A;  2JC2 A;  2OTG C;  3FIA A;  2FOT A;  1SK6 D;  2WCM A;  4MLW A;  1SRA A;  2AMI A;  4GGN A;  3EK8 A;  1BG1 A;  5FI2 A;  3FE6 A;  3CDN A;  1XFU O;  1UUS A;  1W9Z A;  1NUB A;  3B7A A;  3CR5 X;  1BR4 B;  3OGN A;  4OZD A;  2ZNE A;  1UHK A;  1SSE B;  5I2L A;  2CCM A;  2R2I A;  3CWG A;  2BCX A;  1U5I B;  3CZT X;  5D3O A;  4E68 A;  3DZT A;  2BBM A;  1DF0 A;  1A4P A;  2JNF A;  2WOR A;  3ICB A;  1MR8 A;  1YRU B;  3BUN B;  4BY4 A;  1J7O A;  1WY9 A;  1H4B A;  2QEB A;  4XJK B;  1PSR A;  1B7T Y;  1XFV O;  2GGZ A;  2I2R E;  1SCV A;  2AUC A;  2BE4 A;  2KFH A;  2ZN8 A;  1BR1 B;  1N0Y A;  2HF5 A;  1X02 A;  1S5G Z;  4XJK A;  5KTY A;  1DEK A;  1Y1U A;  2EC6 C;  2MAZ A;  1XFR A;  4N1F A;  1CFC A;  1YUS A;  3I5F C;  3FWC A;  4HRE E;  3SG3 A;  1UHH A;  4DS7 A;  1YX7 A;  4PE0 A;  4PE4 A;  1SCM B;  2JOJ A;  2BBN A;  3LL8 B;  3RZS A;  2KI4 B;  1TTX A;  1J7R A;  2LVI A;  2G9B A;  3IVT A;  2JNX A;  1PVB A;  3H4S E;  2SCP A;  1NYA A;  2Y1M A;  5G08 A;  1G8I A;  4F0Z B;  5I2O A;  2PQL A;  1TOP A;  2L0P A;  4QJ3 B;  1AVS A;  1YVL A;  2NXQ A;  2MBX A;  4HRG A;  2LLT A;  4GPL B;  4NDC A;  3B6X A;  4OCI A;  1ZFS A;  1Z2C B;  2JQ6 A;  1EH2 A;  3VRQ A;  4CFR A;  1XO5 A;  2VRG A;  3S0B A;  1WLM A;  4DRW A;  1C7V A;  5ER5 A;  3BUW B;  4DUQ A;  1RFJ A;  3NHI A;  2PAL A;  2NZ0 A;  1NX2 A;  1IH0 A;  4JD9 A;  3V2L A;  3EVR A;  3LLE A;  1DT7 B;  2JXC A;  1B1G A;  1D1O A;  3S0E A;  2KI6 D;  1WRK A;  5I2Q A;  1A2X A;  1GJY A;  1NCX A;  2HQ8 A;  2LP2 A;  5HL1 A;  1JWD A;  2WCJ A;  4INW A;  3I5G B;  2JZI A;  2KAX A;  2PVB A;  2SAS A;  3OBV A;  2M9G A;  3DD4 A;  1NWD A;  2ISD A;  1SR6 C;  4DIR A;  3WNX B;  1BT6 A;  1VRK A;  2CXJ A;  1M39 A;  4L9M A;  3K21 A;  1CNP A;  3D74 A;  1OOJ A;  3IQQ A;  4MRX A;  1L2O B;  4JPZ B;  1GGW A;  1F54 A;  2KAY A;  1C07 A;  1CLM A;  3L4L A;  1NIW A;  1UP5 A;  1FI5 A;  1G33 A;  1ZOT B;  1PSB A;  3D75 A;  5J3X A;  1BLQ A;  1FW4 A;  5ER4 X;  1S26 D;  1IIO A;  3PLF B;  1CFF A;  1J7P A;  3N7H A;  3PN7 B;  2WCF A;  5DKN A;  3PJI A;  2G2B A;  2H61 A;  4TNC A;  3VRR A;  4PHM A;  1B9A A;  3L47 A;  5FI6 A;  2E6W A;  3DY9 A;  2A4J A;  1RWY A;  4MN0 A;  2BL0 C;  1OW4 A;  1CKK A;  1KFU S;  4GBA A;  1NCY A;  1KFU L;  1CB1 A;  5DKQ A;  3S0F A;  2LUX A;  2ERB A;  1MXE A;  1W7I B;  1Y0V H;  2L2C A;  2M1U A;  5AER A;  2EHB A;  3L4A A;  