2LHLA

Chemical shift assignments and solution structure of human apo-s100a1 e32q mutant
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
93
structure length
93
Chain Sequence
GSELETAMETLINVFHAHSGKEGDKYKLSKKQLKELLQTELSGFLDAQKDVDAVDKVMKELDENGDGEVDFQEYVVLVAALTVACNNFFWENS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein S100-A1
publication title 1H, 13C and 15N NMR sequence-specific resonance assignments and relaxation parameters for human apo-S100A1 E32Q mutant
rcsb
source organism Homo sapiens
molecule tags Metal binding protein
total genus 20
structure length 93
sequence length 93
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2lhlA00
1PALA 2M49B 2NCPA 3CR5X 1S5GZ 1CDLA 2NLNA 4AQJA 4IL1A 2LLTA 1M45A 1K96A 4GGFA 1BG1A 2SCPA 3D10A 3FWBA 1RTP1 1YRTB 1UP5A 1B4CA 3VRQA 3VROA 4FQOA 1ZACA 1JFKA 3QRXA 5KSZA 3F45A 4MZLA 1F71A 3CLNA 4JPZB 1OMVA 3PN7B 4ICBA 1S6IA 2G2BA 3I5IB 2LHIA 1KK7Z 4N1FA 4N1GA 1K93D 2KI4C 3PM8A 2H61C 2LP3A 1JBAA 1QIWA 1Y1UA 2F3ZA 2GGZA 1AK8A 1QX2A 1XVJA 3K21A 1WY9A 3FS7A 3VRRA 1JF2A 1S5GY 1OZSA 1WDCB 2QPTA 1XFWO 4OCIA 1B8LA 3RM1A 2LCPA 1UHJA 3BUXB 1OZOA 1YTZC 3EVUA 4GNKB 1DT7B 2ZRSA 3FWCA 1F4OA 2MAZA 4PHKA 3JTDB 3AKAA 2MLFC 3HX4A 2F2PA 3SG6A 2NCOA 2KOTA 3HCMA 1DJZA 2COLB 1NUBA 2F2OA 3CZTX 4YGDB 5AXIA 1CDNA 1K2HA 1J1EA 2L2EA 4R1EA 3WHUB 2I2RE 1SL9A 2PVBA 3ICBA 2KI6C 4DIRA 2KBMA 5BPJA 1JSAA 3A8RA 2E6WA 4MSPA 1NX2A 1RK9A 1SKTA 2H61A 1NCXA 2M7NA 3DVJA 3LK1A 4A4BA 4CPVA 3GK2A 4MRXA 1JWDA 4BY4A 1KWOB 1CMFA 2BL0B 4QJ5B 2BECA 2L0PA 3DVMA 4NDCA 4TNCA 4ORBB 4M2OA 1SY9A 3RLZA 4PHMA 1SR6C 1SPYA 2LMTA 2JXCA 5HLOA 2M3WA 4GFTA 4I5LB 2WOSA 1YX7A 3DD4A 4OKHA 1NCZA 2KBIA 4CFRA 3OB2B 1QIVA 3I5GB 1DJGA 1M63B 3TDUA 5I2OA 1UUSA 2LVIA 5K89A 1ZOTB 1X02A 3KF9A 2BCAA 4PDZA 2KAXA 1SCMC 5HKWA 4UPGA 4ORCB 1F70A 1J7OA 4HREE 3TDZA 1ALVA 3CR2A 1ODBA 1K95A 1BOCA 5HKZA 1DGVA 2PSRA 4MRYA 1KFUS 4MEWA 3DVEA 1A75B 4YRUA 2JXLA 4PE0A 1AVSA 1KFXS 4MVFA 1WRZA 4HRGA 4ZCUA 1BODA 3WHTB 2JWWA 1U5IA 4AOMA 1TOPA 4I5KA 1XFZO 1G8IA 1XK4C 4CIDA 1Y1XA 3MSEB 2WNDA 1IJ5A 4GGNA 4JQ0D 3VRPA 2G9BA 1R2UA 1KCYA 3KO0A 3GK1A 1E8AA 2KFHA 2M0RA 4YI8A 5IBWA 2JOJA 5B8IB 2AAOA 2Y4QA 1IRJA 1NSHA 2BBMA 1TTXA 3DF0A 4PE7A 3TUYC 1KQMB 4HRHA 3GOFA 1BLQA 1OE9B 1L7ZA 1AP4A 2JNFA 1RWYA 2WORA 1DF0A 5HKYA 1CB1A 3EKJA 1W7JB 1GGZA 1KK8C 2D8NA 3DVKA 1QASA 1TCFA 3NSKA 4XJKA 1MR8A 1AJ5A 2KFGA 4M2PA 1NIWA 3WXAA 3H4SE 3TS5B 1SYMA 1LKJA 1WRLA 1MHOA 2KFFA 1S3PA 4CFQA 1TIZA 2LHLA 2JNXA 1B47A 1XFXO 1S26D 1XK4A 2ZN9A 4HSZA 2CTNA 4MN0A 4YBHB 1H8BA 2L5XB 3OX6A 1FI6A 4N5XA 2K7CA 1NX1A 1QXPA 1OOJA 1BJFA 1SL7A 2BE4A 3PALA 2Q4UA 1RFJA 1GJYA 2OTGC 1QATA 1DJYA 2M1UA 2M1KB 2MBXA 3BUNB 2I7AA 2LAPA 2VRGA 2JT0A 4DUQA 2KAVA 2LM5A 2Y1NA 4AQIA 2M9GA 3BUMB 1CNPA 4OVNF 1DJHA 3KPXA 1BMOA 2O60A 3FIAA 1JUOA 3OP0A 2JZIA 2MHHA 3E3RA 2MJWB 1WLZA 3JVTC 3PFVA 2OS8C 3EK8A 3I5HC 1NWDA 1QV0A 1A2XA 5DKQA 2R2IA 1B7TZ 1S6JA 2ZNDA 1D1OA 1BF5A 1B9AA 3SG3A 3BOWA 5G08A 2KGBC 5ER5A 1K8UA 1CTRA 3TDIA 2DOQA 2EC6C 1SK6D 2WCEA 1FF1A 2LP2A 2BCBA 3BUOB 1QVIY 1NX0A 5DKNA 5I2QA 2LUCA 4XYNA 1KQVA 3BYAA 4E68A 4WQ3A 1ALWA 1DJWA 4YI9A 1IH0A 4JWQA 1TRFA 2JT8A 1LINA 2KI4B 1C7WA 3BOWB 1M39A 2ZRTA 2JTTA 1L2OC 2CCMA 2JPTA 2L4IA 3A4UB 4ORAB 5I8NA 4C0JA 4DS7A 1B7TY 1PSBA 5I2LA 2M97A 3CTNA 2L50A 1IGVA 4GAOA 2ZNEA 1IQ5A 2LANA 4DRWA 1OMRA 2BKHB 2KAYA 1AUIB 2L51A 4M2QA 4CLNA 1S6CA 1HT9A 1ZMZA 1G4YR 1AJ4A 3BXKA 3EVVA 2MLEC 4MZKA 3EKHA 1CM1A 1K94A 1K90D 2BBNA 3CR4X 5GQQC 1NCYA 2JQ6A 1QX7A 4I5JA 1K9PA 4FTGA 3LLEA 4MLWA 3D0YA 1BR1B 1XYDA 2LMUA 2PALA 4DCKA 1QV1A 1YX8A 4C0KA 3EK7A 1DMOA 5AEQA 1LXFC 1EJ3A 2V53A 1V1GA 3OB1B 4WRIA 1FBVA 2KDHA 1QJTA 1H4BA 2KQYA 2B1UA 1IQ3A 1IWQA 2RGIA 2K7DA 1BU3A 1GQMA 2OPOA 1LVCD 3I5FC 4NDDA 2EGDA 1FI5A 1CFCA 1VRKA 1CLBA 4QJ4B 3PLFB 1MUXA 1N65A 1SBJA 4GPLB 1UHHA 1SR6B 2PASA 2LV7A 2KI6D 2AUCA 2TN4A 4WQ2A 1XFVO 1J7QA 3IF7A 4I5NB 1DTLA 1U5IB 2EHBA 2SASA 1XO5A 1K9UA 3PN7C 4GUKA 1YVHA 3I5IC 1SMGA 1CFDA 2LVJA 3SJSA 1SCMB 2LVKA 4NDBA 2JTZA 1R6PA 1TNXA 4A4CA 1C7VA 1LA3A 1UHKA 1F54A 1M31A 1NP8A 1UURA 1CDMA 2ZFDA 1CMGA 2FCDA 1CFPA 1WDCC 1UHNA 2K2AA 2JULA 3DF0B 3ZWHA 2H2KA 1PSRA 1IJ6A 2WCFA 2LUXA 4NQGA 2E30A 2KNEA 2L98A 1SL8A 1CLLA 2ZKMX 1OMDA 3JTDC 1DF0B 5HYDA 2KHNA 1NX3A 2KYCA 3KHEA 1XFYO 2LE9B 3NSLA 4F0ZB 4XJKB 2KYFA 1PULA 3M0WA 5DKRA 1MF8B 2LLUA 2JRFA 3SG7A 2HPSA 1J7PA 1AHRA 1NPQA 2K7BA 3VRNA 4USLA 2KQ6A 1SW8A 2AMIA 5J3XA 3EK4A 2Y5IA 1CLMA 5CSFA 2IS9A 2JC2A 1J1DA 2Q91A 3NXAA 4P2YB 4YGEB 1KWOC 1JF0A 5CPVA 2BKIB 2BL0C 1QVIZ 2JU0A 2GV5A 1YUSA 1QLKA 2A4JA 2F33A 4GBAA 4MZJA 3TUYB 2HQ8A 1WLMA 3EVRA 3O78A 3CS1A 3OX5A 4C0LA 4YGAA 1PVBA 1KK8B 1RJVA 2K7OA 2K0JA 3OHMB 4PHJA 5TNCA 3LL8B 2LLSA 3SG2A 2LVVA 3I5GC 3PSRA 5PALA 1F4QA 3WNXB 2CBLA 4PCWA 1C07A 1V1FA 1F55A 1UWOA 1SNLA 2WC8A 3O4YA 2L4HA 2PMYA 3VGOA 5KU1A 1QTXA 2K61A 1B1GA 1FPWA 2I18A 2FOTA 4BY5A 1TN4A 2F3YA 2O5GA 2HQWA 3O6BA 5KTYA 3SG5A 1EH2A 2FJUB 1DVIA 1QX5B 1N0YA 1SCVA 2KSPA 1WRKA 5JOLA 1B8CA 1KK7Y 2OTGB 4PE4A 1EXRA 1S1EA 2MA2A 1QLSA 1CDPA 2FCEA 3C1VA 1Y0VH 2BE6A 1TCOB 1DGUA 1YR5A 1ZUZA 4MBEA 1MXEA 4ZCVA 4PHNA 3ZNIA 4D1EA 2Y1MA 4L9MA 3LCPC 3SIAA 2M8UA 1B8RA 1YUTA 2P6BB 1OQPA 4Q04A 3BQ3A 3SIBA 1A03A 1M46A 2F8PA 4U8DA 1JFJA 1FW4A 1LA0A 1CM4A 1KSMA 4YGBB 1EG4A 3JVTB 5CSNA 2OS8B 5CSIA 3SG4A 3I5HB 1EG3A 1HQVA 3CWGA 1XA5A 1TNQA 3KEVA 3O2PA 2ZN8A 1NYAA 1XFUO 4P5OE 3AAKA 2KGRA 3IQQA 2NXQA 3AAJA 2CNPA 1YURA 1KQMC 1YRUB 1MWNA 1YUUA 1A75A 1ZFSA 2EC6B 1K9KA 3AKBA 1PRWA 2MRDA 1A29A 5D7FA 1KFUL 1UHIA 3D0YB 4PE1A 3CGAA 1Y6WA 3IQOA 1J7RA 4ETOA 1OSAA 2M7LA 1MXLC 1PK0D 1KFXL 1RECA 1RROA 1W7IB 2JT3A 2WCBA 4OR9B 5FYXA 1IG5A 3TS5C 5ER4X 1Q80A 1L2OB 2LNKA 1TNPA 2I94A 2BCXA 1GGWA 1A4PA 2CXJA 5AERA 1JC2A 1SRAA 3LK0A 5F6TA 1BT6A 2ISDA 5AANA 5HLVA 3NSOA 2LMVA 1CFFA 2NZ0A 4GGFC 4PALA 1KSOA 1CKKA 5AFPA 2K2FA 1DJIA 1N2DA 1TNWA 1G33A 1YVLA 2M29A 4QJ3B 2PRUA 5D69A 1S36A 5JJGA 2LC5A 4YGCB 1F8HA 1J55A 1DJXA 2K8MB 3GK4X 1EL4A 4OV2A 2HF5A 5CSJA 1BR4B 1QS7A 3NSIA 3TZ1A 2QACA 3PATA 2GGMA 1PVAA 2HETA 2CT9A 1Y1AA 3BUWB 1IKUA 3I5FB 1MQ1A
