2LHLA

Chemical shift assignments and solution structure of human apo-s100a1 e32q mutant
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
93
structure length
93
Chain Sequence
GSELETAMETLINVFHAHSGKEGDKYKLSKKQLKELLQTELSGFLDAQKDVDAVDKVMKELDENGDGEVDFQEYVVLVAALTVACNNFFWENS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords Protein S100-A1
publication title 1H, 13C and 15N NMR sequence-specific resonance assignments and relaxation parameters for human apo-S100A1 E32Q mutant
rcsb
source organism Homo sapiens
total genus 20
structure length 93
sequence length 93
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2lhlA00
4OR9B 2M1KB 1CMFA 1PSBA 5KTYA 1A29A 1MF8B 5TNCA 1E8AA 4MZJA 1BJFA 3NSKA 4XJKA 3AAJA 3SG5A 1DGUA 3AAKA 2LVKA 1XO5A 1C7VA 5JJGA 1HT9A 2LANA 1ALVA 1WLZA 2MRDA 4DRWA 3EVRA 5J3XA 4NDDA 3TUYC 1S36A 1EG3A 1K90D 1XK4A 1QV0A 1G4YR 2EHBA 1XK4C 2HF5A 3KEVA 2LCPA 4L9MA 3VRNA 1DVIA 2KFHA 5I2QA 1A75A 2Y4QA 2G9BA 1SL9A 1CFFA 1B8RA 1CKKA 4GAOA 5FYXA 1SY9A 3VRRA 1KK7Z 4C0KA 2ZKMX 1WY9A 1SL8A 1TNWA 1RK9A 1UURA 4PE4A 2BECA 1TNXA 1F70A 2BL0B 5HKYA 5B8IB 2M0RA 2MBXA 3ZWHA 2A4JA 1ZMZA 1TCFA 3BOWA 1KSMA 4CFRA 2KGBC 5AFPA 1DJYA 1CLBA 1KFUS 2NCPA 1GGZA 1R6PA 2BKIB 3FS7A 2LP2A 2L4IA 4XJKB 1NCXA 1ZOTB 2JT0A 2JQ6A 1SW8A 4GFTA 5D7FA 1NWDA 2JTTA 3LK0A 1QASA 1NX0A 1J7QA 4R1EA 4A4BA 1RFJA 3SIAA 1MUXA 2LP3A 3EKHA 3JTDC 1YRTB 3TUYB 3DD4A 1RTP1 5AERA 2GGZA 1TCOB 1CLMA 4CPVA 1A75B 1CDPA 1LXFC 1A03A 3BUWB 3HX4A 5I8NA 1QLKA 2JWWA 3LK1A 1YR5A 2KBIA 2L98A 1TNPA 2LE9B 1KQMC 4MRYA 4HSZA 3WXAA 4M2PA 5KU1A 3DVEA 1J7PA 2JZIA 1F4OA 1S5GZ 2FJUB 1G33A 3MSEB 3RLZA 1JSAA 3O4YA 2ZNEA 4CIDA 1OMRA 3BOWB 1DJZA 1U5IA 2LUCA 1OMDA 1S6JA 1OMVA 1XFVO 3KO0A 1UHIA 2KGRA 4GNKB 2WNDA 1AUIB 1EL4A 3EK8A 3PSRA 5CPVA 2LHIA 4WRIA 2M9GA 3I5IC 1QS7A 3O78A 2OPOA 1XFUO 4YGDB 1IWQA 5F6TA 1V1GA 1KFXL 2ISDA 1BG1A 2AUCA 4NQGA 1UP5A 1PULA 3A4UB 3JTDB 4ICBA 2FCEA 3AKBA 3SG3A 3F45A 1IRJA 1A4PA 2ZN9A 1BLQA 1TTXA 4I5KA 4M2QA 4N1GA 1DMOA 3EVVA 1LINA 2PVBA 3EVUA 3H4SE 4MEWA 1OSAA 2KI4C 1B9AA 1ZFSA 3TDZA 1EJ3A 1C7WA 2LMUA 1QX2A 2ZN8A 1QXPA 2KAXA 4USLA 1W7IB 2K7DA 2Q91A 1VRKA 2CNPA 2RGIA 5HLOA 1NUBA 1S1EA 1XFXO 2IS9A 2AAOA 4D1EA 1K2HA 1N0YA 3SG4A 3DVKA 1DGVA 1U5IB 2I2RE 1Y0VH 1DJXA 4AQJA 4DS7A 1UHJA 2L2EA 1KK8C 4ORAB 4DUQA 2LLTA 2F2PA 3I5IB 1X02A 1IQ3A 1LA3A 1CNPA 1TNQA 2WCBA 2O5GA 1QATA 1CFCA 2KBMA 1YUUA 1MXEA 1FF1A 4HRGA 2PMYA 1UHNA 2KFGA 2OTGC 2Y1MA 3GK1A 2BCAA 2JT8A 1NCYA 3TS5C 1M39A 1DJHA 1JWDA 2EC6C 2JXLA 4DIRA 3I5HC 1GGWA 1J55A 2KI4B 2K7CA 3I5GC 2QPTA 3OB1B 4JQ0D 1S3PA 5DKQA 4PDZA 2G2BA 2O60A 1BU3A 1EG4A 1PVBA 2VRGA 2PASA 1AHRA 4YBHB 2K61A 1XYDA 3OX6A 1K8UA 1K95A 1SR6C 1NX3A 1GQMA 2WC8A 4I5JA 4MZLA 2H2KA 2LAPA 2OS8C 1BR1B 1KK8B 2KYCA 1AP4A 2K7OA 1IKUA 2CTNA 2KYFA 2R2IA 5CSNA 1RECA 4C0JA 1HQVA 1B8LA 3BUNB 2D8NA 1EH2A 5G08A 1F4QA 1WRZA 1MHOA 5K89A 1PRWA 2L5XB 2LLUA 3I5FC 3PATA 4GGFA 4GGFC 2F3YA 2OTGB 4HREE 4AOMA 4OVNF 5AXIA 1BODA 3AKAA 4ORCB 4OV2A 3TS5B 1BR4B 1NPQA 1QJTA 2EC6B 2FOTA 2LM5A 3I5HB 1V1FA 4GGNA 1FPWA 1NCZA 1SPYA 1WDCC 1H8BA 3I5GB 4MBEA 1YVHA 2JPTA 1G8IA 2M3WA 1QVIY 1F55A 1IG5A 2JTZA 1IH0A 2CBLA 3NSIA 1FI6A 1YRUB 1XVJA 2L50A 1RWYA 3D0YA 5BPJA 1Y1AA 4WQ3A 2BKHB 2NXQA 4GPLB 1SR6B 2M1UA 2OS8B 1M31A 1YUTA 1UHHA 1LA0A 1S6IA 3DVMA 3EKJA 3IQQA 1QV1A 3K21A 4PE7A 4PCWA 1CTRA 3WHUB 5I2OA 2ZRSA 4E68A 3FIAA 1JC2A 2ZRTA 3I5FB 2LMVA 2K8MB 2KI6D 1N2DA 1CFDA 1H4BA 1CDLA 4FTGA 3LCPC 1PVAA 2LV7A 1WRLA 1S26D 4MRXA 2M7LA 1WDCB 1B47A 4C0LA 3E3RA 3IF7A 3PLFB 1QTXA 3RM1A 5D69A 2PRUA 2BBNA 3NSLA 4HRHA 5ER4X 1NP8A 3NXAA 3D0YB 3ICBA 4U8DA 3BQ3A 4QJ5B 1IGVA 3BXKA 1BF5A 3CLNA 2I7AA 2F8PA 1SYMA 1Y6WA 2JC2A 1RROA 1PALA 4I5NB 1BOCA 1OZSA 1SNLA 2MAZA 2GGMA 2LC5A 4N1FA 3TZ1A 1FBVA 1J1DA 1OZOA 1UUSA 4M2OA 1K96A 2WOSA 3DVJA 3PALA 4MZKA 5ER5A 2WCEA 2JRFA 3CTNA 4GUKA 5JOLA 2SASA 1YUSA 2KNEA 4BY5A 1CM1A 3NSOA 4AQIA 1LVCD 1PSRA 2DOQA 2KQ6A 4I5LB 4MSPA 4P5OE 3GOFA 1S6CA 4YI8A 2LLSA 4PHJA 2TN4A 3SG7A 1Q80A 3M0WA 2EGDA 1KFXS 3CGAA 4JPZB 3PFVA 2CXJA 2HPSA 1FW4A 1SCMC 1KWOC 1DT7B 2K7BA 2JNFA 2MLFC 3LLEA 1MR8A 3VRPA 1K93D 1NSHA 1KQVA 1J7RA 1NX1A 3CZTX 3D10A 3SIBA 2B1UA 1ZUZA 1Y1XA 1Y1UA 2L4HA 4NDCA 2CCMA 1GJYA 1UWOA 2BE6A 4OKHA 1K9PA 2Y5IA 1DTLA 1DF0A 3KF9A 1CDNA 2JXCA 5HLVA 4MLWA 1OE9B 1JF2A 1DJWA 1KSOA 1AK8A 4CFQA 1JUOA 3GK2A 2P6BB 5GQQC 2LVJA 1TIZA 1TRFA 1F8HA 3TDIA 4BY4A 2H61A 1PK0D 2H61C 2LVIA 3IQOA 3SG6A 1EXRA 4MVFA 2JOJA 1B7TY 2MJWB 1M45A 3CR4X 1BMOA 1QVIZ 1F54A 2HETA 3BYAA 4N5XA 1YX8A 2KHNA 1SCMB 1R2UA 1KWOB 2MA2A 5CSJA 1SMGA 3BUMB 1KFUL 3A8RA 3PN7C 3ZNIA 1YTZC 4CLNA 2CT9A 4PHNA 5AEQA 1QLSA 2LVVA 2SCPA 3WNXB 2KSPA 3GK4X 1SBJA 5DKNA 1QIVA 4QJ4B 3EK7A 1NYAA 1DF0B 4ZCUA 2COLB 2E30A 1IQ5A 1YVLA 3LL8B 3CR5X 2PSRA 1NIWA 2F3ZA 1QIWA 1J7OA 5IBWA 1B1GA 2ZNDA 2E6WA 3HCMA 1YURA 3DF0A 5AANA 4YGAA 2NZ0A 1SKTA 3OHMB 4JWQA 3WHTB 2L51A 2WCFA 5PALA 3VRQA 2BCBA 1SRAA 1C07A 1ZACA 3PN7B 1XFYO 3KHEA 1AJ5A 1KK7Y 3CWGA 4PE1A 4YGBB 2M29A 2JU0A 1OOJA 1TOPA 1OQPA 1JBAA 3QRXA 5KSZA 1MQ1A 5HKZA 1IJ6A 2FCDA 2K2AA 4ZCVA 2M7NA 1QX5B 3BUOB 1J1EA 1DJIA 1CLLA 1CDMA 2KQYA 5HYDA 1SL7A 2KOTA 4P2YB 3OB2B 4PHMA 3CS1A 4WQ2A 1WRKA 2NLNA 4PE0A 3DF0B 1D1OA 3O6BA 2AMIA 3BUXB 3CR2A 2LHLA 1F71A 5DKRA 1W7JB 3C1VA 4XYNA 1NX2A 1B8CA 1M63B 3SJSA 2BBMA 4DCKA 1QX7A 2V53A 2PALA 3JVTC 1K9UA 2KAYA 1XA5A 2MHHA 4PHKA 1S5GY 2F33A 3KPXA 2L0PA 4UPGA 2I94A 3FWBA 1YX7A 2QACA 3O2PA 2NCOA 1BT6A 2HQWA 4PALA 2JNXA 3VGOA 4ORBB 1L2OC 2M97A 4ETOA 4GBAA 3TDUA 3EK4A 1KQMB 4NDBA 1UHKA 1CFPA 1CB1A 3OX5A 2M8UA 1DJGA 4YGCB 4QJ3B 1FI5A 1KCYA 1AVSA 2BCXA 1AJ4A 1CM4A 1K9KA 1MXLC 2WORA 4TNCA 4Q04A 4FQOA 4OCIA 1SK6D 2K0JA 2K2FA 2LMTA 1WLMA 4YGEB 1XFWO 1SCVA 1MWNA 5CSFA 1JFKA 1N65A 1B7TZ 4YI9A 3VROA 3FWCA 1JF0A 5HKWA 5I2LA 3JVTB 2HQ8A 1K94A 1M46A 2BE4A 3SG2A 3PM8A 2KFFA 4IL1A 2ZFDA 3OP0A 4MN0A 2KI6C 1ODBA 2JT3A 1TN4A 1JFJA 4A4CA 2M49B 1XFZO 1ALWA 2LUXA 1IJ5A 1LKJA 2I18A 2GV5A 2KAVA 1L2OB 2BL0C 1B4CA 2F2OA 2LNKA 5CSIA 4YRUA 1L7ZA 1CMGA 1A2XA 1RJVA 2KDHA 2Y1NA 2MLEC 4F0ZB 2Q4UA 2JULA
