5CSNA

S100b-rsk1 crystal structure c
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
94
structure length
94
Chain Sequence
GSHMSELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDNDGDGECDFQEFMAFVAMVTTACHEFFEH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Protein S100-B
publication title Structural Basis of Ribosomal S6 Kinase 1 (RSK1) Inhibition by S100B Protein: MODULATION OF THE EXTRACELLULAR SIGNAL-REGULATED KINASE (ERK) SIGNALING CASCADE IN A CALCIUM-DEPENDENT WAY.
pubmed doi rcsb
source organism Homo sapiens
total genus 30
structure length 94
sequence length 94
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-07-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 5csnA00
1CM1A 2F3ZA 2FCDA 2Y1NA 1MXEA 1J7PA 4DUQA 1NYAA 2JT8A 1FBVA 1DJIA 2BBMA 1S6CA 4WQ3A 1JF0A 4GBAA 3GOFA 4I5NB 1JSAA 2KBMA 1FW4A 1TCOB 1SCMC 1R2UA 2DOQA 1J7OA 2MLFC 3FWCA 1CMGA 2MAZA 2JXCA 5K89A 1SPYA 3RM1A 3BUMB 1F70A 1BR1B 3HCMA 1A2XA 4YGCB 3WNXB 2JXLA 4Q04A 4OVNF 1YRUB 2L50A 2NZ0A 1PVBA 1BJFA 2WORA 1AP4A 2COLB 1N2DA 2JRFA 2PALA 4PCWA 1SBJA 4DIRA 1CDMA 1B4CA 1XFWO 1LXFC 1WRLA 4JQ0D 1KQMC 2MJWB 2SASA 5HLVA 1OMRA 1K2HA 4MLWA 4MVFA 1AUIB 1B9AA 3I5FC 1Y1XA 3JTDB 3CTNA 3FWBA 1MXLC 2K7CA 1SL7A 2EHBA 1DJYA 3CLNA 1H4BA 3VROA 1WLZA 2CBLA 3PATA 1K93D 5JOLA 3SJSA 4CLNA 1NCZA 3C1VA 1KK8C 3NSIA 1OOJA 1YUSA 3SG6A 1XFVO 1UHKA 2OTGC 1GGZA 2CNPA 3O6BA 1SR6C 4GGNA 1YR5A 1PULA 1B8LA 1XK4A 1M31A 1QIWA 3TS5B 3VRRA 1ODBA 2A4JA 5D69A 1BMOA 1PK0D 4PE0A 1CFDA 2PASA 1QX5B 2M97A 2ZN8A 3LK0A 3CR2A 1F71A 1BF5A 2KQYA 4A4BA 1FF1A 3OB1B 2KNEA 1UP5A 3SG2A 3A8RA 2LP3A 1S6IA 1UUSA 1KSOA 2WCFA 3D0YB 3IQQA 2EC6B 3CGAA 1S26D 2L51A 1WY9A 2ZNEA 1TRFA 1SMGA 2KSPA 5AEQA 1OE9B 2KHNA 3EKHA 1QATA 3KO0A 1CLBA 1S5GY 1F55A 4C0JA 4YGEB 1ZACA 1RK9A 1MWNA 1DJXA 1UHNA 2JT0A 1CDNA 5I2LA 1NCXA 3ZNIA 1BU3A 4C0KA 4MEWA 4OKHA 2D8NA 3I5FB 1L2OC 5D7FA 3A4UB 1F8HA 1AVSA 1JUOA 2GGMA 1V1FA 1XA5A 5J3XA 5HLOA 2BKHB 2H61C 1AJ4A 1F4QA 5CPVA 1S5GZ 2ZRTA 1A75A 3PN7B 2F8PA 4XJKB 1G8IA 2Q91A 1IG5A 3DD4A 3PFVA 4HRGA 3BUNB 5I8NA 2K0JA 1JF2A 4MBEA 1IRJA 1X02A 3QRXA 1EG4A 1K9KA 1LKJA 1IJ5A 1N0YA 3IF7A 2GV5A 5PALA 2F2OA 1QASA 1BLQA 5CSJA 3BUOB 4PE7A 4I5JA 3SG3A 1CM4A 2KFFA 2ZNDA 1L7ZA 1W7JB 2OPOA 2K7DA 2I94A 2OS8C 3H4SE 4HRHA 1CFCA 1QVIY 2E30A 2QACA 5JJGA 2IS9A 1TNPA 1LVCD 1LINA 1NCYA 2K2FA 3PALA 4U8DA 1RJVA 1QTXA 4XYNA 4DRWA 1JWDA 2AMIA 2LV7A 4MZKA 5GQQC 2NLNA 2HQWA 1RTP1 4JPZB 4MRXA 1EL4A 2ISDA 1WRZA 1UHHA 5TNCA 4DCKA 3JVTB 2ZRSA 1CDPA 1CNPA 5DKRA 4YBHB 1EH2A 1QVIZ 2FJUB 2BBNA 1B1GA 1C7VA 3EK8A 4PHKA 1BG1A 1GGWA 4GFTA 3WHUB 1KWOC 2HQ8A 2LNKA 5AERA 1EXRA 1QIVA 4N5XA 3CR5X 3ICBA 2L4IA 2M0RA 2BE6A 2WCBA 4CFRA 1NWDA 4XJKA 1OZSA 1NX2A 1K9UA 2KOTA 3OHMB 2M1UA 1PSBA 1TIZA 2BL0C 3KEVA 2MHHA 1S1EA 3OX6A 1SYMA 3EVVA 1UWOA 2VRGA 2PMYA 1J1EA 2JNXA 1IQ3A 4MZLA 3MSEB 2G9BA 1NUBA 2LC5A 4ORBB 4GAOA 3EK7A 4AOMA 3BUXB 1WDCC 5IBWA 5KU1A 5AANA 2KFHA 1GJYA 2JTZA 3AAJA 4YGAA 1MF8B 2O60A 1DF0A 1TN4A 1XFZO 2M8UA 3TDUA 1WLMA 5KSZA 1A75B 1D1OA 1K94A 2KGBC 5FYXA 4MN0A 1N65A 2LMUA 1W7IB 1YTZC 3BYAA 1H8BA 1BODA 1QLSA 1PSRA 2PVBA 3BQ3A 4HSZA 3GK1A 1RROA 1BOCA 3NXAA 4I5KA 4QJ5B 1SCMB 1Q80A 4A4CA 1F4OA 2I2RE 1JC2A 3NSKA 3I5HC 2V53A 5F6TA 2H61A 2PSRA 3SG4A 4QJ3B 2JTTA 2M7LA 1DJGA 1NX1A 1Y1AA 1SCVA 1HT9A 3I5IC 3O4YA 1K96A 3TDZA 1IKUA 1YUTA 2MRDA 2NCPA 4BY5A 5AXIA 3O2PA 4R1EA 1NIWA 2LAPA 5AFPA 1DGUA 2I18A 1A03A 3LCPC 1NPQA 1ALVA 2R2IA 1Y0VH 2AUCA 4PDZA 4CPVA 1JFJA 1KQMB 1SK6D 3DVKA 2JT3A 5CSNA 4CIDA 2KI4C 1J55A 4OCIA 2HF5A 4YRUA 1UHJA 2CXJA 1IH0A 3BUWB 1SL9A 3BOWA 3PM8A 3TUYC 1JBAA 1TOPA 1MR8A 3CR4X 2M3WA 1M39A 1ZMZA 1YX7A 1CKKA 1TNXA 3IQOA 1KK8B 1DVIA 1NSHA 4F0ZB 2JC2A 3K21A 3OB2B 4PE1A 1JFKA 2LLSA 2OTGB 1ZUZA 2F33A 4YGBB 5I2QA 2M9GA 4GUKA 1K95A 1SR6B 1ZOTB 1QV0A 2KI6C 2KGRA 1AK8A 2BKIB 3AKAA 3RLZA 4NDCA 5CSFA 3NSOA 2KAYA 2FCEA 2KI6D 2LHIA 1DJZA 3E3RA 5HKZA 1NX3A 3CWGA 1CTRA 1S6JA 3EVRA 2LVKA 2LANA 1DGVA 1K90D 1QXPA 1EJ3A 2PRUA 1E8AA 1B47A 4C0LA 1GQMA 3VRQA 1QX7A 1XFYO 4NQGA 1F54A 3LLEA 2F2PA 1B7TZ 1DF0B 4P5OE 2L5XB 5ER5A 1UHIA 3AAKA 2KFGA 2LP2A 3LL8B 1SW8A 1PVAA 1TCFA 2EGDA 1CLMA 4GGFC 1QV1A 4L9MA 3M0WA 1C07A 2JQ6A 2CCMA 4WRIA 5HKWA 2JU0A 1CB1A 1FPWA 2L98A 4PHMA 3KPXA 1TNWA 1PALA 2H2KA 3I5GC 1L2OB 4CFQA 3NSLA 1M45A 3JTDC 1DT7B 1J1DA 1DJHA 2K2AA 2I7AA 2K7BA 2G2BA 2RGIA 2BCBA 2WNDA 5BPJA 2L2EA 2Y5IA 4E68A 2Y1MA 2Q4UA 4HREE 4WQ2A 4DS7A 1Y6WA 1KFXS 1XYDA 2MBXA 1QJTA 4ZCUA 1OQPA 1KQVA 1YX8A 1R6PA 1FI5A 2CTNA 1K8UA 1RFJA 1SKTA 3TZ1A 1OZOA 1BR4B 3EVUA 3TS5C 4GPLB 1HQVA 2LVIA 1IGVA 3DF0A 3BXKA 2ZFDA 4NDBA 3SIAA 3VGOA 4UPGA 3OP0A 2JPTA 2KQ6A 2TN4A 2JZIA 4ORAB 5G08A 1A4PA 3PSRA 1AHRA 1XVJA 2FOTA 1YRTB 3F45A 2JOJA 2LUXA 1XFXO 2KYFA 5HYDA 2LLTA 1NP8A 2OS8B 4USLA 3AKBA 1PRWA 3BOWB 1Y1UA 1B8RA 1VRKA 2LM5A 2MA2A 2M1KB 2EC6C 4JWQA 1M63B 3PLFB 2QPTA 1UURA 2HETA 2M7NA 3SG5A 5ER4X 2KAVA 3DVJA 4IL1A 1KFUS 2SCPA 1MQ1A 3CS1A 4YGDB 5KTYA 3KF9A 4ZCVA 1AJ5A 1IJ6A 4PALA 1YVHA 1U5IA 2MLEC 1KSMA 3OX5A 1ALWA 3I5GB 3CZTX 3FS7A 1SRAA 4M2OA 2HPSA 4MSPA 2NCOA 1KWOB 1KFXL 3DVEA 1RWYA 2KAXA 1BT6A 3WXAA 1J7QA 3PN7C 4M2QA 4YI9A 3LK1A 3VRNA 4QJ4B 4PHJA 2K8MB 1KCYA 2LVJA 2Y4QA 1EG3A 2LE9B 2GGZA 2BCXA 4ICBA 2BL0B 2M29A 1OSAA 2LVVA 4AQIA 1QLKA 1CFFA 2B1UA 1QX2A 4FQOA 1CMFA 2L4HA 4M2PA 2WCEA 1OMDA 4ETOA 4P2YB 1WDCB 1DJWA 1XFUO 4PHNA 2JNFA 3SIBA 1YURA 3SG7A 5B8IB 1MUXA 1CLLA 3EK4A 2K7OA 2LLUA 2L0PA 1ZFSA 1IWQA 2KYCA 1LA3A 2E6WA 1KFUL 2CT9A 2K61A 2LHLA 1A29A 1C7WA 2KBIA 1KK7Y 4MZJA 4GGFA 1RECA 2AAOA 4YI8A 5HKYA 1XO5A 4ORCB 3ZWHA 2WOSA 1WRKA 1V1GA 1B8CA 1B7TY 1QS7A 2O5GA 3HX4A 1XK4C 4NDDA 4FTGA 5I2OA 3DF0B 3JVTC 4OV2A 5DKNA 2M49B 2F3YA 5CSIA 4AQJA 4MRYA 3I5HB 3TDIA 2BCAA 4N1FA 1SL8A 1SNLA 1CDLA 3EKJA 4I5LB 4OR9B 1KK7Z 1G33A 1MHOA 1IQ5A 3VRPA 3FIAA 3I5IB 2ZKMX 4PE4A 2NXQA 2JULA 2P6BB 2LMTA 4GNKB 1YUUA 2LUCA 1TTXA 1NX0A 1YVLA 2BE4A 4N1GA 3GK4X 3GK2A 1S3PA 3O78A 4TNCA 1K9PA 1DMOA 1U5IB 2WC8A 1DTLA 1S36A 2LMVA 4D1EA 2JWWA 3KHEA 2KI4B 5DKQA 2LCPA 1TNQA 3TUYB 3WHTB 3D0YA 3D10A 2ZN9A 1J7RA 2KDHA 1CFPA 1LA0A 1FI6A 1SY9A 1M46A 2BECA 1OMVA 3DVMA 1G4YR 4BY4A
