5CSNA

S100b-rsk1 crystal structure c
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
94
structure length
94
Chain Sequence
GSHMSELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDNDGDGECDFQEFMAFVAMVTTACHEFFEH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein S100-B
publication title Structural Basis of Ribosomal S6 Kinase 1 (RSK1) Inhibition by S100B Protein: MODULATION OF THE EXTRACELLULAR SIGNAL-REGULATED KINASE (ERK) SIGNALING CASCADE IN A CALCIUM-DEPENDENT WAY.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 30
structure length 94
sequence length 94
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-07-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 5csnA00
1TNPA 1G33A 3PSRA 3NSLA 4PALA 3NSIA 5HLVA 3BUMB 2LCPA 2LMUA 2WNDA 1S5GY 2LUCA 1EJ3A 1DGUA 2I2RE 3TZ1A 1XFYO 2PMYA 3BOWB 4JQ0D 2I18A 3HCMA 1CFPA 1S6JA 2AMIA 2MJWB 4U8DA 1DJWA 1UHNA 2M8UA 2MBXA 3SJSA 2FOTA 1A75A 1Y1XA 3EK4A 1CDPA 4QJ4B 4PE7A 3DF0A 1FW4A 1E8AA 4GPLB 2JXLA 2COLB 1YRTB 1XFUO 1S5GZ 5KU1A 4OVNF 4BY4A 2JPTA 2LV7A 3D0YA 5KSZA 3EVRA 5D7FA 2MLFC 2HQWA 3LCPC 4YI9A 2CT9A 2CNPA 4DCKA 2CXJA 1YR5A 2JZIA 4JPZB 3PM8A 3ZWHA 5CSIA 4ZCUA 3SIAA 2BBMA 2BE4A 1B8RA 4USLA 2KBIA 1M46A 1NCYA 3EVUA 1W7JB 3DVJA 1EH2A 1FBVA 2F2PA 2LHIA 2M3WA 1NX0A 4GGFA 2O5GA 2EGDA 2NZ0A 2NCPA 3WHUB 5B8IB 4E68A 4FTGA 1JBAA 1QATA 1XYDA 1A2XA 1U5IA 1PALA 1QASA 1IJ5A 1MWNA 1NCZA 2M0RA 2F3ZA 2ZRTA 3EKJA 3AKBA 1AP4A 5I2LA 3PLFB 1YTZC 1NX1A 2KAYA 1RWYA 1YUTA 1UHHA 5I8NA 2WCFA 2LLTA 3I5HB 1S6IA 1DGVA 2JWWA 2LC5A 4GFTA 1AHRA 2H61A 3I5HC 4M2PA 2ZN9A 4IL1A 1IH0A 3OHMB 3CS1A 1DT7B 1XVJA 3TS5B 2LVJA 1B1GA 3TS5C 2K7BA 1K2HA 1DTLA 3BUWB 3WXAA 1K9UA 2K2AA 1QLKA 2HQ8A 1WDCB 2FCDA 5J3XA 1L2OB 1WDCC 1IG5A 1K90D 1L2OC 4PDZA 2BCBA 2OS8B 1PULA 1NIWA 2R2IA 2OS8C 3TDIA 1KK7Z 5HKZA 2JNFA 2KQYA 1UUSA 3I5GB 1WLMA 3RM1A 3I5FB 3I5GC 3RLZA 1H4BA 3I5FC 5AANA 1WLZA 2G9BA 2HF5A 3MSEB 4ICBA 3SG5A 2L50A 2K7DA 2KBMA 1AVSA 1YUUA 2WC8A 1TNWA 2M9GA 3KPXA 1KQVA 1N0YA 3HX4A 3EVVA 1YRUB 3O4YA 2QACA 1R6PA 1XFWO 3LK0A 2KSPA 1IKUA 1JC2A 1MXLC 2F2OA 3AAJA 1PRWA 2JXCA 2O60A 2DOQA 2QPTA 3TDZA 4DRWA 1LA0A 2KYFA 3GK2A 1YVLA 2JOJA 3CZTX 5AEQA 1SBJA 1CDMA 1ZFSA 4AOMA 1WRLA 2EHBA 4XJKA 1QX5B 3OB2B 3PN7B 2CBLA 2NLNA 1TNXA 2WCBA 3PN7C 2KQ6A 1FI5A 2L98A 2ZN8A 1Y0VH 1K9PA 4PHJA 4YGEB 1M63B 2LHLA 2E30A 1CNPA 2JT3A 1TCOB 4MZJA 1SPYA 1A75B 2M97A 4CLNA 3CWGA 3QRXA 1OMRA 1JSAA 2JU0A 3BQ3A 3PATA 2KAXA 1B8CA 5CSFA 4PHMA 1A29A 2TN4A 3D0YB 1AJ4A 4I5KA 4QJ3B 1ODBA 1KSOA 2WOSA 2LAPA 2LMVA 2KGRA 1BODA 2JTTA 2LP3A 3EK7A 2F33A 1DJIA 2E6WA 2PASA 1D1OA 1YUSA 2A4JA 1ZMZA 2WORA 1UURA 2LVIA 1XK4A 1F4QA 1S26D 2M1KB 1UHKA 4AQJA 3FIAA 1TOPA 2JTZA 4D1EA 1B4CA 3H4SE 3DVEA 1C7VA 2BE6A 5DKRA 4MZLA 1KFUS 1H8BA 1LVCD 2LUXA 4FQOA 3VRPA 2F8PA 3EK8A 1U5IB 1NSHA 2KOTA 4DUQA 3LK1A 2M7LA 2PSRA 3JTDB 3SG2A 3FWBA 3JTDC 5F6TA 3LLEA 4MRXA 2JULA 4PE4A 1YURA 1ALVA 2LE9B 1JF0A 4DIRA 1ZOTB 3BUXB 5DKNA 1DJXA 4ETOA 5JJGA 2K7CA 3KO0A 3FWCA 1OZSA 2H61C 1OOJA 2KGBC 1AJ5A 2LP2A 3SG7A 1QLSA 1OQPA 2IS9A 2LMTA 1JF2A 1TRFA 3WNXB 1QIVA 5CSJA 1OMDA 1DJHA 1CFDA 1F54A 1MXEA 1SR6B 2Y4QA 1KFXS 1SRAA 4YI8A 4CFQA 1SR6C 3NXAA 2CTNA 2KI6D 1QX2A 4F0ZB 3IQOA 4OKHA 3CR5X 1CB1A 1KSMA 1QVIY 1M39A 1J55A 1KK7Y 5GQQC 3VROA 1IQ3A 1L7ZA 5D69A 1F8HA 2D8NA 1K96A 3CR4X 3FS7A 4C0KA 1DJGA 4OV2A 1DJYA 1EXRA 1RECA 1M45A 1KK8B 2KI4B 1QS7A 1F55A 2KI4C 1KK8C 1XFZO 1KWOB 2Y5IA 4YGBB 4NDDA 1QVIZ 3OX6A 1KWOC 1Y6WA 2K2FA 3CR2A 2GV5A 2KI6C 4CPVA 4OR9B 1DF0B 1G4YR 1PVAA 4MN0A 4XJKB 4YGCB 1LINA 3CTNA 2JT8A 1HT9A 2LLSA 1NYAA 4P2YB 1SCMB 4PE1A 4ZCVA 4YRUA 1QJTA 1SCMC 1UHJA 2L0PA 3ICBA 1K93D 2M49B 3OB1B 4GGNA 1N2DA 4A4CA 1S36A 1QV1A 3GK1A 5AERA 1BF5A 4YGAA 1CLMA 3BYAA 5CSNA 4MVFA 1ALWA 1IQ5A 1XFXO 1ZUZA 4Q04A 1N65A 1K9KA 2ZNEA 3TDUA 1BLQA 4L9MA 1F71A 1JFKA 3M0WA 1B9AA 2OPOA 1J1DA 1SNLA 4YGDB 4QJ5B 1Y1AA 3O6BA 1FI6A 1C7WA 1PSBA 2RGIA 3CGAA 5IBWA 1JWDA 2Q4UA 1OMVA 1FF1A 1CFCA 1NUBA 1XFVO 1WRKA 2KFGA 3O2PA 4MEWA 4GBAA 3IF7A 1S3PA 3DVMA 4AQIA 2BBNA 2GGZA 1GGWA 4C0LA 4N1GA 4HRHA 1OE9B 1LXFC 1M31A 1XK4C 2Y1MA 5HKWA 1RK9A 4I5LB 3NSKA 3DF0B 1GGZA 1YX8A 1W7IB 1KQMB 1RTP1 2LANA 5FYXA 1NPQA 1KQMC 1FPWA 1TCFA 2JC2A 3O78A 1J7OA 2M7NA 1YX7A 1UHIA 2K61A 4C0JA 1BJFA 5JOLA 2M29A 2CCMA 1UP5A 4CIDA 3SG4A 2KYCA 1CDNA 1SK6D 2K7OA 2I7AA 2K0JA 4TNCA 1NX2A 5G08A 2B1UA 3SG3A 1J1EA 2L2EA 1TNQA 2I94A 1RROA 2JNXA 3GK4X 1CMFA 2ZFDA 4MZKA 1IRJA 1BR4B 3BUNB 3CLNA 1MHOA 1MQ1A 5HKYA 2Y1NA 1PVBA 3A4UB 3AAKA 3PALA 4MRYA 4GGFC 1TIZA 4CFRA 3VRNA 1CFFA 2G2BA 3OX5A 2V53A 1F4OA 1BT6A 2M1UA 2MLEC 2NCOA 1JUOA 1EG3A 4GAOA 4M2OA 4BY5A 1NX3A 1AK8A 2NXQA 2LLUA 4GNKB 1SCVA 1SW8A 1GQMA 3F45A 3KF9A 1B47A 1X02A 3NSOA 4M2QA 4ORCB 1BR1B 4ORAB 1CM4A 2BCAA 1B8LA 1CM1A 4MBEA 1CLBA 2BCXA 2GGMA 2SCPA 1SL9A 1BMOA 1NP8A 3ZNIA 2OTGB 3D10A 1TN4A 2KFHA 3K21A 4WQ3A 2ISDA 2OTGC 1KFUL 1WRZA 3DD4A 1RFJA 4WQ2A 2JQ6A 1WY9A 5K89A 2LVKA 1BOCA 3BOWA 2MHHA 2JT0A 3VRRA 4HRGA 4HREE 3DVKA 3TUYB 1OZOA 4JWQA 2L4HA 3TUYC 2K8MB 1B7TY 1K8UA 1CKKA 3IQQA 2FJUB 3LL8B 3OP0A 3EKHA 1G8IA 2ZKMX 4NDCA 1CLLA 1HQVA 4N5XA 4WRIA 4PE0A 3C1VA 2BKIB 4UPGA 1C07A 2BECA 1OSAA 1MR8A 3AKAA 1JFJA 2KDHA 2PALA 2WCEA 1SYMA 2L4IA 1IGVA 2PVBA 1B7TZ 1VRKA 5HYDA 1ZACA 1LA3A 2L5XB 1KFXL 3BXKA 2ZNDA 1LKJA 1BG1A 3WHTB 1S1EA 1QIWA 2BL0B 2BL0C 5CPVA 2KFFA 2KNEA 4ORBB 2P6BB 4DS7A 5TNCA 5KTYA 2MA2A 3VRQA 5BPJA 1DVIA 2AUCA 1UWOA 1KCYA 2LNKA 1RJVA 2HETA 1F70A 2KHNA 2LM5A 2FCEA 3BUOB 3KHEA 3PFVA 2KAVA 4NQGA 4I5NB 1NCXA 1QXPA 4PHKA 1NWDA 4PCWA 1CDLA 1BU3A 2Q91A 1SY9A 1MUXA 1YVHA 1IJ6A 1K95A 1TTXA 5HLOA 1PSRA 2MAZA 1AUIB 4NDBA 1EG4A 2LVVA 4R1EA 3SIBA 1CMGA 1A03A 1SMGA 1XA5A 1SKTA 3I5IB 2ZRSA 1DMOA 3I5IC 2BKHB 1R2UA 3A8RA 3JVTB 1XO5A 3KEVA 4MSPA 4P5OE 5ER4X 1IWQA 3JVTC 1DJZA 1CTRA 5PALA 4N1FA 1Y1UA 1A4PA 2F3YA 1GJYA 1EL4A 1QTXA 2MRDA 2L51A 2PRUA 4PHNA 4HSZA 5I2QA 1QV0A 1S6CA 3GOFA 4A4BA 2EC6B 1MF8B 3VGOA 5ER5A 2EC6C 1DF0A 5AFPA 5AXIA 2VRGA 2SASA 1SL7A 4OCIA 2H2KA 2HPSA 2AAOA 5DKQA 1K94A 4YBHB 1J7PA 1J7RA 1PK0D 4GUKA 1QX7A 1Q80A 4MLWA 3E3RA 1J7QA 4I5JA 4XYNA 2JRFA 1V1GA 3SG6A 1SL8A 1V1FA 5I2OA