chains in the Genus database with same CATH superfamily
2FJYA 1PALA 2M49B 2NCPA 3CR5X 1S5GZ 1CDLA 2NLNA 4AQJA 4IL1A 2LLTA 1M45A 1K96A 1T14A 1W9ZA 4GGFA 3DXLA 2SCPA 3D10A 3V2LA 1BG1A 3FWBA 2WCJA 1RTP1 1YRTB 3CZ2A 1UP5A 1B4CA 3VRQA 3VROA 4FQOA 1ZACA 1JFKA 3QRXA 5KSZA 3F45A 4MZLA 1F71A 3CLNA 4JPZB 1OMVA 3PN7B 4ICBA 1S6IA 2G2BA 3I5IB 2LHIA 1KK7Z 4N1FA 4N1GA 1K93D 2KI4C 4FQTA 3PM8A 2H61C 2LP3A 1JBAA 1QIWA 1Y1UA 2F3ZA 2GGZA 1OW4A 1AK8A 1QX2A 1XVJA 3D74A 1WY9A 2P71A 3FS7A 3K21A 3VRRA 1JF2A 1S5GY 1OZSA 1WDCB 2QPTA 1XFWO 4OCIA 1B8LA 3B7AA 1DEKA 3RM1A 2LCPA 1UHJA 2L5YA 1OZOA 1YTZC 3BUXB 3EVUA 4GNKB 1DT7B 2ZRSA 3FWCA 1F4OA 2MAZA 4PHKA 3JTDB 3AKAA 2MLFC 3HX4A 2F2PA 3SG6A 2ERBA 2NCOA 2KOTA 3HCMA 1DJZA 2COLB 1NUBA 2F2OA 2BAPA 3PJIA 3CZTX 4YGDB 5AXIA 1CDNA 1K2HA 1J1EA 2L2EA 4R1EA 3WHUB 2I2RE 1SL9A 2PVBA 3ICBA 2KI6C 4DIRA 2KBMA 5BPJA 1JSAA 3B88A 4OZDA 3A8RA 2E6WA 4MSPA 1NX2A 1RK9A 1SKTA 2H61A 1NCXA 2M7NA 3DVJA 3LK1A 4A4BA 1DQEA 4CPVA 3GK2A 4MRXA 3CZ1A 1JWDA 4BY4A 1KWOB 1CMFA 2BL0B 2K60A 4QJ5B 2BECA 2L0PA 3DVMA 4NDCA 4TNCA 4ORBB 4M2OA 1OOGA 1SY9A 3RLZA 4PHMA 3PM2A 1SR6C 1SPYA 2LMTA 2JXCA 5HLOA 3B6XA 1C3ZA 2M3WA 4GFTA 4I5LB 2WOSA 1YX7A 3DD4A 4OKHA 1H8BA 1NCZA 2KBIA 4CFRA 3OB2B 3CABA 1QIVA 3I5GB 1DJGA 1M63B 3TDUA 5I2OA 1UUSA 2LVIA 5K89A 1ZOTB 1X02A 3KF9A 2BCAA 4PDZA 2KAXA 1SCMC 5HKWA 3UNWA 4INXA 4UPGA 4ORCB 1F70A 2KLEA 1J7OA 4HREE 4INWA 3TDZA 1ALVA 3CR2A 1ODBA 1K95A 3D76A 1BOCA 5HKZA 1DGVA 2PSRA 4MRYA 1KFUS 4MEWA 3D78A 1A75B 3DVEA 4YRUA 2JXLA 4PE0A 1AVSA 1KFXS 4MVFA 1WRZA 4HRGA 5EL2A 4ZCUA 1BODA 3WHTB 2JWWA 1U5IA 5D3OA 1TOPA 4AOMA 4I5KA 3OGNA 1XFZO 1G8IA 2WC5A 1XK4C 4CIDA 1Y1XA 3MSEB 2PYQA 1IJ5A 2WNDA 4GGNA 4JQ0D 3VRPA 2G9BA 1R2UA 2GTEA 3KO0A 1LS8A 3GK1A 1KCYA 1E8AA 2KFHA 2M0RA 3D73A 4YI8A 5IBWA 2JOJA 5B8IB 2AAOA 2Y4QA 1IRJA 1NSHA 2BBMA 1TTXA 3DF0A 4PE7A 3DYEA 3Q8IA 1KQMB 4HRHA 3GOFA 3TUYC 1BLQA 1OE9B 1L7ZA 1AP4A 2JNFA 1C3YA 1RWYA 2WORA 1DF0A 3EG5B 5HKYA 3EKJA 1W7JB 1CB1A 1GGZA 1KK8C 2D8NA 3DVKA 1QASA 1TCFA 3NSKA 4XJKA 1MR8A 1OOIX 1AJ5A 3FE9A 2KFGA 4M2PA 1NIWA 3WXAA 3H4SE 3TS5B 1SYMA 1LKJA 1WRLA 1MHOA 2KFFA 3CYZA 1S3PA 4CFQA 1TIZA 2LHLA 2JNXA 1B47A 1XFXO 1S26D 1TWOA 1XK4A 2ZN9A 2CTNA 2JPOA 4HSZA 4MN0A 2L5XB 4YBHB 3S0FA 3OX6A 1FI6A 4N5XA 2K7CA 3CDNA 1NX1A 1QXPA 1OOJA 2P70A 1BJFA 1SL7A 2BE4A 3PALA 2Q4UA 1RFJA 1GJYA 2OTGC 1QATA 1DJYA 2M1UA 2M1KB 3CZ0A 2MBXA 2H8VA 3FE8A 3BUNB 2I7AA 2LAPA 2VRGA 2JT0A 2WCMA 4DUQA 2KAVA 2LM5A 2Y1NA 4AQIA 2M9GA 3BUMB 1CNPA 2PQLA 4OVNF 1DJHA 3KPXA 1BMOA 2O60A 3FIAA 1JUOA 3OP0A 2JZIA 4PT1A 2MHHA 3E3RA 2MJWB 1WLZA 2WC6A 2L2CA 3JVTC 3PFVA 2OS8C 3EK8A 3I5HC 3SS4A 1NWDA 1QV0A 1A2XA 5DKQA 2R2IA 1B7TZ 1S6JA 2ZNDA 4JKTA 1D1OA 1BF5A 1B9AA 3SG3A 3BOWA 5G08A 2KGBC 5ER5A 1K8UA 1CTRA 3TDIA 2QEBA 2DOQA 2EC6C 3RZSA 1SK6D 2WCEA 1FF1A 2LP2A 2BCBA 1Z2CB 2KPHA 3BUOB 1QVIY 1NX0A 5DKNA 5I2QA 2LUCA 4XYNA 1KQVA 3BYAA 4E68A 4WQ3A 1ALWA 1DJWA 4YI9A 1IH0A 4JWQA 1TRFA 2JT8A 1LINA 2KI4B 1C7WA 3BOWB 1M39A 2ZRTA 2JTTA 1L2OC 3DY9A 3UO9A 1IIOA 2CCMA 2JPTA 2L4IA 3A4UB 4ORAB 5I8NA 4C0JA 4DS7A 1B7TY 1XFRA 1PSBA 5I2LA 2M97A 3CTNA 2L50A 1IGVA 4GAOA 2ZNEA 1IQ5A 2LANA 4DRWA 3O4XA 1OMRA 2BKHB 2KAYA 1AUIB 2L51A 4M2QA 4CLNA 1S6CA 1HT9A 1ZMZA 1G4YR 1AJ4A 3BXKA 3EVVA 2MLEC 4MZKA 3EKHA 1CM1A 1K94A 1K90D 2BBNA 3CR4X 5GQQC 1NCYA 2JQ6A 1QX7A 4I5JA 1K9PA 4FTGA 3LLEA 4MLWA 3D0YA 1BR1B 1XYDA 2LMUA 2PALA 3R72A 4DCKA 1QV1A 1YX8A 4C0KA 3EK7A 1DMOA 5AEQA 1LXFC 1EJ3A 2V53A 1V1GA 3OB1B 4WRIA 1FBVA 2KDHA 1QJTA 1TUZA 1H4BA 2KQYA 2B1UA 1IQ3A 1IWQA 2RGIA 2K7DA 3BFHA 3N7HA 1BU3A 1GQMA 2OPOA 1LVCD 3I5FC 4NDDA 4IJ7A 3S0GA 2EGDA 1FI5A 1QWVA 1CFCA 1VRKA 1CLBA 4QJ4B 3PLFB 1MUXA 1N65A 1SBJA 4GPLB 3S0DA 5DICA 1UHHA 3L4LA 1SR6B 2PASA 4F7FA 2LV7A 2KI6D 2AUCA 2YGUA 2TN4A 4WQ2A 3B86A 1XFVO 1J7QA 3IF7A 4I5NB 1DTLA 1U5IB 2EHBA 3B87A 2SASA 1XO5A 1K9UA 3PN7C 4GUKA 1YVHA 3I5IC 1SMGA 1CFDA 2LVJA 2BNXA 3SJSA 1SCMB 2LVKA 4NDBA 2JTZA 1R6PA 1TNXA 3L47A 4A4CA 2QEOA 1C7VA 1LA3A 1UHKA 2WCLA 1F54A 1M31A 3D77A 1NP8A 1UURA 1CDMA 2ZFDA 1CMGA 3SS3A 2FCDA 1CFPA 1WDCC 1UHNA 2K2AA 2JULA 3DF0B 3ZWHA 2H2KA 1PSRA 1IJ6A 2WCFA 2LUXA 4NQGA 2E30A 5FI7A 2KNEA 2L98A 1SL8A 1CLLA 2ZKMX 1OMDA 3JTDC 1DF0B 5HYDA 2KHNA 1NX3A 2KYCA 3KHEA 1XFYO 2LE9B 1OOFA 2QEHA 3NSLA 4XJKB 4F0ZB 2KYFA 1PULA 3M0WA 5DKRA 1MF8B 2LLUA 2JRFA 1ORGA 3SG7A 2HPSA 1J7PA 1AHRA 1NPQA 2K7BA 3BFAA 3VRNA 1TUJA 2WCHA 4USLA 2KQ6A 1SW8A 2AMIA 5J3XA 3EK4A 4JD9A 2Y5IA 3VB1A 1CLMA 5CSFA 2IS9A 2JC2A 1J1DA 2Q91A 3NXAA 4P2YB 4YGEB 1KWOC 1JF0A 5CPVA 2BKIB 2BL0C 1QVIZ 2JU0A 2GV5A 1YUSA 1QLKA 2A4JA 2F33A 3BFBA 5FI6A 4GBAA 4MZJA 3TUYB 2HQ8A 1WLMA 3EVRA 3O78A 3CS1A 3OX5A 4C0LA 4YGAA 3DZTA 3R1OA 1PVBA 1KK8B 1RJVA 2K7OA 2K0JA 3D75A 3OHMB 4PHJA 5TNCA 3LL8B 2LLSA 3SG2A 2LVVA 1OOHA 3I5GC 3PSRA 5PALA 1F4QA 1SSEB 3WNXB 2CBLA 