chains in the Genus database with same CATH superfamily
1CM1A 3DYEA 2ERBA 2F3ZA 3DXLA 2FCDA 2Y1NA 1Z4HA 1MXEA 1J7PA 4DUQA 1NYAA 2JT8A 1FBVA 1DJIA 2BBMA 1S6CA 4WQ3A 1JF0A 4GBAA 3GOFA 4I5NB 1JSAA 2KBMA 1FW4A 1TCOB 1SCMC 1R2UA 2DOQA 3QMEA 1J7OA 2MLFC 3FWCA 1CMGA 2MAZA 2JXCA 5K89A 1SPYA 3RM1A 3BUMB 1F70A 1BR1B 3N7HA 3HCMA 2BAPA 1A2XA 4YGCB 3WNXB 2JXLA 4Q04A 4OVNF 3S0FA 1YRUB 1OW4A 2L50A 4JD9A 2NZ0A 4KYNA 1PVBA 1BJFA 2WORA 1AP4A 2COLB 1N2DA 2JRFA 2PALA 3FE6A 4PCWA 1SBJA 1TWOA 4DIRA 1CDMA 1B4CA 2WCMA 1XFWO 1LXFC 1WRLA 4JQ0D 1KQMC 2MJWB 2SASA 5HLVA 1OMRA 4FQTA 1K2HA 4MLWA 4MVFA 1AUIB 1B9AA 3I5FC 1Y1XA 3JTDB 3CTNA 3FWBA 1MXLC 2K7CA 1SL7A 2EHBA 1DJYA 3CLNA 1H4BA 3VROA 1WLZA 3UNWA 2CBLA 3PATA 1K93D 5JOLA 3SJSA 4CLNA 3Q8IA 1NCZA 3C1VA 1KK8C 3NSIA 1OOJA 1YUSA 3SG6A 1XFVO 1UHKA 2OTGC 1GGZA 2CNPA 3O6BA 1SR6C 3PM2A 4GGNA 1YR5A 1PULA 5EL2A 1B8LA 1XK4A 1M31A 1TUZA 1QIWA 3TS5B 1QWVA 1ODBA 2A4JA 3VRRA 1W9ZA 5D69A 1BMOA 1PK0D 4PE0A 1CFDA 2PASA 1QX5B 2M97A 2ZN8A 3LK0A 4INWA 3CR2A 1F71A 1BF5A 2KQYA 4A4BA 1FF1A 3OB1B 2KNEA 1UP5A 3SG2A 2WCHA 3A8RA 2LP3A 1S6IA 1UUSA 1KSOA 2WCFA 3D0YB 3IQQA 2EC6B 3CGAA 1S26D 2L51A 1WY9A 2ZNEA 5D3OA 1TRFA 1SMGA 2KSPA 5AEQA 1OE9B 2KHNA 3EKHA 1QATA 3KO0A 1CLBA 1S5GY 1F55A 4C0JA 4YGEB 3B88A 1ZACA 1RK9A 1MWNA 1DJXA 1UHNA 2JT0A 3R1PA 5I2LA 1CDNA 1NCXA 3ZNIA 1BU3A 3VB1A 4C0KA 4MEWA 4OKHA 2D8NA 3I5FB 3SS5A 1L2OC 5D7FA 3A4UB 1F8HA 1AVSA 1JUOA 2GGMA 1V1FA 2L5YA 1XA5A 3EG5B 3OGNA 5J3XA 5HLOA 2BKHB 2H61C 1AJ4A 1F4QA 2WCKA 5CPVA 1S5GZ 2ZRTA 1A75A 3CZ2A 3D73A 3PN7B 2F8PA 4XJKB 1G8IA 2Q91A 1IG5A 3DD4A 3PFVA 4HRGA 3BUNB 5I8NA 2K0JA 1JF2A 4MBEA 1IRJA 1X02A 3QRXA 1EG4A 1K9KA 1LKJA 1IJ5A 1N0YA 3IF7A 2GV5A 5PALA 2F2OA 1QASA 1BLQA 5CSJA 3BUOB 4PE7A 4I5JA 3SG3A 1CM4A 2KFFA 2ZNDA 1L7ZA 1W7JB 2OPOA 2K7DA 3BFBA 2I94A 2OS8C 3H4SE 4HRHA 5I94A 1CFCA 1QVIY 2E30A 2QACA 5JJGA 2IS9A 1TNPA 1LVCD 1LINA 1NCYA 2K2FA 2P70A 3PALA 4U8DA 1RJVA 1QTXA 4XYNA 4DRWA 1JWDA 2AMIA 2LV7A 4MZKA 5GQQC 2NLNA 1ORGA 2HQWA 1RTP1 4JPZB 4MRXA 1EL4A 1TUJA 2ISDA 1WRZA 3FE8A 1UHHA 5TNCA 4DCKA 3JVTB 2ZRSA 1CDPA 1CNPA 5DKRA 4YBHB 3R1OA 1QVIZ 1EH2A 2FJUB 5FI6A 2BBNA 1B1GA 1C7VA 3EK8A 4OZDA 4PHKA 1BG1A 4GFTA 3WHUB 1GGWA 1KWOC 3L47A 2HQ8A 2LNKA 5AERA 1EXRA 1QIVA 4N5XA 3CR5X 3ICBA 2L4IA 2M0RA 2BE6A 2WCBA 4CFRA 1NWDA 2WC5A 4XJKA 1OZSA 1NX2A 1T14A 1K9UA 2KOTA 2PQLA 3OHMB 2M1UA 2YGUA 3S0DA 1PSBA 1TIZA 2BL0C 3KEVA 2MHHA 1S1EA 1XFRA 3UO9A 3OX6A 1SYMA 3EVVA 1UWOA 2VRGA 2PMYA 1J1EA 2JNXA 3CYZA 1IQ3A 4MZLA 3MSEB 2G9BA 1NUBA 2WCJA 2LC5A 4ORBB 4GAOA 3EK7A 4AOMA 3BUXB 1WDCC 5IBWA 5KU1A 5AANA 2KFHA 1GJYA 2JTZA 3AAJA 3L4LA 4YGAA 1MF8B 2O60A 1DF0A 1TN4A 1XFZO 2M8UA 3TDUA 1WLMA 5KSZA 1A75B 1D1OA 1K94A 2KGBC 5FYXA 4MN0A 1N65A 2LMUA 1W7IB 1YTZC 3BYAA 4JKTA 1H8BA 1BODA 1QLSA 1PSRA 2PVBA 3BQ3A 4HSZA 3D75A 3GK1A 1RROA 1BOCA 3NXAA 4I5KA 4QJ5B 5FI7A 1C3YA 1SCMB 1Q80A 4A4CA 1F4OA 2I2RE 1JC2A 3NSKA 3I5HC 2V53A 5F6TA 3D78A 2H61A 1OOFA 2PSRA 3RZSA 3SG4A 4QJ3B 2JTTA 2M7LA 1DJGA 1NX1A 1Y1AA 1SCVA 3S0BA 1HT9A 3DZTA 3I5IC 3O4YA 1K96A 3TDZA 1IKUA 1YUTA 3BFAA 2MRDA 2NCPA 4BY5A 5AXIA 3O2PA 4R1EA 1NIWA 2LAPA 5AFPA 1DGUA 2I18A 1A03A 3LCPC 1NPQA 1ALVA 2R2IA 1Y0VH 2AUCA 2KLDA 4PDZA 4CPVA 1JFJA 1KQMB 1SK6D 1DEKA 2JT3A 3DVKA 5CSNA 4CIDA 2KI4C 3DY9A 1J55A 4OCIA 2HF5A 4YRUA 1UHJA 2CXJA 1IH0A 3BUWB 1SL9A 3BOWA 3PM8A 3TUYC 1JBAA 1TOPA 1MR8A 3CR4X 2M3WA 1M39A 1ZMZA 1YX7A 1CKKA 1TNXA 3IQOA 1KK8B 1DVIA 1NSHA 4F0ZB 2JC2A 3OBVA 3K21A 4PT1A 3OB2B 4PE1A 1JFKA 2LLSA 2OTGB 1ZUZA 2QEBA 2F33A 4YGBB 5I2QA 2M9GA 4GUKA 1K95A 1SR6B 1ZOTB 1QV0A 2KI6C 2KGRA 1AK8A 2BKIB 3AKAA 3RLZA 4NDCA 5CSFA 3NSOA 2KAYA 2FCEA 2KI6D 2LHIA 1DJZA 3E3RA 5HKZA 1NX3A 3CDNA 3CWGA 1CTRA 1S6JA 3EVRA 2LVKA 2LANA 1DGVA 1K90D 1QXPA 1EJ3A 2PRUA 3L4AA 1E8AA 1B47A 2QEVA 1GQMA 3VRQA 4C0LA 1QX7A 1XFYO 4NQGA 1F54A 3LLEA 2F2PA 1B7TZ 1DF0B 4P5OE 2L5XB 5ER5A 1UHIA 3AAKA 2KFGA 2LP2A 3LL8B 1SW8A 1PVAA 1TCFA 2EGDA 1CLMA 4GGFC 1QV1A 3NGVA 3S0GA 4L9MA 3M0WA 2WCLA 2JQ6A 2CCMA 4WRIA 5HKWA 2JU0A 1C07A 1CB1A 1FPWA 2L98A 4PHMA 1GM0A 3KPXA 3PJIA 3B86A 1TNWA 1PALA 2H2KA 3I5GC 1L2OB 4CFQA 3NSLA 1M45A 3JTDC 4F7FA 1DT7B 1J1DA 1DJHA 2K2AA 2I7AA 2K7BA 3BJHA 2G2BA 3S0EA 2KLEA 2RGIA 2BCBA 2WNDA 5BPJA 2L2EA 2Y5IA 4E68A 2Y1MA 2Q4UA 4HREE 4WQ2A 4DS7A 1Y6WA 1KFXS 1XYDA 2MBXA 1QJTA 1P28A 4ZCUA 1Z2CB 1OQPA 1KQVA 1YX8A 1R6PA 1FI5A 1SSEB 2CTNA 2KPHA 1K8UA 1RFJA 1SKTA 2QEOA 3IVTA 4INXA 3TZ1A 1OZOA 1BR4B 3EVUA 3TS5C 4GPLB 1HQVA 2LVIA 1IGVA 3DF0A 3BXKA 2ZFDA 4NDBA 3SIAA 3VGOA 4UPGA 3OP0A 2JPTA 2KQ6A 2TN4A 