chains in the Genus database with same CATH superfamily
4OR9B 2M1KB 1CMFA 1PSBA 5KTYA 2YGUA 1A29A 1MF8B 5TNCA 1E8AA 4MZJA 1BJFA 3NSKA 4XJKA 3AAJA 3SG5A 1DGUA 3AAKA 2LVKA 1XO5A 1C7VA 5JJGA 1ORGA 1HT9A 2LANA 1ALVA 1WLZA 2MRDA 4DRWA 3D77A 3EVRA 5J3XA 4NDDA 3TUYC 1S36A 1EG3A 1K90D 1XK4A 1QV0A 1G4YR 2EHBA 1XK4C 2HF5A 3B88A 2LCPA 4L9MA 4YGEB 3VRNA 1DVIA 2KFHA 5I2QA 1A75A 2Y4QA 2G9BA 1SL9A 1CFFA 1B8RA 1CKKA 5FI6A 4GAOA 5FYXA 1SY9A 3VRRA 1KK7Z 4C0KA 2ZKMX 3KEVA 3S0GA 1WY9A 1SL8A 1TNWA 1RK9A 1UURA 2WCKA 3BFAA 1C3YA 2WCMA 4PE4A 2BECA 1TNXA 1F70A 2BL0B 5HKYA 5B8IB 2M0RA 2MBXA 3ZWHA 2A4JA 1ZMZA 1TCFA 3BOWA 1KSMA 4CFRA 2KGBC 5AFPA 1DJYA 1CLBA 5FI7A 4JD9A 1KFUS 2NCPA 1GGZA 1R6PA 2BKIB 3FS7A 2LP2A 2L4IA 4XJKB 1NCXA 1ZOTB 2JT0A 5I94A 2JQ6A 1SW8A 4GFTA 5D7FA 1NWDA 2JTTA 3LK0A 1QASA 1NX0A 1J7QA 4R1EA 4A4BA 1RFJA 4PT1A 3SIAA 1MUXA 2LP3A 3EKHA 3JTDC 1YRTB 3TUYB 3DD4A 1RTP1 5AERA 2GGZA 1TCOB 2P70A 1CLMA 4CPVA 1A75B 1CDPA 1LXFC 1A03A 3BUWB 3HX4A 1Z4HA 5I8NA 1QLKA 2JWWA 3LK1A 1YR5A 2KBIA 2L98A 1TNPA 2LE9B 1KQMC 4MRYA 4HSZA 3WXAA 4M2PA 5KU1A 3DVEA 3L4LA 2JZIA 1J7PA 1F4OA 1S5GZ 2FJUB 1G33A 1C3ZA 3MSEB 3RLZA 1JSAA 3O4YA 2BAPA 2ZNEA 4CIDA 1OMRA 3BOWB 1DJZA 1U5IA 2LUCA 1OMDA 1S6JA 1OMVA 1XFVO 3KO0A 1UHIA 2KGRA 4GNKB 2WNDA 1AUIB 1EL4A 3EK8A 3PSRA 3CZ2A 2LHIA 4WRIA 5CPVA 2M9GA 3I5IC 1QS7A 3O78A 2OPOA 1XFUO 4YGDB 1IWQA 5F6TA 1V1GA 1KFXL 2ISDA 4INWA 2AUCA 4NQGA 1BG1A 1UP5A 1PULA 3A4UB 3JTDB 3L47A 2FCEA 3AKBA 4ICBA 1SSEB 3F45A 4INXA 3SG3A 1IRJA 1A4PA 2ZN9A 1BLQA 1TTXA 4I5KA 4M2QA 4N1GA 1DMOA 3S0AA 3EVVA 1LINA 2PVBA 3EVUA 3H4SE 4MEWA 1OSAA 2KI4C 1QWVA 1B9AA 1ZFSA 3TDZA 1EJ3A 1C7WA 2LMUA 1QX2A 2ZN8A 1QXPA 4IJ7A 2KAXA 4USLA 1P28A 1W7IB 2K7DA 2Q91A 1VRKA 2CNPA 2RGIA 5HLOA 3S0BA 1NUBA 1S1EA 2KLDA 1XFXO 2IS9A 3FE6A 3PM2A 2AAOA 4D1EA 1K2HA 1N0YA 3SG4A 3DVKA 1DGVA 1U5IB 2I2RE 1Y0VH 1DJXA 4AQJA 4DS7A 1UHJA 2L2EA 1KK8C 1TUJA 4ORAB 4DUQA 2LLTA 2F2PA 3I5IB 1X02A 1IQ3A 4OKHA 1LA3A 1CNPA 1TNQA 2WCBA 2O5GA 1QATA 1CFCA 2KBMA 1YUUA 1MXEA 1FF1A 4HRGA 2PMYA 1UHNA 2KFGA 2OTGC 1Z2CB 2Y1MA 3GK1A 2BCAA 2JT8A 1NCYA 3TS5C 1M39A 1DJHA 3L4AA 1JWDA 2EC6C 2JXLA 4DIRA 3I5HC 1GGWA 1J55A 2KI4B 2K7CA 3I5GC 2QPTA 5D3OA 2KLEA 3OB1B 4JQ0D 1S3PA 5DKQA 4PDZA 2G2BA 2O60A 1BU3A 1EG4A 1PVBA 2QDIA 2PASA 2VRGA 2WCJA 5HL1A 1AHRA 4YBHB 2K61A 3DZTA 1XYDA 3OX6A 1K8UA 3DYEA 1K95A 1SR6C 1NX3A 1GQMA 2WC8A 4I5JA 4MZLA 2H2KA 2LAPA 2OS8C 1BR1B 1KK8B 2KYCA 1AP4A 2K7OA 3BFBA 3FE9A 1IKUA 2CTNA 2KYFA 2R2IA 5CSNA 1RECA 4C0JA 1HQVA 1B8LA 3BUNB 2D8NA 1EH2A 5G08A 1F4QA 1WRZA 2BNXA 1MHOA 5K89A 1PRWA 2L5XB 2LLUA 3I5FC 3PATA 4GGFA 4GGFC 2F3YA 2OTGB 4HREE 4AOMA 3NGVA 4OVNF 5AXIA 1BODA 3AKAA 4ORCB 4OV2A 3TS5B 1BR4B 1NPQA 3D75A 1QJTA 2EC6B 2FOTA 2LM5A 3I5HB 1V1FA 4GGNA 1FPWA 1NCZA 1SPYA 1WDCC 1IIOA 1H8BA 3I5GB 4MBEA 1YVHA 2JPTA 3D76A 1OOFA 1G8IA 3S0DA 2WCLA 1OOGA 2M3WA 1QVIY 1F55A 1IG5A 2JTZA 1IH0A 2CBLA 3NSIA 1FI6A 1YRUB 1XVJA 2L50A 1RWYA 3D0YA 5BPJA 1Y1AA 4WQ3A 2BKHB 2NXQA 3CYZA 4GPLB 1SR6B 2M1UA 3OBVA 2OS8B 1M31A 1YUTA 1UHHA 3NHIA 1LA0A 1S6IA 3DVMA 3EKJA 3IQQA 1QV1A 3K21A 4PE7A 4PCWA 1CTRA 3WHUB 5I2OA 2ZRSA 4E68A 3FIAA 1JC2A 2ZRTA 3I5FB 2LMVA 2K8MB 2KI6D 1N2DA 1CFDA 1H4BA 3N7HA 1XFRA 1CDLA 4FTGA 3LCPC 1PVAA 2LV7A 1WRLA 1S26D 4MRXA 2M7LA 1WDCB 1B47A 4C0LA 3E3RA 3IF7A 3PLFB 1QTXA 3RM1A 5D69A 2PRUA 2BBNA 3NSLA 4HRHA 5ER4X 1NP8A 3NXAA 3D0YB 3B86A 2WC6A 3ICBA 4U8DA 3BQ3A 2WC5A 4QJ5B 3D74A 1IGVA 3BXKA 1BF5A 3CLNA 3D73A 2I7AA 2F8PA 1SYMA 1LS8A 1Y6WA 2JC2A 1RROA 4KYNA 1PALA 2QEOA 4I5NB 2K60A 2L2CA 1BOCA 1OZSA 1SNLA 2L5YA 2MAZA 2GGMA 2LC5A 4N1FA 3TZ1A 1FBVA 1J1DA 1OZOA 1UUSA 1DC1A 4M2OA 1K96A 2WOSA 3DVJA 3PALA 4MZKA 5ER5A 2WCEA 2JRFA 3CTNA 4GUKA 5JOLA 2SASA 1YUSA 2KNEA 4BY5A 1CM1A 3CDNA 3NSOA 4AQIA 1DELA 1LVCD 1PSRA 2DOQA 2KQ6A 4I5LB 4MSPA 5EL2A 4P5OE 3GOFA 1S6CA 4YI8A 2LLSA 4PHJA 2TN4A 3SG7A 1Q80A 3M0WA 2EGDA 1KFXS 3CGAA 4JPZB 3R72A 1GM0A 3FE8A 3PFVA 2CXJA 2HPSA 1FW4A 1SCMC 1DQEA 1KWOC 1DT7B 2K7BA 2JNFA 1DEKA 2MLFC 3LLEA 1MR8A 3VRPA 1K93D 1NSHA 1KQVA 1J7RA 1NX1A 3V2LA 3CZTX 3D10A 3SIBA 2B1UA 1ZUZA 1Y1XA 1Y1UA 2ERBA 2L4HA 2CCMA 1GJYA 1UWOA 2BE6A 3Q8IA 4NDCA 4OZDA 1K9PA 3O4XA 2Y5IA 1DTLA 1DF0A 3BFHA 3KF9A 1CDNA 2JXCA 5HLVA 4MLWA 1OE9B 1JF2A 1DJWA 1KSOA 1AK8A 4CFQA 1JUOA 2PYQA 3GK2A 2P6BB 5DICA 2LVJA 5GQQC 1TIZA 1TRFA 1F8HA 3TDIA 4BY4A 2H61A 3K1EA 1PK0D 2H61C 2LVIA 3IQOA 1OOHA 3SG6A 1EXRA 4MVFA 2JOJA 1B7TY 2MJWB 1M45A 2H8VA 3CR4X 3B87A 1BMOA 1QVIZ 1F54A 2HETA 3BJHA 3BYAA 4N5XA 1YX8A 2QEVA 3B6XA 2KHNA 1SCMB 1R2UA 1KWOB 2MA2A 5CSJA 1SMGA 3BUMB 1KFUL 3A8RA 3PN7C 3ZNIA 3DXLA 1YTZC 4CLNA 2CT9A 4PHNA 3PJIA 5AEQA 1QLSA 2LVVA 2SCPA 3SS3A 2KSPA 3GK4X 3S0EA 3WNXB 1SBJA 5DKNA 1QIVA 1TUZA 4QJ4B 3R1PA 3EK7A 1NYAA 3B7AA 1DF0B 4ZCUA 2COLB 2E30A 1IQ5A 1YVLA 3LL8B 3CR5X 2PSRA 1NIWA 2F3ZA 1QIWA 1J7OA 5IBWA 1B1GA 