3IVTA 3K1EA 4PCWA 1C07A 1V1FA 2QDIA 1F55A 1UWOA 1SNLA 2KLDA 2WC8A 3O4YA 2L4HA 2PMYA 3VGOA 5KU1A 1QTXA 2K61A 1B1GA 1FPWA 2I18A 3BJHA 2FOTA 5FI2A 4BY5A 1TN4A 2F3YA 2O5GA 2HQWA 3O6BA 5KTYA 3SG5A 1EH2A 2FJUB 2WCKA 1DVIA 1QX5B 1N0YA 1SCVA 2KSPA 1WRKA 5JOLA 1B8CA 1KK7Y 2OTGB 4PE4A 1EXRA 1S1EA 2MA2A 1QLSA 1CDPA 2FCEA 3C1VA 1Y0VH 2BE6A 3R1VA 1TCOB 1Z4HA 1DGUA 2QEVA 1YR5A 1ZUZA 4MBEA 1MXEA 4ZCVA 4PHNA 3ZNIA 4D1EA 2Y1MA 4L9MA 3LCPC 3L4AA 3SIAA 2M8UA 1B8RA 1YUTA 2P6BB 5HL1A 1OQPA 3NHIA 4Q04A 3BQ3A 3SIBA 1A03A 1M46A 2F8PA 3NGVA 4U8DA 1JFJA 3S0AA 1FW4A 1LA0A 1CM4A 1KSMA 4YGBB 1EG4A 3JVTB 5CSNA 2OS8B 5CSIA 3SG4A 3I5HB 3S0BA 1EG3A 1HQVA 3CWGA 1XA5A 1TNQA 3KEVA 3O2PA 2ZN8A 1NYAA 1XFUO 4P5OE 3AAKA 2KGRA 3IQQA 2NXQA 3AAJA 2CNPA 1YURA 1KQMC 1YRUB 3OBVA 4KYNA 1MWNA 1YUUA 1A75A 1ZFSA 2EC6B 1K9KA 3AKBA 1PRWA 2MRDA 3S0EA 1A29A 5D7FA 1KFUL 1UHIA 3D0YB 4PE1A 3CGAA 1Y6WA 3IQOA 1J7RA 3SS5A 1OSAA 3NHTA 2M7LA 4ETOA 1MXLC 1PK0D 1KFXL 1RECA 1RROA 1W7IB 2JT3A 2WCBA 4OR9B 5FYXA 1IG5A 3TS5C 1GM0A 5ER4X 1Q80A 1L2OB 2LNKA 1TNPA 2I94A 2BCXA 1DC1A 1GGWA 1A4PA 2CXJA 5AERA 1JC2A 1P28A 1SRAA 3LK0A 5F6TA 1BT6A 2ISDA 3R1PA 5HLVA 5AANA 3NSOA 2LMVA 1CFFA 2NZ0A 4GGFC 1DELA 1KSOA 4PALA 5AFPA 2K2FA 1CKKA 1DJIA 1N2DA 1TNWA 1G33A 1YVLA 3QMEA 2M29A 4QJ3B 2PRUA 5D69A 1S36A 5JJGA 2LC5A 5I94A 4YGCB 1F8HA 1J55A 1DJXA 2K8MB 3GK4X 1EL4A 3FE6A 4OV2A 2HF5A 5CSJA 1BR4B 1QS7A 3NSIA 3TZ1A 2QACA 3PATA 2GGMA 1PVAA 2HETA 2CT9A 1Y1AA 3BUWB 1IKUA 3I5FB 1MQ1A
chains in the Genus database with same CATH topology
1PALA 2M49B 2NCPA 3CR5X 1S5GZ 1CDLA 2NLNA 4AQJA 4IL1A 2LLTA 1M45A 1K96A 4GGFA 1BG1A 2SCPA 3D10A 3FWBA 1RTP1 1YRTB 1UP5A 1B4CA 3VRQA 3VROA 4FQOA 1ZACA 1JFKA 3QRXA 5KSZA 3F45A 4MZLA 1F71A 3CLNA 4JPZB 1OMVA 3PN7B 4ICBA 1S6IA 2G2BA 3I5IB 2LHIA 1KK7Z 4N1FA 4N1GA 1K93D 2KI4C 3PM8A 2H61C 2LP3A 1JBAA 1QIWA 1Y1UA 2F3ZA 2GGZA 1AK8A 1QX2A 1XVJA 3K21A 1WY9A 3FS7A 3VRRA 1JF2A 1S5GY 1OZSA 1WDCB 2QPTA 1XFWO 4OCIA 1B8LA 3RM1A 2LCPA 1UHJA 3BUXB 1OZOA 1YTZC 3EVUA 4GNKB 1DT7B 2ZRSA 3FWCA 1F4OA 2MAZA 4PHKA 3JTDB 3AKAA 2MLFC 3HX4A 2F2PA 3SG6A 2NCOA 2KOTA 3HCMA 1DJZA 2COLB 1NUBA 2F2OA 3CZTX 4YGDB 5AXIA 1CDNA 1K2HA 1J1EA 2L2EA 4R1EA 3WHUB 2I2RE 1SL9A 2PVBA 3ICBA 2KI6C 4DIRA 2KBMA 5BPJA 1JSAA 3A8RA 2E6WA 4MSPA 1NX2A 1RK9A 1SKTA 2H61A 1NCXA 2M7NA 3DVJA 3LK1A 4A4BA 4CPVA 3GK2A 4MRXA 1JWDA 4BY4A 1KWOB 1CMFA 2BL0B 4QJ5B 2BECA 2L0PA 3DVMA 4NDCA 4TNCA 4ORBB 4M2OA 1SY9A 3RLZA 4PHMA 1SR6C 1SPYA 2LMTA 2JXCA 5HLOA 2M3WA 4GFTA 4I5LB 2WOSA 1YX7A 3DD4A 4OKHA 1NCZA 2KBIA 4CFRA 3OB2B 1QIVA 3I5GB 1DJGA 1M63B 3TDUA 5I2OA 1UUSA 2LVIA 5K89A 1ZOTB 1X02A 3KF9A 2BCAA 4PDZA 2KAXA 1SCMC 5HKWA 4UPGA 4ORCB 1F70A 1J7OA 4HREE 3TDZA 1ALVA 3CR2A 1ODBA 1K95A 1BOCA 5HKZA 1DGVA 2PSRA 4MRYA 1KFUS 4MEWA 3DVEA 1A75B 4YRUA 2JXLA 4PE0A 1AVSA 1KFXS 4MVFA 1WRZA 4HRGA 4ZCUA 1BODA 3WHTB 2JWWA 1U5IA 4AOMA 1TOPA 4I5KA 1XFZO 1G8IA 1XK4C 4CIDA 1Y1XA 3MSEB 2WNDA 1IJ5A 4GGNA 4JQ0D 3VRPA 2G9BA 1R2UA 1KCYA 3KO0A 3GK1A 1E8AA 2KFHA 2M0RA 4YI8A 5IBWA 2JOJA 5B8IB 2AAOA 2Y4QA 1IRJA 1NSHA 2BBMA 1TTXA 3DF0A 4PE7A 3TUYC 1KQMB 4HRHA 3GOFA 1BLQA 1OE9B 1L7ZA 1AP4A 2JNFA 1RWYA 2WORA 1DF0A 5HKYA 1CB1A 3EKJA 1W7JB 1GGZA 1KK8C 2D8NA 3DVKA 1QASA 1TCFA 3NSKA 4XJKA 1MR8A 1AJ5A 2KFGA 4M2PA 1NIWA 3WXAA 3H4SE 3TS5B 1SYMA 1LKJA 1WRLA 1MHOA 2KFFA 1S3PA 4CFQA 1TIZA 2LHLA 2JNXA 1B47A 1XFXO 1S26D 1XK4A 2ZN9A 4HSZA 2CTNA 4MN0A 4YBHB 1H8BA 2L5XB 3OX6A 1FI6A 4N5XA 2K7CA 1NX1A 1QXPA 1OOJA 1BJFA 1SL7A 2BE4A 3PALA 2Q4UA 1RFJA 1GJYA 2OTGC 1QATA 1DJYA 2M1UA 2M1KB 2MBXA 3BUNB 2I7AA 2LAPA 2VRGA 2JT0A 4DUQA 2KAVA 2LM5A 2Y1NA 4AQIA 2M9GA 3BUMB 1CNPA 4OVNF 1DJHA 3KPXA 1BMOA 2O60A 3FIAA 1JUOA 3OP0A 2JZIA 2MHHA 3E3RA 2MJWB 1WLZA 3JVTC 3PFVA 2OS8C 3EK8A 3I5HC 1NWDA 1QV0A 1A2XA 5DKQA 2R2IA 1B7TZ 1S6JA 2ZNDA 1D1OA 1BF5A 1B9AA 3SG3A 3BOWA 5G08A 2KGBC 5ER5A 1K8UA 1CTRA 3TDIA 2DOQA 2EC6C 1SK6D 2WCEA 1FF1A 2LP2A 2BCBA 3BUOB 1QVIY 1NX0A 5DKNA 5I2QA 2LUCA 4XYNA 1KQVA 3BYAA 4E68A 4WQ3A 1ALWA 1DJWA 4YI9A 1IH0A 4JWQA 1TRFA 2JT8A 1LINA 2KI4B 1C7WA 3BOWB 1M39A 2ZRTA 2JTTA 1L2OC 2CCMA 2JPTA 2L4IA 3A4UB 4ORAB 5I8NA 4C0JA 4DS7A 1B7TY 1PSBA 5I2LA 2M97A 3CTNA 2L50A 1IGVA 4GAOA 2ZNEA 1IQ5A 2LANA 4DRWA 1OMRA 2BKHB 2KAYA 1AUIB 2L51A 4M2QA 4CLNA 1S6CA 1HT9A 1ZMZA 1G4YR 1AJ4A 3BXKA 3EVVA 2MLEC 4MZKA 3EKHA 1CM1A 1K94A 1K90D 2BBNA 3CR4X 5GQQC 1NCYA 2JQ6A 1QX7A 4I5JA 1K9PA 4FTGA 3LLEA 4MLWA 3D0YA 1BR1B 1XYDA 2LMUA 2PALA 4DCKA 1QV1A 1YX8A 4C0KA 3EK7A 1DMOA 5AEQA 1LXFC 1EJ3A 2V53A 1V1GA 3OB1B 4WRIA 1FBVA 2KDHA 1QJTA 1H4BA 2KQYA 2B1UA 1IQ3A 1IWQA 2RGIA 2K7DA 1BU3A 1GQMA 2OPOA 1LVCD 3I5FC 4NDDA 2EGDA 1FI5A 1CFCA 1VRKA 1CLBA 4QJ4B 3PLFB 1MUXA 1N65A 1SBJA 4GPLB 1UHHA 1SR6B 2PASA 2LV7A 2KI6D 2AUCA 2TN4A 4WQ2A 1XFVO 1J7QA 3IF7A 4I5NB 1DTLA 1U5IB 2EHBA 2SASA 1XO5A 1K9UA 3PN7C 4GUKA 1YVHA 3I5IC 1SMGA 1CFDA 2LVJA 3SJSA 1SCMB 2LVKA 4NDBA 2JTZA 1R6PA 1TNXA 4A4CA 1C7VA 1LA3A 1UHKA 1F54A 1M31A 1NP8A 1UURA 1CDMA 2ZFDA 1CMGA 2FCDA 1CFPA 1WDCC 1UHNA 2K2AA 2JULA 3DF0B 3ZWHA 2H2KA 1PSRA 1IJ6A 2WCFA 2LUXA 4NQGA 2E30A 2KNEA 2L98A 1SL8A 1CLLA 2ZKMX 1OMDA 3JTDC 1DF0B 5HYDA 2KHNA 1NX3A 2KYCA 3KHEA 1XFYO 2LE9B 3NSLA 4F0ZB 4XJKB 2KYFA 1PULA 3M0WA 5DKRA 1MF8B 2LLUA 2JRFA 3SG7A 2HPSA 1J7PA 1AHRA 1NPQA 2K7BA 3VRNA 4USLA 2KQ6A 1SW8A 2AMIA 5J3XA 3EK4A 2Y5IA 1CLMA 5CSFA 2IS9A 2JC2A 1J1DA 2Q91A 3NXAA 4P2YB 4YGEB 1KWOC 1JF0A 5CPVA 2BKIB 2BL0C 1QVIZ 2JU0A 2GV5A 1YUSA 1QLKA 2A4JA 2F33A 4GBAA 