2LHLA

Chemical shift assignments and solution structure of human apo-s100a1 e32q mutant
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
93
structure length
93
Chain Sequence
b'GSELETAMETLINVFHAHSGKEGDKYKLSKKQLKELLQTELSGFLDAQKDVDAVDKVMKELDENGDGEVDFQEYVVLVAALTVACNNFFWENS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein S100-A1
publication title 1H, 13C and 15N NMR sequence-specific resonance assignments and relaxation parameters for human apo-S100A1 E32Q mutant
rcsb
source organism Homo sapiens
molecule tags Metal binding protein
total genus 20
structure length 93
sequence length 93
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2lhlA00
1CDNA 1GQMA 1WDCB 2PSRA 2JZIA 1BR1B 2LP2A 3KO0A 1DJIA 1S1EA 3SG7A 2GV5A 1FBVA 2GGZA 4U8DA 4GGFA 5CSJA 3DVJA 4HRGA 4M2OA 1SBJA 2HPSA 2JOJA 1EH2A 1SL9A 2L5XB 2B1UA 1Y1UA 2LE9B 1TNPA 3E3RA 5KSZA 5TNCA 4OR9B 2CXJA 4NDBA 1DF0B 2MHHA 1QATA 1BR4B 1PSRA 2SASA 4GPLB 4PHKA 5D69A 3PSRA 1DGVA 2KDHA 1M46A 4I5KA 2IS9A 1J55A 1KWOB 2F3ZA 2KI6D 2NCPA 4E68A 2EC6B 1IWQA 3DF0A 3NSOA 1AJ4A 1G4YR 1IQ5A 1A2XA 1B8RA 1V1GA 2FOTA 1GGWA 1TNWA 2ZN8A 1DJYA 3LL8B 5AANA 1FI5A 3GK4X 3RM1A 3H4SE 4OKHA 3EKHA 1ALVA 2L50A 1UUSA 3I5GC 3EK4A 4USLA 2OTGB 1PULA 3ZWHA 4C0JA 1RECA 2JT8A 2K2AA 1S26D 2LAPA 4HRHA 2GGMA 2ZN9A 1F4QA 2OS8C 5DKRA 3JTDB 5D7FA 1OMVA 1SW8A 1N2DA 2BBNA 2LV7A 1R6PA 5J3XA 1DTLA 1F4OA 4ZCVA 3ICBA 4A4CA 2K7OA 1AUIB 4DUQA 2KGBC 3K21A 4MZJA 1QVIZ 2F8PA 1NCYA 2AUCA 4GGFC 4MZKA 5CSNA 2RGIA 1QVIY 5DKNA 4BY5A 1IRJA 1BF5A 3VRPA 2BCXA 2LUXA 2I7AA 1F8HA 2BL0B 1CFPA 1YURA 4XYNA 1CLMA 1TN4A 3VROA 3CGAA 2OPOA 2WCBA 4DCKA 3O78A 1U5IA 1NUBA 1BODA 1JSAA 1DJXA 3I5FB 3BUOB 1YUSA 1W7JB 2TN4A 2K61A 2A4JA 1LINA 3DVMA 1Y1AA 2K2FA 1IH0A 1OOJA 4MSPA 2HQWA 2KOTA 4MN0A 3DVKA 5AERA 2LMUA 4OCIA 1Y1XA 4FQOA 3PM8A 1SMGA 1ZFSA 1UHJA 1YUUA 3WHTB 1CM1A 3RLZA 1NCXA 1K9KA 2CBLA 1NP8A 2KBMA 4PDZA 3I5HB 1IJ5A 1YX8A 3FIAA 4Q04A 3KEVA 1XYDA 2KFHA 4WRIA 4YGEB 3EKJA 3O2PA 4ETOA 2MLEC 2L4IA 5PALA 4C0LA 3SG6A 4GFTA 1MR8A 4JPZB 5AEQA 1LXFC 4CFQA 1A4PA 1SR6C 2H61A 3TS5C 4MVFA 4I5JA 1RK9A 4JQ0D 1MUXA 1B7TY 1ZOTB 1KK8C 1XK4A 1CKKA 2PALA 2LLTA 2FCEA 2AMIA 2PVBA 1SNLA 2BCBA 2MA2A 2P6BB 1NWDA 1NSHA 1SPYA 1C7WA 1J7RA 2M1UA 4MZLA 4ORCB 3VGOA 2M0RA 1BG1A 1SCMB 1UHIA 2LVVA 3CR2A 3MSEB 3BUMB 1BMOA 4QJ4B 3JVTC 1UHKA 2ZNDA 3PN7B 3M0WA 2JTZA 1JWDA 4DS7A 2Y1NA 1ZMZA 1S6IA 2KI4C 2Q4UA 5F6TA 5AXIA 1KFXS 1K96A 2ZFDA 2BE4A 3NSKA 1CFCA 1QS7A 1UHHA 1S3PA 5CSIA 2MBXA 3OX6A 1XFWO 2LM5A 1L7ZA 2O5GA 3OHMB 1CMFA 1KCYA 4WQ2A 3QRXA 4PALA 2PMYA 3HCMA 4MBEA 1OSAA 1N0YA 1JUOA 2LP3A 3VRRA 1EJ3A 1KQMC 4HSZA 5GQQC 3SG4A 1HQVA 3WHUB 1FPWA 1OQPA 2KBIA 2H61C 2WC8A 2JQ6A 1XA5A 3SG5A 1IQ3A 2NCOA 1QLSA 4P5OE 4PE1A 2FJUB 1XFXO 4PCWA 2G9BA 1QLKA 2JT3A 3VRQA 4I5LB 1XK4C 2ISDA 1B8CA 1EG3A 1JF2A 1M39A 2BECA 2K0JA 1TCOB 2H2KA 3AAKA 1OMRA 1WRZA 2KAVA 1NCZA 3GK1A 1SCVA 2LVIA 2K7CA 1LA0A 4YGBB 2WNDA 3BQ3A 1QV1A 4GAOA 1NYAA 1MWNA 5BPJA 1RROA 1XFUO 1ZUZA 2JULA 3LK1A 4CIDA 2DOQA 5DKQA 1DF0A 2L2EA 2JRFA 1WY9A 4NDDA 5HYDA 1L2OC 2KAXA 1B1GA 1F54A 1XFYO 1F70A 1B47A 1M45A 2AAOA 2JPTA 2MAZA 1RTP1 1DJWA 1NX1A 2LNKA 1QX5B 2KHNA 3I5IB 2MLFC 3EVVA 2KFFA 2Y4QA 4M2QA 2L4HA 2NXQA 1S36A 3BUNB 1UP5A 1UWOA 1A03A 1BLQA 1ALWA 4QJ3B 1DMOA 4FTGA 2I94A 3DVEA 4XJKB 5HKWA 2MRDA 1J1DA 1PSBA 3PLFB 3TUYC 1QJTA 1RWYA 1CMGA 2F2OA 1AP4A 3IQOA 1WDCC 1PRWA 1B9AA 4GUKA 1G8IA 2EHBA 2KQ6A 4P2YB 4DIRA 1F71A 2LANA 4GGNA 1FW4A 1V1FA 2L51A 1EG4A 2SCPA 3NSIA 1IGVA 1TRFA 4R1EA 1KK7Y 1JBAA 2R2IA 5JOLA 1SY9A 3EK7A 1TCFA 1R2UA 1XVJA 1F55A 4AQJA 1EXRA 2M97A 1C7VA 1G33A 1QTXA 2K7BA 3O6BA 1A75B 3PALA 1XFVO 1JFKA 1JFJA 1TIZA 2JWWA 2PRUA 1AVSA 3AAJA 1SK6D 1MXLC 4PHMA 5CSFA 2NLNA 3TZ1A 1K93D 1RJVA 2WCFA 1BJFA 1KWOC 3CLNA 1WLZA 2QPTA 3D0YB 4AOMA 1B7TZ 1CLLA 2EC6C 1CNPA 4YGAA 5K89A 3HX4A 1Q80A 1MF8B 2JC2A 2EGDA 4CLNA 1KSMA 2WORA 3C1VA 1Y6WA 1QASA 1TOPA 1NPQA 4N5XA 2KGRA 1B4CA 3OX5A 4PE0A 2OTGC 3VRNA 3I5GB 2M1KB 1IG5A 3BOWB 1DJHA 4PE7A 1MHOA 2HQ8A 3JTDC 4YI8A 2OS8B 5HKZA 1KFXL 4BY4A 2ZNEA 1AJ5A 4YI9A 1J7QA 1IJ6A 3SIBA 4YGCB 3D0YA 2CCMA 1ZACA 4PE4A 4NQGA 3EK8A 1CTRA 2G2BA 1Y0VH 1CDPA 1WLMA 1HT9A 1K9PA 2Q91A 1SYMA 3PFVA 4N1GA 2Y5IA 2BL0C 2F2PA 3NSLA 2JXLA 1E8AA 2KSPA 1YUTA 3OB2B 1NX3A 1XO5A 1CFFA 4YGDB 4MRYA 4UPGA 2BKHB 1GGZA 2V53A 3I5FC 1D1OA 3LK0A 1SKTA 3LLEA 1K8UA 1FI6A 1NX0A 5KTYA 2M3WA 5ER4X 2CTNA 2LHIA 3DF0B 5JJGA 3TDZA 1A29A 2Y1MA 4MRXA 2JTTA 3O4YA 2WCEA 2KNEA 3CZTX 5HLOA 3GOFA 4CFRA 1PALA 1J1EA 1FF1A 2MJWB 1YTZC 2LLSA 4PHJA 2LHLA 2CNPA 3I5HC 5B8IB 3ZNIA 1N65A 3FWCA 1LA3A 1M63B 1X02A 5FYXA 2JNXA 1NIWA 2M7NA 4A4BA 3CR5X 1SL7A 4OVNF 4NDCA 2COLB 1AHRA 3AKBA 3TDUA 1DT7B 1YR5A 3BUWB 2KAYA 4YRUA 3GK2A 2M7LA 3SG3A 1K90D 1K2HA 1QIWA 1QXPA 1SR6B 1WRLA 3TS5B 1CM4A 1NX2A 2CT9A 4ORAB 3CWGA 4N1FA 2JXCA 2NZ0A 3TDIA 1H8BA 4IL1A 2JNFA 5I2QA 2VRGA 1KK8B 2FCDA 3F45A 1W7IB 2LC5A 1TTXA 1SCMC 1SL8A 2M9GA 3D10A 1C07A 4HREE 1U5IB 1YRUB 2M8UA 2ZRSA 3SJSA 3KHEA 3PN7C 5HKYA 1JF0A 2BCAA 2ZKMX 2BKIB 4D1EA 4YBHB 1QV0A 3JVTB 3BUXB 1J7OA 1KQVA 1K95A 4MEWA 1XFZO 2I2RE 3WNXB 1KK7Z 2WOSA 1OMDA 2KYFA 1EL4A 2KI4B 1BOCA 2K8MB 5I2LA 1YVLA 2K7DA 5HLVA 2KFGA 1CB1A 5G08A 3EVRA 1AK8A 1DGUA 4PHNA 2LMTA 2F33A 1RFJA 1QX2A 2LLUA 1CDMA 1QIVA 1JC2A 4GBAA 4ORBB 2KYCA 2JU0A 1BU3A 3LCPC 3WXAA 4ICBA 4MLWA 1J7PA 1S6JA 3OB1B 2L0PA 1KQMB 4XJKA 3CTNA 1DVIA 5ER5A 1PK0D 1UHNA 3EVUA 2E6WA 2F3YA 5IBWA 5AFPA 1SRAA 1MXEA 2HF5A 3A4UB 1B8LA 2O60A 2HETA 2M49B 4JWQA 1MQ1A 1TNXA 1YX7A 4QJ5B 1DJZA 1IKUA 3FS7A 3KPXA 4WQ3A 1WRKA 4ZCUA 3SIAA 1CDLA 2LUCA 1A75A 1OZOA 3NXAA 4DRWA 3AKAA 1YVHA 3PATA 3A8RA 1DJGA 4M2PA 5I8NA 2QACA 1GJYA 3OP0A 4GNKB 2E30A 1H4BA 2BBMA 2ZRTA 1M31A 2LVJA 2LVKA 2KI6C 4OV2A 1S5GZ 4L9MA 2D8NA 4TNCA 1OZSA 1CLBA 1L2OB 3CR4X 3SG2A 2PASA 1QX7A 1KSOA 1K9UA 1S5GY 3I5IC 3FWBA 5KU1A 1KFUL 3KF9A 5I2OA 3IF7A 1BT6A 1LKJA 3BYAA 4C0KA 2BE6A 1CFDA 3BXKA 3DD4A 2LCPA 1K94A 5CPVA 1KFUS 1VRKA 1PVAA 1TNQA 1YRTB 2LMVA 1S6CA 2I18A 2M29A 2KQYA 4AQIA 1LVCD 1OE9B 3BOWA 4CPVA 3TUYB 1PVBA 4I5NB 1UURA 2L98A 3CS1A 3IQQA 2JT0A 4F0ZB 1ODBA
