2LHLA

Chemical shift assignments and solution structure of human apo-s100a1 e32q mutant
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
93
structure length
93
Chain Sequence
GSELETAMETLINVFHAHSGKEGDKYKLSKKQLKELLQTELSGFLDAQKDVDAVDKVMKELDENGDGEVDFQEYVVLVAALTVACNNFFWENS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein S100-A1
publication title 1H, 13C and 15N NMR sequence-specific resonance assignments and relaxation parameters for human apo-S100A1 E32Q mutant
rcsb
source organism Homo sapiens
molecule tags Metal binding protein
total genus 20
structure length 93
sequence length 93
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2lhlA00
1DJIA 1K9UA 2PASA 2FCEA 2KDHA 4CFQA 2LANA 5ER5A 2JXCA 4GBAA 1DJWA 4CFRA 2PALA 3KEVA 1KQMB 2I94A 4WRIA 1JF0A 1UHHA 2BE6A 3D10A 2MRDA 1ZFSA 1SBJA 3I5GC 3PSRA 1CDLA 4F0ZB 1MXLC 4YGBB 1IRJA 4MRYA 4YI8A 1PVBA 1TNXA 2KFHA 1RWYA 2KQ6A 2LM5A 1QJTA 2P6BB 2MAZA 3WHTB 1BLQA 3DVEA 3MSEB 2EC6C 2M1KB 2LHLA 3VRRA 2KI6D 2OTGC 1KK8B 1J7OA 1NWDA 4I5JA 1FBVA 4HSZA 1K8UA 1NYAA 1R2UA 2SCPA 3I5FC 2OS8C 4PCWA 5PALA 3TS5C 1DMOA 1XO5A 3NSLA 4OV2A 1C7VA 1KFUL 2KI6C 1B1GA 5TNCA 4UPGA 1OSAA 2LNKA 5HKYA 4C0KA 4QJ3B 4GUKA 1QX5B 1W7IB 3KHEA 1UHKA 1AVSA 3QRXA 1C07A 3I5GB 2GV5A 1DJXA 2WCBA 1QXPA 4MRXA 1CNPA 1DF0A 2JNFA 1AHRA 1WLZA 1X02A 2LMVA 1SYMA 1FF1A 2Y1MA 4MBEA 1B8CA 3EKHA 2ZFDA 2M3WA 1NCYA 1G8IA 1IJ6A 2OTGB 2ZNDA 1U5IB 4CIDA 1DJHA 1MR8A 3KF9A 5DKNA 4MZKA 3PN7C 4MVFA 2MHHA 2H2KA 2JTZA 2LUCA 2WCEA 2OS8B 4XJKA 1XVJA 5KU1A 3TS5B 3AAJA 1KQVA 1J7PA 4ICBA 2Q91A 4Q04A 5FYXA 3NSKA 2M0RA 3NSIA 1B4CA 1Y6WA 3D0YA 1JFKA 1YUUA 2IS9A 3IF7A 1S6JA 3O78A 4DS7A 2HETA 2L4IA 2L51A 4M2OA 3DVJA 2Y1NA 5DKQA 2LVVA 1YVHA 1L2OC 1G4YR 2MBXA 1CM1A 1PSRA 3CGAA 5AANA 2WCFA 4CLNA 4C0LA 2D8NA 3BUXB 4XYNA 1ZMZA 2F2PA 1CB1A 3PM8A 1L7ZA 2BCBA 1Y0VH 3OB2B 4QJ5B 1S1EA 2BECA 4GNKB 1ZACA 1SW8A 2BKHB 1TN4A 1JBAA 5J3XA 1CMFA 2PSRA 1NX3A 5CPVA 3DF0A 1QIWA 5BPJA 1LVCD 4ORCB 1SY9A 3TDZA 1OE9B 1TOPA 1K90D 1B8RA 3PN7B 3WNXB 2BCAA 1MUXA 4PE4A 1BU3A 1SMGA 4AQJA 1BOCA 1CFDA 4YI9A 5ER4X 5KSZA 4A4CA 3JTDC 1MWNA 1CDNA 2CXJA 3NSOA 3A4UB 2F33A 2JULA 2NXQA 1CLMA 1R6PA 2CT9A 1DJYA 2KQYA 4ORAB 3SG7A 1YVLA 2G9BA 1N65A 2LV7A 3RM1A 2LC5A 5I8NA 1CLLA 2JTTA 1K9PA 2Y5IA 2BL0B 1SL9A 1TCFA 2I7AA 3TUYC 1L2OB 1EJ3A 2M8UA 1N2DA 1RFJA 2CTNA 2LVIA 2KBIA 1B47A 2KGRA 1EG3A 2LP3A 4GGFA 1E8AA 2JC2A 5HYDA 3VRPA 3HCMA 1QX2A 2LUXA 4WQ2A 3SIAA 1M39A 3EK8A 1UHJA 1WDCB 2KSPA 5JOLA 2LLUA 4MSPA 1YX8A 2LLTA 2H61A 2K2FA 2LVKA 1DJZA 1JSAA 4PE7A 5B8IB 3JTDB 1CMGA 3ICBA 3M0WA 1NIWA 2MLFC 2M9GA 2M7NA 4BY5A 1XFUO 2JT0A 3I5IC 3O2PA 1B7TZ 3SG4A 1W7JB 4U8DA 4AQIA 1AJ4A 1YR5A 4YGCB 4PHJA 1UURA 3EKJA 4GFTA 1J1DA 2ZRTA 3K21A 1QTXA 5I2LA 1IQ3A 1SPYA 2AMIA 1DT7B 1QATA 2NLNA 4ETOA 1CFFA 1PSBA 1NUBA 1XA5A 4ZCUA 2L0PA 1NX0A 3CS1A 2BE4A 2NZ0A 1CTRA 2LCPA 1FPWA 1EG4A 2KYCA 2I18A 1D1OA 2MA2A 1TNPA 5AERA 1H4BA 3BUOB 1S26D 1MHOA 1QLKA 1QLSA 1XK4C 3SG2A 1NX2A 2AAOA 3DVMA 4NDDA 3KO0A 1WY9A 2K7CA 3AKBA 2NCOA 1WRZA 1AJ5A 3LK0A 1ALVA 2WOSA 4JQ0D 1J1EA 2LLSA 1K93D 1SCMC 5F6TA 4MZLA 4MLWA 2ZKMX 3NXAA 5I2OA 4ZCVA 1B9AA 3RLZA 3LL8B 2QACA 3VRNA 2KAVA 2O60A 3BOWB 3LK1A 1KFXL 4JPZB 2EC6B 2WNDA 4P2YB 3FWBA 3GK2A 1LA3A 3GK1A 1VRKA 2V53A 1J7QA 2HQ8A 4M2PA 3WXAA 2KHNA 1DVIA 1JF2A 1BR1B 2LP2A 1FI5A 3I5FB 1PULA 1JFJA 4YGEB 2F3YA 2HPSA 2ZN8A 4D1EA 1LKJA 3BYAA 4YGAA 3IQQA 2JWWA 1NCXA 1TNWA 2KFFA 4MZJA 2HF5A 1C7WA 1TRFA 1CFCA 1FI6A 1SCMB 1PVAA 3O4YA 1ZUZA 2M1UA 1YUSA 3H4SE 1TTXA 1J55A 5D7FA 4A4BA 1K94A 3C1VA 3FWCA 3FIAA 1NPQA 4JWQA 1A03A 2E6WA 1TCOB 2JXLA 1IQ5A 2BCXA 4AOMA 3PFVA 1GGWA 1CDMA 1RROA 5HKZA 3PALA 1BT6A 2ZN9A 1KCYA 1S5GY 1Y1AA 3PATA 2OPOA 2L5XB 5I2QA 2LAPA 1SKTA 4R1EA 1UHIA 2ZRSA 1ALWA 2A4JA 4I5KA 1K2HA 1XFWO 2F8PA 4WQ3A 1U5IA 1JUOA 4DCKA 1GGZA 1S5GZ 1KFUS 4C0JA 5D69A 4HRHA 4MN0A 1NCZA 1DGVA 4CPVA 2M49B 4E68A 2KNEA 4PALA 1XFZO 2LE9B 1CLBA 1NP8A 2FOTA 3BQ3A 4N1GA 3CR2A 1Y1XA 4N1FA 2GGMA 1S6IA 1XFXO 2KYFA 4PE1A 5K89A 5JJGA 2KFGA 2EHBA 1AUIB 2R2IA 3DVKA 3JVTC 5GQQC 1MF8B 2M29A 2HQWA 3BUMB 1QS7A 1NX1A 3VROA 2ZNEA 3WHUB 1KFXS 1YURA 1A2XA 1MQ1A 4USLA 3SIBA 3E3RA 5CSFA 1CFPA 2K0JA 1PK0D 4OCIA 3IQOA 1F55A 1YTZC 1RK9A 2B1UA 1GQMA 5G08A 3TUYB 3OP0A 4BY4A 4P5OE 2K61A 1SK6D 1M31A 2PMYA 3AKAA 1AP4A 3VRQA 1OQPA 2G2BA 2FCDA 3CWGA 1LXFC 3JVTB 2M7LA 1DF0B 1OOJA 1QIVA 2JPTA 3ZWHA 1S3PA 4YBHB 1BJFA 3BXKA 2BBMA 3OHMB 2KOTA 4HREE 2E30A 1KSMA 2JT8A 5AXIA 3FS7A 1PRWA 1KSOA 3LCPC 2JRFA 3DD4A 4M2QA 3A8RA 2QPTA 5CSJA 2CNPA 2KGBC 1A29A 2JNXA 3I5IB 4MEWA 4XJKB 1PALA 1BG1A 1UUSA 4PDZA 3HX4A 2VRGA 1F54A 3TDIA 1OZOA 3GK4X 2AUCA 1WRKA 3OB1B 1ZOTB 1KWOC 3D0YB 4FQOA 1BR4B 1IGVA 3CTNA 1QV0A 2L50A 1WRLA 4YGDB 1SL7A 1YRUB 1M46A 2L4HA 2Q4UA 1CKKA 1HQVA 2L98A 1ODBA 2JOJA 2PRUA 1CDPA 2CBLA 1DGUA 4GGFC 3TZ1A 1JWDA 1H8BA 2KI4C 4OVNF 1DJGA 1LA0A 4I5LB 1SL8A 3DF0B 2CCMA 4GAOA 2I2RE 1B8LA 5CSIA 1BF5A 4IL1A 2H61C 3OX6A 4PHMA 1FW4A 1J7RA 1S6CA 1A75B 4OKHA 3KPXA 1YUTA 1IJ5A 4TNCA 3I5HC 1BMOA 3TDUA 1KWOB 2KBMA 2LMUA 2SASA 4NDCA 4DRWA 1CM4A 1SCVA 1WLMA 1K9KA 2KAXA 1XFVO 1Y1UA 4PHKA 4HRGA 1G33A 2KAYA 4DIRA 2NCPA 1KK7Y 1DTLA 1HT9A 4NDBA 2O5GA 1F4QA 3F45A 2TN4A 1SR6C 5HLVA 1OZSA 3AAKA 1QX7A 2K2AA 4I5NB 1UP5A 2KI4B 2K7DA 3SJSA 2LVJA 2LMTA 4FTGA 1IG5A 2BL0C 1S36A 1OMVA 1KK7Z 3BOWA 1A4PA 3CZTX 3OX5A 5AFPA 2WC8A 3SG6A 1F71A 3PLFB 1XYDA 4ORBB 1TIZA 1XFYO 3I5HB 1V1FA 1NSHA 2K7OA 2K8MB 4L9MA 3SG3A 2RGIA 1YX7A 2WORA 2COLB 1OMDA 3LLEA 1EXRA 1XK4A 1BODA 1QVIY 1WDCC 2FJUB 3BUWB 5IBWA 1M45A 2BKIB 2K7BA 1UHNA 1F70A 3EVUA 1A75A 3EVRA 4DUQA 2MJWB 4YRUA 3ZNIA 1SR6B 4OR9B 2MLEC 4PE0A 2Y4QA 4GPLB 4PHNA 1K96A 1IWQA 2JU0A 2F2OA 2DOQA 2JZIA 2M97A 1QVIZ 3O6BA 1F4OA 1M63B 1K95A 3GOFA 1KQMC 4GGNA 5KTYA 1YRTB 1MXEA 1SNLA 3BUNB 1IH0A 1UWOA 1LINA 1EL4A 1N0YA 2EGDA 2GGZA 3EK7A 5HKWA 3SG5A 4N5XA 5HLOA 2F3ZA 1Q80A 3CR5X 5CSNA 4NQGA 2ISDA 2BBNA 3CR4X 5AEQA 2JQ6A 2JT3A 1RJVA 2L2EA 1RECA 1EH2A 1F8HA 1RTP1 3EK4A 4QJ4B 3VGOA 1JC2A 1SRAA 1AK8A 1B7TY 1OMRA 1V1GA 3EVVA 1IKUA 1KK8C 1GJYA 2LHIA 3CLNA 1QASA 2PVBA 5DKRA 1QV1A 1TNQA