2JZIA 4ORAB 1LS8A 1A4PA 5G08A 3PSRA 1AHRA 1XVJA 2FOTA 3D74A 1YRTB 3F45A 2JOJA 5DICA 2LUXA 1XFXO 2KYFA 5HYDA 2LLTA 1NP8A 2OS8B 3R72A 4USLA 3AKBA 3CABA 1PRWA 3BOWB 1Y1UA 1B8RA 1VRKA 2LM5A 2MA2A 2M1KB 2EC6C 4JWQA 3D76A 1M63B 3PLFB 2QPTA 2PYQA 1UURA 2HETA 2M7NA 3SG5A 3SS3A 5ER4X 2KAVA 3DVJA 1OOIX 4IL1A 1KFUS 2SCPA 1MQ1A 5HL1A 3CS1A 4YGDB 5KTYA 2JPOA 3D77A 3KF9A 4ZCVA 1AJ5A 1IJ6A 4PALA 1YVHA 1U5IA 2MLEC 1KSMA 3OX5A 1ALWA 2WC6A 3I5GB 3V2LA 3CZTX 3FS7A 1SRAA 4M2OA 2HPSA 4MSPA 3K1EA 2NCOA 1KWOB 1KFXL 3DVEA 1RWYA 2KAXA 5FI2A 1BT6A 3WXAA 1J7QA 3R1VA 2P71A 3PN7C 4M2QA 3NHIA 4YI9A 3LK1A 3VRNA 4QJ4B 4PHJA 2H8VA 2K8MB 1KCYA 2LVJA 2K60A 1EG3A 2Y4QA 2LE9B 2GGZA 2BCXA 4ICBA 2BL0B 3CZ0A 2M29A 1OSAA 1DELA 2LVVA 4AQIA 2L2CA 1QLKA 1C3ZA 1CFFA 2B1UA 1QX2A 3O4XA 4FQOA 1CMFA 2L4HA 4M2PA 2WCEA 1OMDA 4ETOA 4P2YB 1WDCB 1DJWA 1XFUO 4PHNA 3CZ1A 2JNFA 3SIBA 1YURA 3SG7A 5B8IB 1MUXA 1CLLA 3EK4A 2K7OA 2LLUA 2L0PA 3S0AA 1ZFSA 1IWQA 2KYCA 1LA3A 2E6WA 1KFUL 2CT9A 2K61A 2LHLA 1A29A 1C7WA 3FE9A 2KBIA 2GTEA 1KK7Y 4MZJA 4GGFA 1RECA 2AAOA 2BNXA 4YI8A 5HKYA 1XO5A 4ORCB 3ZWHA 2WOSA 1WRKA 1V1GA 1B8CA 1B7TY 1QS7A 2O5GA 1OOHA 3HX4A 1DQEA 1XK4C 4NDDA 4FTGA 5I2OA 3DF0B 3JVTC 4OV2A 5DKNA 2M49B 1DC1A 2F3YA 5CSIA 3NHTA 4AQJA 4MRYA 3I5HB 3TDIA 2BCAA 2QDIA 4N1FA 1SL8A 1SNLA 1CDLA 3EKJA 4I5LB 4OR9B 3BFHA 1KK7Z 1G33A 1MHOA 1IQ5A 2FJYA 3VRPA 3FIAA 3I5IB 1IIOA 2ZKMX 4PE4A 2NXQA 2JULA 2P6BB 2LMTA 3B6XA 4GNKB 1YUUA 3B87A 2LUCA 1TTXA 1NX0A 1YVLA 3DVMA 2BE4A 4N1GA 3GK4X 3SS4A 2QEHA 1S3PA 3GK2A 3O78A 4TNCA 1K9PA 1OOGA 1DMOA 1U5IB 2WC8A 1DTLA 1S36A 2LMVA 4D1EA 2JWWA 3KHEA 2KI4B 5DKQA 2LCPA 1TNQA 3TUYB 3WHTB 3D0YA 3D10A 2ZN9A 4IJ7A 1J7RA 2KDHA 1CFPA 1LA0A 1FI6A 1SY9A 1M46A 2BECA 1OMVA 3B7AA 1G4YR 4BY4A
chains in the Genus database with same CATH topology
1CM1A 2F3ZA 2FCDA 2Y1NA 1MXEA 1J7PA 4DUQA 1NYAA 2JT8A 1FBVA 1DJIA 2BBMA 1S6CA 4WQ3A 1JF0A 4GBAA 3GOFA 4I5NB 1JSAA 2KBMA 1FW4A 1TCOB 1SCMC 1R2UA 2DOQA 1J7OA 2MLFC 3FWCA 1CMGA 2MAZA 2JXCA 5K89A 1SPYA 3RM1A 3BUMB 1F70A 1BR1B 3HCMA 1A2XA 4YGCB 3WNXB 2JXLA 4Q04A 4OVNF 1YRUB 2L50A 2NZ0A 1PVBA 1BJFA 2WORA 1AP4A 2COLB 1N2DA 2JRFA 2PALA 4PCWA 1SBJA 4DIRA 1CDMA 1B4CA 1XFWO 1LXFC 1WRLA 4JQ0D 1KQMC 2MJWB 2SASA 5HLVA 1OMRA 1K2HA 4MLWA 4MVFA 1AUIB 1B9AA 3I5FC 1Y1XA 3JTDB 3CTNA 3FWBA 1MXLC 2K7CA 1SL7A 2EHBA 1DJYA 3CLNA 1H4BA 3VROA 1WLZA 2CBLA 3PATA 1K93D 5JOLA 3SJSA 4CLNA 1NCZA 3C1VA 1KK8C 3NSIA 1OOJA 1YUSA 3SG6A 1XFVO 1UHKA 2OTGC 1GGZA 2CNPA 3O6BA 1SR6C 4GGNA 1YR5A 1PULA 1B8LA 1XK4A 1M31A 1QIWA 3TS5B 3VRRA 1ODBA 2A4JA 5D69A 1BMOA 1PK0D 4PE0A 1CFDA 2PASA 1QX5B 2M97A 2ZN8A 3LK0A 3CR2A 1F71A 1BF5A 2KQYA 4A4BA 1FF1A 3OB1B 2KNEA 1UP5A 3SG2A 3A8RA 2LP3A 1S6IA 1UUSA 1KSOA 2WCFA 3D0YB 3IQQA 2EC6B 3CGAA 1S26D 2L51A 1WY9A 2ZNEA 1TRFA 1SMGA 2KSPA 5AEQA 1OE9B 2KHNA 3EKHA 1QATA 3KO0A 1CLBA 1S5GY 1F55A 4C0JA 4YGEB 1ZACA 1RK9A 1MWNA 1DJXA 1UHNA 2JT0A 1CDNA 5I2LA 1NCXA 3ZNIA 1BU3A 4C0KA 4MEWA 4OKHA 2D8NA 3I5FB 1L2OC 5D7FA 3A4UB 1F8HA 1AVSA 1JUOA 2GGMA 1V1FA 1XA5A 5J3XA 5HLOA 2BKHB 2H61C 1AJ4A 1F4QA 5CPVA 1S5GZ 2ZRTA 1A75A 3PN7B 2F8PA 4XJKB 1G8IA 2Q91A 1IG5A 3DD4A 3PFVA 4HRGA 3BUNB 5I8NA 2K0JA 1JF2A 4MBEA 1IRJA 1X02A 3QRXA 1EG4A 1K9KA 1LKJA 1IJ5A 1N0YA 3IF7A 2GV5A 5PALA 2F2OA 1QASA 1BLQA 5CSJA 3BUOB 4PE7A 4I5JA 3SG3A 1CM4A 2KFFA 2ZNDA 1L7ZA 1W7JB 2OPOA 2K7DA 2I94A 2OS8C 3H4SE 4HRHA 1CFCA 1QVIY 2E30A 2QACA 5JJGA 2IS9A 1TNPA 1LVCD 1LINA 1NCYA 2K2FA 3PALA 4U8DA 1RJVA 1QTXA 4XYNA 4DRWA 1JWDA 2AMIA 2LV7A 4MZKA 5GQQC 2NLNA 2HQWA 1RTP1 4JPZB 4MRXA 1EL4A 2ISDA 1WRZA 1UHHA 5TNCA 4DCKA 3JVTB 2ZRSA 1CDPA 1CNPA 5DKRA 4YBHB 1EH2A 1QVIZ 2FJUB 2BBNA 1B1GA 1C7VA 3EK8A 4PHKA 1BG1A 1GGWA 4GFTA 3WHUB 1KWOC 2HQ8A 2LNKA 5AERA 1EXRA 1QIVA 4N5XA 3CR5X 3ICBA 2L4IA 2M0RA 2BE6A 2WCBA 4CFRA 1NWDA 4XJKA 1OZSA 1NX2A 1K9UA 2KOTA 3OHMB 2M1UA 1PSBA 1TIZA 2BL0C 3KEVA 2MHHA 1S1EA 3OX6A 1SYMA 3EVVA 1UWOA 2VRGA 2PMYA 1J1EA 2JNXA 1IQ3A 4MZLA 3MSEB 2G9BA 1NUBA 2LC5A 4ORBB 4GAOA 3EK7A 4AOMA 3BUXB 1WDCC 5IBWA 5KU1A 5AANA 2KFHA 1GJYA 2JTZA 3AAJA 4YGAA 1MF8B 2O60A 1DF0A 1TN4A 1XFZO 2M8UA 3TDUA 1WLMA 5KSZA 1A75B 1D1OA 1K94A 2KGBC 5FYXA 4MN0A 1N65A 2LMUA 1W7IB 1YTZC 3BYAA 1H8BA 1BODA 1QLSA 1PSRA 2PVBA 3BQ3A 4HSZA 3GK1A 1RROA 1BOCA 3NXAA 4I5KA 4QJ5B 1SCMB 1Q80A 4A4CA 1F4OA 2I2RE 1JC2A 3NSKA 3I5HC 2V53A 5F6TA 2H61A 2PSRA 3SG4A 4QJ3B 2JTTA 2M7LA 1DJGA 1NX1A 1Y1AA 1SCVA 1HT9A 3I5IC 3O4YA 1K96A 3TDZA 1IKUA 1YUTA 2MRDA 2NCPA 4BY5A 5AXIA 3O2PA 4R1EA 1NIWA 2LAPA 5AFPA 1DGUA 2I18A 1A03A 3LCPC 1NPQA 1ALVA 2R2IA 1Y0VH 2AUCA 4PDZA 4CPVA 1JFJA 1KQMB 1SK6D 3DVKA 2JT3A 5CSNA 4CIDA 2KI4C 1J55A 4OCIA 2HF5A 4YRUA 1UHJA 2CXJA 1IH0A 3BUWB 1SL9A 3BOWA 3PM8A 3TUYC 1JBAA 1TOPA 1MR8A 3CR4X 2M3WA 1M39A 1ZMZA 1YX7A 1CKKA 1TNXA 3IQOA 1KK8B 1DVIA 1NSHA 4F0ZB 2JC2A 3K21A 3OB2B 4PE1A 1JFKA 2LLSA 2OTGB 1ZUZA 2F33A 4YGBB 5I2QA 2M9GA 4GUKA 1K95A 1SR6B 1ZOTB 1QV0A 2KI6C 2KGRA 1AK8A 2BKIB 3AKAA 3RLZA 4NDCA 5CSFA 3NSOA 2KAYA 2FCEA 2KI6D 2LHIA 1DJZA 3E3RA 5HKZA 1NX3A 3CWGA 1CTRA 1S6JA 3EVRA 2LVKA 2LANA 1DGVA 1K90D 1QXPA 1EJ3A 2PRUA 1E8AA 1B47A 4C0LA 1GQMA 3VRQA 1QX7A 1XFYO 4NQGA 1F54A 3LLEA 2F2PA 1B7TZ 1DF0B 4P5OE 2L5XB 5ER5A 1UHIA 3AAKA 2KFGA 2LP2A 3LL8B 1SW8A 1PVAA 1TCFA 2EGDA 1CLMA 4GGFC 1QV1A 4L9MA 3M0WA 1C07A 2JQ6A 2CCMA 4WRIA 5HKWA 2JU0A 1CB1A 1FPWA 2L98A 4PHMA 3KPXA 1TNWA 1PALA 