4MZJA 3TUYB 2HQ8A 1WLMA 3EVRA 3O78A 3CS1A 3OX5A 4C0LA 4YGAA 1PVBA 1KK8B 1RJVA 2K7OA 2K0JA 3OHMB 4PHJA 5TNCA 3LL8B 2LLSA 3SG2A 2LVVA 3I5GC 3PSRA 5PALA 1F4QA 3WNXB 2CBLA 4PCWA 1C07A 1V1FA 1F55A 1UWOA 1SNLA 2WC8A 3O4YA 2L4HA 2PMYA 3VGOA 5KU1A 1QTXA 2K61A 1B1GA 1FPWA 2I18A 2FOTA 4BY5A 1TN4A 2F3YA 2O5GA 2HQWA 3O6BA 5KTYA 3SG5A 1EH2A 2FJUB 1DVIA 1QX5B 1N0YA 1SCVA 2KSPA 1WRKA 5JOLA 1B8CA 1KK7Y 2OTGB 4PE4A 1EXRA 1S1EA 2MA2A 1QLSA 1CDPA 2FCEA 3C1VA 1Y0VH 2BE6A 1TCOB 1DGUA 1YR5A 1ZUZA 4MBEA 1MXEA 4ZCVA 4PHNA 3ZNIA 4D1EA 2Y1MA 4L9MA 3LCPC 3SIAA 2M8UA 1B8RA 1YUTA 2P6BB 1OQPA 4Q04A 3BQ3A 3SIBA 1A03A 1M46A 2F8PA 4U8DA 1JFJA 1FW4A 1LA0A 1CM4A 1KSMA 4YGBB 1EG4A 3JVTB 5CSNA 2OS8B 5CSIA 3SG4A 3I5HB 1EG3A 1HQVA 3CWGA 1XA5A 1TNQA 3KEVA 3O2PA 2ZN8A 1NYAA 1XFUO 4P5OE 3AAKA 2KGRA 3IQQA 2NXQA 3AAJA 2CNPA 1YURA 1KQMC 1YRUB 1MWNA 1YUUA 1A75A 1ZFSA 2EC6B 1K9KA 3AKBA 1PRWA 2MRDA 1A29A 5D7FA 1KFUL 1UHIA 3D0YB 4PE1A 3CGAA 1Y6WA 3IQOA 1J7RA 4ETOA 1OSAA 2M7LA 1MXLC 1PK0D 1KFXL 1RECA 1RROA 1W7IB 2JT3A 2WCBA 4OR9B 5FYXA 1IG5A 3TS5C 5ER4X 1Q80A 1L2OB 2LNKA 1TNPA 2I94A 2BCXA 1GGWA 1A4PA 2CXJA 5AERA 1JC2A 1SRAA 3LK0A 5F6TA 1BT6A 2ISDA 5AANA 5HLVA 3NSOA 2LMVA 1CFFA 2NZ0A 4GGFC 4PALA 1KSOA 1CKKA 5AFPA 2K2FA 1DJIA 1N2DA 1TNWA 1G33A 1YVLA 2M29A 4QJ3B 2PRUA 5D69A 1S36A 5JJGA 2LC5A 4YGCB 1F8HA 1J55A 1DJXA 2K8MB 3GK4X 1EL4A 4OV2A 2HF5A 5CSJA 1BR4B 1QS7A 3NSIA 3TZ1A 2QACA 3PATA 2GGMA 1PVAA 2HETA 2CT9A 1Y1AA 3BUWB 1IKUA 3I5FB 1MQ1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PAL A;  2M49 B;  2NCP A;  3CR5 X;  1S5G Z;  1CDL A;  2NLN A;  4AQJ A;  4IL1 A;  2LLT A;  1M45 A;  1K96 A;  4GGF A;  1BG1 A;  2SCP A;  3D10 A;  3FWB A;  1RTP 1;  1YRT B;  1UP5 A;  1B4C A;  3VRQ A;  3VRO A;  4FQO A;  1ZAC A;  1JFK A;  3QRX A;  5KSZ A;  3F45 A;  4MZL A;  1F71 A;  3CLN A;  4JPZ B;  1OMV A;  3PN7 B;  4ICB A;  1S6I A;  2G2B A;  3I5I B;  2LHI A;  1KK7 Z;  4N1F A;  4N1G A;  1K93 D;  2KI4 C;  3PM8 A;  2H61 C;  2LP3 A;  1JBA A;  1QIW A;  1Y1U A;  2F3Z A;  2GGZ A;  1AK8 A;  1QX2 A;  1XVJ A;  3K21 A;  1WY9 A;  3FS7 A;  3VRR A;  1JF2 A;  1S5G Y;  1OZS A;  1WDC B;  2QPT A;  1XFW O;  4OCI A;  1B8L A;  3RM1 A;  2LCP A;  1UHJ A;  3BUX B;  1OZO A;  1YTZ C;  3EVU A;  4GNK B;  1DT7 B;  2ZRS A;  3FWC A;  1F4O A;  2MAZ A;  4PHK A;  3JTD B;  3AKA A;  2MLF C;  3HX4 A;  2F2P A;  3SG6 A;  2NCO A;  2KOT A;  3HCM A;  1DJZ A;  2COL B;  1NUB A;  2F2O A;  3CZT X;  4YGD B;  5AXI A;  1CDN A;  1K2H A;  1J1E A;  2L2E A;  4R1E A;  3WHU B;  2I2R E;  1SL9 A;  2PVB A;  3ICB A;  2KI6 C;  4DIR A;  2KBM A;  5BPJ A;  1JSA A;  3A8R A;  2E6W A;  4MSP A;  1NX2 A;  1RK9 A;  1SKT A;  2H61 A;  1NCX A;  2M7N A;  3DVJ A;  3LK1 A;  4A4B A;  4CPV A;  3GK2 A;  4MRX A;  1JWD A;  4BY4 A;  1KWO B;  1CMF A;  2BL0 B;  4QJ5 B;  2BEC A;  2L0P A;  3DVM A;  4NDC A;  4TNC A;  4ORB B;  4M2O A;  1SY9 A;  3RLZ A;  4PHM A;  1SR6 C;  1SPY A;  2LMT A;  2JXC A;  5HLO A;  2M3W A;  4GFT A;  4I5L B;  2WOS A;  1YX7 A;  3DD4 A;  4OKH A;  1NCZ A;  2KBI A;  4CFR A;  3OB2 B;  1QIV A;  3I5G B;  1DJG A;  1M63 B;  3TDU A;  5I2O A;  1UUS A;  2LVI A;  5K89 A;  1ZOT B;  1X02 A;  3KF9 A;  2BCA A;  4PDZ A;  2KAX A;  1SCM C;  5HKW A;  4UPG A;  4ORC B;  1F70 A;  1J7O A;  4HRE E;  3TDZ A;  1ALV A;  3CR2 A;  1ODB A;  1K95 A;  1BOC A;  5HKZ A;  1DGV A;  2PSR A;  4MRY A;  1KFU S;  4MEW A;  3DVE A;  1A75 B;  4YRU A;  2JXL A;  4PE0 A;  1AVS A;  1KFX S;  4MVF A;  1WRZ A;  4HRG A;  4ZCU A;  1BOD A;  3WHT B;  2JWW A;  1U5I A;  4AOM A;  1TOP A;  4I5K A;  1XFZ O;  1G8I A;  1XK4 C;  4CID A;  1Y1X A;  3MSE B;  2WND A;  1IJ5 A;  4GGN A;  4JQ0 D;  3VRP A;  2G9B A;  1R2U A;  1KCY A;  3KO0 A;  3GK1 A;  1E8A A;  2KFH A;  2M0R A;  4YI8 A;  5IBW A;  2JOJ A;  5B8I B;  2AAO A;  2Y4Q A;  1IRJ A;  1NSH A;  2BBM A;  1TTX A;  3DF0 A;  4PE7 A;  3TUY C;  1KQM B;  4HRH A;  3GOF A;  1BLQ A;  1OE9 B;  1L7Z A;  1AP4 A;  2JNF A;  1RWY A;  2WOR A;  1DF0 A;  5HKY A;  1CB1 A;  3EKJ A;  1W7J B;  1GGZ A;  1KK8 C;  2D8N A;  3DVK A;  1QAS A;  1TCF A;  3NSK A;  4XJK A;  1MR8 A;  1AJ5 A;  2KFG A;  4M2P A;  1NIW A;  3WXA A;  3H4S E;  3TS5 B;  1SYM A;  1LKJ A;  1WRL A;  1MHO A;  2KFF A;  1S3P A;  4CFQ A;  1TIZ A;  2LHL A;  2JNX A;  1B47 A;  1XFX O;  1S26 D;  1XK4 A;  2ZN9 A;  4HSZ A;  2CTN A;  4MN0 A;  4YBH B;  1H8B A;  2L5X B;  3OX6 A;  1FI6 A;  4N5X A;  2K7C A;  1NX1 A;  1QXP A;  1OOJ A;  1BJF A;  1SL7 A;  2BE4 A;  3PAL A;  2Q4U A;  1RFJ A;  1GJY A;  2OTG C;  1QAT A;  1DJY A;  2M1U A;  2M1K B;  2MBX A;  3BUN B;  2I7A A;  2LAP A;  2VRG A;  2JT0 A;  4DUQ A;  2KAV A;  2LM5 A;  2Y1N A;  4AQI A;  2M9G A;  3BUM B;  1CNP A;  4OVN F;  1DJH A;  3KPX A;  1BMO A;  2O60 A;  3FIA A;  1JUO A;  3OP0 A;  2JZI A;  2MHH A;  3E3R A;  2MJW B;  1WLZ A;  3JVT C;  3PFV A;  2OS8 C;  3EK8 A;  3I5H C;  1NWD A;  1QV0 A;  1A2X A;  5DKQ A;  2R2I A;  1B7T Z;  1S6J A;  2ZND A;  1D1O A;  1BF5 A;  1B9A A;  3SG3 A;  3BOW A;  5G08 A;  2KGB C;  5ER5 A;  1K8U A;  1CTR A;  3TDI A;  2DOQ A;  2EC6 C;  1SK6 D;  2WCE A;  1FF1 A;  2LP2 A;  2BCB A;  3BUO B;  1QVI Y;  1NX0 A;  5DKN A;  5I2Q A;  2LUC A;  4XYN A;  1KQV A;  3BYA A;  4E68 A;  4WQ3 A;  1ALW A;  1DJW A;  4YI9 A;  1IH0 A;  4JWQ A;  1TRF A;  2JT8 A;  1LIN A;  2KI4 B;  1C7W A;  3BOW B;  1M39 A;  2ZRT A;  2JTT A;  1L2O C;  2CCM A;  2JPT A;  2L4I A;  3A4U B;  4ORA B;  5I8N A;  4C0J A;  4DS7 A;  1B7T Y;  1PSB A;  5I2L A;  2M97 