chains in the Genus database with same CATH superfamily
1DJIA 1K9UA 2BNXA 2PASA 2FCEA 2KDHA 4CFQA 2LANA 5ER5A 2JXCA 4GBAA 1DJWA 4CFRA 2PALA 2QEOA 3KEVA 1KQMB 2I94A 4WRIA 1JF0A 1UHHA 2BE6A 3D10A 2MRDA 1ZFSA 1SBJA 3I5GC 3PSRA 1CDLA 4F0ZB 3S0FA 1MXLC 3D73A 4YGBB 1IRJA 4MRYA 4YI8A 1PVBA 1TNXA 2KFHA 1RWYA 2KQ6A 2LM5A 1QJTA 2P6BB 2MAZA 3WHTB 1BLQA 3DVEA 3MSEB 2EC6C 2M1KB 2LHLA 3VRRA 2KI6D 2OTGC 4FQTA 1KK8B 1J7OA 1NWDA 4I5JA 1FBVA 4HSZA 1K8UA 2P70A 4JKTA 1NYAA 1R2UA 2SCPA 3I5FC 2OS8C 3B6XA 4PCWA 5PALA 3TS5C 1DMOA 1XO5A 3NSLA 4OV2A 1C7VA 5FI7A 1KFUL 2KI6C 1B1GA 1QWVA 5TNCA 4UPGA 1OSAA 2LNKA 5HKYA 4C0KA 4QJ3B 4GUKA 1QX5B 1W7IB 3KHEA 1UHKA 1AVSA 3QRXA 1C07A 3I5GB 2GV5A 1DJXA 2WCBA 1QXPA 4MRXA 1CNPA 1DF0A 2JNFA 2L2CA 1AHRA 1WLZA 1X02A 2LMVA 1SYMA 2QEHA 3BFHA 1FF1A 2Y1MA 4MBEA 1B8CA 3EKHA 2ZFDA 2M3WA 1NCYA 1G8IA 1IJ6A 2OTGB 2ZNDA 1U5IB 4CIDA 2WCMA 1DJHA 1MR8A 3IVTA 1DQEA 3KF9A 2WCHA 3PN7C 4MZKA 1OOIX 4MVFA 2MHHA 2H2KA 2JTZA 2LUCA 2WCEA 2OS8B 4XJKA 1XVJA 5KU1A 3TS5B 3AAJA 1KQVA 1J7PA 4ICBA 2Q91A 4Q04A 5FYXA 1GM0A 3NSKA 2M0RA 3NSIA 1B4CA 1Y6WA 3D0YA 1JFKA 1YUUA 2IS9A 3IF7A 1S6JA 3O78A 4DS7A 2HETA 2L4IA 2L51A 2ERBA 2QEVA 4M2OA 3DVJA 2Y1NA 5DKQA 2LVVA 1YVHA 1L2OC 1G4YR 2MBXA 3CZ0A 1CM1A 1PSRA 3CGAA 5AANA 2WCFA 4CLNA 4C0LA 2D8NA 3BUXB 4XYNA 1ZMZA 2F2PA 3DY9A 1CB1A 3PM8A 1L7ZA 2BCBA 1Y0VH 1T14A 3O4XA 3OB2B 4QJ5B 1S1EA 3S0EA 2BECA 3NHIA 1ZACA 4GNKB 1SW8A 2BKHB 1TN4A 1JBAA 5J3XA 1CMFA 2PSRA 1NX3A 5CPVA 3DF0A 1QIWA 5BPJA 1LVCD 4ORCB 1SY9A 3TDZA 1OE9B 1TOPA 1K90D 1B8RA 3PN7B 3WNXB 2BCAA 1MUXA 4PE4A 1BU3A 1SMGA 4AQJA 1BOCA 1CFDA 4YI9A 5ER4X 5KSZA 1LS8A 4A4CA 3JTDC 1MWNA 1CDNA 2CXJA 3NSOA 3A4UB 2F33A 2JULA 2NXQA 1CLMA 1DEKA 1R6PA 2CT9A 2JPOA 1DJYA 2KQYA 1OOHA 4ORAB 3SG7A 1YVLA 2G9BA 1N65A 2LV7A 3RM1A 2LC5A 5I8NA 1CLLA 2JTTA 1K9PA 2Y5IA 3UO9A 2BL0B 1SL9A 1TCFA 2I7AA 3TUYC 1L2OB 1EJ3A 2M8UA 1N2DA 1RFJA 2CTNA 2LVIA 2KBIA 1B47A 2KGRA 1EG3A 2LP3A 4GGFA 1E8AA 2JC2A 5HYDA 3VRPA 3HCMA 1QX2A 2LUXA 3CYZA 4WQ2A 3SIAA 1M39A 3EK8A 1UHJA 1WDCB 2KSPA 5JOLA 2LLUA 4MSPA 1YX8A 2LLTA 2H61A 2K2FA 2LVKA 1DJZA 1JSAA 4PE7A 5B8IB 1W9ZA 3JTDB 3CZ1A 1CMGA 3ICBA 3M0WA 1NIWA 2MLFC 2M9GA 2M7NA 4BY5A 1XFUO 2QEBA 2WCJA 2JT0A 3I5IC 3OBVA 3O2PA 4OZDA 1B7TZ 3SG4A 1W7JB 4U8DA 3NGVA 3FE8A 4AQIA 1AJ4A 1YR5A 3DZTA 4YGCB 3S0GA 4PHJA 1UURA 3EKJA 4GFTA 1J1DA 2ZRTA 3K21A 1QTXA 3OGNA 5I2LA 1IQ3A 1SPYA 2AMIA 1DT7B 1QATA 2NLNA 4ETOA 1CFFA 1PSBA 3R1VA 1NUBA 1XA5A 4ZCUA 2L0PA 1NX0A 3CS1A 2BE4A 2NZ0A 1CTRA 2LCPA 1FPWA 1EG4A 2KYCA 2I18A 2WC5A 3S0DA 1D1OA 2MA2A 1TNPA 5AERA 1H4BA 3BUOB 1S26D 1MHOA 1QLKA 1QLSA 1XK4C 3SG2A 1NX2A 2AAOA 3DVMA 4NDDA 3KO0A 1WY9A 2K7CA 3AKBA 2WCKA 2NCOA 1WRZA 2P71A 1AJ5A 5HL1A 3LK0A 1ALVA 2WOSA 3D76A 4JQ0D 1J1EA 2LLSA 1K93D 1SCMC 5F6TA 4MZLA 4MLWA 2ZKMX 3NXAA 5I2OA 4ZCVA 1SSEB 1B9AA 3RLZA 3LL8B 2QACA 4IJ7A 3VRNA 2KAVA 2O60A 3BOWB 3LK1A 1KFXL 4JPZB 2EC6B 2WNDA 4P2YB 3FWBA 2H8VA 3GK2A 1LA3A 1DELA 3GK1A 1VRKA 2V53A 1J7QA 4INWA 2HQ8A 4M2PA 3WXAA 2KHNA 1DVIA 1JF2A 1BR1B 2LP2A 1FI5A 3I5FB 1PULA 1JFJA 1TWOA 4YGEB 2F3YA 2HPSA 2ZN8A 3DYEA 1LKJA 4D1EA 3BYAA 4YGAA 5FI6A 3IQQA 2JWWA 1NCXA 1TNWA 2KFFA 3BJHA 4MZJA 2HF5A 1C7WA 1TRFA 1CFCA 1FI6A 1SCMB 1PVAA 3O4YA 3CABA 1ZUZA 2M1UA 1YUSA 3H4SE 1TTXA 1J55A 5D7FA 4A4BA 1K94A 3C1VA 3SS3A 3FWCA 3FIAA 1DC1A 1NPQA 3Q8IA 4JWQA 1A03A 2E6WA 1TCOB 2JXLA 1IQ5A 2BCXA 3FE9A 4AOMA 3PFVA 1GGWA 1C3ZA 1CDMA 1RROA 5HKZA 3PALA 1BT6A 2ZN9A 1KCYA 1S5GY 3VB1A 1Y1AA 3PATA 3BFAA 2OPOA 2L5XB 5I2QA 2LAPA 1SKTA 4R1EA 1UHIA 2ZRSA 1ALWA 2A4JA 4I5KA 1K2HA 1XFWO 2F8PA 4WQ3A 1U5IA 1JUOA 4DCKA 1GGZA 1S5GZ 1KFUS 4C0JA 5D69A 4HRHA 4MN0A 1NCZA 1DGVA 4CPVA 2M49B 4E68A 2KNEA 4PALA 3SS5A 1XFZO 2L5YA 2LE9B 1CLBA 1NP8A 2FOTA 3BQ3A 4N1GA 3CR2A 1Y1XA 2PQLA 2GGMA 4N1FA 1S6IA 1XFXO 2KYFA 4PE1A 3QMEA 5K89A 5JJGA 2KFGA 2EHBA 1AUIB 2R2IA 3DVKA 3JVTC 5GQQC 1MF8B 3B86A 2M29A 2HQWA 3BUMB 3K1EA 1QS7A 1NX1A 3VROA 2ZNEA 3WHUB 1KFXS 3R72A 1Z4HA 1YURA 1A2XA 1MQ1A 4USLA 4PT1A 3SIBA 3E3RA 5CSFA 1CFPA 2K0JA 1PK0D 3SS4A 2KPHA 4OCIA 3IQOA 1F55A 1YTZC 1RK9A 3S0BA 2B1UA 1GQMA 5G08A 3TUYB 3OP0A 4BY4A 4P5OE 2K61A 1SK6D 3B7AA 1M31A 3FE6A 3L4LA 2PMYA 1TUZA 3AKAA 3D75A 1AP4A 3VRQA 1OQPA 2G2BA 2FCDA 3CWGA 1LXFC 3R1OA 3JVTB 3EG5B 2KLEA 2M7LA 1DF0B 1OOJA 1QIVA 2GTEA 2JPTA 3D78A 3ZWHA 1S3PA 4YBHB 1BJFA 3BXKA 2BBMA 3OHMB 2KOTA 4HREE 2E30A 1KSMA 2JT8A 5AXIA 3FS7A 1PRWA 1KSOA 3LCPC 2JRFA 3L4AA 3DD4A 3PJIA 4M2QA 5DKNA 3A8RA 2QPTA 5CSJA 2CNPA 2KGBC 2KLDA 1A29A 3CDNA 2JNXA 3I5IB 4MEWA 4XJKB 1PALA 1BG1A 1UUSA 4PDZA 3HX4A 2VRGA 1F54A 3TDIA 1OZOA 3GK4X 2AUCA 1WRKA 2WCLA 1ZOTB 3OB1B 1KWOC 3D0YB 4FQOA 1BR4B 1IGVA 3CTNA 1QV0A 2L50A 1WRLA 4INXA 2PYQA 1SL7A 4YGDB 1YRUB 1M46A 1OOFA 2L4HA 2Q4UA 1CKKA 5DICA 1HQVA 2L98A 1ODBA 2JOJA 2PRUA 1CDPA 2CBLA 1DGUA 4GGFC 3TZ1A 1JWDA 