chains in the Genus database with same CATH superfamily
1TNPA 3BFAA 1G33A 3PSRA 3NSLA 4PALA 3NSIA 5HLVA 3BUMB 2LCPA 2LMUA 2WNDA 1S5GY 2LUCA 1EJ3A 1DGUA 2I2RE 3TZ1A 1XFYO 2PMYA 3BOWB 4JQ0D 2I18A 3HCMA 1CFPA 3RZSA 1S6JA 2AMIA 2MJWB 4U8DA 1DJWA 1UHNA 2M8UA 3L4LA 3OGNA 2FOTA 2MBXA 3SJSA 1A75A 1Y1XA 2QDIA 1CDPA 3EK4A 4QJ4B 4PE7A 3DF0A 1FW4A 3CZ2A 1E8AA 4GPLB 2JXLA 1P28A 1YRTB 2COLB 4JD9A 1LS8A 1XFUO 1S5GZ 5KU1A 4OVNF 4BY4A 2JPTA 2LV7A 3D0YA 5KSZA 3EVRA 3K1EA 5D7FA 2MLFC 2HQWA 3LCPC 3S0FA 4YI9A 2CT9A 2CNPA 4DCKA 2CXJA 1YR5A 1CLBA 2JZIA 4JPZB 3PM8A 3ZWHA 5CSIA 4ZCUA 3SIAA 2BBMA 2BE4A 1B8RA 3O4XA 1TUJA 2KBIA 4USLA 1M46A 4IJ7A 3UNWA 1NCYA 3EVUA 1W7JB 3DVJA 1EH2A 1FBVA 2F2PA 2LHIA 2M3WA 1NX0A 2GTEA 4GGFA 5D3OA 3VB1A 2O5GA 2EGDA 2NZ0A 2NCPA 3V2LA 3WHUB 5B8IB 4E68A 4FTGA 2WCLA 1JBAA 1QATA 1XYDA 1A2XA 1U5IA 1PALA 1QASA 1IJ5A 1MWNA 1NCZA 2M0RA 1DELA 1SSEB 2F3ZA 2ZRTA 3EKJA 2QEVA 3AKBA 1AP4A 5I2LA 3PLFB 1YTZC 1NX1A 2KAYA 1RWYA 1YUTA 1UHHA 2KLEA 2WCFA 2LLTA 1Z2CB 5I8NA 3I5HB 3D76A 1S6IA 1DGVA 2JWWA 2K60A 2LC5A 1AHRA 2H61A 3I5HC 4GFTA 4M2PA 2ZN9A 4IL1A 1IH0A 3OHMB 3CS1A 3FE9A 1XVJA 3TS5B 3DYEA 2LVJA 1DT7B 1B1GA 3TS5C 2K7BA 1K2HA 1DTLA 3BUWB 3WXAA 1K9UA 2K2AA 3B7AA 1QLKA 2HQ8A 1WDCB 2FCDA 1GM0A 5J3XA 1L2OB 1WDCC 2PQLA 1IG5A 1K90D 1L2OC 4PDZA 2BCBA 2OS8B 1PULA 1NIWA 2R2IA 2OS8C 3TDIA 1KK7Z 5HKZA 2JNFA 2KQYA 1UUSA 3I5GB 3SS4A 1WLMA 3RM1A 5FI2A 3I5FB 3I5GC 3RLZA 1H4BA 3I5FC 2ERBA 5AANA 1WLZA 2G9BA 2HF5A 3MSEB 4ICBA 3SG5A 2L50A 2K7DA 2L2CA 2KBMA 1AVSA 1YUUA 2WC8A 5EL2A 1TNWA 2M9GA 3KPXA 1KQVA 1N0YA 3HX4A 3EVVA 1YRUB 3O4YA 2QACA 1R6PA 1XFWO 3LK0A 2KSPA 1IKUA 1JC2A 1MXLC 3S0DA 2F2OA 3AAJA 1PRWA 2JXCA 2O60A 2DOQA 2QPTA 3TDZA 4DRWA 1LA0A 2KYFA 3GK2A 1YVLA 2JOJA 3CZTX 5AEQA 1SBJA 1CDMA 1ZFSA 4AOMA 1WRLA 2EHBA 4XJKA 1QX5B 3OB2B 3PN7B 2CBLA 2NLNA 1TNXA 2WCBA 3PN7C 2KQ6A 1FI5A 2L98A 2ZN8A 1Y0VH 1K9PA 4PHJA 4YGEB 1M63B 2LHLA 2E30A 1CNPA 2JT3A 1TCOB 4MZJA 1SPYA 1A75B 2M97A 4CLNA 3CWGA 3QRXA 1OMRA 1JSAA 2JU0A 3BQ3A 3PATA 2KAXA 2WCKA 1B8CA 5CSFA 4PHMA 1A29A 2L5YA 3BJHA 1IIOA 2TN4A 3D0YB 1AJ4A 4I5KA 4QJ3B 1ODBA 1KSOA 1DQEA 2WOSA 2LAPA 2LMVA 2KGRA 1BODA 2JTTA 2LP3A 3EK7A 2F33A 4KYNA 1DJIA 2E6WA 2PASA 1D1OA 1YUSA 2A4JA 1ZMZA 2WORA 1UURA 2LVIA 1XK4A 2QEBA 1W9ZA 1F4QA 1S26D 2M1KB 1UHKA 4AQJA 3FIAA 1TOPA 2JTZA 4D1EA 1B4CA 3H4SE 3DVEA 1C7VA 2BE6A 5DKRA 4MZLA 1KFUS 1H8BA 1LVCD 3DY9A 2LUXA 4FQOA 3VRPA 3QMEA 3SS3A 2F8PA 3EK8A 1U5IB 1NSHA 2KOTA 4DUQA 3LK1A 2M7LA 4PT1A 3S0GA 2PSRA 4FQTA 3JTDB 3SG2A 3FWBA 3JTDC 5F6TA 3LLEA 1OOGA 2PYQA 4MRXA 2JULA 3N7HA 4PE4A 1YURA 1ALVA 2LE9B 1JF0A 4DIRA 1ZOTB 3BUXB 2P71A 1DJXA 5DKNA 4ETOA 5JJGA 3NHIA 2K7CA 3KO0A 3FWCA 1OZSA 2H61C 1OOJA 2KGBC 1AJ5A 2LP2A 3SG7A 1QLSA 1OQPA 2IS9A 2LMTA 4JKTA 1JF2A 1TRFA 3WNXB 1QIVA 5CSJA 1OMDA 1DJHA 1CFDA 5I94A 1F54A 1MXEA 1SR6B 2Y4QA 2WCJA 1KFXS 1SRAA 4YI8A 4CFQA 1SR6C 3NXAA 2CTNA 2YGUA 2KI6D 1QX2A 4F0ZB 3IQOA 4OKHA 3DXLA 3CR5X 1CB1A 1KSMA 1QVIY 1M39A 1J55A 1KK7Y 1XFRA 3FE6A 5FI6A 5GQQC 3VROA 1IQ3A 1L7ZA 5D69A 1F8HA 2D8NA 1K96A 3BFBA 3CR4X 3FS7A 4C0KA 1DJGA 3R1OA 4OV2A 3D73A 3S0BA 1DJYA 1EXRA 1RECA 1M45A 1KK8B 2KI4B 1QS7A 1F55A 2KI4C 1KK8C 1XFZO 1KWOB 2Y5IA 4YGBB 4NDDA 1QVIZ 3OX6A 1KWOC 1Y6WA 2K2FA 3CR2A 3CZ0A 2GV5A 2KI6C 4CPVA 4OR9B 1DF0B 1G4YR 1PVAA 1Z4HA 4MN0A 4XJKB 4YGCB 1LINA 3CTNA 2JT8A 1HT9A 2LLSA 1NYAA 4P2YB 1SCMB 4OZDA 4PE1A 4ZCVA 4YRUA 1QJTA 1SCMC 1UHJA 2L0PA 3ICBA 1K93D 2M49B 3OB1B 4GGNA 1N2DA 4A4CA 1S36A 1QV1A 3GK1A 5AERA 1BF5A 4YGAA 1CLMA 3BYAA 2QEHA 5CSNA 4MVFA 1ALWA 1IQ5A 1XFXO 1ZUZA 4Q04A 1N65A 1K9KA 2ZNEA 3TDUA 1BLQA 4L9MA 1F71A 1JFKA 3M0WA 1B9AA 2OPOA 1J1DA 1SNLA 4YGDB 4QJ5B 1Y1AA 3O6BA 3DZTA 1C7WA 1FI6A 1PSBA 2RGIA 3CGAA 3PM2A 5FI7A 5IBWA 1JWDA 2Q4UA 1OMVA 1FF1A 1CFCA 1NUBA 1XFVO 1WRKA 2KFGA 3O2PA 4MEWA 4GBAA 3IF7A 1S3PA 3DVMA 4AQIA 2BBNA 1C3ZA 2GGZA 1GGWA 4C0LA 4N1GA 4HRHA 1OE9B 1LXFC 1M31A 1XK4C 2Y1MA 5HKWA 1RK9A 4I5LB 3NSKA 3DF0B 1ORGA 3D75A 1GGZA 1YX8A 1W7IB 3CYZA 1KQMB 1RTP1 2LANA 5FYXA 1C3YA 1NPQA 1KQMC 1FPWA 1TCFA 2JC2A 3O78A 1J7OA 2M7NA 1YX7A 1UHIA 2K61A 4C0JA 1T14A 1BJFA 3S0AA 3B88A 5JOLA 2M29A 2CCMA 1UP5A 4CIDA 3SG4A 1OW4A 2KYCA 1CDNA 1SK6D 2K7OA 2I7AA 2K0JA 3NGVA 4INWA 4TNCA 1NX2A 5G08A 2B1UA 3SG3A 1J1EA 3R72A 2L2EA 1TNQA 2I94A 3BFHA 1RROA 2JNXA 3GK4X 1CMFA 3D78A 2ZFDA 4MZKA 1IRJA 1BR4B 3BUNB 3CLNA 1DC1A 2BAPA 1MHOA 1MQ1A 1TWOA 2Y1NA 2JPOA 1OOIX 1PVBA 3Q8IA 5HKYA 3A4UB 3AAKA 3PALA 4MRYA 4GGFC 1TIZA 3CDNA 3VRNA 4CFRA 1CFFA 2G2BA 3OX5A 2V53A 1F4OA 1BT6A 2M1UA 2MLEC 2QEOA 2NCOA 1JUOA 1EG3A 4GAOA 4M2OA 4BY5A 1NX3A 1OOHA 1AK8A 5HL1A 2NXQA 2LLUA 4GNKB 1SCVA 1SW8A 1GQMA 3F45A 3KF9A 1B47A 1X02A 3NSOA 4M2QA 4ORCB 3IVTA 1BR1B 4ORAB 1CM4A 2BCAA 1B8LA 1CM1A 4MBEA 3L4AA 2BCXA 2GGMA 2SCPA 1SL9A 1BMOA 1NP8A 