chains in the Genus database with same CATH superfamily
1CDNA 1GQMA 1WDCB 2PSRA 3D77A 3B7AA 2JZIA 3IVTA 1BR1B 2LP2A 3KO0A 3NGVA 1DJIA 5EL2A 1S1EA 3SG7A 2GV5A 1FBVA 2GGZA 4U8DA 4GGFA 5CSJA 3DVJA 4HRGA 3B88A 4M2OA 1SBJA 2HPSA 2JOJA 1EH2A 1SL9A 2L5XB 2B1UA 1Y1UA 2LE9B 1TNPA 3E3RA 5KSZA 5TNCA 4OR9B 2CXJA 4NDBA 1DF0B 2MHHA 1P28A 1QATA 1BR4B 1PSRA 2SASA 4GPLB 4PHKA 3FE8A 5D69A 3PSRA 1DGVA 2KDHA 3DYEA 1M46A 4I5KA 2IS9A 1J55A 1KWOB 2F3ZA 2KI6D 2NCPA 4E68A 2EC6B 1IWQA 3DF0A 3NSOA 1AJ4A 1G4YR 1IQ5A 1A2XA 1B8RA 1V1GA 2FOTA 2GTEA 4INXA 1TNWA 2ZN8A 1GGWA 1DJYA 3LL8B 5AANA 1FI5A 3GK4X 3RM1A 1TWOA 3H4SE 4OKHA 3EKHA 1ALVA 2L50A 1UUSA 3I5GC 3EK4A 4USLA 2OTGB 1PULA 3ZWHA 4C0JA 1RECA 2JT8A 2K2AA 1S26D 2LAPA 4HRHA 4INWA 2K60A 2GGMA 2ZN9A 1F4QA 2OS8C 5DKRA 3JTDB 5D7FA 1OMVA 1SW8A 1N2DA 2BBNA 2LV7A 1R6PA 5J3XA 1DTLA 1F4OA 4ZCVA 3ICBA 4A4CA 2K7OA 1AUIB 4DUQA 2KGBC 4KYNA 3K21A 4MZJA 1QVIZ 2F8PA 1NCYA 2AUCA 4GGFC 4MZKA 5CSNA 3D73A 2RGIA 1QVIY 3S0EA 5DKNA 4BY5A 1IRJA 1BF5A 3VRPA 2BCXA 2LUXA 2I7AA 3RZSA 2BL0B 1CFPA 1F8HA 1YURA 2QEOA 1CLMA 4XYNA 1TN4A 3VROA 3CGAA 2OPOA 2WCBA 4DCKA 3O78A 1U5IA 1NUBA 1BODA 1JSAA 1DJXA 2H8VA 3BUOB 3I5FB 1YUSA 1W7JB 2TN4A 2K61A 3R1VA 3DZTA 2A4JA 1LINA 3DVMA 1Y1AA 2K2FA 1IH0A 1OOJA 4MSPA 2HQWA 2KOTA 4MN0A 3DVKA 5AERA 2LMUA 4OCIA 1Y1XA 1DELA 4FQOA 3PM8A 1SMGA 1ZFSA 1UHJA 1YUUA 3WHTB 1CM1A 3RLZA 1NCXA 1K9KA 2CBLA 3S0AA 1NP8A 2KBMA 4PDZA 3S0BA 3I5HB 1IJ5A 1YX8A 3FIAA 4Q04A 3KEVA 1XYDA 2KFHA 4WRIA 4YGEB 1ORGA 3EKJA 3O2PA 4ETOA 2MLEC 2L4IA 5PALA 4C0LA 3SG6A 4GFTA 1MR8A 4JPZB 5AEQA 1SSEB 1LXFC 4CFQA 3UNWA 1A4PA 1SR6C 2H61A 3TS5C 4MVFA 4I5JA 1RK9A 4JQ0D 3Q8IA 1MUXA 3OGNA 1B7TY 1ZOTB 1KK8C 2WC6A 2KLDA 1XK4A 1CKKA 2PALA 2LLTA 2FCEA 2AMIA 2PVBA 1SNLA 2BCBA 2MA2A 2P6BB 1NWDA 1NSHA 1SPYA 1C7WA 1J7RA 2M1UA 1Z2CB 2WCMA 3S0FA 4FQTA 4ORCB 3VGOA 2M0RA 1BG1A 1SCMB 1UHIA 2LVVA 3CR2A 3S0GA 3MSEB 3BUMB 1BMOA 4QJ4B 2QEHA 3JVTC 1UHKA 2ZNDA 3PN7B 3M0WA 2JTZA 1JWDA 4DS7A 2Y1NA 1ZMZA 1S6IA 2KI4C 2Q4UA 3DXLA 2KPHA 5F6TA 5AXIA 1KFXS 1K96A 2ZFDA 2BE4A 3NSKA 1CFCA 1QS7A 5HL1A 1UHHA 1S3PA 5CSIA 2MBXA 3OX6A 1OOGA 1XFWO 2LM5A 1L7ZA 4JD9A 4PT1A 1OOHA 2O5GA 3OHMB 1CMFA 1KCYA 4WQ2A 3QRXA 4PALA 2PMYA 3HCMA 4MBEA 1OSAA 1N0YA 1JUOA 2LP3A 3VRRA 1EJ3A 1KQMC 4HSZA 5GQQC 3SG4A 1HQVA 3WHUB 1FPWA 1OQPA 2KBIA 2H61C 2WC8A 2JQ6A 1XA5A 3SG5A 1IQ3A 2NCOA 1QLSA 4P5OE 4PE1A 2FJUB 1XFXO 2L2CA 2G9BA 1QLKA 2JT3A 4PCWA 4I5LB 3VRQA 1XK4C 2ISDA 1B8CA 1EG3A 1JF2A 1M39A 2BECA 2K0JA 5DICA 1TCOB 2H2KA 3AAKA 1OMRA 1WRZA 2KAVA 1NCZA 3GK1A 1KQVA 1SCVA 2LVIA 2K7CA 1LA0A 4YGBB 2WNDA 3BQ3A 1QV1A 4GAOA 1NYAA 1MWNA 5BPJA 1RROA 1XFUO 1ZUZA 3D74A 3UO9A 3VB1A 2JULA 3LK1A 4CIDA 3R1PA 2DOQA 5DKQA 1DF0A 2L2EA 2JRFA 1WY9A 4NDDA 5HYDA 1L2OC 2KAXA 1B1GA 1F54A 1XFYO 1F70A 1B47A 1M45A 2AAOA 2JPTA 2MAZA 1RTP1 1DJWA 1NX1A 2LNKA 1QX5B 2KHNA 3I5IB 3QMEA 2MLFC 3EVVA 2KFFA 2Y4QA 4M2QA 2L4HA 2NXQA 1S36A 3BUNB 1UP5A 1UWOA 1A03A 1BLQA 1ALWA 4QJ3B 5FI2A 1DMOA 2WC5A 4FTGA 2I94A 3DVEA 3FE9A 4XJKB 2MRDA 5HKWA 1J1DA 2KLEA 1PSBA 3PLFB 3TUYC 1QJTA 1RWYA 1CMGA 2F2OA 1AP4A 3IQOA 1WDCC 1PRWA 1B9AA 4GUKA 1G8IA 2EHBA 2KQ6A 4P2YB 4DIRA 3FE6A 1F71A 2LANA 3NHTA 1FW4A 1V1FA 4GGNA 2FJYA 2L51A 1EG4A 2SCPA 3NSIA 1IGVA 2L98A 1TRFA 4R1EA 1KK7Y 1JBAA 2R2IA 5JOLA 1SY9A 3EK7A 1TCFA 1R2UA 1XVJA 1F55A 4AQJA 1C3YA 1EXRA 2M97A 1C7VA 1G33A 1QTXA 2K7BA 3O6BA 3D76A 1A75B 3PALA 1XFVO 1JFKA 3PM2A 1JFJA 1TIZA 2JWWA 2PRUA 1AVSA 1OW4A 3AAJA 1SK6D 2BAPA 4OZDA 4F7FA 1MXLC 4PHMA 5CSFA 2NLNA 3TZ1A 1K93D 1RJVA 2WCFA 1BJFA 1KWOC 3CLNA 1WLZA 2QPTA 3D0YB 4AOMA 1B7TZ 1CLLA 2EC6C 1CNPA 4YGAA 5K89A 3HX4A 1Q80A 1MF8B 2JC2A 2EGDA 4CLNA 1KSMA 2WORA 3C1VA 1Y6WA 1QASA 1TOPA 1NPQA 4N5XA 2KGRA 1B4CA 2PYQA 3N7HA 3OX5A 3R1OA 4PE0A 2OTGC 3VRNA 3I5GB 2M1KB 1IG5A 3BOWB 1DJHA 4PE7A 2BNXA 3SS4A 1MHOA 2HQ8A 3JTDC 4YI8A 2OS8B 5HKZA 1KFXL 4BY4A 2ZNEA 1AJ5A 4YI9A 1J7QA 1IJ6A 3SIBA 4YGCB 3D0YA 2CCMA 1ZACA 4PE4A 4NQGA 3EK8A 1CTRA 2G2BA 1Y0VH 1CDPA 1WLMA 1HT9A 1K9PA 2Q91A 1SYMA 3PFVA 4N1GA 2Y5IA 2BL0C 2F2PA 3BFAA 3NSLA 1DC1A 2JXLA 1E8AA 2KSPA 1YUTA 3OB2B 1NX3A 1XO5A 1CFFA 4YGDB 4MRYA 4UPGA 2WCKA 2BKHB 3BJHA 1GGZA 2V53A 3EG5B 3I5FC 1D1OA 3LK0A 1SKTA 3NHIA 3LLEA 1K8UA 1FI6A 1NX0A 5KTYA 2M3WA 5ER4X 2CTNA 2LHIA 3DF0B 5JJGA 3TDZA 1A29A 2Y1MA 4MRXA 2JTTA 3R72A 3O4YA 2WCEA 2KNEA 3CZTX 5HLOA 2QDIA 3GOFA 4CFRA 1PALA 1J1EA 2QEBA 1FF1A 2MJWB 3OBVA 1YTZC 2LLSA 4PHJA 2LHLA 2CNPA 3I5HC 5B8IB 3ZNIA 1N65A 3FWCA 1LA3A 1M63B 1X02A 5FYXA 3SS3A 2JNXA 3CYZA 1NIWA 2M7NA 4A4BA 3CR5X 1SL7A 4OVNF 4NDCA 2COLB 1AHRA 3AKBA 3TDUA 3D75A 1DT7B 1GM0A 1YR5A 3BUWB 2KAYA 4YRUA 3GK2A 2WCJA 2M7LA 3SG3A 1K90D 1DEKA 3PJIA 1K2HA 1QIWA 1QXPA 1SR6B 1WRLA 3TS5B 1CM4A 3L4LA 2L5YA 1NX2A 2CT9A 4ORAB 3CWGA 4N1FA 2JXCA 2NZ0A 3TDIA 1H8BA 4IL1A 2JNFA 5I2QA 2VRGA 1KK8B 2FCDA 