1C3YA 1H8BA 2KI4C 4OVNF 1DJGA 3N7HA 3L47A 1LA0A 4I5LB 3DXLA 1SL8A 3DF0B 2CCMA 4GAOA 2I2RE 1B8LA 2FJYA 5CSIA 4IL1A 1BF5A 2H61C 3OX6A 4PHMA 3S0AA 1XFRA 1FW4A 1J7RA 1S6CA 1A75B 4OKHA 3KPXA 1YUTA 1IJ5A 4TNCA 3I5HC 4KYNA 1BMOA 3TDUA 1KWOB 2KBMA 2LMUA 2SASA 4NDCA 4DRWA 1CM4A 3PM2A 1WLMA 1SCVA 1K9KA 2KAXA 1XFVO 1Y1UA 4PHKA 5EL2A 3D74A 2BAPA 4HRGA 1G33A 2KAYA 4DIRA 1OOGA 2NCPA 1KK7Y 1DTLA 1HT9A 4NDBA 2O5GA 1F4QA 3F45A 2TN4A 1SR6C 3BFBA 5HLVA 1OZSA 3AAKA 1QX7A 2K2AA 3B87A 1UP5A 4I5NB 2KI4B 2K7DA 3B88A 5D3OA 2LVJA 3SJSA 2LMTA 4FTGA 4F7FA 1IG5A 2BL0C 2K60A 1S36A 1OMVA 1KK7Z 3NHTA 3UNWA 3BOWA 1A4PA 3CZTX 3OX5A 5AFPA 2QDIA 2WC8A 3SG6A 1IIOA 1F71A 3PLFB 1XYDA 2WC6A 3CZ2A 4ORBB 1TIZA 1XFYO 3I5HB 1V1FA 1NSHA 2K7OA 2K8MB 4L9MA 3SG3A 2RGIA 1YX7A 2WORA 2COLB 1OMDA 3LLEA 1EXRA 1XK4A 1BODA 1QVIY 1WDCC 2FJUB 3BUWB 5IBWA 1M45A 2BKIB 2K7BA 1UHNA 4JD9A 1F70A 3EVUA 1A75A 3EVRA 4DUQA 2MJWB 4YRUA 3ZNIA 1SR6B 4OR9B 2MLEC 4PE0A 2Y4QA 4GPLB 4PHNA 1K96A 1IWQA 2JU0A 2F2OA 2DOQA 2JZIA 2M97A 2YGUA 3D77A 1QVIZ 3O6BA 1F4OA 1M63B 1K95A 3GOFA 1KQMC 4GGNA 5I94A 5KTYA 1YRTB 1MXEA 1SNLA 3BUNB 3R1PA 1IH0A 1UWOA 1LINA 1EL4A 1N0YA 2EGDA 2GGZA 3EK7A 5HKWA 3SG5A 4N5XA 5HLOA 2F3ZA 1Q80A 1TUJA 3CR5X 5CSNA 4NQGA 2ISDA 2BBNA 3CR4X 5AEQA 2JQ6A 2JT3A 1RJVA 2L2EA 1RECA 3RZSA 5FI2A 1EH2A 1F8HA 1OW4A 1RTP1 3EK4A 4QJ4B 3VGOA 1JC2A 1SRAA 1AK8A 1B7TY 1OMRA 1V1GA 3EVVA 1ORGA 1KK8C 1GJYA 1Z2CB 2LHIA 3CLNA 3V2LA 1IKUA 1P28A 1QASA 2PVBA 5DKRA 1QV1A 1TNQA
chains in the Genus database with same CATH topology
1DJIA 1K9UA 2PASA 2FCEA 2KDHA 4CFQA 2LANA 5ER5A 2JXCA 4GBAA 1DJWA 4CFRA 2PALA 3KEVA 1KQMB 2I94A 4WRIA 1JF0A 1UHHA 2BE6A 3D10A 2MRDA 1ZFSA 1SBJA 3I5GC 3PSRA 1CDLA 4F0ZB 1MXLC 4YGBB 1IRJA 4MRYA 4YI8A 1PVBA 1TNXA 2KFHA 1RWYA 2KQ6A 2LM5A 1QJTA 2P6BB 2MAZA 3WHTB 1BLQA 3DVEA 3MSEB 2EC6C 2M1KB 2LHLA 3VRRA 2KI6D 2OTGC 1KK8B 1J7OA 1NWDA 4I5JA 1FBVA 4HSZA 1K8UA 1NYAA 1R2UA 2SCPA 3I5FC 2OS8C 4PCWA 5PALA 3TS5C 1DMOA 1XO5A 3NSLA 4OV2A 1C7VA 1KFUL 2KI6C 1B1GA 5TNCA 4UPGA 1OSAA 2LNKA 5HKYA 4C0KA 4QJ3B 4GUKA 1QX5B 1W7IB 3KHEA 1UHKA 1AVSA 3QRXA 1C07A 3I5GB 2GV5A 1DJXA 2WCBA 1QXPA 4MRXA 1CNPA 1DF0A 2JNFA 1AHRA 1WLZA 1X02A 2LMVA 1SYMA 1FF1A 2Y1MA 4MBEA 1B8CA 3EKHA 2ZFDA 2M3WA 1NCYA 1G8IA 1IJ6A 2OTGB 2ZNDA 1U5IB 4CIDA 1DJHA 1MR8A 3KF9A 5DKNA 4MZKA 3PN7C 4MVFA 2MHHA 2H2KA 2JTZA 2LUCA 2WCEA 2OS8B 4XJKA 1XVJA 5KU1A 3TS5B 3AAJA 1KQVA 1J7PA 4ICBA 2Q91A 4Q04A 5FYXA 3NSKA 2M0RA 3NSIA 1B4CA 1Y6WA 3D0YA 1JFKA 1YUUA 2IS9A 3IF7A 1S6JA 3O78A 4DS7A 2HETA 2L4IA 2L51A 4M2OA 3DVJA 2Y1NA 5DKQA 2LVVA 1YVHA 1L2OC 1G4YR 2MBXA 1CM1A 1PSRA 3CGAA 5AANA 2WCFA 4CLNA 4C0LA 2D8NA 3BUXB 4XYNA 1ZMZA 2F2PA 1CB1A 3PM8A 1L7ZA 2BCBA 1Y0VH 3OB2B 4QJ5B 1S1EA 2BECA 4GNKB 1ZACA 1SW8A 2BKHB 1TN4A 1JBAA 5J3XA 1CMFA 2PSRA 1NX3A 5CPVA 3DF0A 1QIWA 5BPJA 1LVCD 4ORCB 1SY9A 3TDZA 1OE9B 1TOPA 1K90D 1B8RA 3PN7B 3WNXB 2BCAA 1MUXA 4PE4A 1BU3A 1SMGA 4AQJA 1BOCA 1CFDA 4YI9A 5ER4X 5KSZA 4A4CA 3JTDC 1MWNA 1CDNA 2CXJA 3NSOA 3A4UB 2F33A 2JULA 2NXQA 1CLMA 1R6PA 2CT9A 1DJYA 2KQYA 4ORAB 3SG7A 1YVLA 2G9BA 1N65A 2LV7A 3RM1A 2LC5A 5I8NA 1CLLA 2JTTA 1K9PA 2Y5IA 2BL0B 1SL9A 1TCFA 2I7AA 3TUYC 1L2OB 1EJ3A 2M8UA 1N2DA 1RFJA 2CTNA 2LVIA 2KBIA 1B47A 2KGRA 1EG3A 2LP3A 4GGFA 1E8AA 2JC2A 5HYDA 3VRPA 3HCMA 1QX2A 2LUXA 4WQ2A 3SIAA 1M39A 3EK8A 1UHJA 1WDCB 2KSPA 5JOLA 2LLUA 4MSPA 1YX8A 2LLTA 2H61A 2K2FA 2LVKA 1DJZA 1JSAA 4PE7A 5B8IB 3JTDB 1CMGA 3ICBA 3M0WA 1NIWA 2MLFC 2M9GA 2M7NA 4BY5A 1XFUO 2JT0A 3I5IC 3O2PA 1B7TZ 3SG4A 1W7JB 4U8DA 4AQIA 1AJ4A 1YR5A 4YGCB 4PHJA 1UURA 3EKJA 4GFTA 1J1DA 2ZRTA 3K21A 1QTXA 5I2LA 1IQ3A 1SPYA 2AMIA 1DT7B 1QATA 2NLNA 4ETOA 1CFFA 1PSBA 1NUBA 1XA5A 4ZCUA 2L0PA 1NX0A 3CS1A 2BE4A 2NZ0A 1CTRA 2LCPA 1FPWA 1EG4A 2KYCA 2I18A 1D1OA 2MA2A 1TNPA 5AERA 1H4BA 3BUOB 1S26D 1MHOA 1QLKA 1QLSA 1XK4C 3SG2A 1NX2A 2AAOA 3DVMA 4NDDA 3KO0A 1WY9A 2K7CA 3AKBA 2NCOA 1WRZA 1AJ5A 3LK0A 1ALVA 2WOSA 4JQ0D 1J1EA 2LLSA 1K93D 1SCMC 5F6TA 4MZLA 4MLWA 2ZKMX 3NXAA 5I2OA 4ZCVA 1B9AA 3RLZA 3LL8B 2QACA 3VRNA 2KAVA 2O60A 3BOWB 3LK1A 1KFXL 4JPZB 2EC6B 2WNDA 4P2YB 3FWBA 3GK2A 1LA3A 3GK1A 1VRKA 2V53A 1J7QA 2HQ8A 4M2PA 3WXAA 2KHNA 1DVIA 1JF2A 1BR1B 2LP2A 1FI5A 3I5FB 1PULA 1JFJA 4YGEB 2F3YA 2HPSA 2ZN8A 4D1EA 1LKJA 3BYAA 4YGAA 3IQQA 2JWWA 1NCXA 1TNWA 2KFFA 4MZJA 2HF5A 1C7WA 1TRFA 1CFCA 1FI6A 1SCMB 1PVAA 3O4YA 1ZUZA 2M1UA 1YUSA 3H4SE 1TTXA 1J55A 5D7FA 4A4BA 1K94A 3C1VA 3FWCA 3FIAA 1NPQA 4JWQA 1A03A 2E6WA 1TCOB 2JXLA 1IQ5A 2BCXA 4AOMA 3PFVA 1GGWA 1CDMA 1RROA 5HKZA 3PALA 1BT6A 2ZN9A 1KCYA 1S5GY 1Y1AA 3PATA 2OPOA 2L5XB 5I2QA 2LAPA 1SKTA 4R1EA 1UHIA 2ZRSA 1ALWA 2A4JA 4I5KA 1K2HA 1XFWO 2F8PA 4WQ3A 1U5IA 1JUOA 4DCKA 1GGZA 1S5GZ 1KFUS 4C0JA 5D69A 4HRHA 4MN0A 1NCZA 1DGVA 4CPVA 2M49B 4E68A 2KNEA 4PALA 1XFZO 2LE9B 1CLBA 1NP8A 2FOTA 3BQ3A 4N1GA 3CR2A 1Y1XA 4N1FA 2GGMA 1S6IA 1XFXO 2KYFA 4PE1A 5K89A 5JJGA 2KFGA 2EHBA 1AUIB 2R2IA 3DVKA 3JVTC 5GQQC 1MF8B 2M29A 2HQWA 3BUMB 1QS7A 1NX1A 3VROA 2ZNEA 3WHUB 1KFXS 1YURA 1A2XA 1MQ1A 4USLA 3SIBA 3E3RA 5CSFA 1CFPA 2K0JA 1PK0D 4OCIA 3IQOA 1F55A 1YTZC 1RK9A 2B1UA 1GQMA 5G08A 3TUYB 3OP0A 4BY4A 4P5OE 2K61A 1SK6D 1M31A 2PMYA 3AKAA 1AP4A 3VRQA 1OQPA 2G2BA 2FCDA 3CWGA 1LXFC 3JVTB 2M7LA 1DF0B 1OOJA 1QIVA 2JPTA 3ZWHA 1S3PA 4YBHB 1BJFA 3BXKA 2BBMA 3OHMB 2KOTA 4HREE 2E30A 1KSMA 2JT8A 5AXIA 3FS7A 1PRWA 1KSOA 3LCPC 2JRFA 3DD4A 4M2QA 3A8RA 2QPTA 5CSJA 2CNPA 2KGBC 1A29A 2JNXA 3I5IB 4MEWA 4XJKB 1PALA 1BG1A 1UUSA 4PDZA 