2ZNDA 2E6WA 3SS5A 3HCMA 1YURA 3DF0A 5AANA 2QEHA 4YGAA 2NZ0A 1SKTA 2P71A 3OHMB 4JWQA 3WHTB 2L51A 2WCFA 5PALA 3VRQA 2BCBA 1SRAA 1C07A 1ZACA 3PN7B 1XFYO 3KHEA 1AJ5A 3VB1A 3R1VA 1KK7Y 3CWGA 4PE1A 4YGBB 2M29A 3NHTA 2JU0A 1OOJA 1TOPA 1OQPA 1JBAA 3QRXA 5KSZA 1MQ1A 5HKZA 3CABA 1IJ6A 2FCDA 2K2AA 4ZCVA 2M7NA 1QX5B 3BUOB 1J1EA 1DJIA 1CLLA 1CDMA 2KQYA 5HYDA 1SL7A 2KOTA 4FQTA 4P2YB 3OB2B 4PHMA 3CS1A 4WQ2A 1WRKA 2NLNA 4PE0A 3DF0B 1D1OA 3D78A 3O6BA 2AMIA 2KPHA 3BUXB 3CR2A 2LHLA 4JKTA 1F71A 3CZ0A 5DKRA 1W7JB 3C1VA 4XYNA 2PQLA 1NX2A 1B8CA 1M63B 3SJSA 1W9ZA 2BBMA 4DCKA 1QX7A 2V53A 2PALA 3CZ1A 3JVTC 3SS4A 1K9UA 1TWOA 2KAYA 1XA5A 2MHHA 4PHKA 1S5GY 2F33A 3KPXA 2L0PA 4UPGA 2I94A 3FWBA 1YX7A 3UNWA 2JPOA 2QACA 3O2PA 2NCOA 1BT6A 2HQWA 4PALA 2JNXA 3VGOA 4ORBB 1L2OC 2M97A 4ETOA 4GBAA 3TDUA 3EK4A 1KQMB 4NDBA 1UHKA 1CFPA 1CB1A 3OX5A 3R1OA 2M8UA 1DJGA 4YGCB 4QJ3B 1FI5A 1KCYA 1AVSA 2BCXA 1AJ4A 1CM4A 1K9KA 1MXLC 2WORA 4F7FA 4TNCA 4Q04A 2QEBA 4FQOA 4OCIA 1SK6D 2K0JA 2K2FA 3UO9A 2FJYA 1WLMA 2LMTA 1XFWO 1SCVA 1MWNA 3QMEA 1JFKA 1N65A 1B7TZ 3OGNA 5CSFA 4YI9A 3VROA 1OW4A 3FWCA 1JF0A 3DY9A 5HKWA 3RZSA 5I2LA 3JVTB 2HQ8A 1K94A 1M46A 2BE4A 3SG2A 2WCHA 2KFFA 1T14A 3PM8A 4IL1A 2ZFDA 3OP0A 4MN0A 2KI6C 1OOIX 1ODBA 2JT3A 1TN4A 3S0FA 4A4CA 1JFJA 2M49B 1XFZO 1ALWA 2LUXA 1IJ5A 1LKJA 2I18A 5FI2A 3IVTA 2GV5A 2KAVA 1L2OB 2BL0C 1B4CA 2F2OA 2LNKA 5CSIA 4YRUA 1L7ZA 1CMGA 1A2XA 1RJVA 2KDHA 3EG5B 2GTEA 2Y1NA 2MLEC 4F0ZB 2Q4UA 2JULA
chains in the Genus database with same CATH topology
4OR9B 2M1KB 1CMFA 1PSBA 5KTYA 1A29A 1MF8B 5TNCA 1E8AA 4MZJA 1BJFA 3NSKA 4XJKA 3AAJA 3SG5A 1DGUA 3AAKA 2LVKA 1XO5A 1C7VA 5JJGA 1HT9A 2LANA 1ALVA 1WLZA 2MRDA 4DRWA 3EVRA 5J3XA 4NDDA 3TUYC 1S36A 1EG3A 1K90D 1XK4A 1QV0A 1G4YR 2EHBA 1XK4C 2HF5A 3KEVA 2LCPA 4L9MA 3VRNA 1DVIA 2KFHA 5I2QA 1A75A 2Y4QA 2G9BA 1SL9A 1CFFA 1B8RA 1CKKA 4GAOA 5FYXA 1SY9A 3VRRA 1KK7Z 4C0KA 2ZKMX 1WY9A 1SL8A 1TNWA 1RK9A 1UURA 4PE4A 2BECA 1TNXA 1F70A 2BL0B 5HKYA 5B8IB 2M0RA 2MBXA 3ZWHA 2A4JA 1ZMZA 1TCFA 3BOWA 1KSMA 4CFRA 2KGBC 5AFPA 1DJYA 1CLBA 1KFUS 2NCPA 1GGZA 1R6PA 2BKIB 3FS7A 2LP2A 2L4IA 4XJKB 1NCXA 1ZOTB 2JT0A 2JQ6A 1SW8A 4GFTA 5D7FA 1NWDA 2JTTA 3LK0A 1QASA 1NX0A 1J7QA 4R1EA 4A4BA 1RFJA 3SIAA 1MUXA 2LP3A 3EKHA 3JTDC 1YRTB 3TUYB 3DD4A 1RTP1 5AERA 2GGZA 1TCOB 1CLMA 4CPVA 1A75B 1CDPA 1LXFC 1A03A 3BUWB 3HX4A 5I8NA 1QLKA 2JWWA 3LK1A 1YR5A 2KBIA 2L98A 1TNPA 2LE9B 1KQMC 4MRYA 4HSZA 3WXAA 4M2PA 5KU1A 3DVEA 1J7PA 2JZIA 1F4OA 1S5GZ 2FJUB 1G33A 3MSEB 3RLZA 1JSAA 3O4YA 2ZNEA 4CIDA 1OMRA 3BOWB 1DJZA 1U5IA 2LUCA 1OMDA 1S6JA 1OMVA 1XFVO 3KO0A 1UHIA 2KGRA 4GNKB 2WNDA 1AUIB 1EL4A 3EK8A 3PSRA 5CPVA 2LHIA 4WRIA 2M9GA 3I5IC 1QS7A 3O78A 2OPOA 1XFUO 4YGDB 1IWQA 5F6TA 1V1GA 1KFXL 2ISDA 1BG1A 2AUCA 4NQGA 1UP5A 1PULA 3A4UB 3JTDB 4ICBA 2FCEA 3AKBA 3SG3A 3F45A 1IRJA 1A4PA 2ZN9A 1BLQA 1TTXA 4I5KA 4M2QA 4N1GA 1DMOA 3EVVA 1LINA 2PVBA 3EVUA 3H4SE 4MEWA 1OSAA 2KI4C 1B9AA 1ZFSA 3TDZA 1EJ3A 1C7WA 2LMUA 1QX2A 2ZN8A 1QXPA 2KAXA 4USLA 1W7IB 2K7DA 2Q91A 1VRKA 2CNPA 2RGIA 5HLOA 1NUBA 1S1EA 1XFXO 2IS9A 2AAOA 4D1EA 1K2HA 1N0YA 3SG4A 3DVKA 1DGVA 1U5IB 2I2RE 1Y0VH 1DJXA 4AQJA 4DS7A 1UHJA 2L2EA 1KK8C 4ORAB 4DUQA 2LLTA 2F2PA 3I5IB 1X02A 1IQ3A 1LA3A 1CNPA 1TNQA 2WCBA 2O5GA 1QATA 1CFCA 2KBMA 1YUUA 1MXEA 1FF1A 4HRGA 2PMYA 1UHNA 2KFGA 2OTGC 2Y1MA 3GK1A 2BCAA 2JT8A 1NCYA 3TS5C 1M39A 1DJHA 1JWDA 2EC6C 2JXLA 4DIRA 3I5HC 1GGWA 1J55A 2KI4B 2K7CA 3I5GC 2QPTA 3OB1B 4JQ0D 1S3PA 5DKQA 4PDZA 2G2BA 2O60A 1BU3A 1EG4A 1PVBA 2VRGA 2PASA 1AHRA 4YBHB 2K61A 1XYDA 3OX6A 1K8UA 1K95A 1SR6C 1NX3A 1GQMA 2WC8A 4I5JA 4MZLA 2H2KA 2LAPA 2OS8C 1BR1B 1KK8B 2KYCA 1AP4A 2K7OA 1IKUA 2CTNA 2KYFA 2R2IA 5CSNA 1RECA 4C0JA 1HQVA 1B8LA 3BUNB 2D8NA 1EH2A 5G08A 1F4QA 1WRZA 1MHOA 5K89A 1PRWA 2L5XB 2LLUA 3I5FC 3PATA 4GGFA 4GGFC 2F3YA 2OTGB 4HREE 4AOMA 4OVNF 5AXIA 1BODA 3AKAA 4ORCB 4OV2A 3TS5B 1BR4B 1NPQA 1QJTA 2EC6B 2FOTA 2LM5A 3I5HB 1V1FA 4GGNA 1FPWA 1NCZA 1SPYA 1WDCC 1H8BA 3I5GB 4MBEA 1YVHA 2JPTA 1G8IA 2M3WA 1QVIY 1F55A 1IG5A 2JTZA 1IH0A 2CBLA 3NSIA 1FI6A 1YRUB 1XVJA 2L50A 1RWYA 3D0YA 5BPJA 1Y1AA 4WQ3A 2BKHB 2NXQA 4GPLB 1SR6B 2M1UA 2OS8B 1M31A 1YUTA 1UHHA 1LA0A 1S6IA 3DVMA 3EKJA 3IQQA 1QV1A 3K21A 4PE7A 4PCWA 1CTRA 3WHUB 5I2OA 2ZRSA 4E68A 3FIAA 1JC2A 2ZRTA 3I5FB 2LMVA 2K8MB 2KI6D 1N2DA 1CFDA 1H4BA 1CDLA 4FTGA 3LCPC 1PVAA 2LV7A 1WRLA 1S26D 4MRXA 2M7LA 1WDCB 1B47A 4C0LA 3E3RA 3IF7A 3PLFB 1QTXA 3RM1A 5D69A 2PRUA 2BBNA 3NSLA 4HRHA 5ER4X 1NP8A 3NXAA 3D0YB 3ICBA 4U8DA 3BQ3A 4QJ5B 1IGVA 3BXKA 1BF5A 3CLNA 2I7AA 2F8PA 1SYMA 1Y6WA 2JC2A 1RROA 1PALA 4I5NB 1BOCA 1OZSA 1SNLA 2MAZA 2GGMA 2LC5A 4N1FA 3TZ1A 1FBVA 1J1DA 1OZOA 1UUSA 4M2OA 1K96A 2WOSA 3DVJA 3PALA 4MZKA 5ER5A 2WCEA 2JRFA 3CTNA 4GUKA 5JOLA 2SASA 1YUSA 2KNEA 4BY5A 1CM1A 3NSOA 4AQIA 1LVCD 1PSRA 2DOQA 2KQ6A 4I5LB 4MSPA 4P5OE 3GOFA 1S6CA 4YI8A 2LLSA 4PHJA 2TN4A 3SG7A 1Q80A 3M0WA 2EGDA 1KFXS 3CGAA 4JPZB 3PFVA 2CXJA 2HPSA 1FW4A 1SCMC 1KWOC 1DT7B 2K7BA 2JNFA 2MLFC 3LLEA 1MR8A 3VRPA 1K93D 1NSHA 1KQVA 1J7RA 1NX1A 3CZTX 3D10A 3SIBA 2B1UA 1ZUZA 1Y1XA 1Y1UA 2L4HA 4NDCA 2CCMA 1GJYA 1UWOA 2BE6A 4OKHA 1K9PA 2Y5IA 1DTLA 1DF0A 3KF9A 1CDNA 2JXCA 5HLVA 4MLWA 1OE9B 1JF2A 1DJWA 1KSOA 1AK8A 4CFQA 1JUOA 3GK2A 2P6BB 5GQQC 2LVJA 1TIZA 1TRFA 1F8HA 3TDIA 4BY4A 2H61A 1PK0D 2H61C 2LVIA 3IQOA 3SG6A 1EXRA 4MVFA 2JOJA 1B7TY 2MJWB 1M45A 3CR4X 1BMOA 1QVIZ 1F54A 2HETA 3BYAA 4N5XA 1YX8A 2KHNA 1SCMB 1R2UA 1KWOB 2MA2A 5CSJA 1SMGA 3BUMB 1KFUL 