3ZNIA 2OTGB 3D10A 1TN4A 2KFHA 3K21A 4WQ3A 2ISDA 2OTGC 1KFUL 1TUZA 1WRZA 3DD4A 1RFJA 4WQ2A 2JQ6A 1WY9A 5K89A 2LVKA 3B6XA 3BOWA 2MHHA 1BOCA 2JT0A 3VRRA 4HRGA 4HREE 3DVKA 3B87A 3CZ1A 3TUYB 1OZOA 4JWQA 2L4HA 2P70A 3TUYC 2K8MB 2WC6A 1B7TY 1K8UA 1CKKA 3IQQA 2WC5A 2FJUB 3LL8B 3OP0A 3EKHA 4INXA 1G8IA 3UO9A 2ZKMX 4NDCA 1CLLA 1HQVA 4N5XA 2FJYA 4WRIA 4PE0A 2H8VA 3C1VA 2BKIB 4UPGA 3D77A 1C07A 1DEKA 1OSAA 1MR8A 2BECA 3AKAA 1JFJA 2KDHA 2PALA 2WCEA 1SYMA 2L4IA 1IGVA 2PVBA 1B7TZ 1VRKA 5HYDA 1ZACA 1LA3A 1QWVA 2L5XB 1KFXL 3L47A 3BXKA 2ZNDA 1LKJA 3S0EA 1BG1A 3WHTB 1S1EA 1QIWA 2BL0B 3R1PA 2BL0C 5CPVA 2KFFA 2KNEA 4ORBB 2P6BB 2WCHA 4DS7A 5TNCA 5KTYA 2MA2A 3VRQA 3EG5B 3CABA 5BPJA 3SS5A 1DVIA 2AUCA 1UWOA 1KCYA 5DICA 2LNKA 2WCMA 1RJVA 2HETA 1F70A 2KHNA 2LM5A 2FCEA 3BUOB 3KHEA 3PFVA 2KAVA 4NQGA 4I5NB 1NCXA 1QXPA 4PHKA 1NWDA 4PCWA 1CDLA 1BU3A 2Q91A 1SY9A 1MUXA 1YVHA 3D74A 1IJ6A 1K95A 1TTXA 5HLOA 1PSRA 2MAZA 1AUIB 4NDBA 1EG4A 2LVVA 4R1EA 3SIBA 1CMGA 1A03A 1SMGA 1XA5A 1SKTA 3I5IB 2ZRSA 3PJIA 1DMOA 3I5IC 2BKHB 1R2UA 3A8RA 3JVTB 1XO5A 3KEVA 4MSPA 4P5OE 5ER4X 1IWQA 3JVTC 1DJZA 1CTRA 5PALA 4N1FA 1Y1UA 1A4PA 2F3YA 3B86A 1GJYA 1OOFA 1EL4A 1QTXA 2BNXA 2MRDA 2L51A 3NHTA 2PRUA 4PHNA 4HSZA 4F7FA 5I2QA 1QV0A 1S6CA 3GOFA 4A4BA 2EC6B 1MF8B 3VGOA 5ER5A 2EC6C 1DF0A 5AFPA 5AXIA 2VRGA 2SASA 1SL7A 3R1VA 2H2KA 2HPSA 3OBVA 2AAOA 4OCIA 5DKQA 1K94A 4YBHB 1J7PA 1J7RA 1PK0D 4GUKA 1QX7A 1Q80A 2KPHA 4MLWA 3E3RA 2KLDA 1J7QA 4I5JA 4XYNA 2JRFA 1V1GA 3SG6A 1SL8A 1V1FA 5I2OA 3FE8A
chains in the Genus database with same CATH topology
1TNPA 1G33A 3PSRA 3NSLA 4PALA 3NSIA 5HLVA 3BUMB 2LCPA 2LMUA 2WNDA 1S5GY 2LUCA 1EJ3A 1DGUA 2I2RE 3TZ1A 1XFYO 2PMYA 3BOWB 4JQ0D 2I18A 3HCMA 1CFPA 1S6JA 2AMIA 2MJWB 4U8DA 1DJWA 1UHNA 2M8UA 2MBXA 3SJSA 2FOTA 1A75A 1Y1XA 3EK4A 1CDPA 4QJ4B 4PE7A 3DF0A 1FW4A 1E8AA 4GPLB 2JXLA 2COLB 1YRTB 1XFUO 1S5GZ 5KU1A 4OVNF 4BY4A 2JPTA 2LV7A 3D0YA 5KSZA 3EVRA 5D7FA 2MLFC 2HQWA 3LCPC 4YI9A 2CT9A 2CNPA 4DCKA 2CXJA 1YR5A 2JZIA 4JPZB 3PM8A 3ZWHA 5CSIA 4ZCUA 3SIAA 2BBMA 2BE4A 1B8RA 4USLA 2KBIA 1M46A 1NCYA 3EVUA 1W7JB 3DVJA 1EH2A 1FBVA 2F2PA 2LHIA 2M3WA 1NX0A 4GGFA 2O5GA 2EGDA 2NZ0A 2NCPA 3WHUB 5B8IB 4E68A 4FTGA 1JBAA 1QATA 1XYDA 1A2XA 1U5IA 1PALA 1QASA 1IJ5A 1MWNA 1NCZA 2M0RA 2F3ZA 2ZRTA 3EKJA 3AKBA 1AP4A 5I2LA 3PLFB 1YTZC 1NX1A 2KAYA 1RWYA 1YUTA 1UHHA 5I8NA 2WCFA 2LLTA 3I5HB 1S6IA 1DGVA 2JWWA 2LC5A 4GFTA 1AHRA 2H61A 3I5HC 4M2PA 2ZN9A 4IL1A 1IH0A 3OHMB 3CS1A 1DT7B 1XVJA 3TS5B 2LVJA 1B1GA 3TS5C 2K7BA 1K2HA 1DTLA 3BUWB 3WXAA 1K9UA 2K2AA 1QLKA 2HQ8A 1WDCB 2FCDA 5J3XA 1L2OB 1WDCC 1IG5A 1K90D 1L2OC 4PDZA 2BCBA 2OS8B 1PULA 1NIWA 2R2IA 2OS8C 3TDIA 1KK7Z 5HKZA 2JNFA 2KQYA 1UUSA 3I5GB 1WLMA 3RM1A 3I5FB 3I5GC 3RLZA 1H4BA 3I5FC 5AANA 1WLZA 2G9BA 2HF5A 3MSEB 4ICBA 3SG5A 2L50A 2K7DA 2KBMA 1AVSA 1YUUA 2WC8A 1TNWA 2M9GA 3KPXA 1KQVA 1N0YA 3HX4A 3EVVA 1YRUB 3O4YA 2QACA 1R6PA 1XFWO 3LK0A 2KSPA 1IKUA 1JC2A 1MXLC 2F2OA 3AAJA 1PRWA 2JXCA 2O60A 2DOQA 2QPTA 3TDZA 4DRWA 1LA0A 2KYFA 3GK2A 1YVLA 2JOJA 3CZTX 5AEQA 1SBJA 1CDMA 1ZFSA 4AOMA 1WRLA 2EHBA 4XJKA 1QX5B 3OB2B 3PN7B 2CBLA 2NLNA 1TNXA 2WCBA 3PN7C 2KQ6A 1FI5A 2L98A 2ZN8A 1Y0VH 1K9PA 4PHJA 4YGEB 1M63B 2LHLA 2E30A 1CNPA 2JT3A 1TCOB 4MZJA 1SPYA 1A75B 2M97A 4CLNA 3CWGA 3QRXA 1OMRA 1JSAA 2JU0A 3BQ3A 3PATA 2KAXA 1B8CA 5CSFA 4PHMA 1A29A 2TN4A 3D0YB 1AJ4A 4I5KA 4QJ3B 1ODBA 1KSOA 2WOSA 2LAPA 2LMVA 2KGRA 1BODA 2JTTA 2LP3A 3EK7A 2F33A 1DJIA 2E6WA 2PASA 1D1OA 1YUSA 2A4JA 1ZMZA 2WORA 1UURA 2LVIA 1XK4A 1F4QA 1S26D 2M1KB 1UHKA 4AQJA 3FIAA 1TOPA 2JTZA 4D1EA 1B4CA 3H4SE 3DVEA 1C7VA 2BE6A 5DKRA 4MZLA 1KFUS 1H8BA 1LVCD 2LUXA 4FQOA 3VRPA 2F8PA 3EK8A 1U5IB 1NSHA 2KOTA 4DUQA 3LK1A 2M7LA 2PSRA 3JTDB 3SG2A 3FWBA 3JTDC 5F6TA 3LLEA 4MRXA 2JULA 4PE4A 1YURA 1ALVA 2LE9B 1JF0A 4DIRA 1ZOTB 3BUXB 5DKNA 1DJXA 4ETOA 5JJGA 2K7CA 3KO0A 3FWCA 1OZSA 2H61C 1OOJA 2KGBC 1AJ5A 2LP2A 3SG7A 1QLSA 1OQPA 2IS9A 2LMTA 1JF2A 1TRFA 3WNXB 1QIVA 5CSJA 1OMDA 1DJHA 1CFDA 1F54A 1MXEA 1SR6B 2Y4QA 1KFXS 1SRAA 4YI8A 4CFQA 1SR6C 3NXAA 2CTNA 2KI6D 1QX2A 4F0ZB 3IQOA 4OKHA 3CR5X 1CB1A 1KSMA 1QVIY 1M39A 1J55A 1KK7Y 5GQQC 3VROA 1IQ3A 1L7ZA 5D69A 1F8HA 2D8NA 1K96A 3CR4X 3FS7A 4C0KA 1DJGA 4OV2A 1DJYA 1EXRA 1RECA 1M45A 1KK8B 2KI4B 1QS7A 1F55A 2KI4C 1KK8C 1XFZO 1KWOB 2Y5IA 4YGBB 4NDDA 1QVIZ 3OX6A 1KWOC 1Y6WA 2K2FA 3CR2A 2GV5A 2KI6C 4CPVA 4OR9B 1DF0B 1G4YR 1PVAA 4MN0A 4XJKB 4YGCB 1LINA 3CTNA 2JT8A 1HT9A 2LLSA 1NYAA 4P2YB 1SCMB 4PE1A 4ZCVA 4YRUA 1QJTA 1SCMC 1UHJA 2L0PA 3ICBA 1K93D 2M49B 3OB1B 4GGNA 1N2DA 4A4CA 1S36A 1QV1A 3GK1A 5AERA 1BF5A 4YGAA 1CLMA 3BYAA 5CSNA 4MVFA 1ALWA 1IQ5A 1XFXO 1ZUZA 4Q04A 1N65A 1K9KA 2ZNEA 3TDUA 1BLQA 4L9MA 1F71A 1JFKA 3M0WA 1B9AA 2OPOA 1J1DA 1SNLA 4YGDB 4QJ5B 1Y1AA 3O6BA 1FI6A 1C7WA 1PSBA 2RGIA 3CGAA 5IBWA 1JWDA 2Q4UA 1OMVA 1FF1A 1CFCA 1NUBA 1XFVO 1WRKA 2KFGA 3O2PA 4MEWA 4GBAA 3IF7A 1S3PA 3DVMA 4AQIA 2BBNA 2GGZA 1GGWA 4C0LA 4N1GA 4HRHA 1OE9B 1LXFC 1M31A 1XK4C 2Y1MA 5HKWA 1RK9A 4I5LB 3NSKA 3DF0B 1GGZA 1YX8A 1W7IB 1KQMB 1RTP1 2LANA 5FYXA 1NPQA 1KQMC 1FPWA 1TCFA 2JC2A 3O78A 1J7OA 2M7NA 1YX7A 1UHIA 2K61A 4C0JA 1BJFA 5JOLA 2M29A 2CCMA 1UP5A 4CIDA 3SG4A 2KYCA 1CDNA 1SK6D 2K7OA 2I7AA 2K0JA 4TNCA 1NX2A 5G08A 2B1UA 3SG3A 1J1EA 2L2EA 1TNQA 2I94A 1RROA 2JNXA 3GK4X 1CMFA 2ZFDA 4MZKA 1IRJA 1BR4B 3BUNB 3CLNA 1MHOA 1MQ1A 5HKYA 2Y1NA 1PVBA 3A4UB 3AAKA 3PALA 4MRYA 4GGFC 1TIZA 4CFRA 3VRNA 1CFFA 2G2BA 3OX5A 2V53A 1F4OA 1BT6A 2M1UA 2MLEC 2NCOA 1JUOA 