3HX4A 2VRGA 1F54A 3TDIA 1OZOA 3GK4X 2AUCA 1WRKA 3OB1B 1ZOTB 1KWOC 3D0YB 4FQOA 1BR4B 1IGVA 3CTNA 1QV0A 2L50A 1WRLA 4YGDB 1SL7A 1YRUB 1M46A 2L4HA 2Q4UA 1CKKA 1HQVA 2L98A 1ODBA 2JOJA 2PRUA 1CDPA 2CBLA 1DGUA 4GGFC 3TZ1A 1JWDA 1H8BA 2KI4C 4OVNF 1DJGA 1LA0A 4I5LB 1SL8A 3DF0B 2CCMA 4GAOA 2I2RE 1B8LA 5CSIA 1BF5A 4IL1A 2H61C 3OX6A 4PHMA 1FW4A 1J7RA 1S6CA 1A75B 4OKHA 3KPXA 1YUTA 1IJ5A 4TNCA 3I5HC 1BMOA 3TDUA 1KWOB 2KBMA 2LMUA 2SASA 4NDCA 4DRWA 1CM4A 1SCVA 1WLMA 1K9KA 2KAXA 1XFVO 1Y1UA 4PHKA 4HRGA 1G33A 2KAYA 4DIRA 2NCPA 1KK7Y 1DTLA 1HT9A 4NDBA 2O5GA 1F4QA 3F45A 2TN4A 1SR6C 5HLVA 1OZSA 3AAKA 1QX7A 2K2AA 4I5NB 1UP5A 2KI4B 2K7DA 3SJSA 2LVJA 2LMTA 4FTGA 1IG5A 2BL0C 1S36A 1OMVA 1KK7Z 3BOWA 1A4PA 3CZTX 3OX5A 5AFPA 2WC8A 3SG6A 1F71A 3PLFB 1XYDA 4ORBB 1TIZA 1XFYO 3I5HB 1V1FA 1NSHA 2K7OA 2K8MB 4L9MA 3SG3A 2RGIA 1YX7A 2WORA 2COLB 1OMDA 3LLEA 1EXRA 1XK4A 1BODA 1QVIY 1WDCC 2FJUB 3BUWB 5IBWA 1M45A 2BKIB 2K7BA 1UHNA 1F70A 3EVUA 1A75A 3EVRA 4DUQA 2MJWB 4YRUA 3ZNIA 1SR6B 4OR9B 2MLEC 4PE0A 2Y4QA 4GPLB 4PHNA 1K96A 1IWQA 2JU0A 2F2OA 2DOQA 2JZIA 2M97A 1QVIZ 3O6BA 1F4OA 1M63B 1K95A 3GOFA 1KQMC 4GGNA 5KTYA 1YRTB 1MXEA 1SNLA 3BUNB 1IH0A 1UWOA 1LINA 1EL4A 1N0YA 2EGDA 2GGZA 3EK7A 5HKWA 3SG5A 4N5XA 5HLOA 2F3ZA 1Q80A 3CR5X 5CSNA 4NQGA 2ISDA 2BBNA 3CR4X 5AEQA 2JQ6A 2JT3A 1RJVA 2L2EA 1RECA 1EH2A 1F8HA 1RTP1 3EK4A 4QJ4B 3VGOA 1JC2A 1SRAA 1AK8A 1B7TY 1OMRA 1V1GA 3EVVA 1IKUA 1KK8C 1GJYA 2LHIA 3CLNA 1QASA 2PVBA 5DKRA 1QV1A 1TNQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DJI A;  1K9U A;  2PAS A;  2FCE A;  2KDH A;  4CFQ A;  2LAN A;  5ER5 A;  2JXC A;  4GBA A;  1DJW A;  4CFR A;  2PAL A;  3KEV A;  1KQM B;  2I94 A;  4WRI A;  1JF0 A;  1UHH A;  2BE6 A;  3D10 A;  2MRD A;  1ZFS A;  1SBJ A;  3I5G C;  3PSR A;  1CDL A;  4F0Z B;  1MXL C;  4YGB B;  1IRJ A;  4MRY A;  4YI8 A;  1PVB A;  1TNX A;  2KFH A;  1RWY A;  2KQ6 A;  2LM5 A;  1QJT A;  2P6B B;  2MAZ A;  3WHT B;  1BLQ A;  3DVE A;  3MSE B;  2EC6 C;  2M1K B;  2LHL A;  3VRR A;  2KI6 D;  2OTG C;  1KK8 B;  1J7O A;  1NWD A;  4I5J A;  1FBV A;  4HSZ A;  1K8U A;  1NYA A;  1R2U A;  2SCP A;  3I5F C;  2OS8 C;  4PCW A;  5PAL A;  3TS5 C;  1DMO A;  1XO5 A;  3NSL A;  4OV2 A;  1C7V A;  1KFU L;  2KI6 C;  1B1G A;  5TNC A;  4UPG A;  1OSA A;  2LNK A;  5HKY A;  4C0K A;  4QJ3 B;  4GUK A;  1QX5 B;  1W7I B;  3KHE A;  1UHK A;  1AVS A;  3QRX A;  1C07 A;  3I5G B;  2GV5 A;  1DJX A;  2WCB A;  1QXP A;  4MRX A;  1CNP A;  1DF0 A;  2JNF A;  1AHR A;  1WLZ A;  1X02 A;  2LMV A;  1SYM A;  1FF1 A;  2Y1M A;  4MBE A;  1B8C A;  3EKH A;  2ZFD A;  2M3W A;  1NCY A;  1G8I A;  1IJ6 A;  2OTG B;  2ZND A;  1U5I B;  4CID A;  1DJH A;  1MR8 A;  3KF9 A;  5DKN A;  4MZK A;  3PN7 C;  4MVF A;  2MHH A;  2H2K A;  2JTZ A;  2LUC A;  2WCE A;  2OS8 B;  4XJK A;  1XVJ A;  5KU1 A;  3TS5 B;  3AAJ A;  1KQV A;  1J7P A;  4ICB A;  2Q91 A;  4Q04 A;  5FYX A;  3NSK A;  2M0R A;  3NSI A;  1B4C A;  1Y6W A;  3D0Y A;  1JFK A;  1YUU A;  2IS9 A;  3IF7 A;  1S6J A;  3O78 A;  4DS7 A;  2HET A;  2L4I A;  2L51 A;  4M2O A;  3DVJ A;  2Y1N A;  5DKQ A;  2LVV A;  1YVH A;  1L2O C;  1G4Y R;  2MBX A;  1CM1 A;  1PSR A;  3CGA A;  5AAN A;  2WCF A;  4CLN A;  4C0L A;  2D8N A;  3BUX B;  4XYN A;  1ZMZ A;  2F2P A;  1CB1 A;  3PM8 A;  1L7Z A;  2BCB A;  1Y0V H;  3OB2 B;  4QJ5 B;  1S1E A;  2BEC A;  4GNK B;  1ZAC A;  1SW8 A;  2BKH B;  1TN4 A;  1JBA A;  5J3X A;  1CMF A;  2PSR A;  1NX3 A;  5CPV A;  3DF0 A;  1QIW A;  5BPJ A;  1LVC D;  4ORC B;  1SY9 A;  3TDZ A;  1OE9 B;  1TOP A;  1K90 D;  1B8R A;  3PN7 B;  3WNX B;  2BCA A;  1MUX A;  4PE4 A;  1BU3 A;  1SMG A;  4AQJ A;  1BOC A;  1CFD A;  4YI9 A;  5ER4 X;  5KSZ A;  4A4C A;  3JTD C;  1MWN A;  1CDN A;  2CXJ A;  3NSO A;  3A4U B;  2F33 A;  2JUL A;  2NXQ A;  1CLM A;  1R6P A;  2CT9 A;  1DJY A;  2KQY A;  4ORA B;  3SG7 A;  1YVL A;  2G9B A;  1N65 A;  2LV7 A;  3RM1 A;  2LC5 A;  5I8N A;  1CLL A;  2JTT A;  1K9P A;  2Y5I A;  2BL0 B;  1SL9 A;  1TCF A;  2I7A A;  3TUY C;  1L2O B;  1EJ3 A;  2M8U A;  1N2D A;  1RFJ A;  2CTN A;  2LVI A;  2KBI A;  1B47 A;  2KGR A;  1EG3 A;  2LP3 A;  4GGF A;  1E8A A;  2JC2 A;  5HYD A;  3VRP A;  3HCM A;  1QX2 A;  2LUX A;  4WQ2 A;  3SIA A;  1M39 A;  3EK8 A;  1UHJ A;  1WDC B;  2KSP A;  5JOL A;  2LLU A;  4MSP A;  1YX8 A;  2LLT A;  2H61 A;  2K2F A;  2LVK A;  1DJZ A;  1JSA A;  4PE7 A;  5B8I B;  3JTD B;  1CMG A;  3ICB A;  3M0W A;  1NIW A;  2MLF C;  2M9G A;  2M7N A;  4BY5 A;  1XFU O;  2JT0 A;  3I5I C;  3O2P A;  1B7T Z;  3SG4 A;  1W7J B;  4U8D A;  4AQI A;  1AJ4 A;  1YR5 A;  4YGC B;  4PHJ A;  1UUR A;  3EKJ A;  4GFT A;  1J1D A;  2ZRT A;  3K21 A;  1QTX A;  5I2L A;  1IQ3 A;  1SPY A;  2AMI A;  1DT7 B;  1QAT A;  2NLN A;  4ETO A;  1CFF A;  1PSB A;  1NUB A;  1XA5 A;  4ZCU A;  2L0P A;  1NX0 A;  3CS1 A;  2BE4 A;  2NZ0 A;  1CTR A;  2LCP A;  1FPW A;  1EG4 A;  2KYC A;  2I18 A;  1D1O A;  2MA2 A;  1TNP A;  5AER A;  1H4B A;  3BUO B;  1S26 D;  1MHO A;  1QLK A;  1QLS A;  1XK4 C;  3SG2 A;  1NX2 A;  2AAO A;  3DVM A;  4NDD A;  3KO0 A;  1WY9 A;  2K7C A;  3AKB A;  2NCO A;  1WRZ A;  1AJ5 A;  3LK0 A;  1ALV A;  2WOS A;  4JQ0 D;  1J1E A;  2LLS A;  1K93 D;  1SCM C;  5F6T A;  4MZL A;  4MLW A;  2ZKM X;  3NXA A;  5I2O A;  4ZCV A;  1B9A A;  3RLZ A;  3LL8 B;  2QAC A;  3VRN A;  2KAV A;  2O60 A;  3BOW B;  3LK1 A;  1KFX L;  4JPZ B;  2EC6 B;  2WND A;  4P2Y B;  3FWB A;  3GK2 A;  1LA3 A;  3GK1 A;  1VRK A;  2V53 A;  1J7Q A;  2HQ8 A;  4M2P A;  3WXA A;  2KHN