3A8RA 3PN7C 3ZNIA 1YTZC 4CLNA 2CT9A 4PHNA 5AEQA 1QLSA 2LVVA 2SCPA 3WNXB 2KSPA 3GK4X 1SBJA 5DKNA 1QIVA 4QJ4B 3EK7A 1NYAA 1DF0B 4ZCUA 2COLB 2E30A 1IQ5A 1YVLA 3LL8B 3CR5X 2PSRA 1NIWA 2F3ZA 1QIWA 1J7OA 5IBWA 1B1GA 2ZNDA 2E6WA 3HCMA 1YURA 3DF0A 5AANA 4YGAA 2NZ0A 1SKTA 3OHMB 4JWQA 3WHTB 2L51A 2WCFA 5PALA 3VRQA 2BCBA 1SRAA 1C07A 1ZACA 3PN7B 1XFYO 3KHEA 1AJ5A 1KK7Y 3CWGA 4PE1A 4YGBB 2M29A 2JU0A 1OOJA 1TOPA 1OQPA 1JBAA 3QRXA 5KSZA 1MQ1A 5HKZA 1IJ6A 2FCDA 2K2AA 4ZCVA 2M7NA 1QX5B 3BUOB 1J1EA 1DJIA 1CLLA 1CDMA 2KQYA 5HYDA 1SL7A 2KOTA 4P2YB 3OB2B 4PHMA 3CS1A 4WQ2A 1WRKA 2NLNA 4PE0A 3DF0B 1D1OA 3O6BA 2AMIA 3BUXB 3CR2A 2LHLA 1F71A 5DKRA 1W7JB 3C1VA 4XYNA 1NX2A 1B8CA 1M63B 3SJSA 2BBMA 4DCKA 1QX7A 2V53A 2PALA 3JVTC 1K9UA 2KAYA 1XA5A 2MHHA 4PHKA 1S5GY 2F33A 3KPXA 2L0PA 4UPGA 2I94A 3FWBA 1YX7A 2QACA 3O2PA 2NCOA 1BT6A 2HQWA 4PALA 2JNXA 3VGOA 4ORBB 1L2OC 2M97A 4ETOA 4GBAA 3TDUA 3EK4A 1KQMB 4NDBA 1UHKA 1CFPA 1CB1A 3OX5A 2M8UA 1DJGA 4YGCB 4QJ3B 1FI5A 1KCYA 1AVSA 2BCXA 1AJ4A 1CM4A 1K9KA 1MXLC 2WORA 4TNCA 4Q04A 4FQOA 4OCIA 1SK6D 2K0JA 2K2FA 2LMTA 1WLMA 4YGEB 1XFWO 1SCVA 1MWNA 5CSFA 1JFKA 1N65A 1B7TZ 4YI9A 3VROA 3FWCA 1JF0A 5HKWA 5I2LA 3JVTB 2HQ8A 1K94A 1M46A 2BE4A 3SG2A 3PM8A 2KFFA 4IL1A 2ZFDA 3OP0A 4MN0A 2KI6C 1ODBA 2JT3A 1TN4A 1JFJA 4A4CA 2M49B 1XFZO 1ALWA 2LUXA 1IJ5A 1LKJA 2I18A 2GV5A 2KAVA 1L2OB 2BL0C 1B4CA 2F2OA 2LNKA 5CSIA 4YRUA 1L7ZA 1CMGA 1A2XA 1RJVA 2KDHA 2Y1NA 2MLEC 4F0ZB 2Q4UA 2JULA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OR9 B;  2M1K B;  1CMF A;  1PSB A;  5KTY A;  1A29 A;  1MF8 B;  5TNC A;  1E8A A;  4MZJ A;  1BJF A;  3NSK A;  4XJK A;  3AAJ A;  3SG5 A;  1DGU A;  3AAK A;  2LVK A;  1XO5 A;  1C7V A;  5JJG A;  1HT9 A;  2LAN A;  1ALV A;  1WLZ A;  2MRD A;  4DRW A;  3EVR A;  5J3X A;  4NDD A;  3TUY C;  1S36 A;  1EG3 A;  1K90 D;  1XK4 A;  1QV0 A;  1G4Y R;  2EHB A;  1XK4 C;  2HF5 A;  3KEV A;  2LCP A;  4L9M A;  3VRN A;  1DVI A;  2KFH A;  5I2Q A;  1A75 A;  2Y4Q A;  2G9B A;  1SL9 A;  1CFF A;  1B8R A;  1CKK A;  4GAO A;  5FYX A;  1SY9 A;  3VRR A;  1KK7 Z;  4C0K A;  2ZKM X;  1WY9 A;  1SL8 A;  1TNW A;  1RK9 A;  1UUR A;  4PE4 A;  2BEC A;  1TNX A;  1F70 A;  2BL0 B;  5HKY A;  5B8I B;  2M0R A;  2MBX A;  3ZWH A;  2A4J A;  1ZMZ A;  1TCF A;  3BOW A;  1KSM A;  4CFR A;  2KGB C;  5AFP A;  1DJY A;  1CLB A;  1KFU S;  2NCP A;  1GGZ A;  1R6P A;  2BKI B;  3FS7 A;  2LP2 A;  2L4I A;  4XJK B;  1NCX A;  1ZOT B;  2JT0 A;  2JQ6 A;  1SW8 A;  4GFT A;  5D7F A;  1NWD A;  2JTT A;  3LK0 A;  1QAS A;  1NX0 A;  1J7Q A;  4R1E A;  4A4B A;  1RFJ A;  3SIA A;  1MUX A;  2LP3 A;  3EKH A;  3JTD C;  1YRT B;  3TUY B;  3DD4 A;  1RTP 1;  5AER A;  2GGZ A;  1TCO B;  1CLM A;  4CPV A;  1A75 B;  1CDP A;  1LXF C;  1A03 A;  3BUW B;  3HX4 A;  5I8N A;  1QLK A;  2JWW A;  3LK1 A;  1YR5 A;  2KBI A;  2L98 A;  1TNP A;  2LE9 B;  1KQM C;  4MRY A;  4HSZ A;  3WXA A;  4M2P A;  5KU1 A;  3DVE A;  1J7P A;  2JZI A;  1F4O A;  1S5G Z;  2FJU B;  1G33 A;  3MSE B;  3RLZ A;  1JSA A;  3O4Y A;  2ZNE A;  4CID A;  1OMR A;  3BOW B;  1DJZ A;  1U5I A;  2LUC A;  1OMD A;  1S6J A;  1OMV A;  1XFV O;  3KO0 A;  1UHI A;  2KGR A;  4GNK B;  2WND A;  1AUI B;  1EL4 A;  3EK8 A;  3PSR A;  5CPV A;  2LHI A;  4WRI A;  2M9G A;  3I5I C;  1QS7 A;  3O78 A;  2OPO A;  1XFU O;  4YGD B;  1IWQ A;  5F6T A;  1V1G A;  1KFX L;  2ISD A;  1BG1 A;  2AUC A;  4NQG A;  1UP5 A;  1PUL A;  3A4U B;  3JTD B;  4ICB A;  2FCE A;  3AKB A;  3SG3 A;  3F45 A;  1IRJ A;  1A4P A;  2ZN9 A;  1BLQ A;  1TTX A;  4I5K A;  4M2Q A;  4N1G A;  1DMO A;  3EVV A;  1LIN A;  2PVB A;  3EVU A;  3H4S E;  4MEW A;  1OSA A;  2KI4 C;  1B9A A;  1ZFS A;  3TDZ A;  1EJ3 A;  1C7W A;  2LMU A;  1QX2 A;  2ZN8 A;  1QXP A;  2KAX A;  4USL A;  1W7I B;  2K7D A;  2Q91 A;  1VRK A;  2CNP A;  2RGI A;  5HLO A;  1NUB A;  1S1E A;  1XFX O;  2IS9 A;  2AAO A;  4D1E A;  1K2H A;  1N0Y A;  3SG4 A;  3DVK A;  1DGV A;  1U5I B;  2I2R E;  1Y0V H;  1DJX A;  4AQJ A;  4DS7 A;  1UHJ A;  2L2E A;  1KK8 C;  4ORA B;  4DUQ A;  2LLT A;  2F2P A;  3I5I B;  1X02 A;  1IQ3 A;  1LA3 A;  1CNP A;  1TNQ A;  2WCB A;  2O5G A;  1QAT A;  1CFC A;  2KBM A;  1YUU A;  1MXE A;  1FF1 A;  4HRG A;  2PMY A;  1UHN A;  2KFG A;  2OTG C;  2Y1M A;  3GK1 A;  2BCA A;  2JT8 A;  1NCY A;  3TS5 C;  1M39 A;  1DJH A;  1JWD A;  2EC6 C;  2JXL A;  4DIR A;  3I5H C;  1GGW A;  1J55 A;  2KI4 B;  2K7C A;  3I5G C;  2QPT A;  3OB1 B;  4JQ0 D;  1S3P A;  5DKQ A;  4PDZ A;  2G2B A;  2O60 A;  1BU3 A;  1EG4 A;  1PVB A;  2VRG A;  2PAS A;  1AHR A;  4YBH B;  2K61 A;  1XYD A;  3OX6 A;  1K8U A;  1K95 A;  1SR6 C;  1NX3 A;  1GQM A;  2WC8 A;  4I5J A;  4MZL A;  2H2K A;  2LAP A;  2OS8 C;  1BR1 B;  1KK8 B;  2KYC A;  1AP4 A;  2K7O A;  1IKU A;  2CTN A;  2KYF A;  2R2I A;  5CSN A;  1REC A;  4C0J A;  1HQV A;  1B8L A;  3BUN B;  2D8N A;  1EH2 A;  5G08 A;  1F4Q A;  1WRZ A;  1MHO A;  5K89 A;  1PRW A;  2L5X B;  2LLU A;  3I5F C;  3PAT A;  4GGF A;  4GGF C;  2F3Y A;  2OTG B;  4HRE E;  4AOM A;  4OVN F;  5AXI A;  1BOD A;  3AKA A;  4ORC B;  4OV2 A;  3TS5 B;  1BR4 B;  1NPQ A;  1QJT A;  2EC6 B;  2FOT A;  2LM5 A;  3I5H B;  1V1F A;  4GGN A;  1FPW A;  1NCZ A;  1SPY A;  1WDC C;  1H8B A;  3I5G B;  4MBE A;  1YVH A;  2JPT A;  1G8I A;  2M3W A;  1QVI Y;  1F55 A;  1IG5 A;  2JTZ A;  1IH0 A;  2CBL A;  3NSI A;  1FI6 A;  1YRU B;  1XVJ A;  2L50 A;  1RWY A;  3D0Y A;  5BPJ A;  1Y1A A;  4WQ3 A;  2BKH B;  2NXQ A;  4GPL B;  1SR6 B;  2M1U A;  2OS8 B;  1M31 A;  