3DVE A;  3TDU A;  1B8L A;  1A75 B;  2BCA A;  1SMG A;  3D0Y B;  4Q04 A;  4AQJ A;  3S0D A;  1MUX A;  2JT3 A;  1TNW A;  3D0Y A;  1MXL C;  2WCE A;  1A03 A;  1NPQ A;  4PE1 A;  2JPT A;  2P71 A;  3NGV A;  5DKR A;  1QLK A;  2LAP A;  1N2D A;  3TS5 B;  1F55 A;  2OTG B;  1ALW A;  5TNC A;  1CLL A;  1WLZ A;  3D76 A;  1EXR A;  1FF1 A;  2LNK A;  3JTD C;  2BCB A;  4I5J A;  1CMG A;  3K1E A;  1TIZ A;  5F6T A;  1TWO A;  2KGR A;  2JPO A;  2K7B A;  3SG6 A;  2KGB C;  1JF2 A;  1Q80 A;  1RK9 A;  4FTG A;  2QPT A;  4XYN A;  4I5L B;  1IJ5 A;  1KSO A;  3R1V A;  5PAL A;  1JUO A;  1AP4 A;  3NXA A;  3PAT A;  2JTZ A;  1TNP A;  1AJ4 A;  1QAT A;  4ORC B;  1K9U A;  1OZS A;  1Y6W A;  2M7N A;  3OB2 B;  1TNX A;  4USL A;  3PAL A;  4GGF A;  3D73 A;  2EC6 B;  2QEO A;  4PHK A;  3M0W A;  1BU3 A;  1EG4 A;  2ZRS A;  3DXL A;  1Z4H A;  3OB1 B;  2F3Z A;  2KFF A;  1KFX L;  1S5G Y;  1S3P A;  1CLB A;  2Y5I A;  4OVN F;  1OMV A;  1OSA A;  2Q91 A;  1BMO A;  2COL B;  2MJW B;  1BJF A;  3VRN A;  2JU0 A;  1UUR A;  1DJY A;  3TUY C;  1B8C A;  1SL8 A;  3CAB A;  3KEV A;  4ORA B;  1DF0 B;  3CLN A;  4IJ7 A;  2B1U A;  3SG5 A;  1EL4 A;  1UHJ A;  1N65 A;  2BE6 A;  2F3Y A;  4PDZ A;  1SY9 A;  4YGE B;  3SG2 A;  1XFZ O;  1J7Q A;  2LP3 A;  4YI8 A;  4JWQ A;  1DJG A;  1QLS A; 
#chains in the Genus database with same CATH homology
 1PRW A;  1BOD A;  2AAO A;  4GUK A;  2M29 A;  2F33 A;  1SYM A;  1DGV A;  3PFV A;  4ETO A;  1J55 A;  1FPW A;  3JVT B;  3BUO B;  1QVI Z;  4OR9 B;  3CGA A;  4P5O E;  4ZCV A;  1WRZ A;  1ALV A;  2MA2 A;  3ZNI A;  3VRP A;  4AOM A;  1AHR A;  1UWO A;  1S6I A;  3BYA A;  4PHJ A;  5AEQ A;  4C0J A;  1IKU A;  2M49 B;  2OS8 C;  1JBA A;  3SG4 A;  2WOS A;  1NCZ A;  1QJT A;  1YR5 A;  3RM1 A;  5HKY A;  1BOC A;  5B8I B;  2KYC A;  3DVK A;  3A8R A;  2M3W A;  2GGM A;  2L51 A;  4NDB A;  4A4B A;  4CFQ A;  2K0J A;  3ZWH A;  1R2U A;  2KYF A;  1B8R A;  3BUX B;  5D69 A;  1K9P A;  1S1E A;  3TDZ A;  4MRY A;  2CNP A;  1LKJ A;  3LK1 A;  1PVA A;  4BY5 A;  4C0L A;  4PHN A;  2JUL A;  1AJ5 A;  2KBI A;  2M8U A;  4MEW A;  4D1E A;  2BL0 B;  1KCY A;  3I5H C;  1GGZ A;  1KSM A;  3C1V A;  1CFP A;  1JC2 A;  1KK8 B;  1CDN A;  2LHL A;  2QAC A;  1S6C A;  1TRF A;  1XA5 A;  1DJX A;  2LLU A;  1YTZ C;  4ORB B;  4GAO A;  2K2A A;  2O60 A;  3AAJ A;  4P2Y B;  3FWB A;  2P6B B;  1MF8 B;  2KI4 C;  1WDC B;  