A;  3CTN A;  2L50 A;  1IGV A;  4GAO A;  2ZNE A;  1IQ5 A;  2LAN A;  4DRW A;  1OMR A;  2BKH B;  2KAY A;  1AUI B;  2L51 A;  4M2Q A;  4CLN A;  1S6C A;  1HT9 A;  1ZMZ A;  1G4Y R;  1AJ4 A;  3BXK A;  3EVV A;  2MLE C;  4MZK A;  3EKH A;  1CM1 A;  1K94 A;  1K90 D;  2BBN A;  3CR4 X;  5GQQ C;  1NCY A;  2JQ6 A;  1QX7 A;  4I5J A;  1K9P A;  4FTG A;  3LLE A;  4MLW A;  3D0Y A;  1BR1 B;  1XYD A;  2LMU A;  2PAL A;  4DCK A;  1QV1 A;  1YX8 A;  4C0K A;  3EK7 A;  1DMO A;  5AEQ A;  1LXF C;  1EJ3 A;  2V53 A;  1V1G A;  3OB1 B;  4WRI A;  1FBV A;  2KDH A;  1QJT A;  1H4B A;  2KQY A;  2B1U A;  1IQ3 A;  1IWQ A;  2RGI A;  2K7D A;  1BU3 A;  1GQM A;  2OPO A;  1LVC D;  3I5F C;  4NDD A;  2EGD A;  1FI5 A;  1CFC A;  1VRK A;  1CLB A;  4QJ4 B;  3PLF B;  1MUX A;  1N65 A;  1SBJ A;  4GPL B;  1UHH A;  1SR6 B;  2PAS A;  2LV7 A;  2KI6 D;  2AUC A;  2TN4 A;  4WQ2 A;  1XFV O;  1J7Q A;  3IF7 A;  4I5N B;  1DTL A;  1U5I B;  2EHB A;  2SAS A;  1XO5 A;  1K9U A;  3PN7 C;  4GUK A;  1YVH A;  3I5I C;  1SMG A;  1CFD A;  2LVJ A;  3SJS A;  1SCM B;  2LVK A;  4NDB A;  2JTZ A;  1R6P A;  1TNX A;  4A4C A;  1C7V A;  1LA3 A;  1UHK A;  1F54 A;  1M31 A;  1NP8 A;  1UUR A;  1CDM A;  2ZFD A;  1CMG A;  2FCD A;  1CFP A;  1WDC C;  1UHN A;  2K2A A;  2JUL A;  3DF0 B;  3ZWH A;  2H2K A;  1PSR A;  1IJ6 A;  2WCF A;  2LUX A;  4NQG A;  2E30 A;  2KNE A;  2L98 A;  1SL8 A;  1CLL A;  2ZKM X;  1OMD A;  3JTD C;  1DF0 B;  5HYD A;  2KHN A;  1NX3 A;  2KYC A;  3KHE A;  1XFY O;  2LE9 B;  3NSL A;  4F0Z B;  4XJK B;  2KYF A;  1PUL A;  3M0W A;  5DKR A;  1MF8 B;  2LLU A;  2JRF A;  3SG7 A;  2HPS A;  1J7P A;  1AHR A;  1NPQ A;  2K7B A;  3VRN A;  4USL A;  2KQ6 A;  1SW8 A;  2AMI A;  5J3X A;  3EK4 A;  2Y5I A;  1CLM A;  5CSF A;  2IS9 A;  2JC2 A;  1J1D A;  2Q91 A;  3NXA A;  4P2Y B;  4YGE B;  1KWO C;  1JF0 A;  5CPV A;  2BKI B;  2BL0 C;  1QVI Z;  2JU0 A;  2GV5 A;  1YUS A;  1QLK A;  2A4J A;  2F33 A;  4GBA A;  4MZJ A;  3TUY B;  2HQ8 A;  1WLM A;  3EVR A;  3O78 A;  3CS1 A;  3OX5 A;  4C0L A;  4YGA A;  1PVB A;  1KK8 B;  1RJV A;  2K7O A;  2K0J A;  3OHM B;  4PHJ A;  5TNC A;  3LL8 B;  2LLS A;  3SG2 A;  2LVV A;  3I5G C;  3PSR A;  5PAL A;  1F4Q A;  3WNX B;  2CBL A;  4PCW A;  1C07 A;  1V1F A;  1F55 A;  1UWO A;  1SNL A;  2WC8 A;  3O4Y A;  2L4H A;  2PMY A;  3VGO A;  5KU1 A;  1QTX A;  2K61 A;  1B1G A;  1FPW A;  2I18 A;  2FOT A;  4BY5 A;  1TN4 A;  2F3Y A;  2O5G A;  2HQW A;  3O6B A;  5KTY A;  3SG5 A;  1EH2 A;  2FJU B;  1DVI A;  1QX5 B;  1N0Y A;  1SCV A;  2KSP A;  1WRK A;  5JOL A;  1B8C A;  1KK7 Y;  2OTG B;  4PE4 A;  1EXR A;  1S1E A;  2MA2 A;  1QLS A;  1CDP A;  2FCE A;  3C1V A;  1Y0V H;  2BE6 A;  1TCO B;  1DGU A;  1YR5 A;  1ZUZ A;  4MBE A;  1MXE A;  4ZCV A;  4PHN A;  3ZNI A;  4D1E A;  2Y1M A;  4L9M A;  3LCP C;  3SIA A;  2M8U A;  1B8R A;  1YUT A;  2P6B B;  1OQP A;  4Q04 A;  3BQ3 A;  3SIB A;  1A03 A;  1M46 A;  2F8P A;  4U8D A;  1JFJ A;  1FW4 A;  1LA0 A;  1CM4 A;  1KSM A;  4YGB B;  1EG4 A;  3JVT B;  5CSN A;  2OS8 B;  5CSI A;  3SG4 A;  3I5H B;  1EG3 A;  1HQV A;  3CWG A;  1XA5 A;  1TNQ A;  3KEV A;  3O2P A;  2ZN8 A;  1NYA A;  1XFU O;  4P5O E;  3AAK A;  2KGR A;  3IQQ A;  2NXQ A;  3AAJ A;  2CNP A;  1YUR A;  1KQM C;  1YRU B;  1MWN A;  1YUU A;  1A75 A;  1ZFS A;  2EC6 B;  1K9K A;  3AKB A;  1PRW A;  2MRD A;  1A29 A;  5D7F A;  1KFU L;  1UHI A;  3D0Y B;  4PE1 A;  3CGA A;  1Y6W A;  3IQO A;  1J7R A;  4ETO A;  1OSA A;  2M7L A;  1MXL C;  1PK0 D;  1KFX L;  1REC A;  1RRO A;  1W7I B;  2JT3 A;  2WCB A;  4OR9 B;  5FYX A;  1IG5 A;  3TS5 C;  5ER4 X;  1Q80 A;  1L2O B;  2LNK A;  1TNP A;  2I94 A;  2BCX A;  1GGW A;  1A4P A;  2CXJ A;  5AER A;  1JC2 A;  1SRA A;  3LK0 A;  5F6T A;  1BT6 A;  2ISD A;  5AAN A;  5HLV A;  3NSO A;  2LMV A;  1CFF A;  2NZ0 A;  4GGF C;  4PAL A;  1KSO A;  1CKK A;  5AFP A;  2K2F A;  1DJI A;  1N2D A;  1TNW A;  1G33 A;  1YVL A;  2M29 A;  4QJ3 B;  2PRU A;  5D69 A;  1S36 A;  5JJG A;  2LC5 A;  4YGC B;  1F8H A;  1J55 A;  1DJX A;  2K8M B;  3GK4 X;  1EL4 A;  4OV2 A;  2HF5 A;  5CSJ A;  1BR4 B;  1QS7 A;  3NSI A;  3TZ1 A;  2QAC A;  3PAT A;  2GGM A;  1PVA A;  2HET A;  2CT9 A;  1Y1A A;  3BUW B;  1IKU A;  3I5F B;  1MQ1 A; 
#chains in the Genus database with same CATH topology
 2FJY A;  1PAL A;  2M49 B;  2NCP A;  3CR5 X;  1S5G Z;  1CDL A;  2NLN A;  4AQJ A;  4IL1 A;  2LLT A;  1M45 A;  1K96 A;  1T14 A;  1W9Z A;  4GGF A;  3DXL A;  2SCP A;  3D10 A;  3V2L A;  1BG1 A;  3FWB A;  2WCJ A;  1RTP 1;  1YRT B;  3CZ2 A;  1UP5 A;  1B4C A;  3VRQ A;  3VRO A;  4FQO A;  1ZAC A;  1JFK A;  3QRX A;  5KSZ A;  3F45 A;  4MZL A;  1F71 A;  3CLN A;  4JPZ B;  1OMV A;  3PN7 B;  4ICB A;  1S6I A;  2G2B A;  3I5I B;  2LHI A;  1KK7 Z;  4N1F A;  4N1G A;  1K93 D;  2KI4 C;  4FQT A;  3PM8 A;  2H61 C;  2LP3 A;  1JBA A;  1QIW A;  1Y1U A;  2F3Z A;  2GGZ A;  1OW4 A;  1AK8 A;  1QX2 A;  1XVJ A;  3D74 A;  1WY9 A;  2P71 A;  3FS7 A;  3K21 A;  3VRR A;  1JF2 A;  1S5G Y;  1OZS A;  1WDC B;  2QPT A;  1XFW O;  4OCI A;  1B8L A;  3B7A A;  1DEK A;  3RM1 A;  2LCP A;  1UHJ A;  2L5Y A;  1OZO A;  1YTZ C;  3BUX B;  3EVU A;  4GNK B;  1DT7 B;  2ZRS A;  3FWC A;  1F4O A;  2MAZ A;  4PHK A;  3JTD B;  3AKA A;  2MLF C;  3HX4 A;  2F2P A;  3SG6 A;  2ERB A;  2NCO A;  2KOT A;  3HCM A;  1DJZ A;  2COL B;  1NUB A;  2F2O A;  2BAP A;  3PJI A;  3CZT X;  4YGD B;  5AXI A;  1CDN A;  1K2H A;  1J1E A;  2L2E A;  4R1E A;  3WHU B;  2I2R E;  1SL9 A;  2PVB A;  3ICB A;  2KI6 C;  4DIR A;  2KBM A;  5BPJ A;  1JSA A;  3B88 A;  4OZD A;  3A8R A;  2E6W A;  4MSP A;  1NX2 A;  1RK9 A;  1SKT A;  2H61 A;  1NCX A;  2M7N A;  3DVJ A;  3LK1 A;  4A4B A;  1DQE A;  4CPV A;  3GK2 A;  4MRX A;  3CZ1 A;  1JWD A;  4BY4 A;  1KWO B;  1CMF A;  2BL0 B;  2K60 A;  4QJ5 B;  2BEC A;  2L0P A;  3DVM A;  4NDC A;  4TNC A;  4ORB B;  4M2O A;  1OOG A;  1SY9 A;  3RLZ A;  4PHM A;  3PM2 A;  1SR6 C;  1SPY A;  2LMT A;  2JXC A;  5HLO A;  3B6X A;  1C3Z A;  2M3W A;  4GFT A;  4I5L B;  2WOS A;  1YX7 A;  3DD4 A;  4OKH A;  1H8B A;  1NCZ A;  2KBI A;  4CFR A;  3OB2 B;  3CAB A;  1QIV A;  3I5G B;  1DJG A;  1M63 B;  3TDU A;  5I2O A;  1UUS A;  2LVI A;  5K89 A;  1ZOT B;  1X02 A;  3KF9 A;  2BCA A;  4PDZ A;  2KAX A;  1SCM C;  5HKW A;  3UNW A;  4INX A;  4UPG A;  4ORC B;  1F70 A;  2KLE A;  1J7O A;  4HRE E;  4INW A;  3TDZ A;  1ALV A;  3CR2 A;  1ODB A;  1K95 A;  3D76 A;  1BOC A;  5HKZ A;  1DGV A;  2PSR A;  4MRY A;  1KFU S;  4MEW A;  3D78 A;  1A75 B;  3DVE A;  4YRU A;  2JXL A;  4PE0 A;  1AVS A;  1KFX S;  4MVF A;  1WRZ A;  4HRG A;  5EL2 A;  4ZCU A;  1BOD A;  3WHT B;  2JWW A;  1U5I A;  5D3O A;  1TOP A;  4AOM A;  4I5K A;  3OGN A;  1XFZ O;  1G8I A;  2WC5 A;  1XK4 C;  4CID A;  1Y1X A;  3MSE B;  2PYQ A;  1IJ5 A;  2WND A;  4GGN A;  4JQ0 D;  3VRP A;  2G9B A;  1R2U A;  2GTE A;  3KO0 A;  1LS8 A;  3GK1 A;  1KCY A;  1E8A A;  2KFH A;  2M0R A;  3D73 A;  4YI8 A;  5IBW A;  2JOJ A;  5B8I B;  2AAO A;  2Y4Q A;  1IRJ A;  1NSH A;  2BBM A;  1TTX A;  3DF0 A;  4PE7 A;  3DYE A;  3Q8I A;  1KQM B;  4HRH A;  3GOF A;  3TUY C;  1BLQ A;  1OE9 B;  1L7Z A;  1AP4 A;  2JNF A;  1C3Y A;  1RWY A;  2WOR A;  1DF0 A;  3EG5 B;  5HKY A;  3EKJ A;  1W7J B;  1CB1 A;  1GGZ A;  1KK8 C;  2D8N A;  3DVK A;  1QAS A;  1TCF A;  3NSK A;  4XJK A;  1MR8 A;  1OOI X;  1AJ5 A;  3FE9 A;  2KFG A;  4M2P A;  1NIW A;  3WXA A;  3H4S E;  3TS5 B;  1SYM A;  1LKJ A;  1WRL A;  1MHO A;  2KFF A;  3CYZ A;  1S3P A;  4CFQ A;  1TIZ A;  2LHL A;  2JNX A;  1B47 A;  1XFX O;  1S26 D;  1TWO A;  1XK4 A;  2ZN9 A;  2CTN A;  2JPO A;  4HSZ A;  4MN0 A;  2L5X B;  4YBH B;  3S0F A;  3OX6 A;  1FI6 A;  4N5X A;  2K7C A;  3CDN A;  1NX1 A;  1QXP A;  1OOJ A;  2P70 A;  1BJF A;  1SL7 A;  2BE4 A;  3PAL A;  2Q4U A;  1RFJ A;  1GJY A;  2OTG C;  1QAT A;  1DJY A;  2M1U A;  2M1K B;  3CZ0 A;  2MBX A;  2H8V A;  3FE8 A;  3BUN B;  2I7A A;  2LAP A;  2VRG A;  2JT0 A;  2WCM A;  4DUQ A;  2KAV A;  2LM5 A;  2Y1N A;  4AQI A;  2M9G A;  3BUM B;  1CNP A;  2PQL A;  4OVN F;  1DJH A;  3KPX A;  1BMO A;  2O60 A;  3FIA A;  1JUO A;  3OP0 A;  2JZI A;  4PT1 A;  2MHH A;  3E3R A;  2MJW B;  1WLZ A;  2WC6 A;  2L2C A;  3JVT C;  3PFV A;  2OS8 C;  3EK8 A;  3I5H C;  3SS4 A;  1NWD A;  1QV0 A;  1A2X A;  5DKQ A;  2R2I A;  1B7T Z;  1S6J A;  2ZND A;  4JKT A;  1D1O A;  1BF5 A;  1B9A A;  3SG3 A;  3BOW A;  5G08 A;  2KGB C;  5ER5 A;  1K8U A;  1CTR A;  3TDI A;  2QEB A;  2DOQ A;  2EC6 C;  3RZS A;  1SK6 D;  2WCE A;  1FF1 A;  2LP2 A;  2BCB A;  1Z2C B;  2KPH A;  3BUO B;  1QVI Y;  1NX0 A;  5DKN A;  5I2Q A;  2LUC A;  4XYN A;  1KQV A;  3BYA A;  4E68 A;  4WQ3 A;  1ALW A;  1DJW A;  4YI9 A;  1IH0 A;  4JWQ A;  1TRF A;  2JT8 A;  1LIN A;  2KI4 B;  1C7W A;  3BOW B;  1M39 A;  2ZRT A;  2JTT A;  1L2O C;  3DY9 A;  3UO9 A;  1IIO A;  2CCM A;  2JPT A;  2L4I A;  3A4U B;  4ORA B;  5I8N A;  4C0J A;  4DS7 A;  1B7T Y;  1XFR A;  1PSB A;  5I2L A;  2M97 A;  3CTN A;  2L50 A;  1IGV A;  4GAO A;  2ZNE A;  1IQ5 A;  2LAN A;  4DRW A;  3O4X A;  1OMR A;  2BKH B;  2KAY A;  1AUI B;  2L51 A;  4M2Q A;  4CLN A;  1S6C A;  1HT9 A;  1ZMZ A;  1G4Y R;  1AJ4 A;  3BXK A;  3EVV A;  2MLE C;  4MZK A;  3EKH A;  1CM1 A;  1K94 A;  1K90 D;  2BBN A;  3CR4 X;  5GQQ C;  1NCY A;  2JQ6 A;  1QX7 A;  4I5J A;  1K9P A;  4FTG A;  3LLE A;  4MLW A;  3D0Y A;  1BR1 B;  1XYD A;  2LMU A;  2PAL A;  3R72 A;  4DCK A;  1QV1 A;  1YX8 A;  4C0K A;  3EK7 A;  1DMO A;  5AEQ A;  1LXF C;  1EJ3 A;  2V53 A;  1V1G A;  3OB1 B;  4WRI A;  1FBV A;  2KDH A;  1QJT A;  1TUZ A;  1H4B A;  2KQY A;  2B1U A;  1IQ3 A;  1IWQ A;  2RGI A;  2K7D A;  3BFH A;  3N7H A;  1BU3 A;  1GQM A;  2OPO A;  1LVC D;  3I5F C;  4NDD A;  4IJ7 A;  3S0G A;  2EGD A;  1FI5 A;  1QWV A;  1CFC A;  1VRK A;  1CLB A;  4QJ4 B;  3PLF B;  1MUX A;  1N65 A;  1SBJ A;  4GPL B;  3S0D A;  5DIC A;  1UHH A;  3L4L A;  1SR6 B;  2PAS A;  4F7F A;  2LV7 A;  2KI6 D;  2AUC A;  2YGU A;  2TN4 A;  4WQ2 A;  3B86 A;  1XFV O;  1J7Q A;  3IF7 A;  4I5N B;  1DTL A;  1U5I B;  2EHB A;  3B87 A;  2SAS A;  1XO5 A;  1K9U A;  3PN7 C;  4GUK A;  1YVH A;  3I5I C;  1SMG A;  1CFD A;  2LVJ A;  2BNX A;  3SJS A;  1SCM B;  2LVK A;  4NDB A;  2JTZ A;  1R6P A;  1TNX A;  3L47 A;  4A4C A;  2QEO A;  1C7V A;  1LA3 A;  1UHK A;  2WCL A;  1F54 A;  1M31 A;  3D77 A;  1NP8 A;  1UUR A;  1CDM A;  2ZFD A;  1CMG A;  3SS3 A;  2FCD A;  1CFP A;  1WDC C;  1UHN A;  2K2A A;  2JUL A;  3DF0 B;  3ZWH A;  2H2K A;  1PSR A;  1IJ6 A;  2WCF A;  2LUX A;  4NQG A;  2E30 A;  5FI7 A;  2KNE A;  2L98 A;  1SL8 A;  1CLL A;  2ZKM X;  1OMD A;  3JTD C;  1DF0 B;  5HYD A;  2KHN A;  1NX3 A;  2KYC A;  3KHE A;  1XFY O;  2LE9 B;  1OOF A;  2QEH A;  3NSL A;  4XJK B;  4F0Z B;  2KYF A;  1PUL A;  3M0W A;  5DKR A;  1MF8 B;  2LLU A;  2JRF A;  1ORG A;  3SG7 A;  2HPS A;  1J7P A;  1AHR A;  1NPQ A;  2K7B A;  3BFA A;  3VRN A;  1TUJ A;  2WCH A;  4USL A;  2KQ6 A;  1SW8 A;  2AMI A;  5J3X A;  3EK4 A;  4JD9 A;  2Y5I A;  3VB1 A;  1CLM A;  5CSF A;  2IS9 A;  2JC2 A;  1J1D A;  2Q91 A;  3NXA A;  4P2Y B;  