2H2KA 3I5GC 1L2OB 4CFQA 3NSLA 1M45A 3JTDC 1DT7B 1J1DA 1DJHA 2K2AA 2I7AA 2K7BA 2G2BA 2RGIA 2BCBA 2WNDA 5BPJA 2L2EA 2Y5IA 4E68A 2Y1MA 2Q4UA 4HREE 4WQ2A 4DS7A 1Y6WA 1KFXS 1XYDA 2MBXA 1QJTA 4ZCUA 1OQPA 1KQVA 1YX8A 1R6PA 1FI5A 2CTNA 1K8UA 1RFJA 1SKTA 3TZ1A 1OZOA 1BR4B 3EVUA 3TS5C 4GPLB 1HQVA 2LVIA 1IGVA 3DF0A 3BXKA 2ZFDA 4NDBA 3SIAA 3VGOA 4UPGA 3OP0A 2JPTA 2KQ6A 2TN4A 2JZIA 4ORAB 5G08A 1A4PA 3PSRA 1AHRA 1XVJA 2FOTA 1YRTB 3F45A 2JOJA 2LUXA 1XFXO 2KYFA 5HYDA 2LLTA 1NP8A 2OS8B 4USLA 3AKBA 1PRWA 3BOWB 1Y1UA 1B8RA 1VRKA 2LM5A 2MA2A 2M1KB 2EC6C 4JWQA 1M63B 3PLFB 2QPTA 1UURA 2HETA 2M7NA 3SG5A 5ER4X 2KAVA 3DVJA 4IL1A 1KFUS 2SCPA 1MQ1A 3CS1A 4YGDB 5KTYA 3KF9A 4ZCVA 1AJ5A 1IJ6A 4PALA 1YVHA 1U5IA 2MLEC 1KSMA 3OX5A 1ALWA 3I5GB 3CZTX 3FS7A 1SRAA 4M2OA 2HPSA 4MSPA 2NCOA 1KWOB 1KFXL 3DVEA 1RWYA 2KAXA 1BT6A 3WXAA 1J7QA 3PN7C 4M2QA 4YI9A 3LK1A 3VRNA 4QJ4B 4PHJA 2K8MB 1KCYA 2LVJA 2Y4QA 1EG3A 2LE9B 2GGZA 2BCXA 4ICBA 2BL0B 2M29A 1OSAA 2LVVA 4AQIA 1QLKA 1CFFA 2B1UA 1QX2A 4FQOA 1CMFA 2L4HA 4M2PA 2WCEA 1OMDA 4ETOA 4P2YB 1WDCB 1DJWA 1XFUO 4PHNA 2JNFA 3SIBA 1YURA 3SG7A 5B8IB 1MUXA 1CLLA 3EK4A 2K7OA 2LLUA 2L0PA 1ZFSA 1IWQA 2KYCA 1LA3A 2E6WA 1KFUL 2CT9A 2K61A 2LHLA 1A29A 1C7WA 2KBIA 1KK7Y 4MZJA 4GGFA 1RECA 2AAOA 4YI8A 5HKYA 1XO5A 4ORCB 3ZWHA 2WOSA 1WRKA 1V1GA 1B8CA 1B7TY 1QS7A 2O5GA 3HX4A 1XK4C 4NDDA 4FTGA 5I2OA 3DF0B 3JVTC 4OV2A 5DKNA 2M49B 2F3YA 5CSIA 4AQJA 4MRYA 3I5HB 3TDIA 2BCAA 4N1FA 1SL8A 1SNLA 1CDLA 3EKJA 4I5LB 4OR9B 1KK7Z 1G33A 1MHOA 1IQ5A 3VRPA 3FIAA 3I5IB 2ZKMX 4PE4A 2NXQA 2JULA 2P6BB 2LMTA 4GNKB 1YUUA 2LUCA 1TTXA 1NX0A 1YVLA 2BE4A 4N1GA 3GK4X 3GK2A 1S3PA 3O78A 4TNCA 1K9PA 1DMOA 1U5IB 2WC8A 1DTLA 1S36A 2LMVA 4D1EA 2JWWA 3KHEA 2KI4B 5DKQA 2LCPA 1TNQA 3TUYB 3WHTB 3D0YA 3D10A 2ZN9A 1J7RA 2KDHA 1CFPA 1LA0A 1FI6A 1SY9A 1M46A 2BECA 1OMVA 3DVMA 1G4YR 4BY4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CM1 A;  2F3Z A;  2FCD A;  2Y1N A;  1MXE A;  1J7P A;  4DUQ A;  1NYA A;  2JT8 A;  1FBV A;  1DJI A;  2BBM A;  1S6C A;  4WQ3 A;  1JF0 A;  4GBA A;  3GOF A;  4I5N B;  1JSA A;  2KBM A;  1FW4 A;  1TCO B;  1SCM C;  1R2U A;  2DOQ A;  1J7O A;  2MLF C;  3FWC A;  1CMG A;  2MAZ A;  2JXC A;  5K89 A;  1SPY A;  3RM1 A;  3BUM B;  1F70 A;  1BR1 B;  3HCM A;  1A2X A;  4YGC B;  3WNX B;  2JXL A;  4Q04 A;  4OVN F;  1YRU B;  2L50 A;  2NZ0 A;  1PVB A;  1BJF A;  2WOR A;  1AP4 A;  2COL B;  1N2D A;  2JRF A;  2PAL A;  4PCW A;  1SBJ A;  4DIR A;  1CDM A;  1B4C A;  1XFW O;  1LXF C;  1WRL A;  4JQ0 D;  1KQM C;  2MJW B;  2SAS A;  5HLV A;  1OMR A;  1K2H A;  4MLW A;  4MVF A;  1AUI B;  1B9A A;  3I5F C;  1Y1X A;  3JTD B;  3CTN A;  3FWB A;  1MXL C;  2K7C A;  1SL7 A;  2EHB A;  1DJY A;  3CLN A;  1H4B A;  3VRO A;  1WLZ A;  2CBL A;  3PAT A;  1K93 D;  5JOL A;  3SJS A;  4CLN A;  1NCZ A;  3C1V A;  1KK8 C;  3NSI A;  1OOJ A;  1YUS A;  3SG6 A;  1XFV O;  1UHK A;  2OTG C;  1GGZ A;  2CNP A;  3O6B A;  1SR6 C;  4GGN A;  1YR5 A;  1PUL A;  1B8L A;  1XK4 A;  1M31 A;  1QIW A;  3TS5 B;  3VRR A;  1ODB A;  2A4J A;  5D69 A;  1BMO A;  1PK0 D;  4PE0 A;  1CFD A;  2PAS A;  1QX5 B;  2M97 A;  2ZN8 A;  3LK0 A;  3CR2 A;  1F71 A;  1BF5 A;  2KQY A;  4A4B A;  1FF1 A;  3OB1 B;  2KNE A;  1UP5 A;  3SG2 A;  3A8R A;  2LP3 A;  1S6I A;  1UUS A;  1KSO A;  2WCF A;  3D0Y B;  3IQQ A;  2EC6 B;  3CGA A;  1S26 D;  2L51 A;  1WY9 A;  2ZNE A;  1TRF A;  1SMG A;  2KSP A;  5AEQ A;  1OE9 B;  2KHN A;  3EKH A;  1QAT A;  3KO0 A;  1CLB A;  1S5G Y;  1F55 A;  4C0J A;  4YGE B;  1ZAC A;  1RK9 A;  1MWN A;  1DJX A;  1UHN A;  2JT0 A;  1CDN A;  5I2L A;  1NCX A;  3ZNI A;  1BU3 A;  4C0K A;  4MEW A;  4OKH A;  2D8N A;  3I5F B;  1L2O C;  5D7F A;  3A4U B;  1F8H A;  1AVS A;  1JUO A;  2GGM A;  1V1F A;  1XA5 A;  5J3X A;  5HLO A;  2BKH B;  2H61 C;  1AJ4 A;  1F4Q A;  5CPV A;  1S5G Z;  2ZRT A;  1A75 A;  3PN7 B;  2F8P A;  4XJK B;  1G8I A;  2Q91 A;  1IG5 A;  3DD4 A;  3PFV A;  4HRG A;  3BUN B;  5I8N A;  2K0J A;  1JF2 A;  4MBE A;  1IRJ A;  1X02 A;  3QRX A;  1EG4 A;  1K9K A;  1LKJ A;  1IJ5 A;  1N0Y A;  3IF7 A;  2GV5 A;  5PAL A;  2F2O A;  1QAS A;  1BLQ A;  5CSJ A;  3BUO B;  4PE7 A;  4I5J A;  3SG3 A;  1CM4 A;  2KFF A;  2ZND A;  1L7Z A;  1W7J B;  2OPO A;  2K7D A;  2I94 A;  2OS8 C;  3H4S E;  4HRH A;  1CFC A;  1QVI Y;  2E30 A;  2QAC A;  5JJG A;  2IS9 A;  1TNP A;  1LVC D;  1LIN A;  1NCY A;  2K2F A;  3PAL A;  4U8D A;  1RJV A;  1QTX A;  4XYN A;  4DRW A;  1JWD A;  2AMI A;  2LV7 A;  4MZK A;  5GQQ C;  2NLN A;  2HQW A;  1RTP 1;  4JPZ B;  4MRX A;  1EL4 A;  2ISD A;  1WRZ A;  1UHH A;  5TNC A;  4DCK A;  3JVT B;  2ZRS A;  1CDP A;  1CNP A;  5DKR A;  4YBH B;  1EH2 A;  1QVI Z;  2FJU B;  2BBN A;  1B1G A;  1C7V A;  3EK8 A;  4PHK A;  1BG1 A;  1GGW A;  4GFT A;  3WHU B;  1KWO C;  2HQ8 A;  2LNK A;  5AER A;  1EXR A;  1QIV A;  4N5X A;  3CR5 X;  3ICB A;  2L4I A;  2M0R A;  2BE6 A;  2WCB A;  4CFR A;  1NWD A;  4XJK A;  1OZS A;  1NX2 A;  1K9U A;  2KOT A;  3OHM B;  2M1U A;  1PSB A;  1TIZ A;  2BL0 C;  3KEV A;  2MHH A;  1S1E A;  3OX6 A;  1SYM A;  3EVV A;  1UWO A;  2VRG A;  2PMY A;  1J1E A;  2JNX A;  1IQ3 A;  4MZL A;  3MSE B;  2G9B A;  1NUB A;  2LC5 A;  4ORB B;  4GAO A;  3EK7 A;  4AOM A;  3BUX B;  1WDC C;  5IBW A;  5KU1 A;  5AAN A;  2KFH A;  1GJY A;  2JTZ A;  3AAJ A;  4YGA A;  1MF8 B;  2O60 A;  1DF0 A;  1TN4 A;  1XFZ O;  2M8U A;  3TDU A;  1WLM A;  