1YUT A;  1UHH A;  1LA0 A;  1S6I A;  3DVM A;  3EKJ A;  3IQQ A;  1QV1 A;  3K21 A;  4PE7 A;  4PCW A;  1CTR A;  3WHU B;  5I2O A;  2ZRS A;  4E68 A;  3FIA A;  1JC2 A;  2ZRT A;  3I5F B;  2LMV A;  2K8M B;  2KI6 D;  1N2D A;  1CFD A;  1H4B A;  1CDL A;  4FTG A;  3LCP C;  1PVA A;  2LV7 A;  1WRL A;  1S26 D;  4MRX A;  2M7L A;  1WDC B;  1B47 A;  4C0L A;  3E3R A;  3IF7 A;  3PLF B;  1QTX A;  3RM1 A;  5D69 A;  2PRU A;  2BBN A;  3NSL A;  4HRH A;  5ER4 X;  1NP8 A;  3NXA A;  3D0Y B;  3ICB A;  4U8D A;  3BQ3 A;  4QJ5 B;  1IGV A;  3BXK A;  1BF5 A;  3CLN A;  2I7A A;  2F8P A;  1SYM A;  1Y6W A;  2JC2 A;  1RRO A;  1PAL A;  4I5N B;  1BOC A;  1OZS A;  1SNL A;  2MAZ A;  2GGM A;  2LC5 A;  4N1F A;  3TZ1 A;  1FBV A;  1J1D A;  1OZO A;  1UUS A;  4M2O A;  1K96 A;  2WOS A;  3DVJ A;  3PAL A;  4MZK A;  5ER5 A;  2WCE A;  2JRF A;  3CTN A;  4GUK A;  5JOL A;  2SAS A;  1YUS A;  2KNE A;  4BY5 A;  1CM1 A;  3NSO A;  4AQI A;  1LVC D;  1PSR A;  2DOQ A;  2KQ6 A;  4I5L B;  4MSP A;  4P5O E;  3GOF A;  1S6C A;  4YI8 A;  2LLS A;  4PHJ A;  2TN4 A;  3SG7 A;  1Q80 A;  3M0W A;  2EGD A;  1KFX S;  3CGA A;  4JPZ B;  3PFV A;  2CXJ A;  2HPS A;  1FW4 A;  1SCM C;  1KWO C;  1DT7 B;  2K7B A;  2JNF A;  2MLF C;  3LLE A;  1MR8 A;  3VRP A;  1K93 D;  1NSH A;  1KQV A;  1J7R A;  1NX1 A;  3CZT X;  3D10 A;  3SIB A;  2B1U A;  1ZUZ A;  1Y1X A;  1Y1U A;  2L4H A;  4NDC A;  2CCM A;  1GJY A;  1UWO A;  2BE6 A;  4OKH A;  1K9P A;  2Y5I A;  1DTL A;  1DF0 A;  3KF9 A;  1CDN A;  2JXC A;  5HLV A;  4MLW A;  1OE9 B;  1JF2 A;  1DJW A;  1KSO A;  1AK8 A;  4CFQ A;  1JUO A;  3GK2 A;  2P6B B;  5GQQ C;  2LVJ A;  1TIZ A;  1TRF A;  1F8H A;  3TDI A;  4BY4 A;  2H61 A;  1PK0 D;  2H61 C;  2LVI A;  3IQO A;  3SG6 A;  1EXR A;  4MVF A;  2JOJ A;  1B7T Y;  2MJW B;  1M45 A;  3CR4 X;  1BMO A;  1QVI Z;  1F54 A;  2HET A;  3BYA A;  4N5X A;  1YX8 A;  2KHN A;  1SCM B;  1R2U A;  1KWO B;  2MA2 A;  5CSJ A;  1SMG A;  3BUM B;  1KFU L;  3A8R A;  3PN7 C;  3ZNI A;  1YTZ C;  4CLN A;  2CT9 A;  4PHN A;  5AEQ A;  1QLS A;  2LVV A;  2SCP A;  3WNX B;  2KSP A;  3GK4 X;  1SBJ A;  5DKN A;  1QIV A;  4QJ4 B;  3EK7 A;  1NYA A;  1DF0 B;  4ZCU A;  2COL B;  2E30 A;  1IQ5 A;  1YVL A;  3LL8 B;  3CR5 X;  2PSR A;  1NIW A;  2F3Z A;  1QIW A;  1J7O A;  5IBW A;  1B1G A;  2ZND A;  2E6W A;  3HCM A;  1YUR A;  3DF0 A;  5AAN A;  4YGA A;  2NZ0 A;  1SKT A;  3OHM B;  4JWQ A;  3WHT B;  2L51 A;  2WCF A;  5PAL A;  3VRQ A;  2BCB A;  1SRA A;  1C07 A;  1ZAC A;  3PN7 B;  1XFY O;  3KHE A;  1AJ5 A;  1KK7 Y;  3CWG A;  4PE1 A;  4YGB B;  2M29 A;  2JU0 A;  1OOJ A;  1TOP A;  1OQP A;  1JBA A;  3QRX A;  5KSZ A;  1MQ1 A;  5HKZ A;  1IJ6 A;  2FCD A;  2K2A A;  4ZCV A;  2M7N A;  1QX5 B;  3BUO B;  1J1E A;  1DJI A;  1CLL A;  1CDM A;  2KQY A;  5HYD A;  1SL7 A;  2KOT A;  4P2Y B;  3OB2 B;  4PHM A;  3CS1 A;  4WQ2 A;  1WRK A;  2NLN A;  4PE0 A;  3DF0 B;  1D1O A;  3O6B A;  2AMI A;  3BUX B;  3CR2 A;  2LHL A;  1F71 A;  5DKR A;  1W7J B;  3C1V A;  4XYN A;  1NX2 A;  1B8C A;  1M63 B;  3SJS A;  2BBM A;  4DCK A;  1QX7 A;  2V53 A;  2PAL A;  3JVT C;  1K9U A;  2KAY A;  1XA5 A;  2MHH A;  4PHK A;  1S5G Y;  2F33 A;  3KPX A;  2L0P A;  4UPG A;  2I94 A;  3FWB A;  1YX7 A;  2QAC A;  3O2P A;  2NCO A;  1BT6 A;  2HQW A;  4PAL A;  2JNX A;  3VGO A;  4ORB B;  1L2O C;  2M97 A;  4ETO A;  4GBA A;  3TDU A;  3EK4 A;  1KQM B;  4NDB A;  1UHK A;  1CFP A;  1CB1 A;  3OX5 A;  2M8U A;  1DJG A;  4YGC B;  4QJ3 B;  1FI5 A;  1KCY A;  1AVS A;  2BCX A;  1AJ4 A;  1CM4 A;  1K9K A;  1MXL C;  2WOR A;  4TNC A;  4Q04 A;  4FQO A;  4OCI A;  1SK6 D;  2K0J A;  2K2F A;  2LMT A;  1WLM A;  4YGE B;  1XFW O;  1SCV A;  1MWN A;  5CSF A;  1JFK A;  1N65 A;  1B7T Z;  4YI9 A;  3VRO A;  3FWC A;  1JF0 A;  5HKW A;  5I2L A;  3JVT B;  2HQ8 A;  1K94 A;  1M46 A;  2BE4 A;  3SG2 A;  3PM8 A;  2KFF A;  4IL1 A;  2ZFD A;  3OP0 A;  4MN0 A;  2KI6 C;  1ODB A;  2JT3 A;  1TN4 A;  1JFJ A;  4A4C A;  2M49 B;  1XFZ O;  1ALW A;  2LUX A;  1IJ5 A;  1LKJ A;  2I18 A;  2GV5 A;  2KAV A;  1L2O B;  2BL0 C;  1B4C A;  2F2O A;  2LNK A;  5CSI A;  4YRU A;  1L7Z A;  1CMG A;  1A2X A;  1RJV A;  2KDH A;  2Y1N A;  2MLE C;  4F0Z B;  2Q4U A;  2JUL A; 
#chains in the Genus database with same CATH topology
 4OR9 B;  2M1K B;  1CMF A;  1PSB A;  5KTY A;  2YGU A;  1A29 A;  1MF8 B;  5TNC A;  1E8A A;  4MZJ A;  1BJF A;  3NSK A;  4XJK A;  3AAJ A;  3SG5 A;  1DGU A;  3AAK A;  2LVK A;  1XO5 A;  1C7V A;  5JJG A;  1ORG A;  1HT9 A;  2LAN A;  1ALV A;  1WLZ A;  2MRD A;  4DRW A;  3D77 A;  3EVR A;  5J3X A;  4NDD A;  3TUY C;  1S36 A;  1EG3 A;  1K90 D;  1XK4 A;  1QV0 A;  1G4Y R;  2EHB A;  1XK4 C;  2HF5 A;  3B88 A;  2LCP A;  4L9M A;  4YGE B;  3VRN A;  1DVI A;  2KFH A;  5I2Q A;  1A75 A;  2Y4Q A;  2G9B A;  1SL9 A;  1CFF A;  1B8R A;  1CKK A;  5FI6 A;  4GAO A;  5FYX A;  1SY9 A;  3VRR A;  1KK7 Z;  4C0K A;  2ZKM X;  3KEV A;  3S0G A;  1WY9 A;  1SL8 A;  1TNW A;  1RK9 A;  1UUR A;  2WCK A;  3BFA A;  1C3Y A;  2WCM A;  4PE4 A;  2BEC A;  1TNX A;  1F70 A;  2BL0 B;  5HKY A;  5B8I B;  2M0R A;  2MBX A;  3ZWH A;  2A4J A;  1ZMZ A;  1TCF A;  3BOW A;  1KSM A;  4CFR A;  2KGB C;  5AFP A;  1DJY A;  1CLB A;  5FI7 A;  4JD9 A;  1KFU S;  2NCP A;  1GGZ A;  1R6P A;  2BKI B;  3FS7 A;  2LP2 A;  2L4I A;  4XJK B;  1NCX A;  1ZOT B;  2JT0 A;  5I94 A;  2JQ6 A;  1SW8 A;  4GFT A;  5D7F A;  1NWD A;  2JTT A;  3LK0 A;  1QAS A;  1NX0 A;  1J7Q A;  4R1E A;  4A4B A;  1RFJ A;  4PT1 A;  3SIA A;  1MUX A;  2LP3 A;  3EKH