2YGUA 3F45A 1W7IB 2LC5A 1TTXA 1SCMC 1SL8A 2M9GA 3D10A 1C07A 4HREE 1QWVA 1U5IB 1YRUB 2M8UA 2ZRSA 3CZ1A 1W9ZA 3SJSA 3CZ0A 3KHEA 3PN7C 5HKYA 1JF0A 2BCAA 2ZKMX 2BKIB 3CZ2A 4D1EA 4YBHB 1QV0A 3JVTB 3BUXB 5FI7A 1J7OA 1K95A 4MEWA 1XFZO 2I2RE 3DY9A 4IJ7A 3WNXB 2WCHA 1KK7Z 2WOSA 1OMDA 2KYFA 1EL4A 1DQEA 2KI4B 2K8MB 5I2LA 2ERBA 1BOCA 1YVLA 2K7DA 5HLVA 2KFGA 3V2LA 3O4XA 5G08A 1CB1A 1TUZA 3EVRA 1AK8A 1DGUA 4PHNA 2LMTA 2F33A 1RFJA 1QX2A 2LLUA 1CDMA 1QIVA 1JC2A 4GBAA 3L4AA 4ORBB 2KYCA 2JU0A 1Z4HA 1IIOA 1BU3A 3LCPC 3WXAA 4ICBA 4MLWA 1J7PA 3BFBA 1S6JA 3OB1B 2L0PA 1KQMB 4XJKA 3CTNA 1DVIA 5ER5A 1LS8A 1PK0D 2WCLA 1UHNA 2P70A 3EVUA 2E6WA 2F3YA 5IBWA 3BFHA 5AFPA 1SRAA 1MXEA 2HF5A 3A4UB 1B8LA 2O60A 2HETA 4JKTA 2M49B 4JWQA 2P71A 1MQ1A 1TNXA 1YX7A 1C3ZA 4QJ5B 1DJZA 1IKUA 4MZLA 3FS7A 2QEVA 3KPXA 4WQ3A 1WRKA 4ZCUA 3B86A 3SIAA 1CDLA 2LUCA 5FI6A 1A75A 1OZOA 3NXAA 4DRWA 3AKAA 1YVHA 1T14A 3PATA 3A8RA 1DJGA 4M2PA 5I8NA 2QACA 1GJYA 3OP0A 4GNKB 2E30A 1H4BA 2BBMA 2ZRTA 1M31A 2LVJA 2LVKA 2KI6C 4OV2A 1S5GZ 4L9MA 2D8NA 3K1EA 1OZSA 4TNCA 1L2OB 5D3OA 3CR4X 3SS5A 1CLBA 1TUJA 2PQLA 3SG2A 2PASA 1QX7A 3S0DA 1KSOA 1K9UA 1S5GY 1OOIX 3FWBA 3I5IC 5KU1A 1KFUL 3KF9A 3CDNA 5I2OA 2JPOA 3IF7A 3L47A 1BT6A 1LKJA 3BYAA 4C0KA 2BE6A 1CFDA 3BXKA 3DD4A 3D78A 2LCPA 1K94A 5CPVA 1KFUS 1VRKA 1PVAA 1TNQA 3B87A 1OOFA 1YRTB 2LMVA 1S6CA 2I18A 2M29A 2KQYA 4AQIA 1LVCD 1OE9B 3BOWA 3CABA 3B6XA 4CPVA 3TUYB 1PVBA 4I5NB 5I94A 1UURA 1XFRA 3CS1A 3IQQA 2JT0A 4F0ZB 1ODBA
chains in the Genus database with same CATH topology
1CDNA 1GQMA 1WDCB 2PSRA 2JZIA 1BR1B 2LP2A 3KO0A 1DJIA 1S1EA 3SG7A 2GV5A 1FBVA 2GGZA 4U8DA 4GGFA 5CSJA 3DVJA 4HRGA 4M2OA 1SBJA 2HPSA 2JOJA 1EH2A 1SL9A 2L5XB 2B1UA 1Y1UA 2LE9B 1TNPA 3E3RA 5KSZA 5TNCA 4OR9B 2CXJA 4NDBA 1DF0B 2MHHA 1QATA 1BR4B 1PSRA 2SASA 4GPLB 4PHKA 5D69A 3PSRA 1DGVA 2KDHA 1M46A 4I5KA 2IS9A 1J55A 1KWOB 2F3ZA 2KI6D 2NCPA 4E68A 2EC6B 1IWQA 3DF0A 3NSOA 1AJ4A 1G4YR 1IQ5A 1A2XA 1B8RA 1V1GA 2FOTA 1GGWA 1TNWA 2ZN8A 1DJYA 3LL8B 5AANA 1FI5A 3GK4X 3RM1A 3H4SE 4OKHA 3EKHA 1ALVA 2L50A 1UUSA 3I5GC 3EK4A 4USLA 2OTGB 1PULA 3ZWHA 4C0JA 1RECA 2JT8A 2K2AA 1S26D 2LAPA 4HRHA 2GGMA 2ZN9A 1F4QA 2OS8C 5DKRA 3JTDB 5D7FA 1OMVA 1SW8A 1N2DA 2BBNA 2LV7A 1R6PA 5J3XA 1DTLA 1F4OA 4ZCVA 3ICBA 4A4CA 2K7OA 1AUIB 4DUQA 2KGBC 3K21A 4MZJA 1QVIZ 2F8PA 1NCYA 2AUCA 4GGFC 4MZKA 5CSNA 2RGIA 1QVIY 5DKNA 4BY5A 1IRJA 1BF5A 3VRPA 2BCXA 2LUXA 2I7AA 1F8HA 2BL0B 1CFPA 1YURA 4XYNA 1CLMA 1TN4A 3VROA 3CGAA 2OPOA 2WCBA 4DCKA 3O78A 1U5IA 1NUBA 1BODA 1JSAA 1DJXA 3I5FB 3BUOB 1YUSA 1W7JB 2TN4A 2K61A 2A4JA 1LINA 3DVMA 1Y1AA 2K2FA 1IH0A 1OOJA 4MSPA 2HQWA 2KOTA 4MN0A 3DVKA 5AERA 2LMUA 4OCIA 1Y1XA 4FQOA 3PM8A 1SMGA 1ZFSA 1UHJA 1YUUA 3WHTB 1CM1A 3RLZA 1NCXA 1K9KA 2CBLA 1NP8A 2KBMA 4PDZA 3I5HB 1IJ5A 1YX8A 3FIAA 4Q04A 3KEVA 1XYDA 2KFHA 4WRIA 4YGEB 3EKJA 3O2PA 4ETOA 2MLEC 2L4IA 5PALA 4C0LA 3SG6A 4GFTA 1MR8A 4JPZB 5AEQA 1LXFC 4CFQA 1A4PA 1SR6C 2H61A 3TS5C 4MVFA 4I5JA 1RK9A 4JQ0D 1MUXA 1B7TY 1ZOTB 1KK8C 1XK4A 1CKKA 2PALA 2LLTA 2FCEA 2AMIA 2PVBA 1SNLA 2BCBA 2MA2A 2P6BB 1NWDA 1NSHA 1SPYA 1C7WA 1J7RA 2M1UA 4MZLA 4ORCB 3VGOA 2M0RA 1BG1A 1SCMB 1UHIA 2LVVA 3CR2A 3MSEB 3BUMB 1BMOA 4QJ4B 3JVTC 1UHKA 2ZNDA 3PN7B 3M0WA 2JTZA 1JWDA 4DS7A 2Y1NA 1ZMZA 1S6IA 2KI4C 2Q4UA 5F6TA 5AXIA 1KFXS 1K96A 2ZFDA 2BE4A 3NSKA 1CFCA 1QS7A 1UHHA 1S3PA 5CSIA 2MBXA 3OX6A 1XFWO 2LM5A 1L7ZA 2O5GA 3OHMB 1CMFA 1KCYA 4WQ2A 3QRXA 4PALA 2PMYA 3HCMA 4MBEA 1OSAA 1N0YA 1JUOA 2LP3A 3VRRA 1EJ3A 1KQMC 4HSZA 5GQQC 3SG4A 1HQVA 3WHUB 1FPWA 1OQPA 2KBIA 2H61C 2WC8A 2JQ6A 1XA5A 3SG5A 1IQ3A 2NCOA 1QLSA 4P5OE 4PE1A 2FJUB 1XFXO 4PCWA 2G9BA 1QLKA 2JT3A 3VRQA 4I5LB 1XK4C 2ISDA 1B8CA 1EG3A 1JF2A 1M39A 2BECA 2K0JA 1TCOB 2H2KA 3AAKA 1OMRA 1WRZA 2KAVA 1NCZA 3GK1A 1SCVA 2LVIA 2K7CA 1LA0A 4YGBB 2WNDA 3BQ3A 1QV1A 4GAOA 1NYAA 1MWNA 5BPJA 1RROA 1XFUO 1ZUZA 2JULA 3LK1A 4CIDA 2DOQA 5DKQA 1DF0A 2L2EA 2JRFA 1WY9A 4NDDA 5HYDA 1L2OC 2KAXA 1B1GA 1F54A 1XFYO 1F70A 1B47A 1M45A 2AAOA 2JPTA 2MAZA 1RTP1 1DJWA 1NX1A 2LNKA 1QX5B 2KHNA 3I5IB 2MLFC 3EVVA 2KFFA 2Y4QA 4M2QA 2L4HA 2NXQA 1S36A 3BUNB 1UP5A 1UWOA 1A03A 1BLQA 1ALWA 4QJ3B 1DMOA 4FTGA 2I94A 3DVEA 4XJKB 5HKWA 2MRDA 1J1DA 1PSBA 3PLFB 3TUYC 1QJTA 1RWYA 1CMGA 2F2OA 1AP4A 3IQOA 1WDCC 1PRWA 1B9AA 4GUKA 1G8IA 2EHBA 2KQ6A 4P2YB 4DIRA 1F71A 2LANA 4GGNA 1FW4A 1V1FA 2L51A 1EG4A 2SCPA 3NSIA 1IGVA 1TRFA 4R1EA 1KK7Y 1JBAA 2R2IA 5JOLA 1SY9A 3EK7A 1TCFA 1R2UA 1XVJA 1F55A 4AQJA 1EXRA 2M97A 1C7VA 1G33A 1QTXA 2K7BA 3O6BA 1A75B 3PALA 1XFVO 1JFKA 1JFJA 1TIZA 2JWWA 2PRUA 1AVSA 3AAJA 1SK6D 1MXLC 4PHMA 5CSFA 2NLNA 3TZ1A 1K93D 1RJVA 2WCFA 1BJFA 1KWOC 3CLNA 1WLZA 2QPTA 3D0YB 4AOMA 1B7TZ 1CLLA 2EC6C 1CNPA 4YGAA 5K89A 3HX4A 1Q80A 1MF8B 2JC2A 2EGDA 4CLNA 1KSMA 2WORA 3C1VA 1Y6WA 1QASA 1TOPA 1NPQA 4N5XA 2KGRA 1B4CA 3OX5A 4PE0A 2OTGC 3VRNA 3I5GB 2M1KB 1IG5A 3BOWB 1DJHA 4PE7A 1MHOA 2HQ8A 3JTDC 4YI8A 2OS8B 5HKZA 1KFXL 4BY4A 2ZNEA 1AJ5A 4YI9A 1J7QA 1IJ6A 3SIBA 4YGCB 3D0YA 2CCMA 1ZACA 4PE4A 4NQGA 3EK8A 1CTRA 2G2BA 1Y0VH 1CDPA 1WLMA 1HT9A 1K9PA 2Q91A 1SYMA 3PFVA 4N1GA 2Y5IA 2BL0C 2F2PA 3NSLA 2JXLA 1E8AA 2KSPA 1YUTA 3OB2B 1NX3A 1XO5A 1CFFA 4YGDB 4MRYA 4UPGA 2BKHB 1GGZA 2V53A 3I5FC 1D1OA 3LK0A 1SKTA 3LLEA 1K8UA 1FI6A 1NX0A 5KTYA 2M3WA 5ER4X 2CTNA 2LHIA 3DF0B 5JJGA 3TDZA 1A29A 2Y1MA 4MRXA 2JTTA 3O4YA 2WCEA 2KNEA 3CZTX 5HLOA 3GOFA 4CFRA 1PALA 1J1EA 1FF1A 2MJWB 1YTZC 2LLSA 4PHJA 2LHLA 2CNPA 3I5HC 5B8IB 3ZNIA 1N65A 3FWCA 1LA3A 1M63B 