A;  1DVI A;  1JF2 A;  1BR1 B;  2LP2 A;  1FI5 A;  3I5F B;  1PUL A;  1JFJ A;  4YGE B;  2F3Y A;  2HPS A;  2ZN8 A;  4D1E A;  1LKJ A;  3BYA A;  4YGA A;  3IQQ A;  2JWW A;  1NCX A;  1TNW A;  2KFF A;  4MZJ A;  2HF5 A;  1C7W A;  1TRF A;  1CFC A;  1FI6 A;  1SCM B;  1PVA A;  3O4Y A;  1ZUZ A;  2M1U A;  1YUS A;  3H4S E;  1TTX A;  1J55 A;  5D7F A;  4A4B A;  1K94 A;  3C1V A;  3FWC A;  3FIA A;  1NPQ A;  4JWQ A;  1A03 A;  2E6W A;  1TCO B;  2JXL A;  1IQ5 A;  2BCX A;  4AOM A;  3PFV A;  1GGW A;  1CDM A;  1RRO A;  5HKZ A;  3PAL A;  1BT6 A;  2ZN9 A;  1KCY A;  1S5G Y;  1Y1A A;  3PAT A;  2OPO A;  2L5X B;  5I2Q A;  2LAP A;  1SKT A;  4R1E A;  1UHI A;  2ZRS A;  1ALW A;  2A4J A;  4I5K A;  1K2H A;  1XFW O;  2F8P A;  4WQ3 A;  1U5I A;  1JUO A;  4DCK A;  1GGZ A;  1S5G Z;  1KFU S;  4C0J A;  5D69 A;  4HRH A;  4MN0 A;  1NCZ A;  1DGV A;  4CPV A;  2M49 B;  4E68 A;  2KNE A;  4PAL A;  1XFZ O;  2LE9 B;  1CLB A;  1NP8 A;  2FOT A;  3BQ3 A;  4N1G A;  3CR2 A;  1Y1X A;  4N1F A;  2GGM A;  1S6I A;  1XFX O;  2KYF A;  4PE1 A;  5K89 A;  5JJG A;  2KFG A;  2EHB A;  1AUI B;  2R2I A;  3DVK A;  3JVT C;  5GQQ C;  1MF8 B;  2M29 A;  2HQW A;  3BUM B;  1QS7 A;  1NX1 A;  3VRO A;  2ZNE A;  3WHU B;  1KFX S;  1YUR A;  1A2X A;  1MQ1 A;  4USL A;  3SIB A;  3E3R A;  5CSF A;  1CFP A;  2K0J A;  1PK0 D;  4OCI A;  3IQO A;  1F55 A;  1YTZ C;  1RK9 A;  2B1U A;  1GQM A;  5G08 A;  3TUY B;  3OP0 A;  4BY4 A;  4P5O E;  2K61 A;  1SK6 D;  1M31 A;  2PMY A;  3AKA A;  1AP4 A;  3VRQ A;  1OQP A;  2G2B A;  2FCD A;  3CWG A;  1LXF C;  3JVT B;  2M7L A;  1DF0 B;  1OOJ A;  1QIV A;  2JPT A;  3ZWH A;  1S3P A;  4YBH B;  1BJF A;  3BXK A;  2BBM A;  3OHM B;  2KOT A;  4HRE E;  2E30 A;  1KSM A;  2JT8 A;  5AXI A;  3FS7 A;  1PRW A;  1KSO A;  3LCP C;  2JRF A;  3DD4 A;  4M2Q A;  3A8R A;  2QPT A;  5CSJ A;  2CNP A;  2KGB C;  1A29 A;  2JNX A;  3I5I B;  4MEW A;  4XJK B;  1PAL A;  1BG1 A;  1UUS A;  4PDZ A;  3HX4 A;  2VRG A;  1F54 A;  3TDI A;  1OZO A;  3GK4 X;  2AUC A;  1WRK A;  3OB1 B;  1ZOT B;  1KWO C;  3D0Y B;  4FQO A;  1BR4 B;  1IGV A;  3CTN A;  1QV0 A;  2L50 A;  1WRL A;  4YGD B;  1SL7 A;  1YRU B;  1M46 A;  2L4H A;  2Q4U A;  1CKK A;  1HQV A;  2L98 A;  1ODB A;  2JOJ A;  2PRU A;  1CDP A;  2CBL A;  1DGU A;  4GGF C;  3TZ1 A;  1JWD A;  1H8B A;  2KI4 C;  4OVN F;  1DJG A;  1LA0 A;  4I5L B;  1SL8 A;  3DF0 B;  2CCM A;  4GAO A;  2I2R E;  1B8L A;  5CSI A;  1BF5 A;  4IL1 A;  2H61 C;  3OX6 A;  4PHM A;  1FW4 A;  1J7R A;  1S6C A;  1A75 B;  4OKH A;  3KPX A;  1YUT A;  1IJ5 A;  4TNC A;  3I5H C;  1BMO A;  3TDU A;  1KWO B;  2KBM A;  2LMU A;  2SAS A;  4NDC A;  4DRW A;  1CM4 A;  1SCV A;  1WLM A;  1K9K A;  2KAX A;  1XFV O;  1Y1U A;  4PHK A;  4HRG A;  1G33 A;  2KAY A;  4DIR A;  2NCP A;  1KK7 Y;  1DTL A;  1HT9 A;  4NDB A;  2O5G A;  1F4Q A;  3F45 A;  2TN4 A;  1SR6 C;  5HLV A;  1OZS A;  3AAK A;  1QX7 A;  2K2A A;  4I5N B;  1UP5 A;  2KI4 B;  2K7D A;  3SJS A;  2LVJ A;  2LMT A;  4FTG A;  1IG5 A;  2BL0 C;  1S36 A;  1OMV A;  1KK7 Z;  3BOW A;  1A4P A;  3CZT X;  3OX5 A;  5AFP A;  2WC8 A;  3SG6 A;  1F71 A;  3PLF B;  1XYD A;  4ORB B;  1TIZ A;  1XFY O;  3I5H B;  1V1F A;  1NSH A;  2K7O A;  2K8M B;  4L9M A;  3SG3 A;  2RGI A;  1YX7 A;  2WOR A;  2COL B;  1OMD A;  3LLE A;  1EXR A;  1XK4 A;  1BOD A;  1QVI Y;  1WDC C;  2FJU B;  3BUW B;  5IBW A;  1M45 A;  2BKI B;  2K7B A;  1UHN A;  1F70 A;  3EVU A;  1A75 A;  3EVR A;  4DUQ A;  2MJW B;  4YRU A;  3ZNI A;  1SR6 B;  4OR9 B;  2MLE C;  4PE0 A;  2Y4Q A;  4GPL B;  4PHN A;  1K96 A;  1IWQ A;  2JU0 A;  2F2O A;  2DOQ A;  2JZI A;  2M97 A;  1QVI Z;  3O6B A;  1F4O A;  1M63 B;  1K95 A;  3GOF A;  1KQM C;  4GGN A;  5KTY A;  1YRT B;  1MXE A;  1SNL A;  3BUN B;  1IH0 A;  1UWO A;  1LIN A;  1EL4 A;  1N0Y A;  2EGD A;  2GGZ A;  3EK7 A;  5HKW A;  3SG5 A;  4N5X A;  5HLO A;  2F3Z A;  1Q80 A;  3CR5 X;  5CSN A;  4NQG A;  2ISD A;  2BBN A;  3CR4 X;  5AEQ A;  2JQ6 A;  2JT3 A;  1RJV A;  2L2E A;  1REC A;  1EH2 A;  1F8H A;  1RTP 1;  3EK4 A;  4QJ4 B;  3VGO A;  1JC2 A;  1SRA A;  1AK8 A;  1B7T Y;  1OMR A;  1V1G A;  3EVV A;  1IKU A;  1KK8 C;  1GJY A;  2LHI A;  3CLN A;  1QAS A;  2PVB A;  5DKR A;  1QV1 A;  1TNQ A; 
#chains in the Genus database with same CATH topology
 1DJI A;  1K9U A;  2BNX A;  2PAS A;  2FCE A;  2KDH A;  4CFQ A;  2LAN A;  5ER5 A;  2JXC A;  4GBA A;  1DJW A;  4CFR A;  2PAL A;  2QEO A;  3KEV A;  1KQM B;  2I94 A;  4WRI A;  1JF0 A;  1UHH A;  2BE6 A;  3D10 A;  2MRD A;  1ZFS A;  1SBJ A;  3I5G C;  3PSR A;  1CDL A;  4F0Z B;  3S0F A;  1MXL C;  3D73 A;  4YGB B;  1IRJ A;  4MRY A;  4YI8 A;  1PVB A;  1TNX A;  2KFH A;  1RWY A;  2KQ6 A;  2LM5 A;  1QJT A;  2P6B B;  2MAZ A;  3WHT B;  1BLQ A;  3DVE A;  3MSE B;  2EC6 C;  2M1K B;  2LHL A;  3VRR A;  2KI6 D;  2OTG C;  4FQT A;  1KK8 B;  1J7O A;  1NWD A;  4I5J A;  1FBV A;  4HSZ A;  1K8U A;  2P70 A;  4JKT A;  1NYA A;  1R2U A;  2SCP A;  3I5F C;  2OS8 C;  3B6X A;  4PCW A;  5PAL A;  3TS5 C;  1DMO A;  1XO5 A;  3NSL A;  4OV2 A;  1C7V A;  5FI7 A;  1KFU L;  2KI6 C;  1B1G A;  1QWV A;  5TNC A;  4UPG A;  1OSA A;  2LNK A;  5HKY A;  4C0K A;  4QJ3 B;  4GUK A;  1QX5 B;  1W7I B;  3KHE A;  1UHK A;  1AVS A;  3QRX A;  1C07 A;  3I5G B;  2GV5 A;  1DJX A;  2WCB A;  1QXP A;  4MRX A;  1CNP A;  1DF0 A;  2JNF A;  2L2C A;  1AHR A;  1WLZ A;  1X02 A;  2LMV A;  1SYM A;  2QEH A;  3BFH A;  1FF1 A;  2Y1M A;  4MBE A;  1B8C A;  3EKH A;  2ZFD A;  2M3W A;  1NCY A;  1G8I A;  1IJ6 A;  2OTG B;  2ZND