1EG3A 4GAOA 4M2OA 4BY5A 1NX3A 1AK8A 2NXQA 2LLUA 4GNKB 1SCVA 1SW8A 1GQMA 3F45A 3KF9A 1B47A 1X02A 3NSOA 4M2QA 4ORCB 1BR1B 4ORAB 1CM4A 2BCAA 1B8LA 1CM1A 4MBEA 1CLBA 2BCXA 2GGMA 2SCPA 1SL9A 1BMOA 1NP8A 3ZNIA 2OTGB 3D10A 1TN4A 2KFHA 3K21A 4WQ3A 2ISDA 2OTGC 1KFUL 1WRZA 3DD4A 1RFJA 4WQ2A 2JQ6A 1WY9A 5K89A 2LVKA 1BOCA 3BOWA 2MHHA 2JT0A 3VRRA 4HRGA 4HREE 3DVKA 3TUYB 1OZOA 4JWQA 2L4HA 3TUYC 2K8MB 1B7TY 1K8UA 1CKKA 3IQQA 2FJUB 3LL8B 3OP0A 3EKHA 1G8IA 2ZKMX 4NDCA 1CLLA 1HQVA 4N5XA 4WRIA 4PE0A 3C1VA 2BKIB 4UPGA 1C07A 2BECA 1OSAA 1MR8A 3AKAA 1JFJA 2KDHA 2PALA 2WCEA 1SYMA 2L4IA 1IGVA 2PVBA 1B7TZ 1VRKA 5HYDA 1ZACA 1LA3A 2L5XB 1KFXL 3BXKA 2ZNDA 1LKJA 1BG1A 3WHTB 1S1EA 1QIWA 2BL0B 2BL0C 5CPVA 2KFFA 2KNEA 4ORBB 2P6BB 4DS7A 5TNCA 5KTYA 2MA2A 3VRQA 5BPJA 1DVIA 2AUCA 1UWOA 1KCYA 2LNKA 1RJVA 2HETA 1F70A 2KHNA 2LM5A 2FCEA 3BUOB 3KHEA 3PFVA 2KAVA 4NQGA 4I5NB 1NCXA 1QXPA 4PHKA 1NWDA 4PCWA 1CDLA 1BU3A 2Q91A 1SY9A 1MUXA 1YVHA 1IJ6A 1K95A 1TTXA 5HLOA 1PSRA 2MAZA 1AUIB 4NDBA 1EG4A 2LVVA 4R1EA 3SIBA 1CMGA 1A03A 1SMGA 1XA5A 1SKTA 3I5IB 2ZRSA 1DMOA 3I5IC 2BKHB 1R2UA 3A8RA 3JVTB 1XO5A 3KEVA 4MSPA 4P5OE 5ER4X 1IWQA 3JVTC 1DJZA 1CTRA 5PALA 4N1FA 1Y1UA 1A4PA 2F3YA 1GJYA 1EL4A 1QTXA 2MRDA 2L51A 2PRUA 4PHNA 4HSZA 5I2QA 1QV0A 1S6CA 3GOFA 4A4BA 2EC6B 1MF8B 3VGOA 5ER5A 2EC6C 1DF0A 5AFPA 5AXIA 2VRGA 2SASA 1SL7A 4OCIA 2H2KA 2HPSA 2AAOA 5DKQA 1K94A 4YBHB 1J7PA 1J7RA 1PK0D 4GUKA 1QX7A 1Q80A 4MLWA 3E3RA 1J7QA 4I5JA 4XYNA 2JRFA 1V1GA 3SG6A 1SL8A 1V1FA 5I2OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TNP A;  1G33 A;  3PSR A;  3NSL A;  4PAL A;  3NSI A;  5HLV A;  3BUM B;  2LCP A;  2LMU A;  2WND A;  1S5G Y;  2LUC A;  1EJ3 A;  1DGU A;  2I2R E;  3TZ1 A;  1XFY O;  2PMY A;  3BOW B;  4JQ0 D;  2I18 A;  3HCM A;  1CFP A;  1S6J A;  2AMI A;  2MJW B;  4U8D A;  1DJW A;  1UHN A;  2M8U A;  2MBX A;  3SJS A;  2FOT A;  1A75 A;  1Y1X A;  3EK4 A;  1CDP A;  4QJ4 B;  4PE7 A;  3DF0 A;  1FW4 A;  1E8A A;  4GPL B;  2JXL A;  2COL B;  1YRT B;  1XFU O;  1S5G Z;  5KU1 A;  4OVN F;  4BY4 A;  2JPT A;  2LV7 A;  3D0Y A;  5KSZ A;  3EVR A;  5D7F A;  2MLF C;  2HQW A;  3LCP C;  4YI9 A;  2CT9 A;  2CNP A;  4DCK A;  2CXJ A;  1YR5 A;  2JZI A;  4JPZ B;  3PM8 A;  3ZWH A;  5CSI A;  4ZCU A;  3SIA A;  2BBM A;  2BE4 A;  1B8R A;  4USL A;  2KBI A;  1M46 A;  1NCY A;  3EVU A;  1W7J B;  3DVJ A;  1EH2 A;  1FBV A;  2F2P A;  2LHI A;  2M3W A;  1NX0 A;  4GGF A;  2O5G A;  2EGD A;  2NZ0 A;  2NCP A;  3WHU B;  5B8I B;  4E68 A;  4FTG A;  1JBA A;  1QAT A;  1XYD A;  1A2X A;  1U5I A;  1PAL A;  1QAS A;  1IJ5 A;  1MWN A;  1NCZ A;  2M0R A;  2F3Z A;  2ZRT A;  3EKJ A;  3AKB A;  1AP4 A;  5I2L A;  3PLF B;  1YTZ C;  1NX1 A;  2KAY A;  1RWY A;  1YUT A;  1UHH A;  5I8N A;  2WCF A;  2LLT A;  3I5H B;  1S6I A;  1DGV A;  2JWW A;  2LC5 A;  4GFT A;  1AHR A;  2H61 A;  3I5H C;  4M2P A;  2ZN9 A;  4IL1 A;  1IH0 A;  3OHM B;  3CS1 A;  1DT7 B;  1XVJ A;  3TS5 B;  2LVJ A;  1B1G A;  3TS5 C;  2K7B A;  1K2H A;  1DTL A;  3BUW B;  3WXA A;  1K9U A;  2K2A A;  1QLK A;  2HQ8 A;  1WDC B;  2FCD A;  5J3X A;  1L2O B;  1WDC C;  1IG5 A;  1K90 D;  1L2O C;  4PDZ A;  2BCB A;  2OS8 B;  1PUL A;  1NIW A;  2R2I A;  2OS8 C;  3TDI A;  1KK7 Z;  5HKZ A;  2JNF A;  2KQY A;  1UUS A;  3I5G B;  1WLM A;  3RM1 A;  3I5F B;  3I5G C;  3RLZ A;  1H4B A;  3I5F C;  5AAN A;  1WLZ A;  2G9B A;  2HF5 A;  3MSE B;  4ICB A;  3SG5 A;  2L50 A;  2K7D A;  2KBM A;  1AVS A;  1YUU A;  2WC8 A;  1TNW A;  2M9G A;  3KPX A;  1KQV A;  1N0Y A;  3HX4 A;  3EVV A;  1YRU B;  3O4Y A;  2QAC A;  1R6P A;  1XFW O;  3LK0 A;  2KSP A;  1IKU A;  1JC2 A;  1MXL C;  2F2O A;  3AAJ A;  1PRW A;  2JXC A;  2O60 A;  2DOQ A;  2QPT A;  3TDZ A;  4DRW A;  1LA0 A;  2KYF A;  3GK2 A;  1YVL A;  2JOJ A;  3CZT X;  5AEQ A;  1SBJ A;  1CDM A;  1ZFS A;  4AOM A;  1WRL A;  2EHB A;  4XJK A;  1QX5 B;  3OB2 B;  3PN7 B;  2CBL A;  2NLN A;  1TNX A;  2WCB A;  3PN7 C;  2KQ6 A;  1FI5 A;  2L98 A;  2ZN8 A;  1Y0V H;  1K9P A;  4PHJ A;  4YGE B;  1M63 B;  2LHL A;  2E30 A;  1CNP A;  2JT3 A;  1TCO B;  4MZJ A;  1SPY A;  1A75 B;  2M97 A;  4CLN A;  3CWG A;  3QRX A;  1OMR A;  1JSA A;  2JU0 A;  3BQ3 A;  3PAT A;  2KAX A;  1B8C A;  5CSF A;  4PHM A;  1A29 A;  2TN4 A;  3D0Y B;  1AJ4 A;  4I5K A;  4QJ3 B;  1ODB A;  1KSO A;  2WOS A;  2LAP A;  2LMV A;  2KGR A;  1BOD A;  2JTT A;  2LP3 A;  3EK7 A;  2F33 A;  1DJI A;  2E6W A;  2PAS A;  1D1O A;  1YUS A;  2A4J A;  1ZMZ A;  2WOR A;  1UUR A;  2LVI A;  1XK4 A;  1F4Q A;  1S26 D;  2M1K B;  1UHK A;  4AQJ A;  3FIA A;  1TOP A;  2JTZ A;  4D1E A;  1B4C A;  3H4S E;  3DVE A;  1C7V A;  2BE6 A;  5DKR A;  4MZL A;  1KFU S;  1H8B A;  1LVC D;  2LUX A;  4FQO A;  3VRP A;  2F8P A;  3EK8 A;  1U5I B;  1NSH A;  2KOT A;  4DUQ A;  3LK1 A;  2M7L A;  2PSR A;  3JTD B;  3SG2 A;  3FWB A;  3JTD C;  5F6T A;  3LLE A;  4MRX A;  2JUL A;  4PE4 A;  1YUR A;  1ALV A;  2LE9 B;  1JF0 A;  4DIR A;  1ZOT B;  3BUX B;  5DKN A;  1DJX A;  4ETO A;  5JJG A;  2K7C A;  3KO0 A;  3FWC A;  1OZS A;  2H61 C;  1OOJ A;  2KGB C;  1AJ5 A;  2LP2 A;  3SG7 A;  1QLS A;  1OQP A;  2IS9 A;  2LMT A;  1JF2 A;  1TRF A;  3WNX B;  1QIV A;  5CSJ A;  1OMD A;  1DJH A;  1CFD A;  1F54 A;  1MXE A;  1SR6 B;  2Y4Q A;  1KFX S;  1SRA A;  4YI8 A;  4CFQ A;  1SR6 C;  3NXA A;  2CTN A;  2KI6 D;  1QX2 A;  4F0Z B;  3IQO A;  4OKH A;  3CR5 X;  1CB1 A;  1KSM A;  1QVI Y;  1M39 A;  1J55 A;  1KK7 Y;  5GQQ C;  3VRO A;  1IQ3 A;  1L7Z A;  5D69 A;  1F8H A;  2D8N A;  1K96 A;  3CR4 