1X02A 5FYXA 2JNXA 1NIWA 2M7NA 4A4BA 3CR5X 1SL7A 4OVNF 4NDCA 2COLB 1AHRA 3AKBA 3TDUA 1DT7B 1YR5A 3BUWB 2KAYA 4YRUA 3GK2A 2M7LA 3SG3A 1K90D 1K2HA 1QIWA 1QXPA 1SR6B 1WRLA 3TS5B 1CM4A 1NX2A 2CT9A 4ORAB 3CWGA 4N1FA 2JXCA 2NZ0A 3TDIA 1H8BA 4IL1A 2JNFA 5I2QA 2VRGA 1KK8B 2FCDA 3F45A 1W7IB 2LC5A 1TTXA 1SCMC 1SL8A 2M9GA 3D10A 1C07A 4HREE 1U5IB 1YRUB 2M8UA 2ZRSA 3SJSA 3KHEA 3PN7C 5HKYA 1JF0A 2BCAA 2ZKMX 2BKIB 4D1EA 4YBHB 1QV0A 3JVTB 3BUXB 1J7OA 1KQVA 1K95A 4MEWA 1XFZO 2I2RE 3WNXB 1KK7Z 2WOSA 1OMDA 2KYFA 1EL4A 2KI4B 1BOCA 2K8MB 5I2LA 1YVLA 2K7DA 5HLVA 2KFGA 1CB1A 5G08A 3EVRA 1AK8A 1DGUA 4PHNA 2LMTA 2F33A 1RFJA 1QX2A 2LLUA 1CDMA 1QIVA 1JC2A 4GBAA 4ORBB 2KYCA 2JU0A 1BU3A 3LCPC 3WXAA 4ICBA 4MLWA 1J7PA 1S6JA 3OB1B 2L0PA 1KQMB 4XJKA 3CTNA 1DVIA 5ER5A 1PK0D 1UHNA 3EVUA 2E6WA 2F3YA 5IBWA 5AFPA 1SRAA 1MXEA 2HF5A 3A4UB 1B8LA 2O60A 2HETA 2M49B 4JWQA 1MQ1A 1TNXA 1YX7A 4QJ5B 1DJZA 1IKUA 3FS7A 3KPXA 4WQ3A 1WRKA 4ZCUA 3SIAA 1CDLA 2LUCA 1A75A 1OZOA 3NXAA 4DRWA 3AKAA 1YVHA 3PATA 3A8RA 1DJGA 4M2PA 5I8NA 2QACA 1GJYA 3OP0A 4GNKB 2E30A 1H4BA 2BBMA 2ZRTA 1M31A 2LVJA 2LVKA 2KI6C 4OV2A 1S5GZ 4L9MA 2D8NA 4TNCA 1OZSA 1CLBA 1L2OB 3CR4X 3SG2A 2PASA 1QX7A 1KSOA 1K9UA 1S5GY 3I5IC 3FWBA 5KU1A 1KFUL 3KF9A 5I2OA 3IF7A 1BT6A 1LKJA 3BYAA 4C0KA 2BE6A 1CFDA 3BXKA 3DD4A 2LCPA 1K94A 5CPVA 1KFUS 1VRKA 1PVAA 1TNQA 1YRTB 2LMVA 1S6CA 2I18A 2M29A 2KQYA 4AQIA 1LVCD 1OE9B 3BOWA 4CPVA 3TUYB 1PVBA 4I5NB 1UURA 2L98A 3CS1A 3IQQA 2JT0A 4F0ZB 1ODBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CDN A;  1GQM A;  1WDC B;  2PSR A;  2JZI A;  1BR1 B;  2LP2 A;  3KO0 A;  1DJI A;  1S1E A;  3SG7 A;  2GV5 A;  1FBV A;  2GGZ A;  4U8D A;  4GGF A;  5CSJ A;  3DVJ A;  4HRG A;  4M2O A;  1SBJ A;  2HPS A;  2JOJ A;  1EH2 A;  1SL9 A;  2L5X B;  2B1U A;  1Y1U A;  2LE9 B;  1TNP A;  3E3R A;  5KSZ A;  5TNC A;  4OR9 B;  2CXJ A;  4NDB A;  1DF0 B;  2MHH A;  1QAT A;  1BR4 B;  1PSR A;  2SAS A;  4GPL B;  4PHK A;  5D69 A;  3PSR A;  1DGV A;  2KDH A;  1M46 A;  4I5K A;  2IS9 A;  1J55 A;  1KWO B;  2F3Z A;  2KI6 D;  2NCP A;  4E68 A;  2EC6 B;  1IWQ A;  3DF0 A;  3NSO A;  1AJ4 A;  1G4Y R;  1IQ5 A;  1A2X A;  1B8R A;  1V1G A;  2FOT A;  1GGW A;  1TNW A;  2ZN8 A;  1DJY A;  3LL8 B;  5AAN A;  1FI5 A;  3GK4 X;  3RM1 A;  3H4S E;  4OKH A;  3EKH A;  1ALV A;  2L50 A;  1UUS A;  3I5G C;  3EK4 A;  4USL A;  2OTG B;  1PUL A;  3ZWH A;  4C0J A;  1REC A;  2JT8 A;  2K2A A;  1S26 D;  2LAP A;  4HRH A;  2GGM A;  2ZN9 A;  1F4Q A;  2OS8 C;  5DKR A;  3JTD B;  5D7F A;  1OMV A;  1SW8 A;  1N2D A;  2BBN A;  2LV7 A;  1R6P A;  5J3X A;  1DTL A;  1F4O A;  4ZCV A;  3ICB A;  4A4C A;  2K7O A;  1AUI B;  4DUQ A;  2KGB C;  3K21 A;  4MZJ A;  1QVI Z;  2F8P A;  1NCY A;  2AUC A;  4GGF C;  4MZK A;  5CSN A;  2RGI A;  1QVI Y;  5DKN A;  4BY5 A;  1IRJ A;  1BF5 A;  3VRP A;  2BCX A;  2LUX A;  2I7A A;  1F8H A;  2BL0 B;  1CFP A;  1YUR A;  4XYN A;  1CLM A;  1TN4 A;  3VRO A;  3CGA A;  2OPO A;  2WCB A;  4DCK A;  3O78 A;  1U5I A;  1NUB A;  1BOD A;  1JSA A;  1DJX A;  3I5F B;  3BUO B;  1YUS A;  1W7J B;  2TN4 A;  2K61 A;  2A4J A;  1LIN A;  3DVM A;  1Y1A A;  2K2F A;  1IH0 A;  1OOJ A;  4MSP A;  2HQW A;  2KOT A;  4MN0 A;  3DVK A;  5AER A;  2LMU A;  4OCI A;  1Y1X A;  4FQO A;  3PM8 A;  1SMG A;  1ZFS A;  1UHJ A;  1YUU A;  3WHT B;  1CM1 A;  3RLZ A;  1NCX A;  1K9K A;  2CBL A;  1NP8 A;  2KBM A;  4PDZ A;  3I5H B;  1IJ5 A;  1YX8 A;  3FIA A;  4Q04 A;  3KEV A;  1XYD A;  2KFH A;  4WRI A;  4YGE B;  3EKJ A;  3O2P A;  4ETO A;  2MLE C;  2L4I A;  5PAL A;  4C0L A;  3SG6 A;  4GFT A;  1MR8 A;  4JPZ B;  5AEQ A;  1LXF C;  4CFQ A;  1A4P A;  1SR6 C;  2H61 A;  3TS5 C;  4MVF A;  4I5J A;  1RK9 A;  4JQ0 D;  1MUX A;  1B7T Y;  1ZOT B;  1KK8 C;  1XK4 A;  1CKK A;  2PAL A;  2LLT A;  2FCE A;  2AMI A;  2PVB A;  1SNL A;  2BCB A;  2MA2 A;  2P6B B;  1NWD A;  1NSH A;  1SPY A;  1C7W A;  1J7R A;  2M1U A;  4MZL A;  4ORC B;  3VGO A;  2M0R A;  1BG1 A;  1SCM B;  1UHI A;  2LVV A;  3CR2 A;  3MSE B;  3BUM B;  1BMO A;  4QJ4 B;  3JVT C;  1UHK A;  2ZND A;  3PN7 B;  3M0W A;  2JTZ A;  1JWD A;  4DS7 A;  2Y1N A;  1ZMZ A;  1S6I A;  2KI4 C;  2Q4U A;  5F6T A;  5AXI A;  1KFX S;  1K96 A;  2ZFD A;  2BE4 A;  3NSK A;  1CFC A;  1QS7 A;  1UHH A;  1S3P A;  5CSI A;  2MBX A;  3OX6 A;  1XFW O;  2LM5 A;  1L7Z A;  2O5G A;  3OHM B;  1CMF A;  1KCY A;  4WQ2 A;  3QRX A;  4PAL A;  2PMY A;  3HCM A;  4MBE A;  1OSA A;  1N0Y A;  1JUO A;  2LP3 A;  3VRR A;  1EJ3 A;  1KQM C;  4HSZ A;  5GQQ C;  3SG4 A;  1HQV A;  3WHU B;  1FPW A;  1OQP A;  2KBI A;  2H61 C;  2WC8 A;  2JQ6 A;  1XA5 A;  3SG5 A;  1IQ3 A;  2NCO A;  1QLS A;  4P5O E;  4PE1 A;  2FJU B;  1XFX O;  4PCW A;  2G9B A;  1QLK A;  2JT3 A;  3VRQ A;  4I5L B;  1XK4 C;  2ISD A;  1B8C A;  1EG3 A;  1JF2 A;  1M39 A;  2BEC A;  2K0J A;  1TCO B;  2H2K A;  3AAK A;  1OMR A;  1WRZ A;  2KAV A;  1NCZ A;  3GK1 A;  1SCV A;  2LVI A;  2K7C A;  1LA0 A;  4YGB B;  2WND A;  3BQ3 A;  1QV1 A;  4GAO A;  1NYA A;  1MWN A;  5BPJ A;  1RRO A;  1XFU O;  1ZUZ A;  2JUL A;  3LK1 A;  4CID A;  2DOQ A;  5DKQ A;  1DF0 A;  2L2E A;  2JRF A;  1WY9 A;  4NDD A;  5HYD A;  1L2O C;  2KAX A;  1B1G A;  1F54 A;  1XFY O;  1F70 A;  1B47 A;  1M45 A;  2AAO A;  2JPT A;  2MAZ A;  1RTP 1;  1DJW A;  1NX1 A;  2LNK A;  1QX5 B;  2KHN A;  3I5I B;  2MLF C;  3EVV A;  2KFF A;  2Y4Q A;  4M2Q A;  2L4H A;  2NXQ A;  1S36 A;  3BUN B;  1UP5 A;  1UWO A;  1A03 A;  1BLQ A;  1ALW A;  4QJ3 B;  1DMO A;  4FTG A;  2I94 A;  3DVE