A;  1U5I B;  4CID A;  2WCM A;  1DJH A;  1MR8 A;  3IVT A;  1DQE A;  3KF9 A;  2WCH A;  3PN7 C;  4MZK A;  1OOI X;  4MVF A;  2MHH A;  2H2K A;  2JTZ A;  2LUC A;  2WCE A;  2OS8 B;  4XJK A;  1XVJ A;  5KU1 A;  3TS5 B;  3AAJ A;  1KQV A;  1J7P A;  4ICB A;  2Q91 A;  4Q04 A;  5FYX A;  1GM0 A;  3NSK A;  2M0R A;  3NSI A;  1B4C A;  1Y6W A;  3D0Y A;  1JFK A;  1YUU A;  2IS9 A;  3IF7 A;  1S6J A;  3O78 A;  4DS7 A;  2HET A;  2L4I A;  2L51 A;  2ERB A;  2QEV A;  4M2O A;  3DVJ A;  2Y1N A;  5DKQ A;  2LVV A;  1YVH A;  1L2O C;  1G4Y R;  2MBX A;  3CZ0 A;  1CM1 A;  1PSR A;  3CGA A;  5AAN A;  2WCF A;  4CLN A;  4C0L A;  2D8N A;  3BUX B;  4XYN A;  1ZMZ A;  2F2P A;  3DY9 A;  1CB1 A;  3PM8 A;  1L7Z A;  2BCB A;  1Y0V H;  1T14 A;  3O4X A;  3OB2 B;  4QJ5 B;  1S1E A;  3S0E A;  2BEC A;  3NHI A;  1ZAC A;  4GNK B;  1SW8 A;  2BKH B;  1TN4 A;  1JBA A;  5J3X A;  1CMF A;  2PSR A;  1NX3 A;  5CPV A;  3DF0 A;  1QIW A;  5BPJ A;  1LVC D;  4ORC B;  1SY9 A;  3TDZ A;  1OE9 B;  1TOP A;  1K90 D;  1B8R A;  3PN7 B;  3WNX B;  2BCA A;  1MUX A;  4PE4 A;  1BU3 A;  1SMG A;  4AQJ A;  1BOC A;  1CFD A;  4YI9 A;  5ER4 X;  5KSZ A;  1LS8 A;  4A4C A;  3JTD C;  1MWN A;  1CDN A;  2CXJ A;  3NSO A;  3A4U B;  2F33 A;  2JUL A;  2NXQ A;  1CLM A;  1DEK A;  1R6P A;  2CT9 A;  2JPO A;  1DJY A;  2KQY A;  1OOH A;  4ORA B;  3SG7 A;  1YVL A;  2G9B A;  1N65 A;  2LV7 A;  3RM1 A;  2LC5 A;  5I8N A;  1CLL A;  2JTT A;  1K9P A;  2Y5I A;  3UO9 A;  2BL0 B;  1SL9 A;  1TCF A;  2I7A A;  3TUY C;  1L2O B;  1EJ3 A;  2M8U A;  1N2D A;  1RFJ A;  2CTN A;  2LVI A;  2KBI A;  1B47 A;  2KGR A;  1EG3 A;  2LP3 A;  4GGF A;  1E8A A;  2JC2 A;  5HYD A;  3VRP A;  3HCM A;  1QX2 A;  2LUX A;  3CYZ A;  4WQ2 A;  3SIA A;  1M39 A;  3EK8 A;  1UHJ A;  1WDC B;  2KSP A;  5JOL A;  2LLU A;  4MSP A;  1YX8 A;  2LLT A;  2H61 A;  2K2F A;  2LVK A;  1DJZ A;  1JSA A;  4PE7 A;  5B8I B;  1W9Z A;  3JTD B;  3CZ1 A;  1CMG A;  3ICB A;  3M0W A;  1NIW A;  2MLF C;  2M9G A;  2M7N A;  4BY5 A;  1XFU O;  2QEB A;  2WCJ A;  2JT0 A;  3I5I C;  3OBV A;  3O2P A;  4OZD A;  1B7T Z;  3SG4 A;  1W7J B;  4U8D A;  3NGV A;  3FE8 A;  4AQI A;  1AJ4 A;  1YR5 A;  3DZT A;  4YGC B;  3S0G A;  4PHJ A;  1UUR A;  3EKJ A;  4GFT A;  1J1D A;  2ZRT A;  3K21 A;  1QTX A;  3OGN A;  5I2L A;  1IQ3 A;  1SPY A;  2AMI A;  1DT7 B;  1QAT A;  2NLN A;  4ETO A;  1CFF A;  1PSB A;  3R1V A;  1NUB A;  1XA5 A;  4ZCU A;  2L0P A;  1NX0 A;  3CS1 A;  2BE4 A;  2NZ0 A;  1CTR A;  2LCP A;  1FPW A;  1EG4 A;  2KYC A;  2I18 A;  2WC5 A;  3S0D A;  1D1O A;  2MA2 A;  1TNP A;  5AER A;  1H4B A;  3BUO B;  1S26 D;  1MHO A;  1QLK A;  1QLS A;  1XK4 C;  3SG2 A;  1NX2 A;  2AAO A;  3DVM A;  4NDD A;  3KO0 A;  1WY9 A;  2K7C A;  3AKB A;  2WCK A;  2NCO A;  1WRZ A;  2P71 A;  1AJ5 A;  5HL1 A;  3LK0 A;  1ALV A;  2WOS A;  3D76 A;  4JQ0 D;  1J1E A;  2LLS A;  1K93 D;  1SCM C;  5F6T A;  4MZL A;  4MLW A;  2ZKM X;  3NXA A;  5I2O A;  4ZCV A;  1SSE B;  1B9A A;  3RLZ A;  3LL8 B;  2QAC A;  4IJ7 A;  3VRN A;  2KAV A;  2O60 A;  3BOW B;  3LK1 A;  1KFX L;  4JPZ B;  2EC6 B;  2WND A;  4P2Y B;  3FWB A;  2H8V A;  3GK2 A;  1LA3 A;  1DEL A;  3GK1 A;  1VRK A;  2V53 A;  1J7Q A;  4INW A;  2HQ8 A;  4M2P A;  3WXA A;  2KHN A;  1DVI A;  1JF2 A;  1BR1 B;  2LP2 A;  1FI5 A;  3I5F B;  1PUL A;  1JFJ A;  1TWO A;  4YGE B;  2F3Y A;  2HPS A;  2ZN8 A;  3DYE A;  1LKJ A;  4D1E A;  3BYA A;  4YGA A;  5FI6 A;  3IQQ A;  2JWW A;  1NCX A;  1TNW A;  2KFF A;  3BJH A;  4MZJ A;  2HF5 A;  1C7W A;  1TRF A;  1CFC A;  1FI6 A;  1SCM B;  1PVA A;  3O4Y A;  3CAB A;  1ZUZ A;  2M1U A;  1YUS A;  3H4S E;  1TTX A;  1J55 A;  5D7F A;  4A4B A;  1K94 A;  3C1V A;  3SS3 A;  3FWC A;  3FIA A;  1DC1 A;  1NPQ A;  3Q8I A;  4JWQ A;  1A03 A;  2E6W A;  1TCO B;  2JXL A;  1IQ5 A;  2BCX A;  3FE9 A;  4AOM A;  3PFV A;  1GGW A;  1C3Z A;  1CDM A;  1RRO A;  5HKZ A;  3PAL A;  1BT6 A;  2ZN9 A;  1KCY A;  1S5G Y;  3VB1 A;  1Y1A A;  3PAT A;  3BFA A;  2OPO A;  2L5X B;  5I2Q A;  2LAP A;  1SKT A;  4R1E A;  1UHI A;  2ZRS A;  1ALW A;  2A4J A;  4I5K A;  1K2H A;  1XFW O;  2F8P A;  4WQ3 A;  1U5I A;  1JUO A;  4DCK A;  1GGZ A;  1S5G Z;  1KFU S;  4C0J A;  5D69 A;  4HRH A;  4MN0 A;  1NCZ A;  1DGV A;  4CPV A;  2M49 B;  4E68 A;  2KNE A;  4PAL A;  3SS5 A;  1XFZ O;  2L5Y A;  2LE9 B;  1CLB A;  1NP8 A;  2FOT A;  3BQ3 A;  4N1G A;  3CR2 A;  1Y1X A;  2PQL A;  2GGM A;  4N1F A;  1S6I A;  1XFX O;  2KYF A;  4PE1 A;  3QME A;  5K89 A;  5JJG A;  2KFG A;  2EHB A;  1AUI B;  2R2I A;  3DVK A;  3JVT C;  5GQQ C;  1MF8 B;  3B86 A;  2M29 A;  2HQW A;  3BUM B;  3K1E A;  1QS7 A;  1NX1 A;  3VRO A;  2ZNE A;  3WHU B;  1KFX S;  3R72 A;  1Z4H A;  1YUR A;  1A2X A;  1MQ1 A;  4USL A;  4PT1 A;  3SIB A;  3E3R A;  5CSF A;  1CFP A;  2K0J A;  1PK0 D;  3SS4 A;  2KPH A;  4OCI A;  3IQO A;  1F55 A;  1YTZ C;  1RK9 A;  3S0B A;  2B1U A;  1GQM A;  5G08 A;  3TUY B;  3OP0 A;  4BY4 A;  4P5O E;  2K61 A;  1SK6 D;  3B7A A;  1M31 A;  3FE6 A;  3L4L A;  2PMY A;  1TUZ A;  3AKA A;  3D75 A;  1AP4 A;  3VRQ A;  1OQP A;  2G2B A;  2FCD A;  3CWG A;  1LXF C;  3R1O A;  3JVT B;  3EG5 B;  2KLE A;  2M7L A;  1DF0 B;  1OOJ A;  1QIV A;  2GTE A;  2JPT A;  3D78 A;  3ZWH A;  1S3P A;  4YBH B;  1BJF A;  3BXK A;  2BBM A;  3OHM B;  2KOT A;  4HRE E;  2E30 A;  1KSM A;  2JT8 A;  5AXI A;  3FS7 A;  1PRW A;  1KSO A;  3LCP C;  2JRF A;  3L4A A;  3DD4 A;  3PJI A;  4M2Q A;  5DKN A;  3A8R A;  2QPT A;  5CSJ A;  2CNP A;  2KGB C;  2KLD A;  1A29 A;  3CDN A;  2JNX A;  