5KSZ A;  1A75 B;  1D1O A;  1K94 A;  2KGB C;  5FYX A;  4MN0 A;  1N65 A;  2LMU A;  1W7I B;  1YTZ C;  3BYA A;  1H8B A;  1BOD A;  1QLS A;  1PSR A;  2PVB A;  3BQ3 A;  4HSZ A;  3GK1 A;  1RRO A;  1BOC A;  3NXA A;  4I5K A;  4QJ5 B;  1SCM B;  1Q80 A;  4A4C A;  1F4O A;  2I2R E;  1JC2 A;  3NSK A;  3I5H C;  2V53 A;  5F6T A;  2H61 A;  2PSR A;  3SG4 A;  4QJ3 B;  2JTT A;  2M7L A;  1DJG A;  1NX1 A;  1Y1A A;  1SCV A;  1HT9 A;  3I5I C;  3O4Y A;  1K96 A;  3TDZ A;  1IKU A;  1YUT A;  2MRD A;  2NCP A;  4BY5 A;  5AXI A;  3O2P A;  4R1E A;  1NIW A;  2LAP A;  5AFP A;  1DGU A;  2I18 A;  1A03 A;  3LCP C;  1NPQ A;  1ALV A;  2R2I A;  1Y0V H;  2AUC A;  4PDZ A;  4CPV A;  1JFJ A;  1KQM B;  1SK6 D;  3DVK A;  2JT3 A;  5CSN A;  4CID A;  2KI4 C;  1J55 A;  4OCI A;  2HF5 A;  4YRU A;  1UHJ A;  2CXJ A;  1IH0 A;  3BUW B;  1SL9 A;  3BOW A;  3PM8 A;  3TUY C;  1JBA A;  1TOP A;  1MR8 A;  3CR4 X;  2M3W A;  1M39 A;  1ZMZ A;  1YX7 A;  1CKK A;  1TNX A;  3IQO A;  1KK8 B;  1DVI A;  1NSH A;  4F0Z B;  2JC2 A;  3K21 A;  3OB2 B;  4PE1 A;  1JFK A;  2LLS A;  2OTG B;  1ZUZ A;  2F33 A;  4YGB B;  5I2Q A;  2M9G A;  4GUK A;  1K95 A;  1SR6 B;  1ZOT B;  1QV0 A;  2KI6 C;  2KGR A;  1AK8 A;  2BKI B;  3AKA A;  3RLZ A;  4NDC A;  5CSF A;  3NSO A;  2KAY A;  2FCE A;  2KI6 D;  2LHI A;  1DJZ A;  3E3R A;  5HKZ A;  1NX3 A;  3CWG A;  1CTR A;  1S6J A;  3EVR A;  2LVK A;  2LAN A;  1DGV A;  1K90 D;  1QXP A;  1EJ3 A;  2PRU A;  1E8A A;  1B47 A;  4C0L A;  1GQM A;  3VRQ A;  1QX7 A;  1XFY O;  4NQG A;  1F54 A;  3LLE A;  2F2P A;  1B7T Z;  1DF0 B;  4P5O E;  2L5X B;  5ER5 A;  1UHI A;  3AAK A;  2KFG A;  2LP2 A;  3LL8 B;  1SW8 A;  1PVA A;  1TCF A;  2EGD A;  1CLM A;  4GGF C;  1QV1 A;  4L9M A;  3M0W A;  1C07 A;  2JQ6 A;  2CCM A;  4WRI A;  5HKW A;  2JU0 A;  1CB1 A;  1FPW A;  2L98 A;  4PHM A;  3KPX A;  1TNW A;  1PAL A;  2H2K A;  3I5G C;  1L2O B;  4CFQ A;  3NSL A;  1M45 A;  3JTD C;  1DT7 B;  1J1D A;  1DJH A;  2K2A A;  2I7A A;  2K7B A;  2G2B A;  2RGI A;  2BCB A;  2WND A;  5BPJ A;  2L2E A;  2Y5I A;  4E68 A;  2Y1M A;  2Q4U A;  4HRE E;  4WQ2 A;  4DS7 A;  1Y6W A;  1KFX S;  1XYD A;  2MBX A;  1QJT A;  4ZCU A;  1OQP A;  1KQV A;  1YX8 A;  1R6P A;  1FI5 A;  2CTN A;  1K8U A;  1RFJ A;  1SKT A;  3TZ1 A;  1OZO A;  1BR4 B;  3EVU A;  3TS5 C;  4GPL B;  1HQV A;  2LVI A;  1IGV A;  3DF0 A;  3BXK A;  2ZFD A;  4NDB A;  3SIA A;  3VGO A;  4UPG A;  3OP0 A;  2JPT A;  2KQ6 A;  2TN4 A;  2JZI A;  4ORA B;  5G08 A;  1A4P A;  3PSR A;  1AHR A;  1XVJ A;  2FOT A;  1YRT B;  3F45 A;  2JOJ A;  2LUX A;  1XFX O;  2KYF A;  5HYD A;  2LLT A;  1NP8 A;  2OS8 B;  4USL A;  3AKB A;  1PRW A;  3BOW B;  1Y1U A;  1B8R A;  1VRK A;  2LM5 A;  2MA2 A;  2M1K B;  2EC6 C;  4JWQ A;  1M63 B;  3PLF B;  2QPT A;  1UUR A;  2HET A;  2M7N A;  3SG5 A;  5ER4 X;  2KAV A;  3DVJ A;  4IL1 A;  1KFU S;  2SCP A;  1MQ1 A;  3CS1 A;  4YGD B;  5KTY A;  3KF9 A;  4ZCV A;  1AJ5 A;  1IJ6 A;  4PAL A;  1YVH A;  1U5I A;  2MLE C;  1KSM A;  3OX5 A;  1ALW A;  3I5G B;  3CZT X;  3FS7 A;  1SRA A;  4M2O A;  2HPS A;  4MSP A;  2NCO A;  1KWO B;  1KFX L;  3DVE A;  1RWY A;  2KAX A;  1BT6 A;  3WXA A;  1J7Q A;  3PN7 C;  4M2Q A;  4YI9 A;  3LK1 A;  3VRN A;  4QJ4 B;  4PHJ A;  2K8M B;  1KCY A;  2LVJ A;  2Y4Q A;  1EG3 A;  2LE9 B;  2GGZ A;  2BCX A;  4ICB A;  2BL0 B;  2M29 A;  1OSA A;  2LVV A;  4AQI A;  1QLK A;  1CFF A;  2B1U A;  1QX2 A;  4FQO A;  1CMF A;  2L4H A;  4M2P A;  2WCE A;  1OMD A;  4ETO A;  4P2Y B;  1WDC B;  1DJW A;  1XFU O;  4PHN A;  2JNF A;  3SIB A;  1YUR A;  3SG7 A;  5B8I B;  1MUX A;  1CLL A;  3EK4 A;  2K7O A;  2LLU A;  2L0P A;  1ZFS A;  1IWQ A;  2KYC A;  1LA3 A;  2E6W A;  1KFU L;  2CT9 A;  2K61 A;  2LHL A;  1A29 A;  1C7W A;  2KBI A;  1KK7 Y;  4MZJ A;  4GGF A;  1REC A;  2AAO A;  4YI8 A;  5HKY A;  1XO5 A;  4ORC B;  3ZWH A;  2WOS A;  1WRK A;  1V1G A;  1B8C A;  1B7T Y;  1QS7 A;  2O5G A;  3HX4 A;  1XK4 C;  4NDD A;  4FTG A;  5I2O A;  3DF0 B;  3JVT C;  4OV2 A;  5DKN A;  2M49 B;  2F3Y A;  5CSI A;  4AQJ A;  4MRY A;  3I5H B;  3TDI A;  2BCA A;  4N1F A;  1SL8 A;  1SNL A;  1CDL A;  3EKJ A;  4I5L B;  4OR9 B;  1KK7 Z;  1G33 A;  1MHO A;  1IQ5 A;  3VRP A;  3FIA A;  3I5I B;  2ZKM X;  4PE4 A;  2NXQ A;  2JUL A;  2P6B B;  2LMT A;  4GNK B;  1YUU A;  2LUC A;  1TTX A;  1NX0 A;  1YVL A;  2BE4 A;  4N1G A;  3GK4 X;  3GK2 A;  1S3P A;  3O78 A;  4TNC A;  1K9P A;  1DMO A;  1U5I B;  2WC8 A;  1DTL A;  1S36 A;  2LMV A;  4D1E A;  2JWW A;  3KHE A;  2KI4 B;  5DKQ A;  2LCP A;  1TNQ A;  3TUY B;  3WHT B;  3D0Y A;  3D10 A;  2ZN9 A;  1J7R A;  2KDH A;  1CFP A;  1LA0 A;  1FI6 A;  1SY9 A;  1M46 A;  2BEC A;  1OMV A;  3DVM A;  1G4Y R;  4BY4 A; 
#chains in the Genus database with same CATH topology