A;  4XJK B;  5HKW A;  2MRD A;  1J1D A;  1PSB A;  3PLF B;  3TUY C;  1QJT A;  1RWY A;  1CMG A;  2F2O A;  1AP4 A;  3IQO A;  1WDC C;  1PRW A;  1B9A A;  4GUK A;  1G8I A;  2EHB A;  2KQ6 A;  4P2Y B;  4DIR A;  1F71 A;  2LAN A;  4GGN A;  1FW4 A;  1V1F A;  2L51 A;  1EG4 A;  2SCP A;  3NSI A;  1IGV A;  1TRF A;  4R1E A;  1KK7 Y;  1JBA A;  2R2I A;  5JOL A;  1SY9 A;  3EK7 A;  1TCF A;  1R2U A;  1XVJ A;  1F55 A;  4AQJ A;  1EXR A;  2M97 A;  1C7V A;  1G33 A;  1QTX A;  2K7B A;  3O6B A;  1A75 B;  3PAL A;  1XFV O;  1JFK A;  1JFJ A;  1TIZ A;  2JWW A;  2PRU A;  1AVS A;  3AAJ A;  1SK6 D;  1MXL C;  4PHM A;  5CSF A;  2NLN A;  3TZ1 A;  1K93 D;  1RJV A;  2WCF A;  1BJF A;  1KWO C;  3CLN A;  1WLZ A;  2QPT A;  3D0Y B;  4AOM A;  1B7T Z;  1CLL A;  2EC6 C;  1CNP A;  4YGA A;  5K89 A;  3HX4 A;  1Q80 A;  1MF8 B;  2JC2 A;  2EGD A;  4CLN A;  1KSM A;  2WOR A;  3C1V A;  1Y6W A;  1QAS A;  1TOP A;  1NPQ A;  4N5X A;  2KGR A;  1B4C A;  3OX5 A;  4PE0 A;  2OTG C;  3VRN A;  3I5G B;  2M1K B;  1IG5 A;  3BOW B;  1DJH A;  4PE7 A;  1MHO A;  2HQ8 A;  3JTD C;  4YI8 A;  2OS8 B;  5HKZ A;  1KFX L;  4BY4 A;  2ZNE A;  1AJ5 A;  4YI9 A;  1J7Q A;  1IJ6 A;  3SIB A;  4YGC B;  3D0Y A;  2CCM A;  1ZAC A;  4PE4 A;  4NQG A;  3EK8 A;  1CTR A;  2G2B A;  1Y0V H;  1CDP A;  1WLM A;  1HT9 A;  1K9P A;  2Q91 A;  1SYM A;  3PFV A;  4N1G A;  2Y5I A;  2BL0 C;  2F2P A;  3NSL A;  2JXL A;  1E8A A;  2KSP A;  1YUT A;  3OB2 B;  1NX3 A;  1XO5 A;  1CFF A;  4YGD B;  4MRY A;  4UPG A;  2BKH B;  1GGZ A;  2V53 A;  3I5F C;  1D1O A;  3LK0 A;  1SKT A;  3LLE A;  1K8U A;  1FI6 A;  1NX0 A;  5KTY A;  2M3W A;  5ER4 X;  2CTN A;  2LHI A;  3DF0 B;  5JJG A;  3TDZ A;  1A29 A;  2Y1M A;  4MRX A;  2JTT A;  3O4Y A;  2WCE A;  2KNE A;  3CZT X;  5HLO A;  3GOF A;  4CFR A;  1PAL A;  1J1E A;  1FF1 A;  2MJW B;  1YTZ C;  2LLS A;  4PHJ A;  2LHL A;  2CNP A;  3I5H C;  5B8I B;  3ZNI A;  1N65 A;  3FWC A;  1LA3 A;  1M63 B;  1X02 A;  5FYX A;  2JNX A;  1NIW A;  2M7N A;  4A4B A;  3CR5 X;  1SL7 A;  4OVN F;  4NDC A;  2COL B;  1AHR A;  3AKB A;  3TDU A;  1DT7 B;  1YR5 A;  3BUW B;  2KAY A;  4YRU A;  3GK2 A;  2M7L A;  3SG3 A;  1K90 D;  1K2H A;  1QIW A;  1QXP A;  1SR6 B;  1WRL A;  3TS5 B;  1CM4 A;  1NX2 A;  2CT9 A;  4ORA B;  3CWG A;  4N1F A;  2JXC A;  2NZ0 A;  3TDI A;  1H8B A;  4IL1 A;  2JNF A;  5I2Q A;  2VRG A;  1KK8 B;  2FCD A;  3F45 A;  1W7I B;  2LC5 A;  1TTX A;  1SCM C;  1SL8 A;  2M9G A;  3D10 A;  1C07 A;  4HRE E;  1U5I B;  1YRU B;  2M8U A;  2ZRS A;  3SJS A;  3KHE A;  3PN7 C;  5HKY A;  1JF0 A;  2BCA A;  2ZKM X;  2BKI B;  4D1E A;  4YBH B;  1QV0 A;  3JVT B;  3BUX B;  1J7O A;  1KQV A;  1K95 A;  4MEW A;  1XFZ O;  2I2R E;  3WNX B;  1KK7 Z;  2WOS A;  1OMD A;  2KYF A;  1EL4 A;  2KI4 B;  1BOC A;  2K8M B;  5I2L A;  1YVL A;  2K7D A;  5HLV A;  2KFG A;  1CB1 A;  5G08 A;  3EVR A;  1AK8 A;  1DGU A;  4PHN A;  2LMT A;  2F33 A;  1RFJ A;  1QX2 A;  2LLU A;  1CDM A;  1QIV A;  1JC2 A;  4GBA A;  4ORB B;  2KYC A;  2JU0 A;  1BU3 A;  3LCP C;  3WXA A;  4ICB A;  4MLW A;  1J7P A;  1S6J A;  3OB1 B;  2L0P A;  1KQM B;  4XJK A;  3CTN A;  1DVI A;  5ER5 A;  1PK0 D;  1UHN A;  3EVU A;  2E6W A;  2F3Y A;  5IBW A;  5AFP A;  1SRA A;  1MXE A;  2HF5 A;  3A4U B;  1B8L A;  2O60 A;  2HET A;  2M49 B;  4JWQ A;  1MQ1 A;  1TNX A;  1YX7 A;  4QJ5 B;  1DJZ A;  1IKU A;  3FS7 A;  3KPX A;  4WQ3 A;  1WRK A;  4ZCU A;  3SIA A;  1CDL A;  2LUC A;  1A75 A;  1OZO A;  3NXA A;  4DRW A;  3AKA A;  1YVH A;  3PAT A;  3A8R A;  1DJG A;  4M2P A;  5I8N A;  2QAC A;  1GJY A;  3OP0 A;  4GNK B;  2E30 A;  1H4B A;  2BBM A;  2ZRT A;  1M31 A;  2LVJ A;  2LVK A;  2KI6 C;  4OV2 A;  1S5G Z;  4L9M A;  2D8N A;  4TNC A;  1OZS A;  1CLB A;  1L2O B;  3CR4 X;  3SG2 A;  2PAS A;  1QX7 A;  1KSO A;  1K9U A;  1S5G Y;  3I5I C;  3FWB A;  5KU1 A;  1KFU L;  3KF9 A;  5I2O A;  3IF7 A;  1BT6 A;  1LKJ A;  3BYA A;  4C0K A;  2BE6 A;  1CFD A;  3BXK A;  3DD4 A;  2LCP A;  1K94 A;  5CPV A;  1KFU S;  1VRK A;  1PVA A;  1TNQ A;  1YRT B;  2LMV A;  1S6C A;  2I18 A;  2M29 A;  2KQY A;  4AQI A;  1LVC D;  1OE9 B;  3BOW A;  4CPV A;  3TUY B;  1PVB A;  4I5N B;  1UUR A;  2L98 A;  3CS1 A;  3IQQ A;  2JT0 A;  4F0Z B;  1ODB A; 
#chains in the Genus database with same CATH topology
 1CDN A;  1GQM A;  1WDC B;  2PSR A;  3D77 A;  3B7A A;  2JZI A;  3IVT A;  1BR1 B;  2LP2 A;  3KO0 A;  3NGV A;  1DJI A;  5EL2 A;  1S1E A;  3SG7 A;  2GV5 A;  1FBV A;  2GGZ A;  4U8D A;  4GGF A;  5CSJ A;  3DVJ A;  4HRG A;  3B88 A;  4M2O A;  1SBJ A;  2HPS A;  2JOJ A;  1EH2 A;  1SL9 A;  2L5X B;  2B1U A;  1Y1U A;  2LE9 B;  1TNP A;  3E3R A;  5KSZ A;  5TNC A;  4OR9 B;  2CXJ A;  4NDB A;  1DF0 B;  2MHH A;  1P28 A;  1QAT A;  1BR4 B;  1PSR A;  2SAS A;  4GPL B;  4PHK A;  3FE8 A;  5D69 A;  3PSR A;  1DGV A;  2KDH A;  3DYE A;  1M46 A;  4I5K A;  2IS9 A;  1J55 A;  1KWO B;  2F3Z A;  2KI6 D;  2NCP A;  4E68 A;  2EC6 B;  1IWQ A;  3DF0 A;  3NSO A;  1AJ4 A;  1G4Y R;  1IQ5 A;  1A2X A;  1B8R A;  1V1G A;  2FOT A;  2GTE A;  4INX A;  1TNW A;  2ZN8 A;  1GGW A;  1DJY A;  3LL8 B;  5AAN A;  1FI5 A;  3GK4 X;  3RM1 A;  1TWO A;  3H4S E;  4OKH A;  3EKH A;  1ALV A;  2L50 A;  1UUS A;  3I5G C;  3EK4 A;  4USL A;  2OTG B;  1PUL A;  3ZWH A;  4C0J A;  1REC A;  2JT8 A;  2K2A A;  1S26 D;  2LAP A;  4HRH A;  4INW A;  2K60 A;  2GGM A;  2ZN9 A;  1F4Q A;  2OS8 C;  5DKR A;  3JTD B;  5D7F A;  1OMV A;  1SW8 A;  1N2D A;  2BBN A;  2LV7 A;  1R6P A;  5J3X A;  1DTL A;  1F4O A;  4ZCV A;  3ICB A;  4A4C