3I5I B;  4MEW A;  4XJK B;  1PAL A;  1BG1 A;  1UUS A;  4PDZ A;  3HX4 A;  2VRG A;  1F54 A;  3TDI A;  1OZO A;  3GK4 X;  2AUC A;  1WRK A;  2WCL A;  1ZOT B;  3OB1 B;  1KWO C;  3D0Y B;  4FQO A;  1BR4 B;  1IGV A;  3CTN A;  1QV0 A;  2L50 A;  1WRL A;  4INX A;  2PYQ A;  1SL7 A;  4YGD B;  1YRU B;  1M46 A;  1OOF A;  2L4H A;  2Q4U A;  1CKK A;  5DIC A;  1HQV A;  2L98 A;  1ODB A;  2JOJ A;  2PRU A;  1CDP A;  2CBL A;  1DGU A;  4GGF C;  3TZ1 A;  1JWD A;  1C3Y A;  1H8B A;  2KI4 C;  4OVN F;  1DJG A;  3N7H A;  3L47 A;  1LA0 A;  4I5L B;  3DXL A;  1SL8 A;  3DF0 B;  2CCM A;  4GAO A;  2I2R E;  1B8L A;  2FJY A;  5CSI A;  4IL1 A;  1BF5 A;  2H61 C;  3OX6 A;  4PHM A;  3S0A A;  1XFR A;  1FW4 A;  1J7R A;  1S6C A;  1A75 B;  4OKH A;  3KPX A;  1YUT A;  1IJ5 A;  4TNC A;  3I5H C;  4KYN A;  1BMO A;  3TDU A;  1KWO B;  2KBM A;  2LMU A;  2SAS A;  4NDC A;  4DRW A;  1CM4 A;  3PM2 A;  1WLM A;  1SCV A;  1K9K A;  2KAX A;  1XFV O;  1Y1U A;  4PHK A;  5EL2 A;  3D74 A;  2BAP A;  4HRG A;  1G33 A;  2KAY A;  4DIR A;  1OOG A;  2NCP A;  1KK7 Y;  1DTL A;  1HT9 A;  4NDB A;  2O5G A;  1F4Q A;  3F45 A;  2TN4 A;  1SR6 C;  3BFB A;  5HLV A;  1OZS A;  3AAK A;  1QX7 A;  2K2A A;  3B87 A;  1UP5 A;  4I5N B;  2KI4 B;  2K7D A;  3B88 A;  5D3O A;  2LVJ A;  3SJS A;  2LMT A;  4FTG A;  4F7F A;  1IG5 A;  2BL0 C;  2K60 A;  1S36 A;  1OMV A;  1KK7 Z;  3NHT A;  3UNW A;  3BOW A;  1A4P A;  3CZT X;  3OX5 A;  5AFP A;  2QDI A;  2WC8 A;  3SG6 A;  1IIO A;  1F71 A;  3PLF B;  1XYD A;  2WC6 A;  3CZ2 A;  4ORB B;  1TIZ A;  1XFY O;  3I5H B;  1V1F A;  1NSH A;  2K7O A;  2K8M B;  4L9M A;  3SG3 A;  2RGI A;  1YX7 A;  2WOR A;  2COL B;  1OMD A;  3LLE A;  1EXR A;  1XK4 A;  1BOD A;  1QVI Y;  1WDC C;  2FJU B;  3BUW B;  5IBW A;  1M45 A;  2BKI B;  2K7B A;  1UHN A;  4JD9 A;  1F70 A;  3EVU A;  1A75 A;  3EVR A;  4DUQ A;  2MJW B;  4YRU A;  3ZNI A;  1SR6 B;  4OR9 B;  2MLE C;  4PE0 A;  2Y4Q A;  4GPL B;  4PHN A;  1K96 A;  1IWQ A;  2JU0 A;  2F2O A;  2DOQ A;  2JZI A;  2M97 A;  2YGU A;  3D77 A;  1QVI Z;  3O6B A;  1F4O A;  1M63 B;  1K95 A;  3GOF A;  1KQM C;  4GGN A;  5I94 A;  5KTY A;  1YRT B;  1MXE A;  1SNL A;  3BUN B;  3R1P A;  1IH0 A;  1UWO A;  1LIN A;  1EL4 A;  1N0Y A;  2EGD A;  2GGZ A;  3EK7 A;  5HKW A;  3SG5 A;  4N5X A;  5HLO A;  2F3Z A;  1Q80 A;  1TUJ A;  3CR5 X;  5CSN A;  4NQG A;  2ISD A;  2BBN A;  3CR4 X;  5AEQ A;  2JQ6 A;  2JT3 A;  1RJV A;  2L2E A;  1REC A;  3RZS A;  5FI2 A;  1EH2 A;  1F8H A;  1OW4 A;  1RTP 1;  3EK4 A;  4QJ4 B;  3VGO A;  1JC2 A;  1SRA A;  1AK8 A;  1B7T Y;  1OMR A;  1V1G A;  3EVV A;  1ORG A;  1KK8 C;  1GJY A;  1Z2C B;  2LHI A;  3CLN A;  3V2L A;  1IKU A;  1P28 A;  1QAS A;  2PVB A;  5DKR A;  1QV1 A;  1TNQ A; 
#chains in the Genus database with same CATH homology
 1DJI A;  1K9U A;  2PAS A;  2FCE A;  2KDH A;  4CFQ A;  2LAN A;  5ER5 A;  2JXC A;  4GBA A;  1DJW A;  4CFR A;  2PAL A;  3KEV A;  1KQM B;  2I94 A;  4WRI A;  1JF0 A;  1UHH A;  2BE6 A;  3D10 A;  2MRD A;  1ZFS A;  1SBJ A;  3I5G C;  3PSR A;  1CDL A;  4F0Z B;  1MXL C;  4YGB B;  1IRJ A;  4MRY A;  4YI8 A;  1PVB A;  1TNX A;  2KFH A;  1RWY A;  2KQ6 A;  2LM5 A;  1QJT A;  2P6B B;  2MAZ A;  3WHT B;  1BLQ A;  3DVE A;  3MSE B;  2EC6 C;  2M1K B;  2LHL A;  3VRR A;  2KI6 D;  2OTG C;  1KK8 B;  1J7O A;  1NWD A;  4I5J A;  1FBV A;  4HSZ A;  1K8U A;  1NYA A;  1R2U A;  2SCP A;  3I5F C;  2OS8 C;  4PCW A;  5PAL A;  3TS5 C;  1DMO A;  1XO5 A;  3NSL A;  4OV2 A;  1C7V A;  1KFU L;  2KI6 C;  1B1G A;  5TNC A;  4UPG A;  1OSA A;  2LNK A;  5HKY A;  4C0K A;  4QJ3 B;  4GUK A;  1QX5 B;  1W7I B;  3KHE A;  1UHK A;  1AVS A;  3QRX A;  1C07 A;  3I5G B;  2GV5 A;  1DJX A;  2WCB A;  1QXP A;  4MRX A;  1CNP A;  1DF0 A;  2JNF A;  1AHR A;  1WLZ A;  1X02 A;  2LMV A;  1SYM A;  1FF1 A;  2Y1M A;  4MBE A;  1B8C A;  3EKH A;  2ZFD A;  2M3W A;  1NCY A;  1G8I A;  1IJ6 A;  2OTG B;  2ZND A;  1U5I B;  4CID A;  1DJH A;  1MR8 A;  3KF9 A;  5DKN A;  4MZK A;  3PN7 C;  4MVF A;  2MHH A;  2H2K A;  2JTZ A;  2LUC A;  2WCE A;  2OS8 B;  4XJK A;  1XVJ A;  5KU1 A;  3TS5 B;  3AAJ A;  1KQV A;  1J7P A;  4ICB A;  2Q91 A;  4Q04 A;  5FYX A;  3NSK A;  2M0R A;  3NSI A;  1B4C A;  1Y6W A;  3D0Y A;  1JFK A;  1YUU A;  2IS9 A;  3IF7 A;  1S6J A;  3O78 A;  4DS7 A;  2HET A;  2L4I A;  2L51 A;  4M2O A;  3DVJ A;  2Y1N A;  5DKQ A;  2LVV A;  1YVH A;  1L2O C;  1G4Y R;  2MBX A;  1CM1 A;  1PSR A;  3CGA A;  5AAN A;  2WCF A;  4CLN A;  4C0L A;  2D8N A;  3BUX B;  4XYN A;  1ZMZ A;  2F2P A;  1CB1 A;  3PM8 A;  1L7Z A;  2BCB A;  1Y0V H;  3OB2 B;  4QJ5 B;  1S1E A;  2BEC A;  4GNK B;  1ZAC A;  1SW8 A;  2BKH B;  1TN4 A;  1JBA A;  5J3X A;  1CMF A;  2PSR A;  1NX3 A;  5CPV A;  3DF0 A;  1QIW A;  5BPJ A;  1LVC D;  4ORC B;  1SY9 A;  3TDZ A;  1OE9 B;  1TOP A;  1K90 D;  1B8R A;  3PN7 B;  3WNX B;  2BCA A;  1MUX A;  4PE4 A;  1BU3 A;  1SMG A;  4AQJ A;  1BOC A;  1CFD A;  4YI9 A;  5ER4 X;  5KSZ A;  4A4C A;  3JTD C;  1MWN A;  1CDN A;  2CXJ A;  3NSO A;  3A4U B;  2F33 A;  2JUL A;  2NXQ A;  1CLM A;  1R6P A;  2CT9 A;  1DJY A;  2KQY A;  4ORA B;  3SG7 A;  1YVL A;  2G9B A;  1N65 A;  2LV7 A;  3RM1 A;  2LC5 A;  5I8N A;  1CLL A;  2JTT A;  1K9P A;  2Y5I A;  2BL0 B;  1SL9 A;  1TCF A;  2I7A A;  3TUY C;  1L2O B;  1EJ3 A;  2M8U A;  1N2D A;  1RFJ A;  2CTN A;  2LVI A;  2KBI A;  1B47 A;  2KGR A;  1EG3 A;  2LP3 A;  4GGF A;  1E8A A;  2JC2 A;  5HYD A;  3VRP A;  3HCM A;  1QX2 A;  2LUX A;  4WQ2 A;  3SIA A;  1M39 A;  3EK8 A;  1UHJ A;  1WDC B;  