A;  3JTD C;  1YRT B;  3TUY B;  3DD4 A;  1RTP 1;  5AER A;  2GGZ A;  1TCO B;  2P70 A;  1CLM A;  4CPV A;  1A75 B;  1CDP A;  1LXF C;  1A03 A;  3BUW B;  3HX4 A;  1Z4H A;  5I8N A;  1QLK A;  2JWW A;  3LK1 A;  1YR5 A;  2KBI A;  2L98 A;  1TNP A;  2LE9 B;  1KQM C;  4MRY A;  4HSZ A;  3WXA A;  4M2P A;  5KU1 A;  3DVE A;  3L4L A;  2JZI A;  1J7P A;  1F4O A;  1S5G Z;  2FJU B;  1G33 A;  1C3Z A;  3MSE B;  3RLZ A;  1JSA A;  3O4Y A;  2BAP A;  2ZNE A;  4CID A;  1OMR A;  3BOW B;  1DJZ A;  1U5I A;  2LUC A;  1OMD A;  1S6J A;  1OMV A;  1XFV O;  3KO0 A;  1UHI A;  2KGR A;  4GNK B;  2WND A;  1AUI B;  1EL4 A;  3EK8 A;  3PSR A;  3CZ2 A;  2LHI A;  4WRI A;  5CPV A;  2M9G A;  3I5I C;  1QS7 A;  3O78 A;  2OPO A;  1XFU O;  4YGD B;  1IWQ A;  5F6T A;  1V1G A;  1KFX L;  2ISD A;  4INW A;  2AUC A;  4NQG A;  1BG1 A;  1UP5 A;  1PUL A;  3A4U B;  3JTD B;  3L47 A;  2FCE A;  3AKB A;  4ICB A;  1SSE B;  3F45 A;  4INX A;  3SG3 A;  1IRJ A;  1A4P A;  2ZN9 A;  1BLQ A;  1TTX A;  4I5K A;  4M2Q A;  4N1G A;  1DMO A;  3S0A A;  3EVV A;  1LIN A;  2PVB A;  3EVU A;  3H4S E;  4MEW A;  1OSA A;  2KI4 C;  1QWV A;  1B9A A;  1ZFS A;  3TDZ A;  1EJ3 A;  1C7W A;  2LMU A;  1QX2 A;  2ZN8 A;  1QXP A;  4IJ7 A;  2KAX A;  4USL A;  1P28 A;  1W7I B;  2K7D A;  2Q91 A;  1VRK A;  2CNP A;  2RGI A;  5HLO A;  3S0B A;  1NUB A;  1S1E A;  2KLD A;  1XFX O;  2IS9 A;  3FE6 A;  3PM2 A;  2AAO A;  4D1E A;  1K2H A;  1N0Y A;  3SG4 A;  3DVK A;  1DGV A;  1U5I B;  2I2R E;  1Y0V H;  1DJX A;  4AQJ A;  4DS7 A;  1UHJ A;  2L2E A;  1KK8 C;  1TUJ A;  4ORA B;  4DUQ A;  2LLT A;  2F2P A;  3I5I B;  1X02 A;  1IQ3 A;  4OKH A;  1LA3 A;  1CNP A;  1TNQ A;  2WCB A;  2O5G A;  1QAT A;  1CFC A;  2KBM A;  1YUU A;  1MXE A;  1FF1 A;  4HRG A;  2PMY A;  1UHN A;  2KFG A;  2OTG C;  1Z2C B;  2Y1M A;  3GK1 A;  2BCA A;  2JT8 A;  1NCY A;  3TS5 C;  1M39 A;  1DJH A;  3L4A A;  1JWD A;  2EC6 C;  2JXL A;  4DIR A;  3I5H C;  1GGW A;  1J55 A;  2KI4 B;  2K7C A;  3I5G C;  2QPT A;  5D3O A;  2KLE A;  3OB1 B;  4JQ0 D;  1S3P A;  5DKQ A;  4PDZ A;  2G2B A;  2O60 A;  1BU3 A;  1EG4 A;  1PVB A;  2QDI A;  2PAS A;  2VRG A;  2WCJ A;  5HL1 A;  1AHR A;  4YBH B;  2K61 A;  3DZT A;  1XYD A;  3OX6 A;  1K8U A;  3DYE A;  1K95 A;  1SR6 C;  1NX3 A;  1GQM A;  2WC8 A;  4I5J A;  4MZL A;  2H2K A;  2LAP A;  2OS8 C;  1BR1 B;  1KK8 B;  2KYC A;  1AP4 A;  2K7O A;  3BFB A;  3FE9 A;  1IKU A;  2CTN A;  2KYF A;  2R2I A;  5CSN A;  1REC A;  4C0J A;  1HQV A;  1B8L A;  3BUN B;  2D8N A;  1EH2 A;  5G08 A;  1F4Q A;  1WRZ A;  2BNX A;  1MHO A;  5K89 A;  1PRW A;  2L5X B;  2LLU A;  3I5F C;  3PAT A;  4GGF A;  4GGF C;  2F3Y A;  2OTG B;  4HRE E;  4AOM A;  3NGV A;  4OVN F;  5AXI A;  1BOD A;  3AKA A;  4ORC B;  4OV2 A;  3TS5 B;  1BR4 B;  1NPQ A;  3D75 A;  1QJT A;  2EC6 B;  2FOT A;  2LM5 A;  3I5H B;  1V1F A;  4GGN A;  1FPW A;  1NCZ A;  1SPY A;  1WDC C;  1IIO A;  1H8B A;  3I5G B;  4MBE A;  1YVH A;  2JPT A;  3D76 A;  1OOF A;  1G8I A;  3S0D A;  2WCL A;  1OOG A;  2M3W A;  1QVI Y;  1F55 A;  1IG5 A;  2JTZ A;  1IH0 A;  2CBL A;  3NSI A;  1FI6 A;  1YRU B;  1XVJ A;  2L50 A;  1RWY A;  3D0Y A;  5BPJ A;  1Y1A A;  4WQ3 A;  2BKH B;  2NXQ A;  3CYZ A;  4GPL B;  1SR6 B;  2M1U A;  3OBV A;  2OS8 B;  1M31 A;  1YUT A;  1UHH A;  3NHI A;  1LA0 A;  1S6I A;  3DVM A;  3EKJ A;  3IQQ A;  1QV1 A;  3K21 A;  4PE7 A;  4PCW A;  1CTR A;  3WHU B;  5I2O A;  2ZRS A;  4E68 A;  3FIA A;  1JC2 A;  2ZRT A;  3I5F B;  2LMV A;  2K8M B;  2KI6 D;  1N2D A;  1CFD A;  1H4B A;  3N7H A;  1XFR A;  1CDL A;  4FTG A;  3LCP C;  1PVA A;  2LV7 A;  1WRL A;  1S26 D;  4MRX A;  2M7L A;  1WDC B;  1B47 A;  4C0L A;  3E3R A;  3IF7 A;  3PLF B;  1QTX A;  3RM1 A;  5D69 A;  2PRU A;  2BBN A;  3NSL A;  4HRH A;  5ER4 X;  1NP8 A;  3NXA A;  3D0Y B;  3B86 A;  2WC6 A;  3ICB A;  4U8D A;  3BQ3 A;  2WC5 A;  4QJ5 B;  3D74 A;  1IGV A;  3BXK A;  1BF5 A;  3CLN A;  3D73 A;  2I7A A;  2F8P A;  1SYM A;  1LS8 A;  1Y6W A;  2JC2 A;  1RRO A;  4KYN A;  1PAL A;  2QEO A;  4I5N B;  2K60 A;  2L2C A;  1BOC A;  1OZS A;  1SNL A;  2L5Y A;  2MAZ A;  2GGM A;  2LC5 A;  4N1F A;  3TZ1 A;  1FBV A;  1J1D A;  1OZO A;  1UUS A;  1DC1 A;  4M2O A;  1K96 A;  2WOS A;  3DVJ A;  3PAL A;  4MZK A;  5ER5 A;  2WCE A;  2JRF A;  3CTN A;  4GUK A;  5JOL A;  2SAS A;  1YUS A;  2KNE A;  4BY5 A;  1CM1 A;  3CDN A;  3NSO A;  4AQI A;  1DEL A;  1LVC D;  1PSR A;  2DOQ A;  2KQ6 A;  4I5L B;  4MSP A;  5EL2 A;  4P5O E;  3GOF A;  1S6C A;  4YI8 A;  2LLS A;  4PHJ A;  2TN4 A;  3SG7 A;  1Q80 A;  3M0W A;  2EGD A;  1KFX S;  3CGA A;  4JPZ B;  3R72 A;  1GM0 A;  3FE8 A;  3PFV A;  2CXJ A;  2HPS A;  1FW4 A;  1SCM C;  1DQE A;  1KWO C;  1DT7 B;  2K7B A;  2JNF A;  1DEK A;  2MLF C;  3LLE A;  1MR8 A;  3VRP A;  1K93 D;  1NSH A;  1KQV A;  1J7R A;  1NX1 A;  3V2L A;  3CZT X;  3D10 A;  3SIB A;  2B1U A;  1ZUZ A;  1Y1X A;  1Y1U A;  2ERB A;  2L4H A;  2CCM A;  1GJY A;  1UWO A;  2BE6 A;  3Q8I A;  4NDC A;  4OZD A;  1K9P A;  3O4X A;  2Y5I A;  1DTL A;  1DF0 A;  3BFH A;  3KF9 A;  1CDN A;  2JXC A;  5HLV A;  4MLW A;  1OE9 B;  1JF2 A;  1DJW A;  1KSO A;  1AK8 A;  4CFQ A;  1JUO A;  2PYQ A;  3GK2 A;  2P6B B;  5DIC A;  2LVJ A;  5GQQ C;  1TIZ A;  1TRF A;  1F8H A;  3TDI A;  4BY4 A;  2H61 A;  3K1E A;  1PK0 D;  2H61 C;  2LVI A;  3IQO A;  1OOH A;  3SG6 A;  1EXR A;  4MVF A;  2JOJ A;  1B7T Y;  2MJW B;  1M45 A;  2H8V A;  3CR4 X;  3B87 A;  1BMO A;  1QVI Z;  1F54 A;  2HET A;  3BJH A;  3BYA A;  4N5X A;  1YX8 A;  2QEV A;  3B6X A;  