4YGE B;  1KWO C;  1JF0 A;  5CPV A;  2BKI B;  2BL0 C;  1QVI Z;  2JU0 A;  2GV5 A;  1YUS A;  1QLK A;  2A4J A;  2F33 A;  3BFB A;  5FI6 A;  4GBA A;  4MZJ A;  3TUY B;  2HQ8 A;  1WLM A;  3EVR A;  3O78 A;  3CS1 A;  3OX5 A;  4C0L A;  4YGA A;  3DZT A;  3R1O A;  1PVB A;  1KK8 B;  1RJV A;  2K7O A;  2K0J A;  3D75 A;  3OHM B;  4PHJ A;  5TNC A;  3LL8 B;  2LLS A;  3SG2 A;  2LVV A;  1OOH A;  3I5G C;  3PSR A;  5PAL A;  1F4Q A;  1SSE B;  3WNX B;  2CBL A;  3IVT A;  3K1E A;  4PCW A;  1C07 A;  1V1F A;  2QDI A;  1F55 A;  1UWO A;  1SNL A;  2KLD A;  2WC8 A;  3O4Y A;  2L4H A;  2PMY A;  3VGO A;  5KU1 A;  1QTX A;  2K61 A;  1B1G A;  1FPW A;  2I18 A;  3BJH A;  2FOT A;  5FI2 A;  4BY5 A;  1TN4 A;  2F3Y A;  2O5G A;  2HQW A;  3O6B A;  5KTY A;  3SG5 A;  1EH2 A;  2FJU B;  2WCK A;  1DVI A;  1QX5 B;  1N0Y A;  1SCV A;  2KSP A;  1WRK A;  5JOL A;  1B8C A;  1KK7 Y;  2OTG B;  4PE4 A;  1EXR A;  1S1E A;  2MA2 A;  1QLS A;  1CDP A;  2FCE A;  3C1V A;  1Y0V H;  2BE6 A;  3R1V A;  1TCO B;  1Z4H A;  1DGU A;  2QEV A;  1YR5 A;  1ZUZ A;  4MBE A;  1MXE A;  4ZCV A;  4PHN A;  3ZNI A;  4D1E A;  2Y1M A;  4L9M A;  3LCP C;  3L4A A;  3SIA A;  2M8U A;  1B8R A;  1YUT A;  2P6B B;  5HL1 A;  1OQP A;  3NHI A;  4Q04 A;  3BQ3 A;  3SIB A;  1A03 A;  1M46 A;  2F8P A;  3NGV A;  4U8D A;  1JFJ A;  3S0A A;  1FW4 A;  1LA0 A;  1CM4 A;  1KSM A;  4YGB B;  1EG4 A;  3JVT B;  5CSN A;  2OS8 B;  5CSI A;  3SG4 A;  3I5H B;  3S0B A;  1EG3 A;  1HQV A;  3CWG A;  1XA5 A;  1TNQ A;  3KEV A;  3O2P A;  2ZN8 A;  1NYA A;  1XFU O;  4P5O E;  3AAK A;  2KGR A;  3IQQ A;  2NXQ A;  3AAJ A;  2CNP A;  1YUR A;  1KQM C;  1YRU B;  3OBV A;  4KYN A;  1MWN A;  1YUU A;  1A75 A;  1ZFS A;  2EC6 B;  1K9K A;  3AKB A;  1PRW A;  2MRD A;  3S0E A;  1A29 A;  5D7F A;  1KFU L;  1UHI A;  3D0Y B;  4PE1 A;  3CGA A;  1Y6W A;  3IQO A;  1J7R A;  3SS5 A;  1OSA A;  3NHT A;  2M7L A;  4ETO A;  1MXL C;  1PK0 D;  1KFX L;  1REC A;  1RRO A;  1W7I B;  2JT3 A;  2WCB A;  4OR9 B;  5FYX A;  1IG5 A;  3TS5 C;  1GM0 A;  5ER4 X;  1Q80 A;  1L2O B;  2LNK A;  1TNP A;  2I94 A;  2BCX A;  1DC1 A;  1GGW A;  1A4P A;  2CXJ A;  5AER A;  1JC2 A;  1P28 A;  1SRA A;  3LK0 A;  5F6T A;  1BT6 A;  2ISD A;  3R1P A;  5HLV A;  5AAN A;  3NSO A;  2LMV A;  1CFF A;  2NZ0 A;  4GGF C;  1DEL A;  1KSO A;  4PAL A;  5AFP A;  2K2F A;  1CKK A;  1DJI A;  1N2D A;  1TNW A;  1G33 A;  1YVL A;  3QME A;  2M29 A;  4QJ3 B;  2PRU A;  5D69 A;  1S36 A;  5JJG A;  2LC5 A;  5I94 A;  4YGC B;  1F8H A;  1J55 A;  1DJX A;  2K8M B;  3GK4 X;  1EL4 A;  3FE6 A;  4OV2 A;  2HF5 A;  5CSJ A;  1BR4 B;  1QS7 A;  3NSI A;  3TZ1 A;  2QAC A;  3PAT A;  2GGM A;  1PVA A;  2HET A;  2CT9 A;  1Y1A A;  3BUW B;  1IKU A;  3I5F B;  1MQ1 A; 
#chains in the Genus database with same CATH homology
 1PAL A;  2M49 B;  2NCP A;  3CR5 X;  1S5G Z;  1CDL A;  2NLN A;  4AQJ A;  4IL1 A;  2LLT A;  1M45 A;  1K96 A;  4GGF A;  1BG1 A;  2SCP A;  3D10 A;  3FWB A;  1RTP 1;  1YRT B;  1UP5 A;  1B4C A;  3VRQ A;  3VRO A;  4FQO A;  1ZAC A;  1JFK A;  3QRX A;  5KSZ A;  3F45 A;  4MZL A;  1F71 A;  3CLN A;  4JPZ B;  1OMV A;  3PN7 B;  4ICB A;  1S6I A;  2G2B A;  3I5I B;  2LHI A;  1KK7 Z;  4N1F A;  4N1G A;  1K93 D;  2KI4 C;  3PM8 A;  2H61 C;  2LP3 A;  1JBA A;  1QIW A;  1Y1U A;  2F3Z A;  2GGZ A;  1AK8 A;  1QX2 A;  1XVJ A;  3K21 A;  1WY9 A;  3FS7 A;  3VRR A;  1JF2 A;  1S5G Y;  1OZS A;  1WDC B;  2QPT A;  1XFW O;  4OCI A;  1B8L A;  3RM1 A;  2LCP A;  1UHJ A;  3BUX B;  1OZO A;  1YTZ C;  3EVU A;  4GNK B;  1DT7 B;  2ZRS A;  3FWC A;  1F4O A;  2MAZ A;  4PHK A;  3JTD B;  3AKA A;  2MLF C;  3HX4 A;  2F2P A;  3SG6 A;  2NCO A;  2KOT A;  3HCM A;  1DJZ A;  2COL B;  1NUB A;  2F2O A;  3CZT X;  4YGD B;  5AXI A;  1CDN A;  1K2H A;  1J1E A;  2L2E A;  4R1E A;  3WHU B;  2I2R E;  1SL9 A;  2PVB A;  3ICB A;  2KI6 C;  4DIR A;  2KBM A;  5BPJ A;  1JSA A;  3A8R A;  2E6W A;  4MSP A;  1NX2 A;  1RK9 A;  1SKT A;  2H61 A;  1NCX A;  2M7N A;  3DVJ A;  3LK1 A;  4A4B A;  4CPV A;  3GK2 A;  4MRX A;  1JWD A;  4BY4 A;  1KWO B;  1CMF A;  2BL0 B;  4QJ5 B;  2BEC A;  2L0P A;  3DVM A;  4NDC A;  4TNC A;  4ORB B;  4M2O A;  1SY9 A;  3RLZ A;  4PHM A;  1SR6 C;  1SPY A;  2LMT A;  2JXC A;  5HLO A;  2M3W A;  4GFT A;  4I5L B;  2WOS A;  1YX7 A;  3DD4 A;  4OKH A;  1NCZ A;  2KBI A;  4CFR A;  3OB2 B;  1QIV A;  3I5G B;  1DJG A;  1M63 B;  3TDU A;  5I2O A;  1UUS A;  2LVI A;  5K89 A;  1ZOT B;  1X02 A;  3KF9 A;  2BCA A;  4PDZ A;  2KAX A;  1SCM C;  5HKW A;  4UPG A;  4ORC B;  1F70 A;  1J7O A;  4HRE E;  3TDZ A;  1ALV A;  3CR2 A;  1ODB A;  1K95 A;  1BOC A;  5HKZ A;  1DGV A;  2PSR A;  4MRY A;  1KFU S;  4MEW A;  3DVE A;  1A75 B;  4YRU A;  2JXL A;  4PE0 A;  1AVS A;  1KFX S;  4MVF A;  1WRZ A;  4HRG A;  4ZCU A;  1BOD A;  3WHT B;  2JWW A;  1U5I A;  4AOM A;  1TOP A;  4I5K A;  1XFZ O;  1G8I A;  1XK4 C;  4CID A;  1Y1X A;  3MSE B;  2WND A;  1IJ5 A;  4GGN A;  4JQ0 D;  3VRP A;  2G9B A;  1R2U A;  1KCY A;  3KO0 A;  3GK1 A;  1E8A A;  2KFH A;  2M0R A;  4YI8 A;  5IBW A;  2JOJ A;  5B8I B;  2AAO A;  2Y4Q A;  1IRJ A;  1NSH A;  2BBM A;  1TTX A;  3DF0 A;  4PE7 A;  3TUY C;  1KQM B;  4HRH A;  3GOF A;  1BLQ A;  1OE9 B;  1L7Z A;  1AP4 A;  2JNF A;  1RWY A;  2WOR A;  1DF0 A;  5HKY A;  1CB1 A;  3EKJ A;  1W7J B;  1GGZ A;  1KK8 C;  2D8N A;  3DVK A;  1QAS A;  1TCF A;  3NSK A;  4XJK A;  1MR8 A;  1AJ5 A;  2KFG A;  4M2P A;  1NIW A;  3WXA A;  3H4S E;  3TS5 B;  1SYM A;  1LKJ A;  1WRL A;  1MHO A;  2KFF A;  1S3P A;  4CFQ A;  