3LK0 A;  1MHO A;  1UHN A;  1Y1X A;  5CSF A;  2MHH A;  2KOT A;  2JT8 A;  1KQM C;  4YGA A;  4HSZ A;  1EG3 A;  1DJI A;  3JTD B;  2F8P A;  1NX1 A;  5HKZ A;  3HCM A;  4YGB B;  2FJU B;  4ZCU A;  5D7F A;  2L5X B;  1BF5 A;  1DJW A;  1OZO A;  1REC A;  1HQV A;  3TZ1 A;  1UHI A;  1V1F A;  2ZND A;  3BOW B;  3TDI A;  3GOF A;  1DGU A;  1IQ3 A;  1KQV A;  4OV2 A;  1PUL A;  3BOW A;  1JFK A;  4I5K A;  5HKW A;  1DVI A;  1ODB A;  5AAN A;  1B4C A;  2BKI B;  2BKH B;  2K2F A;  2FCE A;  1E8A A;  1KWO C;  4MBE A;  1DTL A;  2RGI A;  2L50 A;  1K2H A;  2PRU A;  1H8B A;  2EGD A;  1PAL A;  5AXI A;  2KSP A;  3BXK A;  3VGO A;  4YI9 A;  3SJS A;  2L98 A;  3GK4 X;  1RJV A;  2MLF C;  3WXA A;  4DCK A;  1SW8 A;  2KQY A;  1GQM A;  1QIV A;  3E3R A;  4PE7 A;  1LIN A;  3PN7 C;  2HET A;  3VRO A;  3I5I C;  1DJZ A;  1NSH A;  3I5F B;  2KFG A;  3IF7 A;  1J1D A;  2NLN A;  3O6B A;  4CLN A;  3KF9 A;  4GGF C;  2BEC A;  1KFX S;  2K7C A;  3IQO A;  1HT9 A;  1XFX O;  2CTN A;  3EVV A;  5FYX A;  5I8N A;  2PSR A;  1YRT B;  5KSZ A;  1XFY O;  2FCD A;  4N1G A;  1ZMZ A;  4CID A;  1RRO A;  1MQ1 A;  3EK7 A;  1DJH A;  1NX3 A;  1CMF A;  1OE9 B;  1JFJ A;  2LM5 A;  1C7W A;  2NCO A;  1OMR A;  2LVJ A;  3SG7 A;  1M45 A;  1QVI Y;  1R6P A;  3HX4 A;  1G4Y R;  5GQQ C;  3PM8 A;  2OPO A;  1QIW A;  2PMY A;  1IG5 A;  2OS8 B;  3CR4 X;  1AUI B;  4WRI A;  3TS5 C;  1A29 A;  1CDL A;  2L2E A;  3OP0 A;  3A4U B;  3NSL A;  1KK7 Z;  2PAS A;  4NQG A;  2MLE C;  4YRU A;  4WQ2 A;  1F71 A;  4YGD B;  2L4I A;  4HRH A;  1SBJ A;  3OX6 A;  2WCB A;  1S36 A;  2I18 A;  1W7J B;  4I5N B;  3BUM B;  2IS9 A;  3RLZ A;  1K93 D;  1U5I A;  1SR6 B;  4YGC B;  3WHT B;  1QV1 A;  1QTX A;  1ZUZ A;  3I5H B;  3SIA A;  3O78 A;  1XK4 C;  1QV0 A;  1K8U A;  3D10 A;  1K90 D;  1IWQ A;  1YVH A;  3AKB A;  5HYD A;  1NX0 A;  3AKA A;  1QX2 A;  4A4C A;  3MSE B;  5KU1 A;  2LMT A;  1WRL A;  2LE9 B;  1LA0 A;  1F8H A;  1CDM A;  1F70 A;  2Y4Q A;  2V53 A;  1SPY A;  3EVU A;  4UPG A;  1JF0 A;  3PSR A;  1SNL A;  3AAK A;  1M63 B;  3GK1 A;  4N5X A;  1SL7 A;  2JRF A;  2ZRT A;  5K89 A;  1CFD A;  1YUR A;  1EJ3 A;  1B7T Z;  1S6J A;  1K96 A;  1KQM B;  2ZFD A;  2TN4 A;  2K8M B;  3KHE A;  2M1K B;  3DF0 B;  3DVM A;  5AFP A;  3DF0 A;  4YBH B;  2LUC A;  3EK4 A;  2F2O A;  3O2P A;  3KO0 A;  3DVJ A;  2H2K A;  1YUT A;  4ICB A;  1PK0 D;  1SCM C;  2KQ6 A;  1FBV A;  3JVT C;  2I7A A;  1L7Z A;  4U8D A;  1OQP A;  2M0R A;  2LCP A;  4MZJ A;  2L4H A;  4M2Q A;  3CS1 A;  4MZL A;  2NCP A;  1TCF A;  4CPV A;  1KWO B;  3OHM B;  1QS7 A;  1V1G A;  1XVJ A;  1F4O A;  1TN4 A;  1IRJ A;  1K9K A;  3SIB A;  3CTN A;  2KAV A;  4WQ3 A;  4NDD A;  1YUU A;  1CTR A;  2F2P A;  3O4Y A;  4C0K A;  4FQO A;  1M46 A;  4MSP A;  2D8N A;  1SKT A;  4GNK B;  3CR2 A;  2LVK A;  4MVF A;  2LC5 A;  4AQI A;  2MRD A;  1CDP A;  5JJG A;  3FS7 A;  2M97 A;  2LMV A;  3NSI A;  1IJ6 A;  1TNQ A;  1FI6 A;  2O5G A;  1CM1 A;  3I5I B;  5BPJ A;  5IBW A;  1ZAC A;  2K61 A;  5HLV A;  2KDH A;  2E30 A;  2WND A;  3I5G C;  1F4Q A;  4GFT A;  3KPX A;  1LA3 A;  2LLS A;  2Y1N A;  1IQ5 A;  3EKJ A;  3NSO A;  3LCP C;  2I94 A;  2K7O A;  2LV7 A;  2LAN A;  4JQ0 D;  2ZKM X;  5JOL A;  2ZN9 A;  2Q4U A;  4QJ4 B;  1KK8 C;  1MWN A;  3OX5 A;  4PAL A;  1SL9 A;  3TUY B;  2K7D A;  5CSJ A;  1L2O C;  3F45 A;  2CBL A;  4PCW A;  1YX8 A;  1CM4 A;  1A75 A;  3EKH A;  1WDC C;  5HLO A;  1OMD A;  2GV5 A;  2HPS A;  2KI6 C;  1LVC D;  4OKH A;  1AK8 A;  3BQ3 A;  1QX5 B;  3NSK A;  2H61 C;  3GK2 A;  3WHU B;  1LXF C;  1K94 A;  1RTP 1;  5CSI A;  2LVV A;  1IGV A;  2JT0 A;  1QAS A;  2KHN A;  1B47 A;  1NP8 A;  1QXP A;  2KNE A;  1Y1A A;  1KK7 Y;  4M2P A;  1TCO B;  2KBM A;  1K95 A;  1QX7 A;  4IL1 A;  2M7L A;  2JTT A;  5CSN A;  2DOQ A;  2LHI A;  1JSA A;  4R1E A;  2JXL A;  2HQW A;  1M31 A;  2CT9 A;  2LMU A;  1J1E A;  1XFW O;  2WC8 A;  3QRX A;  4M2O A;  1XK4 A;  1XYD A;  4QJ5 B;  2JWW A;  4MZK A;  1DMO A;  5CPV A;  2JC2 A;  2OTG C;  3FIA A;  2FOT A;  1SK6 D;  4MLW A;  1BG1 A;  1SRA A;  2AMI A;  4GGN A;  3EK8 A;  1UUS A;  1XFU O;  1NUB A;  3CR5 X;  1BR4 B;  2ZNE A;  1UHK A;  5I2L A;  2CCM A;  2R2I A;  3CWG A;  2BCX A;  1U5I B;  3CZT X;  4E68 A;  2BBM A;  1DF0 A;  1A4P A;  2JNF A;  2WOR A;  3ICB A;  1MR8 A;  1YRU B;  3BUN B;  4BY4 A;  1J7O A;  1WY9 A;  1H4B A;  4XJK B;  1PSR A;  1B7T Y;  1XFV O;  2GGZ A;  2I2R E;  1SCV A;  2AUC A;  2BE4 A;  2KFH A;  2ZN8 A;  1BR1 B;  1N0Y A;  2HF5 A;  1X02 A;  1S5G Z;  4XJK A;  5KTY A;  1Y1U A;  2EC6 C;  2MAZ A;  1CFC A;  4N1F A;  1YUS A;  3I5F C;  3FWC A;  4HRE E;  3SG3 A;  1UHH A;  4DS7 A;  1YX7 A;  4PE0 A;  4PE4 A;  1SCM B;  2JOJ A;  2BBN A;  3LL8 B;  2KI4 B;  1TTX A;  1J7R A;  2LVI A;  2G9B A;  2JNX A;  1PVB A;  3H4S E;  2SCP A;  1NYA