2KHN A;  1SCM B;  1R2U A;  1KWO B;  2MA2 A;  5CSJ A;  1SMG A;  3BUM B;  1KFU L;  3A8R A;  3PN7 C;  3ZNI A;  3DXL A;  1YTZ C;  4CLN A;  2CT9 A;  4PHN A;  3PJI A;  5AEQ A;  1QLS A;  2LVV A;  2SCP A;  3SS3 A;  2KSP A;  3GK4 X;  3S0E A;  3WNX B;  1SBJ A;  5DKN A;  1QIV A;  1TUZ A;  4QJ4 B;  3R1P A;  3EK7 A;  1NYA A;  3B7A A;  1DF0 B;  4ZCU A;  2COL B;  2E30 A;  1IQ5 A;  1YVL A;  3LL8 B;  3CR5 X;  2PSR A;  1NIW A;  2F3Z A;  1QIW A;  1J7O A;  5IBW A;  1B1G A;  2ZND A;  2E6W A;  3SS5 A;  3HCM A;  1YUR A;  3DF0 A;  5AAN A;  2QEH A;  4YGA A;  2NZ0 A;  1SKT A;  2P71 A;  3OHM B;  4JWQ A;  3WHT B;  2L51 A;  2WCF A;  5PAL A;  3VRQ A;  2BCB A;  1SRA A;  1C07 A;  1ZAC A;  3PN7 B;  1XFY O;  3KHE A;  1AJ5 A;  3VB1 A;  3R1V A;  1KK7 Y;  3CWG A;  4PE1 A;  4YGB B;  2M29 A;  3NHT A;  2JU0 A;  1OOJ A;  1TOP A;  1OQP A;  1JBA A;  3QRX A;  5KSZ A;  1MQ1 A;  5HKZ A;  3CAB A;  1IJ6 A;  2FCD A;  2K2A A;  4ZCV A;  2M7N A;  1QX5 B;  3BUO B;  1J1E A;  1DJI A;  1CLL A;  1CDM A;  2KQY A;  5HYD A;  1SL7 A;  2KOT A;  4FQT A;  4P2Y B;  3OB2 B;  4PHM A;  3CS1 A;  4WQ2 A;  1WRK A;  2NLN A;  4PE0 A;  3DF0 B;  1D1O A;  3D78 A;  3O6B A;  2AMI A;  2KPH A;  3BUX B;  3CR2 A;  2LHL A;  4JKT A;  1F71 A;  3CZ0 A;  5DKR A;  1W7J B;  3C1V A;  4XYN A;  2PQL A;  1NX2 A;  1B8C A;  1M63 B;  3SJS A;  1W9Z A;  2BBM A;  4DCK A;  1QX7 A;  2V53 A;  2PAL A;  3CZ1 A;  3JVT C;  3SS4 A;  1K9U A;  1TWO A;  2KAY A;  1XA5 A;  2MHH A;  4PHK A;  1S5G Y;  2F33 A;  3KPX A;  2L0P A;  4UPG A;  2I94 A;  3FWB A;  1YX7 A;  3UNW A;  2JPO A;  2QAC A;  3O2P A;  2NCO A;  1BT6 A;  2HQW A;  4PAL A;  2JNX A;  3VGO A;  4ORB B;  1L2O C;  2M97 A;  4ETO A;  4GBA A;  3TDU A;  3EK4 A;  1KQM B;  4NDB A;  1UHK A;  1CFP A;  1CB1 A;  3OX5 A;  3R1O A;  2M8U A;  1DJG A;  4YGC B;  4QJ3 B;  1FI5 A;  1KCY A;  1AVS A;  2BCX A;  1AJ4 A;  1CM4 A;  1K9K A;  1MXL C;  2WOR A;  4F7F A;  4TNC A;  4Q04 A;  2QEB A;  4FQO A;  4OCI A;  1SK6 D;  2K0J A;  2K2F A;  3UO9 A;  2FJY A;  1WLM A;  2LMT A;  1XFW O;  1SCV A;  1MWN A;  3QME A;  1JFK A;  1N65 A;  1B7T Z;  3OGN A;  5CSF A;  4YI9 A;  3VRO A;  1OW4 A;  3FWC A;  1JF0 A;  3DY9 A;  5HKW A;  3RZS A;  5I2L A;  3JVT B;  2HQ8 A;  1K94 A;  1M46 A;  2BE4 A;  3SG2 A;  2WCH A;  2KFF A;  1T14 A;  3PM8 A;  4IL1 A;  2ZFD A;  3OP0 A;  4MN0 A;  2KI6 C;  1OOI X;  1ODB A;  2JT3 A;  1TN4 A;  3S0F A;  4A4C A;  1JFJ A;  2M49 B;  1XFZ O;  1ALW A;  2LUX A;  1IJ5 A;  1LKJ A;  2I18 A;  5FI2 A;  3IVT A;  2GV5 A;  2KAV A;  1L2O B;  2BL0 C;  1B4C A;  2F2O A;  2LNK A;  5CSI A;  4YRU A;  1L7Z A;  1CMG A;  1A2X A;  1RJV A;  2KDH A;  3EG5 B;  2GTE A;  2Y1N A;  2MLE C;  4F0Z B;  2Q4U A;  2JUL A; 
#chains in the Genus database with same CATH homology
 4OR9 B;  2M1K B;  1CMF A;  1PSB A;  5KTY A;  1A29 A;  1MF8 B;  5TNC A;  1E8A A;  4MZJ A;  1BJF A;  3NSK A;  4XJK A;  3AAJ A;  3SG5 A;  1DGU A;  3AAK A;  2LVK A;  1XO5 A;  1C7V A;  5JJG A;  1HT9 A;  2LAN A;  1ALV A;  1WLZ A;  2MRD A;  4DRW A;  3EVR A;  5J3X A;  4NDD A;  3TUY C;  1S36 A;  1EG3 A;  1K90 D;  1XK4 A;  1QV0 A;  1G4Y R;  2EHB A;  1XK4 C;  2HF5 A;  3KEV A;  2LCP A;  4L9M A;  3VRN A;  1DVI A;  2KFH A;  5I2Q A;  1A75 A;  2Y4Q A;  2G9B A;  1SL9 A;  1CFF A;  1B8R A;  1CKK A;  4GAO A;  5FYX A;  1SY9 A;  3VRR A;  1KK7 Z;  4C0K A;  2ZKM X;  1WY9 A;  1SL8 A;  1TNW A;  1RK9 A;  1UUR A;  4PE4 A;  2BEC A;  1TNX A;  1F70 A;  2BL0 B;  5HKY A;  5B8I B;  2M0R A;  2MBX A;  3ZWH A;  2A4J A;  1ZMZ A;  1TCF A;  3BOW A;  1KSM A;  4CFR A;  2KGB C;  5AFP A;  1DJY A;  1CLB A;  1KFU S;  2NCP A;  1GGZ A;  1R6P A;  2BKI B;  3FS7 A;  2LP2 A;  2L4I A;  4XJK B;  1NCX A;  1ZOT B;  2JT0 A;  2JQ6 A;  1SW8 A;  4GFT A;  5D7F A;  1NWD A;  2JTT A;  3LK0 A;  1QAS A;  1NX0 A;  1J7Q A;  4R1E A;  4A4B A;  1RFJ A;  3SIA A;  1MUX A;  2LP3 A;  3EKH A;  3JTD C;  1YRT B;  3TUY B;  3DD4 A;  1RTP 1;  5AER A;  2GGZ A;  1TCO B;  1CLM A;  4CPV A;  1A75 B;  1CDP A;  1LXF C;  1A03 A;  3BUW B;  3HX4 A;  5I8N A;  1QLK A;  2JWW A;  3LK1 A;  1YR5 A;  2KBI A;  2L98 A;  1TNP A;  2LE9 B;  1KQM C;  4MRY A;  4HSZ A;  3WXA A;  4M2P A;  5KU1 A;  3DVE A;  1J7P A;  2JZI A;  1F4O A;  1S5G Z;  2FJU B;  1G33 A;  3MSE B;  3RLZ A;  1JSA A;  3O4Y A;  2ZNE A;  4CID A;  1OMR A;  3BOW B;  1DJZ A;  1U5I A;  2LUC A;  1OMD A;  1S6J A;  1OMV A;  1XFV O;  3KO0 A;  1UHI A;  2KGR A;  4GNK B;  2WND A;  1AUI B;  1EL4 A;  3EK8 A;  3PSR A;  5CPV A;  2LHI A;  4WRI A;  2M9G A;  3I5I C;  1QS7 A;  3O78 A;  2OPO A;  1XFU O;  4YGD B;  1IWQ A;  5F6T A;  1V1G A;  1KFX L;  2ISD A;  1BG1 A;  2AUC A;  4NQG A;  1UP5 A;  1PUL A;  3A4U B;  3JTD B;  4ICB A;  2FCE A;  3AKB A;  3SG3 A;  3F45 A;  1IRJ A;  1A4P A;  2ZN9 A;  1BLQ A;  1TTX A;  4I5K A;  4M2Q A;  4N1G A;  1DMO A;  3EVV A;  1LIN A;  2PVB A;  3EVU A;  3H4S E;  4MEW A;  1OSA A;  2KI4 C;  1B9A A;  1ZFS A;  3TDZ A;  1EJ3 A;  1C7W A;  2LMU A;  1QX2 A;  2ZN8 A;  1QXP A;  2KAX A;  4USL A;  1W7I B;  2K7D A;  2Q91 A;  1VRK A;  2CNP A;  2RGI A;  5HLO A;  1NUB A;  1S1E A;  1XFX O;  2IS9 A;  2AAO A;  4D1E A;  1K2H A;  1N0Y A;  3SG4 A;  3DVK A;  1DGV A;  1U5I B;  2I2R E;  1Y0V H;  1DJX A;  4AQJ A;  4DS7 A;  1UHJ A;  2L2E A;  1KK8 C;  4ORA B;  4DUQ A;  2LLT A;  2F2P A;  3I5I B;  1X02 A;  1IQ3 A;  1LA3 A;  1CNP A;  1TNQ A;  2WCB A;  2O5G A;  1QAT A;  1CFC A;  2KBM A;  1YUU A;  1MXE A;  1FF1 A;  4HRG A;  2PMY A;  1UHN A;  2KFG A;  2OTG C;  