A;  2K7O A;  1AUI B;  4DUQ A;  2KGB C;  4KYN A;  3K21 A;  4MZJ A;  1QVI Z;  2F8P A;  1NCY A;  2AUC A;  4GGF C;  4MZK A;  5CSN A;  3D73 A;  2RGI A;  1QVI Y;  3S0E A;  5DKN A;  4BY5 A;  1IRJ A;  1BF5 A;  3VRP A;  2BCX A;  2LUX A;  2I7A A;  3RZS A;  2BL0 B;  1CFP A;  1F8H A;  1YUR A;  2QEO A;  1CLM A;  4XYN A;  1TN4 A;  3VRO A;  3CGA A;  2OPO A;  2WCB A;  4DCK A;  3O78 A;  1U5I A;  1NUB A;  1BOD A;  1JSA A;  1DJX A;  2H8V A;  3BUO B;  3I5F B;  1YUS A;  1W7J B;  2TN4 A;  2K61 A;  3R1V A;  3DZT A;  2A4J A;  1LIN A;  3DVM A;  1Y1A A;  2K2F A;  1IH0 A;  1OOJ A;  4MSP A;  2HQW A;  2KOT A;  4MN0 A;  3DVK A;  5AER A;  2LMU A;  4OCI A;  1Y1X A;  1DEL A;  4FQO A;  3PM8 A;  1SMG A;  1ZFS A;  1UHJ A;  1YUU A;  3WHT B;  1CM1 A;  3RLZ A;  1NCX A;  1K9K A;  2CBL A;  3S0A A;  1NP8 A;  2KBM A;  4PDZ A;  3S0B A;  3I5H B;  1IJ5 A;  1YX8 A;  3FIA A;  4Q04 A;  3KEV A;  1XYD A;  2KFH A;  4WRI A;  4YGE B;  1ORG A;  3EKJ A;  3O2P A;  4ETO A;  2MLE C;  2L4I A;  5PAL A;  4C0L A;  3SG6 A;  4GFT A;  1MR8 A;  4JPZ B;  5AEQ A;  1SSE B;  1LXF C;  4CFQ A;  3UNW A;  1A4P A;  1SR6 C;  2H61 A;  3TS5 C;  4MVF A;  4I5J A;  1RK9 A;  4JQ0 D;  3Q8I A;  1MUX A;  3OGN A;  1B7T Y;  1ZOT B;  1KK8 C;  2WC6 A;  2KLD A;  1XK4 A;  1CKK A;  2PAL A;  2LLT A;  2FCE A;  2AMI A;  2PVB A;  1SNL A;  2BCB A;  2MA2 A;  2P6B B;  1NWD A;  1NSH A;  1SPY A;  1C7W A;  1J7R A;  2M1U A;  1Z2C B;  2WCM A;  3S0F A;  4FQT A;  4ORC B;  3VGO A;  2M0R A;  1BG1 A;  1SCM B;  1UHI A;  2LVV A;  3CR2 A;  3S0G A;  3MSE B;  3BUM B;  1BMO A;  4QJ4 B;  2QEH A;  3JVT C;  1UHK A;  2ZND A;  3PN7 B;  3M0W A;  2JTZ A;  1JWD A;  4DS7 A;  2Y1N A;  1ZMZ A;  1S6I A;  2KI4 C;  2Q4U A;  3DXL A;  2KPH A;  5F6T A;  5AXI A;  1KFX S;  1K96 A;  2ZFD A;  2BE4 A;  3NSK A;  1CFC A;  1QS7 A;  5HL1 A;  1UHH A;  1S3P A;  5CSI A;  2MBX A;  3OX6 A;  1OOG A;  1XFW O;  2LM5 A;  1L7Z A;  4JD9 A;  4PT1 A;  1OOH A;  2O5G A;  3OHM B;  1CMF A;  1KCY A;  4WQ2 A;  3QRX A;  4PAL A;  2PMY A;  3HCM A;  4MBE A;  1OSA A;  1N0Y A;  1JUO A;  2LP3 A;  3VRR A;  1EJ3 A;  1KQM C;  4HSZ A;  5GQQ C;  3SG4 A;  1HQV A;  3WHU B;  1FPW A;  1OQP A;  2KBI A;  2H61 C;  2WC8 A;  2JQ6 A;  1XA5 A;  3SG5 A;  1IQ3 A;  2NCO A;  1QLS A;  4P5O E;  4PE1 A;  2FJU B;  1XFX O;  2L2C A;  2G9B A;  1QLK A;  2JT3 A;  4PCW A;  4I5L B;  3VRQ A;  1XK4 C;  2ISD A;  1B8C A;  1EG3 A;  1JF2 A;  1M39 A;  2BEC A;  2K0J A;  5DIC A;  1TCO B;  2H2K A;  3AAK A;  1OMR A;  1WRZ A;  2KAV A;  1NCZ A;  3GK1 A;  1KQV A;  1SCV A;  2LVI A;  2K7C A;  1LA0 A;  4YGB B;  2WND A;  3BQ3 A;  1QV1 A;  4GAO A;  1NYA A;  1MWN A;  5BPJ A;  1RRO A;  1XFU O;  1ZUZ A;  3D74 A;  3UO9 A;  3VB1 A;  2JUL A;  3LK1 A;  4CID A;  3R1P A;  2DOQ A;  5DKQ A;  1DF0 A;  2L2E A;  2JRF A;  1WY9 A;  4NDD A;  5HYD A;  1L2O C;  2KAX A;  1B1G A;  1F54 A;  1XFY O;  1F70 A;  1B47 A;  1M45 A;  2AAO A;  2JPT A;  2MAZ A;  1RTP 1;  1DJW A;  1NX1 A;  2LNK A;  1QX5 B;  2KHN A;  3I5I B;  3QME A;  2MLF C;  3EVV A;  2KFF A;  2Y4Q A;  4M2Q A;  2L4H A;  2NXQ A;  1S36 A;  3BUN B;  1UP5 A;  1UWO A;  1A03 A;  1BLQ A;  1ALW A;  4QJ3 B;  5FI2 A;  1DMO A;  2WC5 A;  4FTG A;  2I94 A;  3DVE A;  3FE9 A;  4XJK B;  2MRD A;  5HKW A;  1J1D A;  2KLE A;  1PSB A;  3PLF B;  3TUY C;  1QJT A;  1RWY A;  1CMG A;  2F2O A;  1AP4 A;  3IQO A;  1WDC C;  1PRW A;  1B9A A;  4GUK A;  1G8I A;  2EHB A;  2KQ6 A;  4P2Y B;  4DIR A;  3FE6 A;  1F71 A;  2LAN A;  3NHT A;  1FW4 A;  1V1F A;  4GGN A;  2FJY A;  2L51 A;  1EG4 A;  2SCP A;  3NSI A;  1IGV A;  2L98 A;  1TRF A;  4R1E A;  1KK7 Y;  1JBA A;  2R2I A;  5JOL A;  1SY9 A;  3EK7 A;  1TCF A;  1R2U A;  1XVJ A;  1F55 A;  4AQJ A;  1C3Y A;  1EXR A;  2M97 A;  1C7V A;  1G33 A;  1QTX A;  2K7B A;  3O6B A;  3D76 A;  1A75 B;  3PAL A;  1XFV O;  1JFK A;  3PM2 A;  1JFJ A;  1TIZ A;  2JWW A;  2PRU A;  1AVS A;  1OW4 A;  3AAJ A;  1SK6 D;  2BAP A;  4OZD A;  4F7F A;  1MXL C;  4PHM A;  5CSF A;  2NLN A;  3TZ1 A;  1K93 D;  1RJV A;  2WCF A;  1BJF A;  1KWO C;  3CLN A;  1WLZ A;  2QPT A;  3D0Y B;  4AOM A;  1B7T Z;  1CLL A;  2EC6 C;  1CNP A;  4YGA A;  5K89 A;  3HX4 A;  1Q80 A;  1MF8 B;  2JC2 A;  2EGD A;  4CLN A;  1KSM A;  2WOR A;  3C1V A;  1Y6W A;  1QAS A;  1TOP A;  1NPQ A;  4N5X A;  2KGR A;  1B4C A;  2PYQ A;  3N7H A;  3OX5 A;  3R1O A;  4PE0 A;  2OTG C;  3VRN A;  3I5G B;  2M1K B;  1IG5 A;  3BOW B;  1DJH A;  4PE7 A;  2BNX A;  3SS4 A;  1MHO A;  2HQ8 A;  3JTD C;  4YI8 A;  2OS8 B;  5HKZ A;  1KFX L;  4BY4 A;  2ZNE A;  1AJ5 A;  4YI9 A;  1J7Q A;  1IJ6 A;  3SIB A;  4YGC B;  3D0Y A;  2CCM A;  1ZAC A;  4PE4 A;  4NQG A;  3EK8 A;  1CTR A;  2G2B A;  1Y0V H;  1CDP A;  1WLM A;  1HT9 A;  1K9P A;  2Q91 A;  1SYM A;  3PFV A;  4N1G A;  2Y5I A;  2BL0 C;  2F2P A;  3BFA A;  3NSL A;  1DC1 A;  2JXL A;  1E8A A;  2KSP A;  1YUT A;  3OB2 B;  1NX3 A;  1XO5 A;  1CFF A;  4YGD B;  4MRY A;  4UPG A;  2WCK A;  2BKH B;  3BJH A;  1GGZ A;  2V53 A;  3EG5 B;  3I5F C;  1D1O A;  3LK0 A;  1SKT A;  3NHI A;  3LLE A;  1K8U A;  1FI6 A;  1NX0 A;  5KTY A;  2M3W A;  5ER4 X;  2CTN A;  2LHI A;  3DF0 B;  5JJG A;  3TDZ A;  1A29 A;  2Y1M A;  4MRX A;  2JTT A;  3R72 A;  3O4Y A;  2WCE A;  2KNE A;  3CZT X;  5HLO A;  2QDI A;  3GOF A;  4CFR A;  1PAL A;  1J1E A;  2QEB A;  1FF1 A;  2MJW B;  3OBV A;  1YTZ C;  2LLS A;  4PHJ A;  2LHL A;  2CNP A;  3I5H C;  5B8I B;  3ZNI A;  1N65 A;  3FWC A;  1LA3 A;  1M63 B;  1X02 A;  5FYX A;  3SS3 A;  2JNX A;  3CYZ A;  