 1CM1 A;  3DYE A;  2ERB A;  2F3Z A;  3DXL A;  2FCD A;  2Y1N A;  1Z4H A;  1MXE A;  1J7P A;  4DUQ A;  1NYA A;  2JT8 A;  1FBV A;  1DJI A;  2BBM A;  1S6C A;  4WQ3 A;  1JF0 A;  4GBA A;  3GOF A;  4I5N B;  1JSA A;  2KBM A;  1FW4 A;  1TCO B;  1SCM C;  1R2U A;  2DOQ A;  3QME A;  1J7O A;  2MLF C;  3FWC A;  1CMG A;  2MAZ A;  2JXC A;  5K89 A;  1SPY A;  3RM1 A;  3BUM B;  1F70 A;  1BR1 B;  3N7H A;  3HCM A;  2BAP A;  1A2X A;  4YGC B;  3WNX B;  2JXL A;  4Q04 A;  4OVN F;  3S0F A;  1YRU B;  1OW4 A;  2L50 A;  4JD9 A;  2NZ0 A;  4KYN A;  1PVB A;  1BJF A;  2WOR A;  1AP4 A;  2COL B;  1N2D A;  2JRF A;  2PAL A;  3FE6 A;  4PCW A;  1SBJ A;  1TWO A;  4DIR A;  1CDM A;  1B4C A;  2WCM A;  1XFW O;  1LXF C;  1WRL A;  4JQ0 D;  1KQM C;  2MJW B;  2SAS A;  5HLV A;  1OMR A;  4FQT A;  1K2H A;  4MLW A;  4MVF A;  1AUI B;  1B9A A;  3I5F C;  1Y1X A;  3JTD B;  3CTN A;  3FWB A;  1MXL C;  2K7C A;  1SL7 A;  2EHB A;  1DJY A;  3CLN A;  1H4B A;  3VRO A;  1WLZ A;  3UNW A;  2CBL A;  3PAT A;  1K93 D;  5JOL A;  3SJS A;  4CLN A;  3Q8I A;  1NCZ A;  3C1V A;  1KK8 C;  3NSI A;  1OOJ A;  1YUS A;  3SG6 A;  1XFV O;  1UHK A;  2OTG C;  1GGZ A;  2CNP A;  3O6B A;  1SR6 C;  3PM2 A;  4GGN A;  1YR5 A;  1PUL A;  5EL2 A;  1B8L A;  1XK4 A;  1M31 A;  1TUZ A;  1QIW A;  3TS5 B;  1QWV A;  1ODB A;  2A4J A;  3VRR A;  1W9Z A;  5D69 A;  1BMO A;  1PK0 D;  4PE0 A;  1CFD A;  2PAS A;  1QX5 B;  2M97 A;  2ZN8 A;  3LK0 A;  4INW A;  3CR2 A;  1F71 A;  1BF5 A;  2KQY A;  4A4B A;  1FF1 A;  3OB1 B;  2KNE A;  1UP5 A;  3SG2 A;  2WCH A;  3A8R A;  2LP3 A;  1S6I A;  1UUS A;  1KSO A;  2WCF A;  3D0Y B;  3IQQ A;  2EC6 B;  3CGA A;  1S26 D;  2L51 A;  1WY9 A;  2ZNE A;  5D3O A;  1TRF A;  1SMG A;  2KSP A;  5AEQ A;  1OE9 B;  2KHN A;  3EKH A;  1QAT A;  3KO0 A;  1CLB A;  1S5G Y;  1F55 A;  4C0J A;  4YGE B;  3B88 A;  1ZAC A;  1RK9 A;  1MWN A;  1DJX A;  1UHN A;  2JT0 A;  3R1P A;  5I2L A;  1CDN A;  1NCX A;  3ZNI A;  1BU3 A;  3VB1 A;  4C0K A;  4MEW A;  4OKH A;  2D8N A;  3I5F B;  3SS5 A;  1L2O C;  5D7F A;  3A4U B;  1F8H A;  1AVS A;  1JUO A;  2GGM A;  1V1F A;  2L5Y A;  1XA5 A;  3EG5 B;  3OGN A;  5J3X A;  5HLO A;  2BKH B;  2H61 C;  1AJ4 A;  1F4Q A;  2WCK A;  5CPV A;  1S5G Z;  2ZRT A;  1A75 A;  3CZ2 A;  3D73 A;  3PN7 B;  2F8P A;  4XJK B;  1G8I A;  2Q91 A;  1IG5 A;  3DD4 A;  3PFV A;  4HRG A;  3BUN B;  5I8N A;  2K0J A;  1JF2 A;  4MBE A;  1IRJ A;  1X02 A;  3QRX A;  1EG4 A;  1K9K A;  1LKJ A;  1IJ5 A;  1N0Y A;  3IF7 A;  2GV5 A;  5PAL A;  2F2O A;  1QAS A;  1BLQ A;  5CSJ A;  3BUO B;  4PE7 A;  4I5J A;  3SG3 A;  1CM4 A;  2KFF A;  2ZND A;  1L7Z A;  1W7J B;  2OPO A;  2K7D A;  3BFB A;  2I94 A;  2OS8 C;  3H4S E;  4HRH A;  5I94 A;  1CFC A;  1QVI Y;  2E30 A;  2QAC A;  5JJG A;  2IS9 A;  1TNP A;  1LVC D;  1LIN A;  1NCY A;  2K2F A;  2P70 A;  3PAL A;  4U8D A;  1RJV A;  1QTX A;  4XYN A;  4DRW A;  1JWD A;  2AMI A;  2LV7 A;  4MZK A;  5GQQ C;  2NLN A;  1ORG A;  2HQW A;  1RTP 1;  4JPZ B;  4MRX A;  1EL4 A;  1TUJ A;  2ISD A;  1WRZ A;  3FE8 A;  1UHH A;  5TNC A;  4DCK A;  3JVT B;  2ZRS A;  1CDP A;  1CNP A;  5DKR A;  4YBH B;  3R1O A;  1QVI Z;  1EH2 A;  2FJU B;  5FI6 A;  2BBN A;  1B1G A;  1C7V A;  3EK8 A;  4OZD A;  4PHK A;  1BG1 A;  4GFT A;  3WHU B;  1GGW A;  1KWO C;  3L47 A;  2HQ8 A;  2LNK A;  5AER A;  1EXR A;  1QIV A;  4N5X A;  3CR5 X;  3ICB A;  2L4I A;  2M0R A;  2BE6 A;  2WCB A;  4CFR A;  1NWD A;  2WC5 A;  4XJK A;  1OZS A;  1NX2 A;  1T14 A;  1K9U A;  2KOT A;  2PQL A;  3OHM B;  2M1U A;  2YGU A;  3S0D A;  1PSB A;  1TIZ A;  2BL0 C;  3KEV A;  2MHH A;  1S1E A;  1XFR A;  3UO9 A;  3OX6 A;  1SYM A;  3EVV A;  1UWO A;  2VRG A;  2PMY A;  1J1E A;  2JNX A;  3CYZ A;  1IQ3 A;  4MZL A;  3MSE B;  2G9B A;  1NUB A;  2WCJ A;  2LC5 A;  4ORB B;  4GAO A;  3EK7 A;  4AOM A;  3BUX B;  1WDC C;  5IBW A;  5KU1 A;  5AAN A;  2KFH A;  1GJY A;  2JTZ A;  3AAJ A;  3L4L A;  4YGA A;  1MF8 B;  2O60 A;  1DF0 A;  1TN4 A;  1XFZ O;  2M8U A;  3TDU A;  1WLM A;  5KSZ A;  1A75 B;  1D1O A;  1K94 A;  2KGB C;  5FYX A;  4MN0 A;  1N65 A;  2LMU A;  1W7I B;  1YTZ C;  3BYA A;  4JKT A;  1H8B A;  1BOD A;  1QLS A;  1PSR A;  2PVB A;  3BQ3 A;  4HSZ A;  3D75 A;  3GK1 A;  1RRO A;  1BOC A;  3NXA A;  4I5K A;  4QJ5 B;  5FI7 A;  1C3Y A;  1SCM B;  1Q80 A;  4A4C A;  1F4O A;  2I2R E;  1JC2 A;  3NSK A;  3I5H C;  2V53 A;  5F6T A;  3D78 A;  2H61 A;  1OOF A;  2PSR A;  3RZS A;  3SG4 A;  4QJ3 B;  2JTT A;  2M7L A;  1DJG A;  1NX1 A;  1Y1A A;  1SCV A;  3S0B A;  1HT9 A;  3DZT A;  3I5I C;  3O4Y A;  1K96 A;  3TDZ A;  1IKU A;  1YUT A;  3BFA A;  2MRD A;  2NCP A;  4BY5 A;  5AXI A;  3O2P A;  4R1E A;  1NIW A;  2LAP A;  5AFP A;  1DGU A;  2I18 A;  1A03 A;  3LCP C;  1NPQ A;  1ALV A;  2R2I A;  1Y0V H;  2AUC A;  2KLD A;  4PDZ A;  4CPV A;  1JFJ A;  1KQM B;  1SK6 D;  1DEK A;  2JT3 A;  3DVK A;  5CSN A;  4CID A;  2KI4 C;  3DY9 A;  1J55 A;  4OCI A;  2HF5 A;  4YRU A;  1UHJ A;  2CXJ A;  1IH0 A;  3BUW B;  1SL9 A;  3BOW A;  3PM8 A;  3TUY C;  1JBA A;  1TOP A;  1MR8 A;  3CR4 X;  2M3W A;  1M39 A;  1ZMZ A;  1YX7 A;  1CKK A;  1TNX A;  3IQO A;  1KK8 B;  1DVI A;  1NSH A;  4F0Z B;  2JC2 A;  3OBV A;  3K21 A;  4PT1 A;  3OB2 B;  4PE1 A;  1JFK A;  2LLS A;  2OTG B;  1ZUZ A;  2QEB A;  2F33 A;  4YGB B;  5I2Q A;  2M9G A;  4GUK A;  1K95 A;  1SR6 B;  1ZOT B;  1QV0 A;  2KI6 C;  2KGR A;  1AK8 A;  2BKI B;  3AKA A;  3RLZ A;  4NDC A;  5CSF A;  3NSO A;  2KAY A;  2FCE A;  2KI6 D;  2LHI A;  1DJZ A;  3E3R A;  5HKZ A;  1NX3 A;  3CDN A;  3CWG A;  1CTR A;  1S6J A;  3EVR A;  2LVK A;  2LAN A;  1DGV A;  1K90 D;  1QXP A;  1EJ3 A;  2PRU A;  3L4A A;  1E8A A;  1B47 A;  2QEV A;  1GQM A;  3VRQ A;  4C0L A;  1QX7 A;  1XFY O;  4NQG A;  1F54 A;  3LLE A;  2F2P A;  1B7T Z;  1DF0 B;  4P5O E;  2L5X B;  5ER5 A;  1UHI A;  3AAK A;  2KFG A;  2LP2 A;  3LL8 B;  1SW8 A;  1PVA A;  1TCF A;  2EGD A;  1CLM A;  4GGF C;  1QV1 A;  3NGV A;  3S0G A;  4L9M A;  3M0W A;  2WCL A;  2JQ6 A;  2CCM A;  4WRI A;  5HKW A;  2JU0 A;  1C07 A;  1CB1 A;  1FPW A;  2L98 A;  4PHM