2Y1M A;  3GK1 A;  2BCA A;  2JT8 A;  1NCY A;  3TS5 C;  1M39 A;  1DJH A;  1JWD A;  2EC6 C;  2JXL A;  4DIR A;  3I5H C;  1GGW A;  1J55 A;  2KI4 B;  2K7C A;  3I5G C;  2QPT A;  3OB1 B;  4JQ0 D;  1S3P A;  5DKQ A;  4PDZ A;  2G2B A;  2O60 A;  1BU3 A;  1EG4 A;  1PVB A;  2VRG A;  2PAS A;  1AHR A;  4YBH B;  2K61 A;  1XYD A;  3OX6 A;  1K8U A;  1K95 A;  1SR6 C;  1NX3 A;  1GQM A;  2WC8 A;  4I5J A;  4MZL A;  2H2K A;  2LAP A;  2OS8 C;  1BR1 B;  1KK8 B;  2KYC A;  1AP4 A;  2K7O A;  1IKU A;  2CTN A;  2KYF A;  2R2I A;  5CSN A;  1REC A;  4C0J A;  1HQV A;  1B8L A;  3BUN B;  2D8N A;  1EH2 A;  5G08 A;  1F4Q A;  1WRZ A;  1MHO A;  5K89 A;  1PRW A;  2L5X B;  2LLU A;  3I5F C;  3PAT A;  4GGF A;  4GGF C;  2F3Y A;  2OTG B;  4HRE E;  4AOM A;  4OVN F;  5AXI A;  1BOD A;  3AKA A;  4ORC B;  4OV2 A;  3TS5 B;  1BR4 B;  1NPQ A;  1QJT A;  2EC6 B;  2FOT A;  2LM5 A;  3I5H B;  1V1F A;  4GGN A;  1FPW A;  1NCZ A;  1SPY A;  1WDC C;  1H8B A;  3I5G B;  4MBE A;  1YVH A;  2JPT A;  1G8I A;  2M3W A;  1QVI Y;  1F55 A;  1IG5 A;  2JTZ A;  1IH0 A;  2CBL A;  3NSI A;  1FI6 A;  1YRU B;  1XVJ A;  2L50 A;  1RWY A;  3D0Y A;  5BPJ A;  1Y1A A;  4WQ3 A;  2BKH B;  2NXQ A;  4GPL B;  1SR6 B;  2M1U A;  2OS8 B;  1M31 A;  1YUT A;  1UHH A;  1LA0 A;  1S6I A;  3DVM A;  3EKJ A;  3IQQ A;  1QV1 A;  3K21 A;  4PE7 A;  4PCW A;  1CTR A;  3WHU B;  5I2O A;  2ZRS A;  4E68 A;  3FIA A;  1JC2 A;  2ZRT A;  3I5F B;  2LMV A;  2K8M B;  2KI6 D;  1N2D A;  1CFD A;  1H4B A;  1CDL A;  4FTG A;  3LCP C;  1PVA A;  2LV7 A;  1WRL A;  1S26 D;  4MRX A;  2M7L A;  1WDC B;  1B47 A;  4C0L A;  3E3R A;  3IF7 A;  3PLF B;  1QTX A;  3RM1 A;  5D69 A;  2PRU A;  2BBN A;  3NSL A;  4HRH A;  5ER4 X;  1NP8 A;  3NXA A;  3D0Y B;  3ICB A;  4U8D A;  3BQ3 A;  4QJ5 B;  1IGV A;  3BXK A;  1BF5 A;  3CLN A;  2I7A A;  2F8P A;  1SYM A;  1Y6W A;  2JC2 A;  1RRO A;  1PAL A;  4I5N B;  1BOC A;  1OZS A;  1SNL A;  2MAZ A;  2GGM A;  2LC5 A;  4N1F A;  3TZ1 A;  1FBV A;  1J1D A;  1OZO A;  1UUS A;  4M2O A;  1K96 A;  2WOS A;  3DVJ A;  3PAL A;  4MZK A;  5ER5 A;  2WCE A;  2JRF A;  3CTN A;  4GUK A;  5JOL A;  2SAS A;  1YUS A;  2KNE A;  4BY5 A;  1CM1 A;  3NSO A;  4AQI A;  1LVC D;  1PSR A;  2DOQ A;  2KQ6 A;  4I5L B;  4MSP A;  4P5O E;  3GOF A;  1S6C A;  4YI8 A;  2LLS A;  4PHJ A;  2TN4 A;  3SG7 A;  1Q80 A;  3M0W A;  2EGD A;  1KFX S;  3CGA A;  4JPZ B;  3PFV A;  2CXJ A;  2HPS A;  1FW4 A;  1SCM C;  1KWO C;  1DT7 B;  2K7B A;  2JNF A;  2MLF C;  3LLE A;  1MR8 A;  3VRP A;  1K93 D;  1NSH A;  1KQV A;  1J7R A;  1NX1 A;  3CZT X;  3D10 A;  3SIB A;  2B1U A;  1ZUZ A;  1Y1X A;  1Y1U A;  2L4H A;  4NDC A;  2CCM A;  1GJY A;  1UWO A;  2BE6 A;  4OKH A;  1K9P A;  2Y5I A;  1DTL A;  1DF0 A;  3KF9 A;  1CDN A;  2JXC A;  5HLV A;  4MLW A;  1OE9 B;  1JF2 A;  1DJW A;  1KSO A;  1AK8 A;  4CFQ A;  1JUO A;  3GK2 A;  2P6B B;  5GQQ C;  2LVJ A;  1TIZ A;  1TRF A;  1F8H A;  3TDI A;  4BY4 A;  2H61 A;  1PK0 D;  2H61 C;  2LVI A;  3IQO A;  3SG6 A;  1EXR A;  4MVF A;  2JOJ A;  1B7T Y;  2MJW B;  1M45 A;  3CR4 X;  1BMO A;  1QVI Z;  1F54 A;  2HET A;  3BYA A;  4N5X A;  1YX8 A;  2KHN A;  1SCM B;  1R2U A;  1KWO B;  2MA2 A;  5CSJ A;  1SMG A;  3BUM B;  1KFU L;  3A8R A;  3PN7 C;  3ZNI A;  1YTZ C;  4CLN A;  2CT9 A;  4PHN A;  5AEQ A;  1QLS A;  2LVV A;  2SCP A;  3WNX B;  2KSP A;  3GK4 X;  1SBJ A;  5DKN A;  1QIV A;  4QJ4 B;  3EK7 A;  1NYA A;  1DF0 B;  4ZCU A;  2COL B;  2E30 A;  1IQ5 A;  1YVL A;  3LL8 B;  3CR5 X;  2PSR A;  1NIW A;  2F3Z A;  1QIW A;  1J7O A;  5IBW A;  1B1G A;  2ZND A;  2E6W A;  3HCM A;  1YUR A;  3DF0 A;  5AAN A;  4YGA A;  2NZ0 A;  1SKT A;  3OHM B;  4JWQ A;  3WHT B;  2L51 A;  2WCF A;  5PAL A;  3VRQ A;  2BCB A;  1SRA A;  1C07 A;  1ZAC A;  3PN7 B;  1XFY O;  3KHE A;  1AJ5 A;  1KK7 Y;  3CWG A;  4PE1 A;  4YGB B;  2M29 A;  2JU0 A;  1OOJ A;  1TOP A;  1OQP A;  1JBA A;  3QRX A;  5KSZ A;  1MQ1 A;  5HKZ A;  1IJ6 A;  2FCD A;  2K2A A;  4ZCV A;  2M7N A;  1QX5 B;  3BUO B;  1J1E A;  1DJI A;  1CLL A;  1CDM A;  2KQY A;  5HYD A;  1SL7 A;  2KOT A;  4P2Y B;  3OB2 B;  4PHM A;  3CS1 A;  4WQ2 A;  1WRK A;  2NLN A;  4PE0 A;  3DF0 B;  1D1O A;  3O6B A;  2AMI A;  3BUX B;  3CR2 A;  2LHL A;  1F71 A;  5DKR A;  1W7J B;  3C1V A;  4XYN A;  1NX2 A;  1B8C A;  1M63 B;  3SJS A;  2BBM A;  4DCK A;  1QX7 A;  2V53 A;  2PAL A;  3JVT C;  1K9U A;  2KAY A;  1XA5 A;  2MHH A;  4PHK A;  1S5G Y;  2F33 A;  3KPX A;  2L0P A;  4UPG A;  2I94 A;  3FWB A;  1YX7 A;  2QAC A;  3O2P A;  2NCO A;  1BT6 A;  2HQW A;  4PAL A;  2JNX A;  3VGO A;  4ORB B;  1L2O C;  2M97 A;  4ETO A;  4GBA A;  3TDU A;  3EK4 A;  1KQM B;  4NDB A;  1UHK A;  1CFP A;  1CB1 A;  3OX5 A;  2M8U A;  1DJG A;  4YGC B;  4QJ3 B;  1FI5 A;  1KCY A;  1AVS A;  2BCX A;  1AJ4 A;  1CM4 A;  1K9K A;  1MXL C;  2WOR A;  4TNC A;  4Q04 A;  4FQO A;  4OCI A;  1SK6 D;  2K0J A;  2K2F A;  2LMT A;  1WLM A;  4YGE B;  1XFW O;  1SCV A;  1MWN A;  5CSF A;  1JFK A;  1N65 A;  1B7T Z;  4YI9 A;  3VRO A;  3FWC A;  1JF0 A;  5HKW A;  5I2L A;  3JVT B;  2HQ8 A;  1K94 A;  1M46 A;  2BE4 A;  3SG2 A;  3PM8 A;  2KFF A;  4IL1 A;  2ZFD A;  3OP0 A;  4MN0 A;  2KI6 C;  1ODB A;  2JT3 A;  1TN4 A;  1JFJ A;  4A4C A;  2M49 B;  1XFZ O;  1ALW A;  2LUX A;  1IJ5 A;  1LKJ A;  2I18 A;  2GV5 A;  2KAV A;  1L2O B;  2BL0 C;  1B4C A;  2F2O A;  2LNK A;  5CSI A;  4YRU A;  1L7Z A;  1CMG A;  1A2X A;  1RJV A;  2KDH A;  2Y1N A;  2MLE C;  4F0Z B;  2Q4U A;  2JUL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...