1NIW A;  2M7N A;  4A4B A;  3CR5 X;  1SL7 A;  4OVN F;  4NDC A;  2COL B;  1AHR A;  3AKB A;  3TDU A;  3D75 A;  1DT7 B;  1GM0 A;  1YR5 A;  3BUW B;  2KAY A;  4YRU A;  3GK2 A;  2WCJ A;  2M7L A;  3SG3 A;  1K90 D;  1DEK A;  3PJI A;  1K2H A;  1QIW A;  1QXP A;  1SR6 B;  1WRL A;  3TS5 B;  1CM4 A;  3L4L A;  2L5Y A;  1NX2 A;  2CT9 A;  4ORA B;  3CWG A;  4N1F A;  2JXC A;  2NZ0 A;  3TDI A;  1H8B A;  4IL1 A;  2JNF A;  5I2Q A;  2VRG A;  1KK8 B;  2FCD A;  2YGU A;  3F45 A;  1W7I B;  2LC5 A;  1TTX A;  1SCM C;  1SL8 A;  2M9G A;  3D10 A;  1C07 A;  4HRE E;  1QWV A;  1U5I B;  1YRU B;  2M8U A;  2ZRS A;  3CZ1 A;  1W9Z A;  3SJS A;  3CZ0 A;  3KHE A;  3PN7 C;  5HKY A;  1JF0 A;  2BCA A;  2ZKM X;  2BKI B;  3CZ2 A;  4D1E A;  4YBH B;  1QV0 A;  3JVT B;  3BUX B;  5FI7 A;  1J7O A;  1K95 A;  4MEW A;  1XFZ O;  2I2R E;  3DY9 A;  4IJ7 A;  3WNX B;  2WCH A;  1KK7 Z;  2WOS A;  1OMD A;  2KYF A;  1EL4 A;  1DQE A;  2KI4 B;  2K8M B;  5I2L A;  2ERB A;  1BOC A;  1YVL A;  2K7D A;  5HLV A;  2KFG A;  3V2L A;  3O4X A;  5G08 A;  1CB1 A;  1TUZ A;  3EVR A;  1AK8 A;  1DGU A;  4PHN A;  2LMT A;  2F33 A;  1RFJ A;  1QX2 A;  2LLU A;  1CDM A;  1QIV A;  1JC2 A;  4GBA A;  3L4A A;  4ORB B;  2KYC A;  2JU0 A;  1Z4H A;  1IIO A;  1BU3 A;  3LCP C;  3WXA A;  4ICB A;  4MLW A;  1J7P A;  3BFB A;  1S6J A;  3OB1 B;  2L0P A;  1KQM B;  4XJK A;  3CTN A;  1DVI A;  5ER5 A;  1LS8 A;  1PK0 D;  2WCL A;  1UHN A;  2P70 A;  3EVU A;  2E6W A;  2F3Y A;  5IBW A;  3BFH A;  5AFP A;  1SRA A;  1MXE A;  2HF5 A;  3A4U B;  1B8L A;  2O60 A;  2HET A;  4JKT A;  2M49 B;  4JWQ A;  2P71 A;  1MQ1 A;  1TNX A;  1YX7 A;  1C3Z A;  4QJ5 B;  1DJZ A;  1IKU A;  4MZL A;  3FS7 A;  2QEV A;  3KPX A;  4WQ3 A;  1WRK A;  4ZCU A;  3B86 A;  3SIA A;  1CDL A;  2LUC A;  5FI6 A;  1A75 A;  1OZO A;  3NXA A;  4DRW A;  3AKA A;  1YVH A;  1T14 A;  3PAT A;  3A8R A;  1DJG A;  4M2P A;  5I8N A;  2QAC A;  1GJY A;  3OP0 A;  4GNK B;  2E30 A;  1H4B A;  2BBM A;  2ZRT A;  1M31 A;  2LVJ A;  2LVK A;  2KI6 C;  4OV2 A;  1S5G Z;  4L9M A;  2D8N A;  3K1E A;  1OZS A;  4TNC A;  1L2O B;  5D3O A;  3CR4 X;  3SS5 A;  1CLB A;  1TUJ A;  2PQL A;  3SG2 A;  2PAS A;  1QX7 A;  3S0D A;  1KSO A;  1K9U A;  1S5G Y;  1OOI X;  3FWB A;  3I5I C;  5KU1 A;  1KFU L;  3KF9 A;  3CDN A;  5I2O A;  2JPO A;  3IF7 A;  3L47 A;  1BT6 A;  1LKJ A;  3BYA A;  4C0K A;  2BE6 A;  1CFD A;  3BXK A;  3DD4 A;  3D78 A;  2LCP A;  1K94 A;  5CPV A;  1KFU S;  1VRK A;  1PVA A;  1TNQ A;  3B87 A;  1OOF A;  1YRT B;  2LMV A;  1S6C A;  2I18 A;  2M29 A;  2KQY A;  4AQI A;  1LVC D;  1OE9 B;  3BOW A;  3CAB A;  3B6X A;  4CPV A;  3TUY B;  1PVB A;  4I5N B;  5I94 A;  1UUR A;  1XFR A;  3CS1 A;  3IQQ A;  2JT0 A;  4F0Z B;  1ODB A; 
#chains in the Genus database with same CATH homology
 1CDN A;  1GQM A;  1WDC B;  2PSR A;  2JZI A;  1BR1 B;  2LP2 A;  3KO0 A;  1DJI A;  1S1E A;  3SG7 A;  2GV5 A;  1FBV A;  2GGZ A;  4U8D A;  4GGF A;  5CSJ A;  3DVJ A;  4HRG A;  4M2O A;  1SBJ A;  2HPS A;  2JOJ A;  1EH2 A;  1SL9 A;  2L5X B;  2B1U A;  1Y1U A;  2LE9 B;  1TNP A;  3E3R A;  5KSZ A;  5TNC A;  4OR9 B;  2CXJ A;  4NDB A;  1DF0 B;  2MHH A;  1QAT A;  1BR4 B;  1PSR A;  2SAS A;  4GPL B;  4PHK A;  5D69 A;  3PSR A;  1DGV A;  2KDH A;  1M46 A;  4I5K A;  2IS9 A;  1J55 A;  1KWO B;  2F3Z A;  2KI6 D;  2NCP A;  4E68 A;  2EC6 B;  1IWQ A;  3DF0 A;  3NSO A;  1AJ4 A;  1G4Y R;  1IQ5 A;  1A2X A;  1B8R A;  1V1G A;  2FOT A;  1GGW A;  1TNW A;  2ZN8 A;  1DJY A;  3LL8 B;  5AAN A;  1FI5 A;  3GK4 X;  3RM1 A;  3H4S E;  4OKH A;  3EKH A;  1ALV A;  2L50 A;  1UUS A;  3I5G C;  3EK4 A;  4USL A;  2OTG B;  1PUL A;  3ZWH A;  4C0J A;  1REC A;  2JT8 A;  2K2A A;  1S26 D;  2LAP A;  4HRH A;  2GGM A;  2ZN9 A;  1F4Q A;  2OS8 C;  5DKR A;  3JTD B;  5D7F A;  1OMV A;  1SW8 A;  1N2D A;  2BBN A;  2LV7 A;  1R6P A;  5J3X A;  1DTL A;  1F4O A;  4ZCV A;  3ICB A;  4A4C A;  2K7O A;  1AUI B;  4DUQ A;  2KGB C;  3K21 A;  4MZJ A;  1QVI Z;  2F8P A;  1NCY A;  2AUC A;  4GGF C;  4MZK A;  5CSN A;  2RGI A;  1QVI Y;  5DKN A;  4BY5 A;  1IRJ A;  1BF5 A;  3VRP A;  2BCX A;  2LUX A;  2I7A A;  1F8H A;  2BL0 B;  1CFP A;  1YUR A;  4XYN A;  1CLM A;  1TN4 A;  3VRO A;  3CGA A;  2OPO A;  2WCB A;  4DCK A;  3O78 A;  1U5I A;  1NUB A;  1BOD A;  1JSA A;  1DJX A;  3I5F B;  3BUO B;  1YUS A;  1W7J B;  2TN4 A;  2K61 A;  2A4J A;  1LIN A;  3DVM A;  1Y1A A;  2K2F A;  1IH0 A;  1OOJ A;  4MSP A;  2HQW A;  2KOT A;  4MN0 A;  3DVK A;  5AER A;  2LMU A;  4OCI A;  1Y1X A;  4FQO A;  3PM8 A;  1SMG A;  1ZFS A;  1UHJ A;  1YUU A;  3WHT B;  1CM1 A;  3RLZ A;  1NCX A;  1K9K A;  2CBL A;  1NP8 A;  2KBM A;  4PDZ A;  3I5H B;  1IJ5 A;  1YX8 A;  3FIA A;  4Q04 A;  3KEV A;  1XYD A;  2KFH A;  4WRI A;  4YGE B;  3EKJ A;  3O2P A;  4ETO A;  2MLE C;  2L4I A;  5PAL A;  4C0L A;  3SG6 A;  4GFT A;  1MR8 A;  4JPZ B;  5AEQ A;  1LXF C;  4CFQ A;  1A4P A;  1SR6 C;  2H61 A;  3TS5 C;  4MVF A;  4I5J A;  1RK9 A;  4JQ0 D;  1MUX A;  1B7T Y;  1ZOT B;  1KK8 C;  1XK4 A;  1CKK A;  2PAL A;  2LLT A;  2FCE A;  2AMI A;  2PVB A;  1SNL A;  2BCB A;  2MA2 A;  2P6B B;  1NWD A;  1NSH A;  1SPY A;  1C7W A;  1J7R A;  2M1U A;  4MZL A;  4ORC B;  3VGO A;  2M0R A;  1BG1 A;  1SCM B;  1UHI A;  2LVV A;  3CR2 A;  3MSE B;  3BUM B;  1BMO A;  4QJ4 B;  3JVT C;  1UHK A;  2ZND A;  3PN7 B;  3M0W A;  2JTZ A;  1JWD A;  4DS7 A;  2Y1N A;  1ZMZ A;  1S6I A;  2KI4 C;  2Q4U A;  5F6T A;  5AXI A;  1KFX S;  1K96 A;  2ZFD A;  2BE4 A;  3NSK A;  1CFC A;  1QS7 A;  1UHH A;  