X;  3FS7 A;  4C0K A;  1DJG A;  4OV2 A;  1DJY A;  1EXR A;  1REC A;  1M45 A;  1KK8 B;  2KI4 B;  1QS7 A;  1F55 A;  2KI4 C;  1KK8 C;  1XFZ O;  1KWO B;  2Y5I A;  4YGB B;  4NDD A;  1QVI Z;  3OX6 A;  1KWO C;  1Y6W A;  2K2F A;  3CR2 A;  2GV5 A;  2KI6 C;  4CPV A;  4OR9 B;  1DF0 B;  1G4Y R;  1PVA A;  4MN0 A;  4XJK B;  4YGC B;  1LIN A;  3CTN A;  2JT8 A;  1HT9 A;  2LLS A;  1NYA A;  4P2Y B;  1SCM B;  4PE1 A;  4ZCV A;  4YRU A;  1QJT A;  1SCM C;  1UHJ A;  2L0P A;  3ICB A;  1K93 D;  2M49 B;  3OB1 B;  4GGN A;  1N2D A;  4A4C A;  1S36 A;  1QV1 A;  3GK1 A;  5AER A;  1BF5 A;  4YGA A;  1CLM A;  3BYA A;  5CSN A;  4MVF A;  1ALW A;  1IQ5 A;  1XFX O;  1ZUZ A;  4Q04 A;  1N65 A;  1K9K A;  2ZNE A;  3TDU A;  1BLQ A;  4L9M A;  1F71 A;  1JFK A;  3M0W A;  1B9A A;  2OPO A;  1J1D A;  1SNL A;  4YGD B;  4QJ5 B;  1Y1A A;  3O6B A;  1FI6 A;  1C7W A;  1PSB A;  2RGI A;  3CGA A;  5IBW A;  1JWD A;  2Q4U A;  1OMV A;  1FF1 A;  1CFC A;  1NUB A;  1XFV O;  1WRK A;  2KFG A;  3O2P A;  4MEW A;  4GBA A;  3IF7 A;  1S3P A;  3DVM A;  4AQI A;  2BBN A;  2GGZ A;  1GGW A;  4C0L A;  4N1G A;  4HRH A;  1OE9 B;  1LXF C;  1M31 A;  1XK4 C;  2Y1M A;  5HKW A;  1RK9 A;  4I5L B;  3NSK A;  3DF0 B;  1GGZ A;  1YX8 A;  1W7I B;  1KQM B;  1RTP 1;  2LAN A;  5FYX A;  1NPQ A;  1KQM C;  1FPW A;  1TCF A;  2JC2 A;  3O78 A;  1J7O A;  2M7N A;  1YX7 A;  1UHI A;  2K61 A;  4C0J A;  1BJF A;  5JOL A;  2M29 A;  2CCM A;  1UP5 A;  4CID A;  3SG4 A;  2KYC A;  1CDN A;  1SK6 D;  2K7O A;  2I7A A;  2K0J A;  4TNC A;  1NX2 A;  5G08 A;  2B1U A;  3SG3 A;  1J1E A;  2L2E A;  1TNQ A;  2I94 A;  1RRO A;  2JNX A;  3GK4 X;  1CMF A;  2ZFD A;  4MZK A;  1IRJ A;  1BR4 B;  3BUN B;  3CLN A;  1MHO A;  1MQ1 A;  5HKY A;  2Y1N A;  1PVB A;  3A4U B;  3AAK A;  3PAL A;  4MRY A;  4GGF C;  1TIZ A;  4CFR A;  3VRN A;  1CFF A;  2G2B A;  3OX5 A;  2V53 A;  1F4O A;  1BT6 A;  2M1U A;  2MLE C;  2NCO A;  1JUO A;  1EG3 A;  4GAO A;  4M2O A;  4BY5 A;  1NX3 A;  1AK8 A;  2NXQ A;  2LLU A;  4GNK B;  1SCV A;  1SW8 A;  1GQM A;  3F45 A;  3KF9 A;  1B47 A;  1X02 A;  3NSO A;  4M2Q A;  4ORC B;  1BR1 B;  4ORA B;  1CM4 A;  2BCA A;  1B8L A;  1CM1 A;  4MBE A;  1CLB A;  2BCX A;  2GGM A;  2SCP A;  1SL9 A;  1BMO A;  1NP8 A;  3ZNI A;  2OTG B;  3D10 A;  1TN4 A;  2KFH A;  3K21 A;  4WQ3 A;  2ISD A;  2OTG C;  1KFU L;  1WRZ A;  3DD4 A;  1RFJ A;  4WQ2 A;  2JQ6 A;  1WY9 A;  5K89 A;  2LVK A;  1BOC A;  3BOW A;  2MHH A;  2JT0 A;  3VRR A;  4HRG A;  4HRE E;  3DVK A;  3TUY B;  1OZO A;  4JWQ A;  2L4H A;  3TUY C;  2K8M B;  1B7T Y;  1K8U A;  1CKK A;  3IQQ A;  2FJU B;  3LL8 B;  3OP0 A;  3EKH A;  1G8I A;  2ZKM X;  4NDC A;  1CLL A;  1HQV A;  4N5X A;  4WRI A;  4PE0 A;  3C1V A;  2BKI B;  4UPG A;  1C07 A;  2BEC A;  1OSA A;  1MR8 A;  3AKA A;  1JFJ A;  2KDH A;  2PAL A;  2WCE A;  1SYM A;  2L4I A;  1IGV A;  2PVB A;  1B7T Z;  1VRK A;  5HYD A;  1ZAC A;  1LA3 A;  2L5X B;  1KFX L;  3BXK A;  2ZND A;  1LKJ A;  1BG1 A;  3WHT B;  1S1E A;  1QIW A;  2BL0 B;  2BL0 C;  5CPV A;  2KFF A;  2KNE A;  4ORB B;  2P6B B;  4DS7 A;  5TNC A;  5KTY A;  2MA2 A;  3VRQ A;  5BPJ A;  1DVI A;  2AUC A;  1UWO A;  1KCY A;  2LNK A;  1RJV A;  2HET A;  1F70 A;  2KHN A;  2LM5 A;  2FCE A;  3BUO B;  3KHE A;  3PFV A;  2KAV A;  4NQG A;  4I5N B;  1NCX A;  1QXP A;  4PHK A;  1NWD A;  4PCW A;  1CDL A;  1BU3 A;  2Q91 A;  1SY9 A;  1MUX A;  1YVH A;  1IJ6 A;  1K95 A;  1TTX A;  5HLO A;  1PSR A;  2MAZ A;  1AUI B;  4NDB A;  1EG4 A;  2LVV A;  4R1E A;  3SIB A;  1CMG A;  1A03 A;  1SMG A;  1XA5 A;  1SKT A;  3I5I B;  2ZRS A;  1DMO A;  3I5I C;  2BKH B;  1R2U A;  3A8R A;  3JVT B;  1XO5 A;  3KEV A;  4MSP A;  4P5O E;  5ER4 X;  1IWQ A;  3JVT C;  1DJZ A;  1CTR A;  5PAL A;  4N1F A;  1Y1U A;  1A4P A;  2F3Y A;  1GJY A;  1EL4 A;  1QTX A;  2MRD A;  2L51 A;  2PRU A;  4PHN A;  4HSZ A;  5I2Q A;  1QV0 A;  1S6C A;  3GOF A;  4A4B A;  2EC6 B;  1MF8 B;  3VGO A;  5ER5 A;  2EC6 C;  1DF0 A;  5AFP A;  5AXI A;  2VRG A;  2SAS A;  1SL7 A;  4OCI A;  2H2K A;  2HPS A;  2AAO A;  5DKQ A;  1K94 A;  4YBH B;  1J7P A;  1J7R A;  1PK0 D;  4GUK A;  1QX7 A;  1Q80 A;  4MLW A;  3E3R A;  1J7Q A;  4I5J A;  4XYN A;  2JRF A;  1V1G A;  3SG6 A;  1SL8 A;  1V1F A;  5I2O A; 
#chains in the Genus database with same CATH topology
 1TNP A;  3BFA A;  1G33 A;  3PSR A;  3NSL A;  4PAL A;  3NSI A;  5HLV A;  3BUM B;  2LCP A;  2LMU A;  2WND A;  1S5G Y;  2LUC A;  1EJ3 A;  1DGU A;  2I2R E;  3TZ1 A;  1XFY O;  2PMY A;  3BOW B;  4JQ0 D;  2I18 A;  3HCM A;  1CFP A;  3RZS A;  1S6J A;  2AMI A;  2MJW B;  4U8D A;  1DJW A;  1UHN A;  2M8U A;  3L4L A;  3OGN A;  2FOT A;  2MBX A;  3SJS A;  1A75 A;  1Y1X A;  2QDI A;  1CDP A;  3EK4 A;  4QJ4 B;  4PE7 A;  3DF0 A;  1FW4 A;  3CZ2 A;  1E8A A;  4GPL B;  2JXL A;  1P28 A;  1YRT B;  2COL B;  4JD9 A;  1LS8 A;  1XFU O;  1S5G Z;  5KU1 A;  4OVN F;  4BY4 A;  2JPT A;  2LV7 A;  3D0Y A;  5KSZ A;  3EVR A;  3K1E A;  5D7F A;  2MLF C;  2HQW A;  3LCP C;  3S0F A;  4YI9 A;  2CT9 A;  2CNP A;  4DCK A;  2CXJ A;  1YR5 A;  1CLB A;  2JZI A;  4JPZ B;  3PM8 A;  3ZWH A;  5CSI A;  4ZCU A;  3SIA A;  2BBM A;  2BE4 A;  1B8R A;  3O4X A;  1TUJ A;  2KBI A;  4USL A;  1M46 A;  4IJ7 A;  3UNW A;  1NCY A;  3EVU A;  1W7J B;  3DVJ A;  1EH2 A;  1FBV A;  2F2P A;  2LHI A;  2M3W A;  1NX0 A;  2GTE A;  4GGF A;  5D3O A;  3VB1 A;  2O5G A;  2EGD A;  2NZ0 A;  2NCP A;  3V2L A;  3WHU B;  5B8I B;  4E68 A;  4FTG A;  2WCL A;  1JBA A;  1QAT A;  1XYD A;  1A2X A;  1U5I A;  1PAL A;  1QAS