A;  1GM0 A;  3KPX A;  3PJI A;  3B86 A;  1TNW A;  1PAL A;  2H2K A;  3I5G C;  1L2O B;  4CFQ A;  3NSL A;  1M45 A;  3JTD C;  4F7F A;  1DT7 B;  1J1D A;  1DJH A;  2K2A A;  2I7A A;  2K7B A;  3BJH A;  2G2B A;  3S0E A;  2KLE A;  2RGI A;  2BCB A;  2WND A;  5BPJ A;  2L2E A;  2Y5I A;  4E68 A;  2Y1M A;  2Q4U A;  4HRE E;  4WQ2 A;  4DS7 A;  1Y6W A;  1KFX S;  1XYD A;  2MBX A;  1QJT A;  1P28 A;  4ZCU A;  1Z2C B;  1OQP A;  1KQV A;  1YX8 A;  1R6P A;  1FI5 A;  1SSE B;  2CTN A;  2KPH A;  1K8U A;  1RFJ A;  1SKT A;  2QEO A;  3IVT A;  4INX A;  3TZ1 A;  1OZO A;  1BR4 B;  3EVU A;  3TS5 C;  4GPL B;  1HQV A;  2LVI A;  1IGV A;  3DF0 A;  3BXK A;  2ZFD A;  4NDB A;  3SIA A;  3VGO A;  4UPG A;  3OP0 A;  2JPT A;  2KQ6 A;  2TN4 A;  2JZI A;  4ORA B;  1LS8 A;  1A4P A;  5G08 A;  3PSR A;  1AHR A;  1XVJ A;  2FOT A;  3D74 A;  1YRT B;  3F45 A;  2JOJ A;  5DIC A;  2LUX A;  1XFX O;  2KYF A;  5HYD A;  2LLT A;  1NP8 A;  2OS8 B;  3R72 A;  4USL A;  3AKB A;  3CAB A;  1PRW A;  3BOW B;  1Y1U A;  1B8R A;  1VRK A;  2LM5 A;  2MA2 A;  2M1K B;  2EC6 C;  4JWQ A;  3D76 A;  1M63 B;  3PLF B;  2QPT A;  2PYQ A;  1UUR A;  2HET A;  2M7N A;  3SG5 A;  3SS3 A;  5ER4 X;  2KAV A;  3DVJ A;  1OOI X;  4IL1 A;  1KFU S;  2SCP A;  1MQ1 A;  5HL1 A;  3CS1 A;  4YGD B;  5KTY A;  2JPO A;  3D77 A;  3KF9 A;  4ZCV A;  1AJ5 A;  1IJ6 A;  4PAL A;  1YVH A;  1U5I A;  2MLE C;  1KSM A;  3OX5 A;  1ALW A;  2WC6 A;  3I5G B;  3V2L A;  3CZT X;  3FS7 A;  1SRA A;  4M2O A;  2HPS A;  4MSP A;  3K1E A;  2NCO A;  1KWO B;  1KFX L;  3DVE A;  1RWY A;  2KAX A;  5FI2 A;  1BT6 A;  3WXA A;  1J7Q A;  3R1V A;  2P71 A;  3PN7 C;  4M2Q A;  3NHI A;  4YI9 A;  3LK1 A;  3VRN A;  4QJ4 B;  4PHJ A;  2H8V A;  2K8M B;  1KCY A;  2LVJ A;  2K60 A;  1EG3 A;  2Y4Q A;  2LE9 B;  2GGZ A;  2BCX A;  4ICB A;  2BL0 B;  3CZ0 A;  2M29 A;  1OSA A;  1DEL A;  2LVV A;  4AQI A;  2L2C A;  1QLK A;  1C3Z A;  1CFF A;  2B1U A;  1QX2 A;  3O4X A;  4FQO A;  1CMF A;  2L4H A;  4M2P A;  2WCE A;  1OMD A;  4ETO A;  4P2Y B;  1WDC B;  1DJW A;  1XFU O;  4PHN A;  3CZ1 A;  2JNF A;  3SIB A;  1YUR A;  3SG7 A;  5B8I B;  1MUX A;  1CLL A;  3EK4 A;  2K7O A;  2LLU A;  2L0P A;  3S0A A;  1ZFS A;  1IWQ A;  2KYC A;  1LA3 A;  2E6W A;  1KFU L;  2CT9 A;  2K61 A;  2LHL A;  1A29 A;  1C7W A;  3FE9 A;  2KBI A;  2GTE A;  1KK7 Y;  4MZJ A;  4GGF A;  1REC A;  2AAO A;  2BNX A;  4YI8 A;  5HKY A;  1XO5 A;  4ORC B;  3ZWH A;  2WOS A;  1WRK A;  1V1G A;  1B8C A;  1B7T Y;  1QS7 A;  2O5G A;  1OOH A;  3HX4 A;  1DQE A;  1XK4 C;  4NDD A;  4FTG A;  5I2O A;  3DF0 B;  3JVT C;  4OV2 A;  5DKN A;  2M49 B;  1DC1 A;  2F3Y A;  5CSI A;  3NHT A;  4AQJ A;  4MRY A;  3I5H B;  3TDI A;  2BCA A;  2QDI A;  4N1F A;  1SL8 A;  1SNL A;  1CDL A;  3EKJ A;  4I5L B;  4OR9 B;  3BFH A;  1KK7 Z;  1G33 A;  1MHO A;  1IQ5 A;  2FJY A;  3VRP A;  3FIA A;  3I5I B;  1IIO A;  2ZKM X;  4PE4 A;  2NXQ A;  2JUL A;  2P6B B;  2LMT A;  3B6X A;  4GNK B;  1YUU A;  3B87 A;  2LUC A;  1TTX A;  1NX0 A;  1YVL A;  3DVM A;  2BE4 A;  4N1G A;  3GK4 X;  3SS4 A;  2QEH A;  1S3P A;  3GK2 A;  3O78 A;  4TNC A;  1K9P A;  1OOG A;  1DMO A;  1U5I B;  2WC8 A;  1DTL A;  1S36 A;  2LMV A;  4D1E A;  2JWW A;  3KHE A;  2KI4 B;  5DKQ A;  2LCP A;  1TNQ A;  3TUY B;  3WHT B;  3D0Y A;  3D10 A;  2ZN9 A;  4IJ7 A;  1J7R A;  2KDH A;  1CFP A;  1LA0 A;  1FI6 A;  1SY9 A;  1M46 A;  2BEC A;  1OMV A;  3B7A A;  1G4Y R;  4BY4 A; 
#chains in the Genus database with same CATH homology
 1CM1 A;  2F3Z A;  2FCD A;  2Y1N A;  1MXE A;  1J7P A;  4DUQ A;  1NYA A;  2JT8 A;  1FBV A;  1DJI A;  2BBM A;  1S6C A;  4WQ3 A;  1JF0 A;  4GBA A;  3GOF A;  4I5N B;  1JSA A;  2KBM A;  1FW4 A;  1TCO B;  1SCM C;  1R2U A;  2DOQ A;  1J7O A;  2MLF C;  3FWC A;  1CMG A;  2MAZ A;  2JXC A;  5K89 A;  1SPY A;  3RM1 A;  3BUM B;  1F70 A;  1BR1 B;  3HCM A;  1A2X A;  4YGC B;  3WNX B;  2JXL A;  4Q04 A;  4OVN F;  1YRU B;  2L50 A;  2NZ0 A;  1PVB A;  1BJF A;  2WOR A;  1AP4 A;  2COL B;  1N2D A;  2JRF A;  2PAL A;  4PCW A;  1SBJ A;  4DIR A;  1CDM A;  1B4C A;  1XFW O;  1LXF C;  1WRL A;  4JQ0 D;  1KQM C;  2MJW B;  2SAS A;  5HLV A;  1OMR A;  1K2H A;  4MLW A;  4MVF A;  1AUI B;  1B9A A;  3I5F C;  1Y1X A;  3JTD B;  3CTN A;  3FWB A;  1MXL C;  2K7C A;  1SL7 A;  2EHB A;  1DJY A;  3CLN A;  1H4B A;  3VRO A;  1WLZ A;  2CBL A;  3PAT A;  1K93 D;  5JOL A;  3SJS A;  4CLN A;  1NCZ A;  3C1V A;  1KK8 C;  3NSI A;  1OOJ A;  1YUS A;  3SG6 A;  1XFV O;  1UHK A;  2OTG C;  1GGZ A;  2CNP A;  3O6B A;  1SR6 C;  4GGN A;  1YR5 A;  1PUL A;  1B8L A;  1XK4 A;  1M31 A;  1QIW A;  3TS5 B;  3VRR A;  1ODB A;  2A4J A;  5D69 A;  1BMO A;  1PK0 D;  4PE0 A;  1CFD A;  2PAS A;  1QX5 B;  2M97 A;  2ZN8 A;  3LK0 A;  3CR2 A;  1F71 A;  1BF5 A;  2KQY A;  4A4B A;  1FF1 A;  3OB1 B;  2KNE A;  1UP5 A;  3SG2 A;  3A8R A;  2LP3 A;  1S6I A;  1UUS A;  1KSO A;  2WCF A;  3D0Y B;  3IQQ A;  2EC6 B;  3CGA A;  1S26 D;  2L51 A;  1WY9 A;  2ZNE A;  1TRF A;  1SMG A;  2KSP A;  5AEQ A;  1OE9 B;  2KHN A;  3EKH A;  1QAT A;  3KO0 A;  1CLB A;  1S5G Y;  1F55 A;  4C0J A;  4YGE B;  1ZAC A;  1RK9 A;  1MWN A;  1DJX A;  1UHN A;  2JT0 A;  1CDN A;  5I2L A;  1NCX A;  3ZNI A;  1BU3 A;  4C0K A;  4MEW A;  4OKH A;  2D8N A;  3I5F B;  1L2O C;  5D7F A;  3A4U B;  1F8H A;  1AVS A;  1JUO A;  2GGM A;  1V1F A;  1XA5 A;  5J3X A;  5HLO A;  2BKH B;  2H61 C;  1AJ4 A;  1F4Q A;  5CPV A;  