1TIZ A;  2LHL A;  2JNX A;  1B47 A;  1XFX O;  1S26 D;  1XK4 A;  2ZN9 A;  4HSZ A;  2CTN A;  4MN0 A;  4YBH B;  1H8B A;  2L5X B;  3OX6 A;  1FI6 A;  4N5X A;  2K7C A;  1NX1 A;  1QXP A;  1OOJ A;  1BJF A;  1SL7 A;  2BE4 A;  3PAL A;  2Q4U A;  1RFJ A;  1GJY A;  2OTG C;  1QAT A;  1DJY A;  2M1U A;  2M1K B;  2MBX A;  3BUN B;  2I7A A;  2LAP A;  2VRG A;  2JT0 A;  4DUQ A;  2KAV A;  2LM5 A;  2Y1N A;  4AQI A;  2M9G A;  3BUM B;  1CNP A;  4OVN F;  1DJH A;  3KPX A;  1BMO A;  2O60 A;  3FIA A;  1JUO A;  3OP0 A;  2JZI A;  2MHH A;  3E3R A;  2MJW B;  1WLZ A;  3JVT C;  3PFV A;  2OS8 C;  3EK8 A;  3I5H C;  1NWD A;  1QV0 A;  1A2X A;  5DKQ A;  2R2I A;  1B7T Z;  1S6J A;  2ZND A;  1D1O A;  1BF5 A;  1B9A A;  3SG3 A;  3BOW A;  5G08 A;  2KGB C;  5ER5 A;  1K8U A;  1CTR A;  3TDI A;  2DOQ A;  2EC6 C;  1SK6 D;  2WCE A;  1FF1 A;  2LP2 A;  2BCB A;  3BUO B;  1QVI Y;  1NX0 A;  5DKN A;  5I2Q A;  2LUC A;  4XYN A;  1KQV A;  3BYA A;  4E68 A;  4WQ3 A;  1ALW A;  1DJW A;  4YI9 A;  1IH0 A;  4JWQ A;  1TRF A;  2JT8 A;  1LIN A;  2KI4 B;  1C7W A;  3BOW B;  1M39 A;  2ZRT A;  2JTT A;  1L2O C;  2CCM A;  2JPT A;  2L4I A;  3A4U B;  4ORA B;  5I8N A;  4C0J A;  4DS7 A;  1B7T Y;  1PSB A;  5I2L A;  2M97 A;  3CTN A;  2L50 A;  1IGV A;  4GAO A;  2ZNE A;  1IQ5 A;  2LAN A;  4DRW A;  1OMR A;  2BKH B;  2KAY A;  1AUI B;  2L51 A;  4M2Q A;  4CLN A;  1S6C A;  1HT9 A;  1ZMZ A;  1G4Y R;  1AJ4 A;  3BXK A;  3EVV A;  2MLE C;  4MZK A;  3EKH A;  1CM1 A;  1K94 A;  1K90 D;  2BBN A;  3CR4 X;  5GQQ C;  1NCY A;  2JQ6 A;  1QX7 A;  4I5J A;  1K9P A;  4FTG A;  3LLE A;  4MLW A;  3D0Y A;  1BR1 B;  1XYD A;  2LMU A;  2PAL A;  4DCK A;  1QV1 A;  1YX8 A;  4C0K A;  3EK7 A;  1DMO A;  5AEQ A;  1LXF C;  1EJ3 A;  2V53 A;  1V1G A;  3OB1 B;  4WRI A;  1FBV A;  2KDH A;  1QJT A;  1H4B A;  2KQY A;  2B1U A;  1IQ3 A;  1IWQ A;  2RGI A;  2K7D A;  1BU3 A;  1GQM A;  2OPO A;  1LVC D;  3I5F C;  4NDD A;  2EGD A;  1FI5 A;  1CFC A;  1VRK A;  1CLB A;  4QJ4 B;  3PLF B;  1MUX A;  1N65 A;  1SBJ A;  4GPL B;  1UHH A;  1SR6 B;  2PAS A;  2LV7 A;  2KI6 D;  2AUC A;  2TN4 A;  4WQ2 A;  1XFV O;  1J7Q A;  3IF7 A;  4I5N B;  1DTL A;  1U5I B;  2EHB A;  2SAS A;  1XO5 A;  1K9U A;  3PN7 C;  4GUK A;  1YVH A;  3I5I C;  1SMG A;  1CFD A;  2LVJ A;  3SJS A;  1SCM B;  2LVK A;  4NDB A;  2JTZ A;  1R6P A;  1TNX A;  4A4C A;  1C7V A;  1LA3 A;  1UHK A;  1F54 A;  1M31 A;  1NP8 A;  1UUR A;  1CDM A;  2ZFD A;  1CMG A;  2FCD A;  1CFP A;  1WDC C;  1UHN A;  2K2A A;  2JUL A;  3DF0 B;  3ZWH A;  2H2K A;  1PSR A;  1IJ6 A;  2WCF A;  2LUX A;  4NQG A;  2E30 A;  2KNE A;  2L98 A;  1SL8 A;  1CLL A;  2ZKM X;  1OMD A;  3JTD C;  1DF0 B;  5HYD A;  2KHN A;  1NX3 A;  2KYC A;  3KHE A;  1XFY O;  2LE9 B;  3NSL A;  4F0Z B;  4XJK B;  2KYF A;  1PUL A;  3M0W A;  5DKR A;  1MF8 B;  2LLU A;  2JRF A;  3SG7 A;  2HPS A;  1J7P A;  1AHR A;  1NPQ A;  2K7B A;  3VRN A;  4USL A;  2KQ6 A;  1SW8 A;  2AMI A;  5J3X A;  3EK4 A;  2Y5I A;  1CLM A;  5CSF A;  2IS9 A;  2JC2 A;  1J1D A;  2Q91 A;  3NXA A;  4P2Y B;  4YGE B;  1KWO C;  1JF0 A;  5CPV A;  2BKI B;  2BL0 C;  1QVI Z;  2JU0 A;  2GV5 A;  1YUS A;  1QLK A;  2A4J A;  2F33 A;  4GBA A;  4MZJ A;  3TUY B;  2HQ8 A;  1WLM A;  3EVR A;  3O78 A;  3CS1 A;  3OX5 A;  4C0L A;  4YGA A;  1PVB A;  1KK8 B;  1RJV A;  2K7O A;  2K0J A;  3OHM B;  4PHJ A;  5TNC A;  3LL8 B;  2LLS A;  3SG2 A;  2LVV A;  3I5G C;  3PSR A;  5PAL A;  1F4Q A;  3WNX B;  2CBL A;  4PCW A;  1C07 A;  1V1F A;  1F55 A;  1UWO A;  1SNL A;  2WC8 A;  3O4Y A;  2L4H A;  2PMY A;  3VGO A;  5KU1 A;  1QTX A;  2K61 A;  1B1G A;  1FPW A;  2I18 A;  2FOT A;  4BY5 A;  1TN4 A;  2F3Y A;  2O5G A;  2HQW A;  3O6B A;  5KTY A;  3SG5 A;  1EH2 A;  2FJU B;  1DVI A;  1QX5 B;  1N0Y A;  1SCV A;  2KSP A;  1WRK A;  5JOL A;  1B8C A;  1KK7 Y;  2OTG B;  4PE4 A;  1EXR A;  1S1E A;  2MA2 A;  1QLS A;  1CDP A;  2FCE A;  3C1V A;  1Y0V H;  2BE6 A;  1TCO B;  1DGU A;  1YR5 A;  1ZUZ A;  4MBE A;  1MXE A;  4ZCV A;  4PHN A;  3ZNI A;  4D1E A;  2Y1M A;  4L9M A;  3LCP C;  3SIA A;  2M8U A;  1B8R A;  1YUT A;  2P6B B;  1OQP A;  4Q04 A;  3BQ3 A;  3SIB A;  1A03 A;  1M46 A;  2F8P A;  4U8D A;  1JFJ A;  1FW4 A;  1LA0 A;  1CM4 A;  1KSM A;  4YGB B;  1EG4 A;  3JVT B;  5CSN A;  2OS8 B;  5CSI A;  3SG4 A;  3I5H B;  1EG3 A;  1HQV A;  3CWG A;  1XA5 A;  1TNQ A;  3KEV A;  3O2P A;  2ZN8 A;  1NYA A;  1XFU O;  4P5O E;  3AAK A;  2KGR A;  3IQQ A;  2NXQ A;  3AAJ A;  2CNP A;  1YUR A;  1KQM C;  1YRU B;  1MWN A;  1YUU A;  1A75 A;  1ZFS A;  2EC6 B;  1K9K A;  3AKB A;  1PRW A;  2MRD A;  1A29 A;  5D7F A;  1KFU L;  1UHI A;  3D0Y B;  4PE1 A;  3CGA A;  1Y6W A;  3IQO A;  1J7R A;  4ETO A;  1OSA A;  2M7L A;  1MXL C;  1PK0 D;  1KFX L;  1REC A;  1RRO A;  1W7I B;  2JT3 A;  2WCB A;  4OR9 B;  5FYX A;  1IG5 A;  3TS5 C;  5ER4 X;  1Q80 A;  1L2O B;  2LNK A;  1TNP A;  2I94 A;  2BCX A;  1GGW A;  1A4P A;  2CXJ A;  5AER A;  1JC2 A;  1SRA A;  3LK0 A;  5F6T A;  1BT6 A;  2ISD A;  5AAN A;  5HLV A;  3NSO A;  2LMV A;  1CFF A;  2NZ0 A;  4GGF C;  4PAL A;  1KSO A;  1CKK A;  5AFP A;  2K2F A;  1DJI A;  1N2D A;  1TNW A;  1G33 A;  1YVL A;  2M29 A;  4QJ3 B;  2PRU A;  5D69 A;  1S36 A;  5JJG A;  2LC5 A;  4YGC B;  1F8H A;  1J55 A;  1DJX A;  2K8M B;  3GK4 X;  1EL4 A;  4OV2 A;  2HF5 A;  5CSJ A;  1BR4 B;  1QS7 A;  3NSI A;  3TZ1 A;  2QAC A;  3PAT A;  2GGM A;  1PVA A;  2HET A;  2CT9 A;  1Y1A A;  3BUW B;  1IKU A;  3I5F B;  1MQ1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...