A;  1IJ5 A;  1MWN A;  1NCZ A;  2M0R A;  1DEL A;  1SSE B;  2F3Z A;  2ZRT A;  3EKJ A;  2QEV A;  3AKB A;  1AP4 A;  5I2L A;  3PLF B;  1YTZ C;  1NX1 A;  2KAY A;  1RWY A;  1YUT A;  1UHH A;  2KLE A;  2WCF A;  2LLT A;  1Z2C B;  5I8N A;  3I5H B;  3D76 A;  1S6I A;  1DGV A;  2JWW A;  2K60 A;  2LC5 A;  1AHR A;  2H61 A;  3I5H C;  4GFT A;  4M2P A;  2ZN9 A;  4IL1 A;  1IH0 A;  3OHM B;  3CS1 A;  3FE9 A;  1XVJ A;  3TS5 B;  3DYE A;  2LVJ A;  1DT7 B;  1B1G A;  3TS5 C;  2K7B A;  1K2H A;  1DTL A;  3BUW B;  3WXA A;  1K9U A;  2K2A A;  3B7A A;  1QLK A;  2HQ8 A;  1WDC B;  2FCD A;  1GM0 A;  5J3X A;  1L2O B;  1WDC C;  2PQL A;  1IG5 A;  1K90 D;  1L2O C;  4PDZ A;  2BCB A;  2OS8 B;  1PUL A;  1NIW A;  2R2I A;  2OS8 C;  3TDI A;  1KK7 Z;  5HKZ A;  2JNF A;  2KQY A;  1UUS A;  3I5G B;  3SS4 A;  1WLM A;  3RM1 A;  5FI2 A;  3I5F B;  3I5G C;  3RLZ A;  1H4B A;  3I5F C;  2ERB A;  5AAN A;  1WLZ A;  2G9B A;  2HF5 A;  3MSE B;  4ICB A;  3SG5 A;  2L50 A;  2K7D A;  2L2C A;  2KBM A;  1AVS A;  1YUU A;  2WC8 A;  5EL2 A;  1TNW A;  2M9G A;  3KPX A;  1KQV A;  1N0Y A;  3HX4 A;  3EVV A;  1YRU B;  3O4Y A;  2QAC A;  1R6P A;  1XFW O;  3LK0 A;  2KSP A;  1IKU A;  1JC2 A;  1MXL C;  3S0D A;  2F2O A;  3AAJ A;  1PRW A;  2JXC A;  2O60 A;  2DOQ A;  2QPT A;  3TDZ A;  4DRW A;  1LA0 A;  2KYF A;  3GK2 A;  1YVL A;  2JOJ A;  3CZT X;  5AEQ A;  1SBJ A;  1CDM A;  1ZFS A;  4AOM A;  1WRL A;  2EHB A;  4XJK A;  1QX5 B;  3OB2 B;  3PN7 B;  2CBL A;  2NLN A;  1TNX A;  2WCB A;  3PN7 C;  2KQ6 A;  1FI5 A;  2L98 A;  2ZN8 A;  1Y0V H;  1K9P A;  4PHJ A;  4YGE B;  1M63 B;  2LHL A;  2E30 A;  1CNP A;  2JT3 A;  1TCO B;  4MZJ A;  1SPY A;  1A75 B;  2M97 A;  4CLN A;  3CWG A;  3QRX A;  1OMR A;  1JSA A;  2JU0 A;  3BQ3 A;  3PAT A;  2KAX A;  2WCK A;  1B8C A;  5CSF A;  4PHM A;  1A29 A;  2L5Y A;  3BJH A;  1IIO A;  2TN4 A;  3D0Y B;  1AJ4 A;  4I5K A;  4QJ3 B;  1ODB A;  1KSO A;  1DQE A;  2WOS A;  2LAP A;  2LMV A;  2KGR A;  1BOD A;  2JTT A;  2LP3 A;  3EK7 A;  2F33 A;  4KYN A;  1DJI A;  2E6W A;  2PAS A;  1D1O A;  1YUS A;  2A4J A;  1ZMZ A;  2WOR A;  1UUR A;  2LVI A;  1XK4 A;  2QEB A;  1W9Z A;  1F4Q A;  1S26 D;  2M1K B;  1UHK A;  4AQJ A;  3FIA A;  1TOP A;  2JTZ A;  4D1E A;  1B4C A;  3H4S E;  3DVE A;  1C7V A;  2BE6 A;  5DKR A;  4MZL A;  1KFU S;  1H8B A;  1LVC D;  3DY9 A;  2LUX A;  4FQO A;  3VRP A;  3QME A;  3SS3 A;  2F8P A;  3EK8 A;  1U5I B;  1NSH A;  2KOT A;  4DUQ A;  3LK1 A;  2M7L A;  4PT1 A;  3S0G A;  2PSR A;  4FQT A;  3JTD B;  3SG2 A;  3FWB A;  3JTD C;  5F6T A;  3LLE A;  1OOG A;  2PYQ A;  4MRX A;  2JUL A;  3N7H A;  4PE4 A;  1YUR A;  1ALV A;  2LE9 B;  1JF0 A;  4DIR A;  1ZOT B;  3BUX B;  2P71 A;  1DJX A;  5DKN A;  4ETO A;  5JJG A;  3NHI A;  2K7C A;  3KO0 A;  3FWC A;  1OZS A;  2H61 C;  1OOJ A;  2KGB C;  1AJ5 A;  2LP2 A;  3SG7 A;  1QLS A;  1OQP A;  2IS9 A;  2LMT A;  4JKT A;  1JF2 A;  1TRF A;  3WNX B;  1QIV A;  5CSJ A;  1OMD A;  1DJH A;  1CFD A;  5I94 A;  1F54 A;  1MXE A;  1SR6 B;  2Y4Q A;  2WCJ A;  1KFX S;  1SRA A;  4YI8 A;  4CFQ A;  1SR6 C;  3NXA A;  2CTN A;  2YGU A;  2KI6 D;  1QX2 A;  4F0Z B;  3IQO A;  4OKH A;  3DXL A;  3CR5 X;  1CB1 A;  1KSM A;  1QVI Y;  1M39 A;  1J55 A;  1KK7 Y;  1XFR A;  3FE6 A;  5FI6 A;  5GQQ C;  3VRO A;  1IQ3 A;  1L7Z A;  5D69 A;  1F8H A;  2D8N A;  1K96 A;  3BFB A;  3CR4 X;  3FS7 A;  4C0K A;  1DJG A;  3R1O A;  4OV2 A;  3D73 A;  3S0B A;  1DJY A;  1EXR A;  1REC A;  1M45 A;  1KK8 B;  2KI4 B;  1QS7 A;  1F55 A;  2KI4 C;  1KK8 C;  1XFZ O;  1KWO B;  2Y5I A;  4YGB B;  4NDD A;  1QVI Z;  3OX6 A;  1KWO C;  1Y6W A;  2K2F A;  3CR2 A;  3CZ0 A;  2GV5 A;  2KI6 C;  4CPV A;  4OR9 B;  1DF0 B;  1G4Y R;  1PVA A;  1Z4H A;  4MN0 A;  4XJK B;  4YGC B;  1LIN A;  3CTN A;  2JT8 A;  1HT9 A;  2LLS A;  1NYA A;  4P2Y B;  1SCM B;  4OZD A;  4PE1 A;  4ZCV A;  4YRU A;  1QJT A;  1SCM C;  1UHJ A;  2L0P A;  3ICB A;  1K93 D;  2M49 B;  3OB1 B;  4GGN A;  1N2D A;  4A4C A;  1S36 A;  1QV1 A;  3GK1 A;  5AER A;  1BF5 A;  4YGA A;  1CLM A;  3BYA A;  2QEH A;  5CSN A;  4MVF A;  1ALW A;  1IQ5 A;  1XFX O;  1ZUZ A;  4Q04 A;  1N65 A;  1K9K A;  2ZNE A;  3TDU A;  1BLQ A;  4L9M A;  1F71 A;  1JFK A;  3M0W A;  1B9A A;  2OPO A;  1J1D A;  1SNL A;  4YGD B;  4QJ5 B;  1Y1A A;  3O6B A;  3DZT A;  1C7W A;  1FI6 A;  1PSB A;  2RGI A;  3CGA A;  3PM2 A;  5FI7 A;  5IBW A;  1JWD A;  2Q4U A;  1OMV A;  1FF1 A;  1CFC A;  1NUB A;  1XFV O;  1WRK A;  2KFG A;  3O2P A;  4MEW A;  4GBA A;  3IF7 A;  1S3P A;  3DVM A;  4AQI A;  2BBN A;  1C3Z A;  2GGZ A;  1GGW A;  4C0L A;  4N1G A;  4HRH A;  1OE9 B;  1LXF C;  1M31 A;  1XK4 C;  2Y1M A;  5HKW A;  1RK9 A;  4I5L B;  3NSK A;  3DF0 B;  1ORG A;  3D75 A;  1GGZ A;  1YX8 A;  1W7I B;  3CYZ A;  1KQM B;  1RTP 1;  2LAN A;  5FYX A;  1C3Y A;  1NPQ A;  1KQM C;  1FPW A;  1TCF A;  2JC2 A;  3O78 A;  1J7O A;  2M7N A;  1YX7 A;  1UHI A;  2K61 A;  4C0J A;  1T14 A;  1BJF A;  3S0A A;  3B88 A;  5JOL A;  2M29 A;  2CCM A;  1UP5 A;  4CID A;  3SG4 A;  1OW4 A;  2KYC A;  1CDN A;  1SK6 D;  2K7O A;  2I7A A;  2K0J A;  3NGV A;  4INW A;  4TNC A;  1NX2 A;  5G08 A;  2B1U A;  3SG3 A;  1J1E A;  3R72 A;  2L2E A;  1TNQ A;  2I94 A;  3BFH A;  1RRO A;  2JNX A;  3GK4 X;  1CMF A;  3D78 A;  2ZFD A;  4MZK A;  1IRJ A;  1BR4 B;  3BUN B;  3CLN A;  1DC1 A;  2BAP A;  1MHO A;  1MQ1 A;  1TWO A;  2Y1N A;  2JPO A;  1OOI X;  1PVB A;  3Q8I A;  5HKY A;  3A4U B;  3AAK A;  3PAL A;  4MRY A;  4GGF C;  1TIZ A;  3CDN A;  3VRN A;  4CFR A;  1CFF A;  2G2B A;  