1S3P A;  5CSI A;  2MBX A;  3OX6 A;  1XFW O;  2LM5 A;  1L7Z A;  2O5G A;  3OHM B;  1CMF A;  1KCY A;  4WQ2 A;  3QRX A;  4PAL A;  2PMY A;  3HCM A;  4MBE A;  1OSA A;  1N0Y A;  1JUO A;  2LP3 A;  3VRR A;  1EJ3 A;  1KQM C;  4HSZ A;  5GQQ C;  3SG4 A;  1HQV A;  3WHU B;  1FPW A;  1OQP A;  2KBI A;  2H61 C;  2WC8 A;  2JQ6 A;  1XA5 A;  3SG5 A;  1IQ3 A;  2NCO A;  1QLS A;  4P5O E;  4PE1 A;  2FJU B;  1XFX O;  4PCW A;  2G9B A;  1QLK A;  2JT3 A;  3VRQ A;  4I5L B;  1XK4 C;  2ISD A;  1B8C A;  1EG3 A;  1JF2 A;  1M39 A;  2BEC A;  2K0J A;  1TCO B;  2H2K A;  3AAK A;  1OMR A;  1WRZ A;  2KAV A;  1NCZ A;  3GK1 A;  1SCV A;  2LVI A;  2K7C A;  1LA0 A;  4YGB B;  2WND A;  3BQ3 A;  1QV1 A;  4GAO A;  1NYA A;  1MWN A;  5BPJ A;  1RRO A;  1XFU O;  1ZUZ A;  2JUL A;  3LK1 A;  4CID A;  2DOQ A;  5DKQ A;  1DF0 A;  2L2E A;  2JRF A;  1WY9 A;  4NDD A;  5HYD A;  1L2O C;  2KAX A;  1B1G A;  1F54 A;  1XFY O;  1F70 A;  1B47 A;  1M45 A;  2AAO A;  2JPT A;  2MAZ A;  1RTP 1;  1DJW A;  1NX1 A;  2LNK A;  1QX5 B;  2KHN A;  3I5I B;  2MLF C;  3EVV A;  2KFF A;  2Y4Q A;  4M2Q A;  2L4H A;  2NXQ A;  1S36 A;  3BUN B;  1UP5 A;  1UWO A;  1A03 A;  1BLQ A;  1ALW A;  4QJ3 B;  1DMO A;  4FTG A;  2I94 A;  3DVE A;  4XJK B;  5HKW A;  2MRD A;  1J1D A;  1PSB A;  3PLF B;  3TUY C;  1QJT A;  1RWY A;  1CMG A;  2F2O A;  1AP4 A;  3IQO A;  1WDC C;  1PRW A;  1B9A A;  4GUK A;  1G8I A;  2EHB A;  2KQ6 A;  4P2Y B;  4DIR A;  1F71 A;  2LAN A;  4GGN A;  1FW4 A;  1V1F A;  2L51 A;  1EG4 A;  2SCP A;  3NSI A;  1IGV A;  1TRF A;  4R1E A;  1KK7 Y;  1JBA A;  2R2I A;  5JOL A;  1SY9 A;  3EK7 A;  1TCF A;  1R2U A;  1XVJ A;  1F55 A;  4AQJ A;  1EXR A;  2M97 A;  1C7V A;  1G33 A;  1QTX A;  2K7B A;  3O6B A;  1A75 B;  3PAL A;  1XFV O;  1JFK A;  1JFJ A;  1TIZ A;  2JWW A;  2PRU A;  1AVS A;  3AAJ A;  1SK6 D;  1MXL C;  4PHM A;  5CSF A;  2NLN A;  3TZ1 A;  1K93 D;  1RJV A;  2WCF A;  1BJF A;  1KWO C;  3CLN A;  1WLZ A;  2QPT A;  3D0Y B;  4AOM A;  1B7T Z;  1CLL A;  2EC6 C;  1CNP A;  4YGA A;  5K89 A;  3HX4 A;  1Q80 A;  1MF8 B;  2JC2 A;  2EGD A;  4CLN A;  1KSM A;  2WOR A;  3C1V A;  1Y6W A;  1QAS A;  1TOP A;  1NPQ A;  4N5X A;  2KGR A;  1B4C A;  3OX5 A;  4PE0 A;  2OTG C;  3VRN A;  3I5G B;  2M1K B;  1IG5 A;  3BOW B;  1DJH A;  4PE7 A;  1MHO A;  2HQ8 A;  3JTD C;  4YI8 A;  2OS8 B;  5HKZ A;  1KFX L;  4BY4 A;  2ZNE A;  1AJ5 A;  4YI9 A;  1J7Q A;  1IJ6 A;  3SIB A;  4YGC B;  3D0Y A;  2CCM A;  1ZAC A;  4PE4 A;  4NQG A;  3EK8 A;  1CTR A;  2G2B A;  1Y0V H;  1CDP A;  1WLM A;  1HT9 A;  1K9P A;  2Q91 A;  1SYM A;  3PFV A;  4N1G A;  2Y5I A;  2BL0 C;  2F2P A;  3NSL A;  2JXL A;  1E8A A;  2KSP A;  1YUT A;  3OB2 B;  1NX3 A;  1XO5 A;  1CFF A;  4YGD B;  4MRY A;  4UPG A;  2BKH B;  1GGZ A;  2V53 A;  3I5F C;  1D1O A;  3LK0 A;  1SKT A;  3LLE A;  1K8U A;  1FI6 A;  1NX0 A;  5KTY A;  2M3W A;  5ER4 X;  2CTN A;  2LHI A;  3DF0 B;  5JJG A;  3TDZ A;  1A29 A;  2Y1M A;  4MRX A;  2JTT A;  3O4Y A;  2WCE A;  2KNE A;  3CZT X;  5HLO A;  3GOF A;  4CFR A;  1PAL A;  1J1E A;  1FF1 A;  2MJW B;  1YTZ C;  2LLS A;  4PHJ A;  2LHL A;  2CNP A;  3I5H C;  5B8I B;  3ZNI A;  1N65 A;  3FWC A;  1LA3 A;  1M63 B;  1X02 A;  5FYX A;  2JNX A;  1NIW A;  2M7N A;  4A4B A;  3CR5 X;  1SL7 A;  4OVN F;  4NDC A;  2COL B;  1AHR A;  3AKB A;  3TDU A;  1DT7 B;  1YR5 A;  3BUW B;  2KAY A;  4YRU A;  3GK2 A;  2M7L A;  3SG3 A;  1K90 D;  1K2H A;  1QIW A;  1QXP A;  1SR6 B;  1WRL A;  3TS5 B;  1CM4 A;  1NX2 A;  2CT9 A;  4ORA B;  3CWG A;  4N1F A;  2JXC A;  2NZ0 A;  3TDI A;  1H8B A;  4IL1 A;  2JNF A;  5I2Q A;  2VRG A;  1KK8 B;  2FCD A;  3F45 A;  1W7I B;  2LC5 A;  1TTX A;  1SCM C;  1SL8 A;  2M9G A;  3D10 A;  1C07 A;  4HRE E;  1U5I B;  1YRU B;  2M8U A;  2ZRS A;  3SJS A;  3KHE A;  3PN7 C;  5HKY A;  1JF0 A;  2BCA A;  2ZKM X;  2BKI B;  4D1E A;  4YBH B;  1QV0 A;  3JVT B;  3BUX B;  1J7O A;  1KQV A;  1K95 A;  4MEW A;  1XFZ O;  2I2R E;  3WNX B;  1KK7 Z;  2WOS A;  1OMD A;  2KYF A;  1EL4 A;  2KI4 B;  1BOC A;  2K8M B;  5I2L A;  1YVL A;  2K7D A;  5HLV A;  2KFG A;  1CB1 A;  5G08 A;  3EVR A;  1AK8 A;  1DGU A;  4PHN A;  2LMT A;  2F33 A;  1RFJ A;  1QX2 A;  2LLU A;  1CDM A;  1QIV A;  1JC2 A;  4GBA A;  4ORB B;  2KYC A;  2JU0 A;  1BU3 A;  3LCP C;  3WXA A;  4ICB A;  4MLW A;  1J7P A;  1S6J A;  3OB1 B;  2L0P A;  1KQM B;  4XJK A;  3CTN A;  1DVI A;  5ER5 A;  1PK0 D;  1UHN A;  3EVU A;  2E6W A;  2F3Y A;  5IBW A;  5AFP A;  1SRA A;  1MXE A;  2HF5 A;  3A4U B;  1B8L A;  2O60 A;  2HET A;  2M49 B;  4JWQ A;  1MQ1 A;  1TNX A;  1YX7 A;  4QJ5 B;  1DJZ A;  1IKU A;  3FS7 A;  3KPX A;  4WQ3 A;  1WRK A;  4ZCU A;  3SIA A;  1CDL A;  2LUC A;  1A75 A;  1OZO A;  3NXA A;  4DRW A;  3AKA A;  1YVH A;  3PAT A;  3A8R A;  1DJG A;  4M2P A;  5I8N A;  2QAC A;  1GJY A;  3OP0 A;  4GNK B;  2E30 A;  1H4B A;  2BBM A;  2ZRT A;  1M31 A;  2LVJ A;  2LVK A;  2KI6 C;  4OV2 A;  1S5G Z;  4L9M A;  2D8N A;  4TNC A;  1OZS A;  1CLB A;  1L2O B;  3CR4 X;  3SG2 A;  2PAS A;  1QX7 A;  1KSO A;  1K9U A;  1S5G Y;  3I5I C;  3FWB A;  5KU1 A;  1KFU L;  3KF9 A;  5I2O A;  3IF7 A;  1BT6 A;  1LKJ A;  3BYA A;  4C0K A;  2BE6 A;  1CFD A;  3BXK A;  3DD4 A;  2LCP A;  1K94 A;  5CPV A;  1KFU S;  1VRK A;  1PVA A;  1TNQ A;  1YRT B;  2LMV A;  1S6C A;  2I18 A;  2M29 A;  2KQY A;  4AQI A;  1LVC D;  1OE9 B;  3BOW A;  4CPV A;  3TUY B;  1PVB A;  4I5N B;  1UUR A;  2L98 A;  3CS1 A;  3IQQ A;  2JT0 A;  4F0Z B;  1ODB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...