2KSP A;  5JOL A;  2LLU A;  4MSP A;  1YX8 A;  2LLT A;  2H61 A;  2K2F A;  2LVK A;  1DJZ A;  1JSA A;  4PE7 A;  5B8I B;  3JTD B;  1CMG A;  3ICB A;  3M0W A;  1NIW A;  2MLF C;  2M9G A;  2M7N A;  4BY5 A;  1XFU O;  2JT0 A;  3I5I C;  3O2P A;  1B7T Z;  3SG4 A;  1W7J B;  4U8D A;  4AQI A;  1AJ4 A;  1YR5 A;  4YGC B;  4PHJ A;  1UUR A;  3EKJ A;  4GFT A;  1J1D A;  2ZRT A;  3K21 A;  1QTX A;  5I2L A;  1IQ3 A;  1SPY A;  2AMI A;  1DT7 B;  1QAT A;  2NLN A;  4ETO A;  1CFF A;  1PSB A;  1NUB A;  1XA5 A;  4ZCU A;  2L0P A;  1NX0 A;  3CS1 A;  2BE4 A;  2NZ0 A;  1CTR A;  2LCP A;  1FPW A;  1EG4 A;  2KYC A;  2I18 A;  1D1O A;  2MA2 A;  1TNP A;  5AER A;  1H4B A;  3BUO B;  1S26 D;  1MHO A;  1QLK A;  1QLS A;  1XK4 C;  3SG2 A;  1NX2 A;  2AAO A;  3DVM A;  4NDD A;  3KO0 A;  1WY9 A;  2K7C A;  3AKB A;  2NCO A;  1WRZ A;  1AJ5 A;  3LK0 A;  1ALV A;  2WOS A;  4JQ0 D;  1J1E A;  2LLS A;  1K93 D;  1SCM C;  5F6T A;  4MZL A;  4MLW A;  2ZKM X;  3NXA A;  5I2O A;  4ZCV A;  1B9A A;  3RLZ A;  3LL8 B;  2QAC A;  3VRN A;  2KAV A;  2O60 A;  3BOW B;  3LK1 A;  1KFX L;  4JPZ B;  2EC6 B;  2WND A;  4P2Y B;  3FWB A;  3GK2 A;  1LA3 A;  3GK1 A;  1VRK A;  2V53 A;  1J7Q A;  2HQ8 A;  4M2P A;  3WXA A;  2KHN A;  1DVI A;  1JF2 A;  1BR1 B;  2LP2 A;  1FI5 A;  3I5F B;  1PUL A;  1JFJ A;  4YGE B;  2F3Y A;  2HPS A;  2ZN8 A;  4D1E A;  1LKJ A;  3BYA A;  4YGA A;  3IQQ A;  2JWW A;  1NCX A;  1TNW A;  2KFF A;  4MZJ A;  2HF5 A;  1C7W A;  1TRF A;  1CFC A;  1FI6 A;  1SCM B;  1PVA A;  3O4Y A;  1ZUZ A;  2M1U A;  1YUS A;  3H4S E;  1TTX A;  1J55 A;  5D7F A;  4A4B A;  1K94 A;  3C1V A;  3FWC A;  3FIA A;  1NPQ A;  4JWQ A;  1A03 A;  2E6W A;  1TCO B;  2JXL A;  1IQ5 A;  2BCX A;  4AOM A;  3PFV A;  1GGW A;  1CDM A;  1RRO A;  5HKZ A;  3PAL A;  1BT6 A;  2ZN9 A;  1KCY A;  1S5G Y;  1Y1A A;  3PAT A;  2OPO A;  2L5X B;  5I2Q A;  2LAP A;  1SKT A;  4R1E A;  1UHI A;  2ZRS A;  1ALW A;  2A4J A;  4I5K A;  1K2H A;  1XFW O;  2F8P A;  4WQ3 A;  1U5I A;  1JUO A;  4DCK A;  1GGZ A;  1S5G Z;  1KFU S;  4C0J A;  5D69 A;  4HRH A;  4MN0 A;  1NCZ A;  1DGV A;  4CPV A;  2M49 B;  4E68 A;  2KNE A;  4PAL A;  1XFZ O;  2LE9 B;  1CLB A;  1NP8 A;  2FOT A;  3BQ3 A;  4N1G A;  3CR2 A;  1Y1X A;  4N1F A;  2GGM A;  1S6I A;  1XFX O;  2KYF A;  4PE1 A;  5K89 A;  5JJG A;  2KFG A;  2EHB A;  1AUI B;  2R2I A;  3DVK A;  3JVT C;  5GQQ C;  1MF8 B;  2M29 A;  2HQW A;  3BUM B;  1QS7 A;  1NX1 A;  3VRO A;  2ZNE A;  3WHU B;  1KFX S;  1YUR A;  1A2X A;  1MQ1 A;  4USL A;  3SIB A;  3E3R A;  5CSF A;  1CFP A;  2K0J A;  1PK0 D;  4OCI A;  3IQO A;  1F55 A;  1YTZ C;  1RK9 A;  2B1U A;  1GQM A;  5G08 A;  3TUY B;  3OP0 A;  4BY4 A;  4P5O E;  2K61 A;  1SK6 D;  1M31 A;  2PMY A;  3AKA A;  1AP4 A;  3VRQ A;  1OQP A;  2G2B A;  2FCD A;  3CWG A;  1LXF C;  3JVT B;  2M7L A;  1DF0 B;  1OOJ A;  1QIV A;  2JPT A;  3ZWH A;  1S3P A;  4YBH B;  1BJF A;  3BXK A;  2BBM A;  3OHM B;  2KOT A;  4HRE E;  2E30 A;  1KSM A;  2JT8 A;  5AXI A;  3FS7 A;  1PRW A;  1KSO A;  3LCP C;  2JRF A;  3DD4 A;  4M2Q A;  3A8R A;  2QPT A;  5CSJ A;  2CNP A;  2KGB C;  1A29 A;  2JNX A;  3I5I B;  4MEW A;  4XJK B;  1PAL A;  1BG1 A;  1UUS A;  4PDZ A;  3HX4 A;  2VRG A;  1F54 A;  3TDI A;  1OZO A;  3GK4 X;  2AUC A;  1WRK A;  3OB1 B;  1ZOT B;  1KWO C;  3D0Y B;  4FQO A;  1BR4 B;  1IGV A;  3CTN A;  1QV0 A;  2L50 A;  1WRL A;  4YGD B;  1SL7 A;  1YRU B;  1M46 A;  2L4H A;  2Q4U A;  1CKK A;  1HQV A;  2L98 A;  1ODB A;  2JOJ A;  2PRU A;  1CDP A;  2CBL A;  1DGU A;  4GGF C;  3TZ1 A;  1JWD A;  1H8B A;  2KI4 C;  4OVN F;  1DJG A;  1LA0 A;  4I5L B;  1SL8 A;  3DF0 B;  2CCM A;  4GAO A;  2I2R E;  1B8L A;  5CSI A;  1BF5 A;  4IL1 A;  2H61 C;  3OX6 A;  4PHM A;  1FW4 A;  1J7R A;  1S6C A;  1A75 B;  4OKH A;  3KPX A;  1YUT A;  1IJ5 A;  4TNC A;  3I5H C;  1BMO A;  3TDU A;  1KWO B;  2KBM A;  2LMU A;  2SAS A;  4NDC A;  4DRW A;  1CM4 A;  1SCV A;  1WLM A;  1K9K A;  2KAX A;  1XFV O;  1Y1U A;  4PHK A;  4HRG A;  1G33 A;  2KAY A;  4DIR A;  2NCP A;  1KK7 Y;  1DTL A;  1HT9 A;  4NDB A;  2O5G A;  1F4Q A;  3F45 A;  2TN4 A;  1SR6 C;  5HLV A;  1OZS A;  3AAK A;  1QX7 A;  2K2A A;  4I5N B;  1UP5 A;  2KI4 B;  2K7D A;  3SJS A;  2LVJ A;  2LMT A;  4FTG A;  1IG5 A;  2BL0 C;  1S36 A;  1OMV A;  1KK7 Z;  3BOW A;  1A4P A;  3CZT X;  3OX5 A;  5AFP A;  2WC8 A;  3SG6 A;  1F71 A;  3PLF B;  1XYD A;  4ORB B;  1TIZ A;  1XFY O;  3I5H B;  1V1F A;  1NSH A;  2K7O A;  2K8M B;  4L9M A;  3SG3 A;  2RGI A;  1YX7 A;  2WOR A;  2COL B;  1OMD A;  3LLE A;  1EXR A;  1XK4 A;  1BOD A;  1QVI Y;  1WDC C;  2FJU B;  3BUW B;  5IBW A;  1M45 A;  2BKI B;  2K7B A;  1UHN A;  1F70 A;  3EVU A;  1A75 A;  3EVR A;  4DUQ A;  2MJW B;  4YRU A;  3ZNI A;  1SR6 B;  4OR9 B;  2MLE C;  4PE0 A;  2Y4Q A;  4GPL B;  4PHN A;  1K96 A;  1IWQ A;  2JU0 A;  2F2O A;  2DOQ A;  2JZI A;  2M97 A;  1QVI Z;  3O6B A;  1F4O A;  1M63 B;  1K95 A;  3GOF A;  1KQM C;  4GGN A;  5KTY A;  1YRT B;  1MXE A;  1SNL A;  3BUN B;  1IH0 A;  1UWO A;  1LIN A;  1EL4 A;  1N0Y A;  2EGD A;  2GGZ A;  3EK7 A;  5HKW A;  3SG5 A;  4N5X A;  5HLO A;  2F3Z A;  1Q80 A;  3CR5 X;  5CSN A;  4NQG A;  2ISD A;  2BBN A;  3CR4 X;  5AEQ A;  2JQ6 A;  2JT3 A;  1RJV A;  2L2E A;  1REC A;  1EH2 A;  1F8H A;  1RTP 1;  3EK4 A;  4QJ4 B;  3VGO A;  1JC2 A;  1SRA A;  1AK8 A;  1B7T Y;  1OMR A;  1V1G A;  3EVV A;  1IKU A;  1KK8 C;  1GJY A;  2LHI A;  3CLN A;  1QAS A;  2PVB A;  5DKR A;  1QV1 A;  1TNQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...