A;  2Y1M A;  5G08 A;  1G8I A;  4F0Z B;  5I2O A;  1TOP A;  2L0P A;  4QJ3 B;  1AVS A;  1YVL A;  2NXQ A;  2MBX A;  4HRG A;  2LLT A;  4GPL B;  4NDC A;  4OCI A;  1ZFS A;  2JQ6 A;  1EH2 A;  3VRQ A;  4CFR A;  1XO5 A;  2VRG A;  1WLM A;  4DRW A;  1C7V A;  5ER5 A;  3BUW B;  4DUQ A;  1RFJ A;  2PAL A;  2NZ0 A;  1NX2 A;  1IH0 A;  3EVR A;  3LLE A;  1DT7 B;  2JXC A;  1B1G A;  1D1O A;  2KI6 D;  1WRK A;  5I2Q A;  1A2X A;  1GJY A;  1NCX A;  2HQ8 A;  2LP2 A;  1JWD A;  3I5G B;  2JZI A;  2KAX A;  2PVB A;  2SAS A;  2M9G A;  3DD4 A;  1NWD A;  2ISD A;  1SR6 C;  4DIR A;  3WNX B;  1BT6 A;  1VRK A;  2CXJ A;  1M39 A;  4L9M A;  3K21 A;  1CNP A;  1OOJ A;  3IQQ A;  4MRX A;  1L2O B;  4JPZ B;  1GGW A;  1F54 A;  2KAY A;  1C07 A;  1CLM A;  1FI5 A;  1NIW A;  1UP5 A;  1G33 A;  1ZOT B;  1PSB A;  5J3X A;  1BLQ A;  1FW4 A;  5ER4 X;  1S26 D;  3PLF B;  1CFF A;  1J7P A;  3PN7 B;  2WCF A;  5DKN A;  2G2B A;  2H61 A;  4TNC A;  3VRR A;  4PHM A;  1B9A A;  2E6W A;  2A4J A;  1RWY A;  4MN0 A;  2BL0 C;  1CKK A;  1KFU S;  4GBA A;  1NCY A;  1KFU L;  1CB1 A;  5DKQ A;  2LUX A;  5AER A;  1MXE A;  1W7I B;  1Y0V H;  2M1U A;  2EHB A;  3DVE A;  3TDU A;  1B8L A;  1A75 B;  2BCA A;  1SMG A;  3D0Y B;  4Q04 A;  4AQJ A;  1MUX A;  2JT3 A;  1TNW A;  3D0Y A;  1MXL C;  2WCE A;  1A03 A;  1NPQ A;  4PE1 A;  2JPT A;  5DKR A;  1QLK A;  2LAP A;  1N2D A;  3TS5 B;  1F55 A;  2OTG B;  1ALW A;  5TNC A;  1CLL A;  1WLZ A;  1EXR A;  1FF1 A;  2LNK A;  3JTD C;  2BCB A;  4I5J A;  1CMG A;  1TIZ A;  5F6T A;  2KGR A;  2K7B A;  3SG6 A;  2KGB C;  1JF2 A;  1Q80 A;  1RK9 A;  4FTG A;  2QPT A;  4XYN A;  4I5L B;  1IJ5 A;  1KSO A;  5PAL A;  1JUO A;  1AP4 A;  3NXA A;  3PAT A;  2JTZ A;  1TNP A;  1AJ4 A;  1QAT A;  4ORC B;  1K9U A;  1OZS A;  1Y6W A;  2M7N A;  3OB2 B;  1TNX A;  4USL A;  3PAL A;  4GGF A;  2EC6 B;  4PHK A;  3M0W A;  1BU3 A;  1EG4 A;  2ZRS A;  3OB1 B;  2F3Z A;  2KFF A;  1KFX L;  1S5G Y;  1S3P A;  1CLB A;  2Y5I A;  4OVN F;  1OMV A;  1OSA A;  2Q91 A;  1BMO A;  2COL B;  2MJW B;  1BJF A;  3VRN A;  2JU0 A;  1UUR A;  1DJY A;  3TUY C;  1B8C A;  1SL8 A;  3KEV A;  4ORA B;  1DF0 B;  3CLN A;  2B1U A;  3SG5 A;  1EL4 A;  1UHJ A;  1N65 A;  2BE6 A;  2F3Y A;  4PDZ A;  1SY9 A;  4YGE B;  3SG2 A;  1XFZ O;  1J7Q A;  2LP3 A;  4YI8 A;  4JWQ A;  1DJG A;  1QLS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...