3OX5 A;  2V53 A;  1F4O A;  1BT6 A;  2M1U A;  2MLE C;  2QEO A;  2NCO A;  1JUO A;  1EG3 A;  4GAO A;  4M2O A;  4BY5 A;  1NX3 A;  1OOH A;  1AK8 A;  5HL1 A;  2NXQ A;  2LLU A;  4GNK B;  1SCV A;  1SW8 A;  1GQM A;  3F45 A;  3KF9 A;  1B47 A;  1X02 A;  3NSO A;  4M2Q A;  4ORC B;  3IVT A;  1BR1 B;  4ORA B;  1CM4 A;  2BCA A;  1B8L A;  1CM1 A;  4MBE A;  3L4A A;  2BCX A;  2GGM A;  2SCP A;  1SL9 A;  1BMO A;  1NP8 A;  3ZNI A;  2OTG B;  3D10 A;  1TN4 A;  2KFH A;  3K21 A;  4WQ3 A;  2ISD A;  2OTG C;  1KFU L;  1TUZ A;  1WRZ A;  3DD4 A;  1RFJ A;  4WQ2 A;  2JQ6 A;  1WY9 A;  5K89 A;  2LVK A;  3B6X A;  3BOW A;  2MHH A;  1BOC A;  2JT0 A;  3VRR A;  4HRG A;  4HRE E;  3DVK A;  3B87 A;  3CZ1 A;  3TUY B;  1OZO A;  4JWQ A;  2L4H A;  2P70 A;  3TUY C;  2K8M B;  2WC6 A;  1B7T Y;  1K8U A;  1CKK A;  3IQQ A;  2WC5 A;  2FJU B;  3LL8 B;  3OP0 A;  3EKH A;  4INX A;  1G8I A;  3UO9 A;  2ZKM X;  4NDC A;  1CLL A;  1HQV A;  4N5X A;  2FJY A;  4WRI A;  4PE0 A;  2H8V A;  3C1V A;  2BKI B;  4UPG A;  3D77 A;  1C07 A;  1DEK A;  1OSA A;  1MR8 A;  2BEC A;  3AKA A;  1JFJ A;  2KDH A;  2PAL A;  2WCE A;  1SYM A;  2L4I A;  1IGV A;  2PVB A;  1B7T Z;  1VRK A;  5HYD A;  1ZAC A;  1LA3 A;  1QWV A;  2L5X B;  1KFX L;  3L47 A;  3BXK A;  2ZND A;  1LKJ A;  3S0E A;  1BG1 A;  3WHT B;  1S1E A;  1QIW A;  2BL0 B;  3R1P A;  2BL0 C;  5CPV A;  2KFF A;  2KNE A;  4ORB B;  2P6B B;  2WCH A;  4DS7 A;  5TNC A;  5KTY A;  2MA2 A;  3VRQ A;  3EG5 B;  3CAB A;  5BPJ A;  3SS5 A;  1DVI A;  2AUC A;  1UWO A;  1KCY A;  5DIC A;  2LNK A;  2WCM A;  1RJV A;  2HET A;  1F70 A;  2KHN A;  2LM5 A;  2FCE A;  3BUO B;  3KHE A;  3PFV A;  2KAV A;  4NQG A;  4I5N B;  1NCX A;  1QXP A;  4PHK A;  1NWD A;  4PCW A;  1CDL A;  1BU3 A;  2Q91 A;  1SY9 A;  1MUX A;  1YVH A;  3D74 A;  1IJ6 A;  1K95 A;  1TTX A;  5HLO A;  1PSR A;  2MAZ A;  1AUI B;  4NDB A;  1EG4 A;  2LVV A;  4R1E A;  3SIB A;  1CMG A;  1A03 A;  1SMG A;  1XA5 A;  1SKT A;  3I5I B;  2ZRS A;  3PJI A;  1DMO A;  3I5I C;  2BKH B;  1R2U A;  3A8R A;  3JVT B;  1XO5 A;  3KEV A;  4MSP A;  4P5O E;  5ER4 X;  1IWQ A;  3JVT C;  1DJZ A;  1CTR A;  5PAL A;  4N1F A;  1Y1U A;  1A4P A;  2F3Y A;  3B86 A;  1GJY A;  1OOF A;  1EL4 A;  1QTX A;  2BNX A;  2MRD A;  2L51 A;  3NHT A;  2PRU A;  4PHN A;  4HSZ A;  4F7F A;  5I2Q A;  1QV0 A;  1S6C A;  3GOF A;  4A4B A;  2EC6 B;  1MF8 B;  3VGO A;  5ER5 A;  2EC6 C;  1DF0 A;  5AFP A;  5AXI A;  2VRG A;  2SAS A;  1SL7 A;  3R1V A;  2H2K A;  2HPS A;  3OBV A;  2AAO A;  4OCI A;  5DKQ A;  1K94 A;  4YBH B;  1J7P A;  1J7R A;  1PK0 D;  4GUK A;  1QX7 A;  1Q80 A;  2KPH A;  4MLW A;  3E3R A;  2KLD A;  1J7Q A;  4I5J A;  4XYN A;  2JRF A;  1V1G A;  3SG6 A;  1SL8 A;  1V1F A;  5I2O A;  3FE8 A; 
#chains in the Genus database with same CATH homology
 1TNP A;  1G33 A;  3PSR A;  3NSL A;  4PAL A;  3NSI A;  5HLV A;  3BUM B;  2LCP A;  2LMU A;  2WND A;  1S5G Y;  2LUC A;  1EJ3 A;  1DGU A;  2I2R E;  3TZ1 A;  1XFY O;  2PMY A;  3BOW B;  4JQ0 D;  2I18 A;  3HCM A;  1CFP A;  1S6J A;  2AMI A;  2MJW B;  4U8D A;  1DJW A;  1UHN A;  2M8U A;  2MBX A;  3SJS A;  2FOT A;  1A75 A;  1Y1X A;  3EK4 A;  1CDP A;  4QJ4 B;  4PE7 A;  3DF0 A;  1FW4 A;  1E8A A;  4GPL B;  2JXL A;  2COL B;  1YRT B;  1XFU O;  1S5G Z;  5KU1 A;  4OVN F;  4BY4 A;  2JPT A;  2LV7 A;  3D0Y A;  5KSZ A;  3EVR A;  5D7F A;  2MLF C;  2HQW A;  3LCP C;  4YI9 A;  2CT9 A;  2CNP A;  4DCK A;  2CXJ A;  1YR5 A;  2JZI A;  4JPZ B;  3PM8 A;  3ZWH A;  5CSI A;  4ZCU A;  3SIA A;  2BBM A;  2BE4 A;  1B8R A;  4USL A;  2KBI A;  1M46 A;  1NCY A;  3EVU A;  1W7J B;  3DVJ A;  1EH2 A;  1FBV A;  2F2P A;  2LHI A;  2M3W A;  1NX0 A;  4GGF A;  2O5G A;  2EGD A;  2NZ0 A;  2NCP A;  3WHU B;  5B8I B;  4E68 A;  4FTG A;  1JBA A;  1QAT A;  1XYD A;  1A2X A;  1U5I A;  1PAL A;  1QAS A;  1IJ5 A;  1MWN A;  1NCZ A;  2M0R A;  2F3Z A;  2ZRT A;  3EKJ A;  3AKB A;  1AP4 A;  5I2L A;  3PLF B;  1YTZ C;  1NX1 A;  2KAY A;  1RWY A;  1YUT A;  1UHH A;  5I8N A;  2WCF A;  2LLT A;  3I5H B;  1S6I A;  1DGV A;  2JWW A;  2LC5 A;  4GFT A;  1AHR A;  2H61 A;  3I5H C;  4M2P A;  2ZN9 A;  4IL1 A;  1IH0 A;  3OHM B;  3CS1 A;  1DT7 B;  1XVJ A;  3TS5 B;  2LVJ A;  1B1G A;  3TS5 C;  2K7B A;  1K2H A;  1DTL A;  3BUW B;  3WXA A;  1K9U A;  2K2A A;  1QLK A;  2HQ8 A;  1WDC B;  2FCD A;  5J3X A;  1L2O B;  1WDC C;  1IG5 A;  1K90 D;  1L2O C;  4PDZ A;  2BCB A;  2OS8 B;  1PUL A;  1NIW A;  2R2I A;  2OS8 C;  3TDI A;  1KK7 Z;  5HKZ A;  2JNF A;  2KQY A;  1UUS A;  3I5G B;  1WLM A;  3RM1 A;  3I5F B;  3I5G C;  3RLZ A;  1H4B A;  3I5F C;  5AAN A;  1WLZ A;  2G9B A;  2HF5 A;  3MSE B;  4ICB A;  3SG5 A;  2L50 A;  2K7D A;  2KBM A;  1AVS A;  1YUU A;  2WC8 A;  1TNW A;  2M9G A;  3KPX A;  1KQV A;  1N0Y A;  3HX4 A;  3EVV A;  1YRU B;  3O4Y A;  2QAC A;  1R6P A;  1XFW O;  3LK0 A;  2KSP A;  1IKU A;  1JC2 A;  1MXL C;  2F2O A;  3AAJ A;  1PRW A;  2JXC A;  2O60 A;  2DOQ A;  2QPT A;  3TDZ A;  4DRW A;  1LA0 A;  2KYF A;  3GK2 A;  1YVL A;  2JOJ A;  3CZT X;  5AEQ A;  1SBJ A;  1CDM A;  1ZFS A;  4AOM A;  1WRL A;  2EHB A;  4XJK A;  1QX5 B;  3OB2 B;  3PN7 B;  2CBL A;  2NLN A;  1TNX A;  2WCB A;  3PN7 C;  2KQ6 A;  1FI5 A;  2L98 A;  2ZN8 A;  1Y0V H;  1K9P A;  4PHJ A;  4YGE B;  1M63 B;  2LHL A;  2E30 A;  1CNP A;  2JT3 A;  1TCO B;  4MZJ A;  1SPY A;  1A75 B;  2M97 A;  4CLN A;  3CWG A;  3QRX A;  1OMR A;  1JSA A;  2JU0 A;  3BQ3 A;  3PAT A;  2KAX A;  1B8C A;  5CSF A;  4PHM A;  1A29 A;  2TN4 A;  3D0Y B;  1AJ4 A;  4I5K A;  4QJ3 B;  1ODB A;  1KSO A;  2WOS A;  2LAP A;  2LMV A;  2KGR A;  1BOD A;  2JTT A;  2LP3 A;  3EK7 A;  2F33 A;  1DJI A;  2E6W A;  2PAS A;  1D1O A;  1YUS A;  2A4J A;  1ZMZ A;  2WOR A;  1UUR A;  2LVI A;  1XK4 A;  1F4Q A;  1S26 D;  2M1K B;  1UHK A;  4AQJ A;  3FIA A;  1TOP A;  2JTZ A;  4D1E A;  1B4C A;  3H4S E;  3DVE A;  1C7V A;  2BE6 A;  5DKR A;  4MZL A;  1KFU S;  1H8B A;  1LVC D;  2LUX A;  4FQO A;  3VRP A;  2F8P A;  3EK8 A;  1U5I B;  1NSH A;  2KOT A;  4DUQ A;  3LK1 A;  2M7L A;  2PSR A;  3JTD B;  3SG2 A;  3FWB A;  3JTD C;  5F6T A;  3LLE A;  4MRX A;  2JUL A;  4PE4 A;  1YUR A;  1ALV A;  2LE9 B;  1JF0 A;  4DIR A;  1ZOT B;  3BUX B;  5DKN A;  1DJX A;  4ETO A;  5JJG A;  2K7C A;  3KO0 A;  3FWC A;  1OZS A;  2H61 C;  1OOJ A;  2KGB C;  1AJ5 A;  2LP2 A;  3SG7 A;  1QLS A;  1OQP A;  2IS9 A;  2LMT A;  1JF2 A;  1TRF A;  3WNX B;  1QIV A;  5CSJ A;  1OMD A;  1DJH A;  1CFD A;  1F54 A;  1MXE A;  1SR6 B;  2Y4Q A;  1KFX S;  1SRA A;  4YI8 A;  4CFQ A;  1SR6 C;  3NXA A;  2CTN A;  2KI6 D;  1QX2 A;  4F0Z B;  3IQO A;  4OKH A;  3CR5 X;  1CB1 A;  1KSM A;  1QVI Y;  1M39 A;  1J55 A;  1KK7 Y;  5GQQ C;  3VRO A;  1IQ3 A;  1L7Z A;  5D69 A;  1F8H A;  2D8N A;  1K96 A;  3CR4 X;  3FS7 A;  4C0K A;  1DJG A;  4OV2 A;  1DJY A;  1EXR A;  1REC A;  1M45 A;  1KK8 B;  2KI4 B;  1QS7 A;  1F55 A;  2KI4 C;  1KK8 C;  1XFZ O;  1KWO B;  2Y5I A;  4YGB B;  4NDD A;  1QVI Z;  3OX6 A;  1KWO C;  1Y6W A;  2K2F A;  3CR2 A;  2GV5 A;  2KI6 C;  4CPV A;  4OR9 B;  1DF0 B;  1G4Y R;  1PVA A;  4MN0 A;  4XJK B;  4YGC B;  1LIN A;  3CTN A;  2JT8 A;  1HT9 A;  2LLS A;  1NYA A;  4P2Y B;  1SCM B;  4PE1 A;  4ZCV A;  4YRU A;  1QJT A;  1SCM C;  1UHJ A;  2L0P A;  3ICB A;  1K93 D;  2M49 B;  3OB1 B;  4GGN A;  1N2D A;  4A4C A;  1S36 A;  1QV1 A;  3GK1 A;  5AER A;  1BF5 A;  4YGA A;  1CLM A;  3BYA A;  5CSN A;  4MVF A;  1ALW A;  1IQ5 A;  1XFX O;  1ZUZ A;  4Q04 A;  1N65 A;  1K9K A;  2ZNE A;  3TDU A;  1BLQ A;  4L9M A;  1F71 A;  1JFK A;  3M0W A;  1B9A A;  2OPO A;  1J1D A;  1SNL A;  4YGD B;  4QJ5 B;  1Y1A A;  3O6B A;  1FI6 A;  1C7W A;  1PSB A;  2RGI A;  3CGA A;  5IBW A;  1JWD A;  2Q4U A;  1OMV A;  1FF1 A;  1CFC A;  1NUB A;  1XFV O;  1WRK A;  2KFG A;  3O2P A;  4MEW A;  4GBA A;  3IF7 A;  1S3P A;  3DVM A;  4AQI A;  2BBN A;  2GGZ A;  1GGW A;  4C0L A;  4N1G A;  4HRH A;  1OE9 B;  1LXF C;  1M31 A;  1XK4 C;  2Y1M A;  5HKW A;  1RK9 A;  4I5L B;  3NSK A;  3DF0 B;  1GGZ A;  1YX8 A;  1W7I B;  1KQM B;  1RTP 1;  2LAN A;  5FYX A;  1NPQ A;  1KQM C;  1FPW A;  1TCF A;  2JC2 A;  3O78 A;  1J7O A;  2M7N A;  1YX7 A;  1UHI A;  2K61 A;  4C0J A;  1BJF A;  5JOL A;  2M29 A;  2CCM A;  1UP5 A;  4CID A;  3SG4 A;  2KYC A;  1CDN A;  1SK6 D;  2K7O A;  2I7A A;  2K0J A;  4TNC A;  1NX2 A;  5G08 A;  2B1U A;  3SG3 A;  1J1E A;  2L2E A;  1TNQ A;  2I94 A;  1RRO A;  2JNX A;  3GK4 X;  1CMF A;  2ZFD A;  4MZK A;  1IRJ A;  1BR4 B;  3BUN B;  3CLN A;  1MHO A;  1MQ1 A;  5HKY A;  2Y1N A;  1PVB A;  3A4U B;  3AAK A;  3PAL A;  4MRY A;  4GGF C;  1TIZ A;  4CFR A;  3VRN A;  1CFF A;  2G2B A;  3OX5 A;  2V53 A;  1F4O A;  1BT6 A;  2M1U A;  2MLE C;  2NCO A;  1JUO A;  1EG3 A;  4GAO A;  4M2O A;  4BY5 A;  1NX3 A;  1AK8 A;  2NXQ A;  2LLU A;  4GNK B;  1SCV A;  1SW8 A;  1GQM A;  3F45 A;  3KF9 A;  1B47 A;  1X02 A;  3NSO A;  4M2Q A;  4ORC B;  1BR1 B;  4ORA B;  1CM4 A;  2BCA A;  1B8L A;  1CM1 A;  4MBE A;  1CLB A;  2BCX A;  2GGM A;  2SCP A;  1SL9 A;  1BMO A;  1NP8 A;  3ZNI A;  2OTG B;  3D10 A;  1TN4 A;  2KFH A;  3K21 A;  4WQ3 A;  2ISD A;  2OTG C;  1KFU L;  1WRZ A;  3DD4 A;  1RFJ A;  4WQ2 A;  2JQ6 A;  1WY9 A;  5K89 A;  2LVK A;  1BOC A;  3BOW A;  2MHH A;  2JT0 A;  3VRR A;  4HRG A;  4HRE E;  3DVK A;  3TUY B;  1OZO A;  4JWQ A;  2L4H A;  3TUY C;  2K8M B;  1B7T Y;  1K8U A;  1CKK A;  3IQQ A;  2FJU B;  3LL8 B;  3OP0 A;  3EKH A;  1G8I A;  2ZKM X;  4NDC A;  1CLL A;  1HQV A;  4N5X A;  4WRI A;  4PE0 A;  3C1V A;  2BKI B;  4UPG A;  1C07 A;  2BEC A;  1OSA A;  1MR8 A;  3AKA A;  1JFJ A;  2KDH A;  2PAL A;  2WCE A;  1SYM A;  2L4I A;  1IGV A;  2PVB A;  1B7T Z;  1VRK A;  5HYD A;  1ZAC A;  1LA3 A;  2L5X B;  1KFX L;  3BXK A;  2ZND A;  1LKJ A;  1BG1 A;  3WHT B;  1S1E A;  1QIW A;  2BL0 B;  2BL0 C;  5CPV A;  2KFF A;  2KNE A;  4ORB B;  2P6B B;  4DS7 A;  5TNC A;  5KTY A;  2MA2 A;  3VRQ A;  5BPJ A;  1DVI A;  2AUC A;  1UWO A;  1KCY A;  2LNK A;  1RJV A;  2HET A;  1F70 A;  2KHN A;  2LM5 A;  2FCE A;  3BUO B;  3KHE A;  3PFV A;  2KAV A;  4NQG A;  4I5N B;  1NCX A;  1QXP A;  4PHK A;  1NWD A;  4PCW A;  1CDL A;  1BU3 A;  2Q91 A;  1SY9 A;  1MUX A;  1YVH A;  1IJ6 A;  1K95 A;  1TTX A;  5HLO A;  1PSR A;  2MAZ A;  1AUI B;  4NDB A;  1EG4 A;  2LVV A;  4R1E A;  3SIB A;  1CMG A;  1A03 A;  1SMG A;  1XA5 A;  1SKT A;  3I5I B;  2ZRS A;  1DMO A;  3I5I C;  2BKH B;  1R2U A;  3A8R A;  3JVT B;  1XO5 A;  3KEV A;  4MSP A;  4P5O E;  5ER4 X;  1IWQ A;  3JVT C;  1DJZ A;  1CTR A;  5PAL A;  4N1F A;  1Y1U A;  1A4P A;  2F3Y A;  1GJY A;  1EL4 A;  1QTX A;  2MRD A;  2L51 A;  2PRU A;  4PHN A;  4HSZ A;  5I2Q A;  1QV0 A;  1S6C A;  3GOF A;  4A4B A;  2EC6 B;  1MF8 B;  3VGO A;  5ER5 A;  2EC6 C;  1DF0 A;  5AFP A;  5AXI A;  2VRG A;  2SAS A;  1SL7 A;  4OCI A;  2H2K A;  2HPS A;  2AAO A;  5DKQ A;  1K94 A;  4YBH B;  1J7P A;  1J7R A;  1PK0 D;  4GUK A;  1QX7 A;  1Q80 A;  4MLW A;  3E3R A;  1J7Q A;  4I5J A;  4XYN A;  2JRF A;  1V1G A;  3SG6 A;  1SL8 A;  1V1F A;  5I2O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...