1S5G Z;  2ZRT A;  1A75 A;  3PN7 B;  2F8P A;  4XJK B;  1G8I A;  2Q91 A;  1IG5 A;  3DD4 A;  3PFV A;  4HRG A;  3BUN B;  5I8N A;  2K0J A;  1JF2 A;  4MBE A;  1IRJ A;  1X02 A;  3QRX A;  1EG4 A;  1K9K A;  1LKJ A;  1IJ5 A;  1N0Y A;  3IF7 A;  2GV5 A;  5PAL A;  2F2O A;  1QAS A;  1BLQ A;  5CSJ A;  3BUO B;  4PE7 A;  4I5J A;  3SG3 A;  1CM4 A;  2KFF A;  2ZND A;  1L7Z A;  1W7J B;  2OPO A;  2K7D A;  2I94 A;  2OS8 C;  3H4S E;  4HRH A;  1CFC A;  1QVI Y;  2E30 A;  2QAC A;  5JJG A;  2IS9 A;  1TNP A;  1LVC D;  1LIN A;  1NCY A;  2K2F A;  3PAL A;  4U8D A;  1RJV A;  1QTX A;  4XYN A;  4DRW A;  1JWD A;  2AMI A;  2LV7 A;  4MZK A;  5GQQ C;  2NLN A;  2HQW A;  1RTP 1;  4JPZ B;  4MRX A;  1EL4 A;  2ISD A;  1WRZ A;  1UHH A;  5TNC A;  4DCK A;  3JVT B;  2ZRS A;  1CDP A;  1CNP A;  5DKR A;  4YBH B;  1EH2 A;  1QVI Z;  2FJU B;  2BBN A;  1B1G A;  1C7V A;  3EK8 A;  4PHK A;  1BG1 A;  1GGW A;  4GFT A;  3WHU B;  1KWO C;  2HQ8 A;  2LNK A;  5AER A;  1EXR A;  1QIV A;  4N5X A;  3CR5 X;  3ICB A;  2L4I A;  2M0R A;  2BE6 A;  2WCB A;  4CFR A;  1NWD A;  4XJK A;  1OZS A;  1NX2 A;  1K9U A;  2KOT A;  3OHM B;  2M1U A;  1PSB A;  1TIZ A;  2BL0 C;  3KEV A;  2MHH A;  1S1E A;  3OX6 A;  1SYM A;  3EVV A;  1UWO A;  2VRG A;  2PMY A;  1J1E A;  2JNX A;  1IQ3 A;  4MZL A;  3MSE B;  2G9B A;  1NUB A;  2LC5 A;  4ORB B;  4GAO A;  3EK7 A;  4AOM A;  3BUX B;  1WDC C;  5IBW A;  5KU1 A;  5AAN A;  2KFH A;  1GJY A;  2JTZ A;  3AAJ A;  4YGA A;  1MF8 B;  2O60 A;  1DF0 A;  1TN4 A;  1XFZ O;  2M8U A;  3TDU A;  1WLM A;  5KSZ A;  1A75 B;  1D1O A;  1K94 A;  2KGB C;  5FYX A;  4MN0 A;  1N65 A;  2LMU A;  1W7I B;  1YTZ C;  3BYA A;  1H8B A;  1BOD A;  1QLS A;  1PSR A;  2PVB A;  3BQ3 A;  4HSZ A;  3GK1 A;  1RRO A;  1BOC A;  3NXA A;  4I5K A;  4QJ5 B;  1SCM B;  1Q80 A;  4A4C A;  1F4O A;  2I2R E;  1JC2 A;  3NSK A;  3I5H C;  2V53 A;  5F6T A;  2H61 A;  2PSR A;  3SG4 A;  4QJ3 B;  2JTT A;  2M7L A;  1DJG A;  1NX1 A;  1Y1A A;  1SCV A;  1HT9 A;  3I5I C;  3O4Y A;  1K96 A;  3TDZ A;  1IKU A;  1YUT A;  2MRD A;  2NCP A;  4BY5 A;  5AXI A;  3O2P A;  4R1E A;  1NIW A;  2LAP A;  5AFP A;  1DGU A;  2I18 A;  1A03 A;  3LCP C;  1NPQ A;  1ALV A;  2R2I A;  1Y0V H;  2AUC A;  4PDZ A;  4CPV A;  1JFJ A;  1KQM B;  1SK6 D;  3DVK A;  2JT3 A;  5CSN A;  4CID A;  2KI4 C;  1J55 A;  4OCI A;  2HF5 A;  4YRU A;  1UHJ A;  2CXJ A;  1IH0 A;  3BUW B;  1SL9 A;  3BOW A;  3PM8 A;  3TUY C;  1JBA A;  1TOP A;  1MR8 A;  3CR4 X;  2M3W A;  1M39 A;  1ZMZ A;  1YX7 A;  1CKK A;  1TNX A;  3IQO A;  1KK8 B;  1DVI A;  1NSH A;  4F0Z B;  2JC2 A;  3K21 A;  3OB2 B;  4PE1 A;  1JFK A;  2LLS A;  2OTG B;  1ZUZ A;  2F33 A;  4YGB B;  5I2Q A;  2M9G A;  4GUK A;  1K95 A;  1SR6 B;  1ZOT B;  1QV0 A;  2KI6 C;  2KGR A;  1AK8 A;  2BKI B;  3AKA A;  3RLZ A;  4NDC A;  5CSF A;  3NSO A;  2KAY A;  2FCE A;  2KI6 D;  2LHI A;  1DJZ A;  3E3R A;  5HKZ A;  1NX3 A;  3CWG A;  1CTR A;  1S6J A;  3EVR A;  2LVK A;  2LAN A;  1DGV A;  1K90 D;  1QXP A;  1EJ3 A;  2PRU A;  1E8A A;  1B47 A;  4C0L A;  1GQM A;  3VRQ A;  1QX7 A;  1XFY O;  4NQG A;  1F54 A;  3LLE A;  2F2P A;  1B7T Z;  1DF0 B;  4P5O E;  2L5X B;  5ER5 A;  1UHI A;  3AAK A;  2KFG A;  2LP2 A;  3LL8 B;  1SW8 A;  1PVA A;  1TCF A;  2EGD A;  1CLM A;  4GGF C;  1QV1 A;  4L9M A;  3M0W A;  1C07 A;  2JQ6 A;  2CCM A;  4WRI A;  5HKW A;  2JU0 A;  1CB1 A;  1FPW A;  2L98 A;  4PHM A;  3KPX A;  1TNW A;  1PAL A;  2H2K A;  3I5G C;  1L2O B;  4CFQ A;  3NSL A;  1M45 A;  3JTD C;  1DT7 B;  1J1D A;  1DJH A;  2K2A A;  2I7A A;  2K7B A;  2G2B A;  2RGI A;  2BCB A;  2WND A;  5BPJ A;  2L2E A;  2Y5I A;  4E68 A;  2Y1M A;  2Q4U A;  4HRE E;  4WQ2 A;  4DS7 A;  1Y6W A;  1KFX S;  1XYD A;  2MBX A;  1QJT A;  4ZCU A;  1OQP A;  1KQV A;  1YX8 A;  1R6P A;  1FI5 A;  2CTN A;  1K8U A;  1RFJ A;  1SKT A;  3TZ1 A;  1OZO A;  1BR4 B;  3EVU A;  3TS5 C;  4GPL B;  1HQV A;  2LVI A;  1IGV A;  3DF0 A;  3BXK A;  2ZFD A;  4NDB A;  3SIA A;  3VGO A;  4UPG A;  3OP0 A;  2JPT A;  2KQ6 A;  2TN4 A;  2JZI A;  4ORA B;  5G08 A;  1A4P A;  3PSR A;  1AHR A;  1XVJ A;  2FOT A;  1YRT B;  3F45 A;  2JOJ A;  2LUX A;  1XFX O;  2KYF A;  5HYD A;  2LLT A;  1NP8 A;  2OS8 B;  4USL A;  3AKB A;  1PRW A;  3BOW B;  1Y1U A;  1B8R A;  1VRK A;  2LM5 A;  2MA2 A;  2M1K B;  2EC6 C;  4JWQ A;  1M63 B;  3PLF B;  2QPT A;  1UUR A;  2HET A;  2M7N A;  3SG5 A;  5ER4 X;  2KAV A;  3DVJ A;  4IL1 A;  1KFU S;  2SCP A;  1MQ1 A;  3CS1 A;  4YGD B;  5KTY A;  3KF9 A;  4ZCV A;  1AJ5 A;  1IJ6 A;  4PAL A;  1YVH A;  1U5I A;  2MLE C;  1KSM A;  3OX5 A;  1ALW A;  3I5G B;  3CZT X;  3FS7 A;  1SRA A;  4M2O A;  2HPS A;  4MSP A;  2NCO A;  1KWO B;  1KFX L;  3DVE A;  1RWY A;  2KAX A;  1BT6 A;  3WXA A;  1J7Q A;  3PN7 C;  4M2Q A;  4YI9 A;  3LK1 A;  3VRN A;  4QJ4 B;  4PHJ A;  2K8M B;  1KCY A;  2LVJ A;  2Y4Q A;  1EG3 A;  2LE9 B;  2GGZ A;  2BCX A;  4ICB A;  2BL0 B;  2M29 A;  1OSA A;  2LVV A;  4AQI A;  1QLK A;  1CFF A;  2B1U A;  1QX2 A;  4FQO A;  1CMF A;  2L4H A;  4M2P A;  2WCE A;  1OMD A;  4ETO A;  4P2Y B;  1WDC B;  1DJW A;  1XFU O;  4PHN A;  2JNF A;  3SIB A;  1YUR A;  3SG7 A;  5B8I B;  1MUX A;  1CLL A;  3EK4 A;  2K7O A;  2LLU A;  2L0P A;  1ZFS A;  1IWQ A;  2KYC A;  1LA3 A;  2E6W A;  1KFU L;  2CT9 A;  2K61 A;  2LHL A;  1A29 A;  1C7W A;  2KBI A;  1KK7 Y;  4MZJ A;  4GGF A;  1REC A;  2AAO A;  4YI8 A;  5HKY A;  1XO5 A;  4ORC B;  3ZWH A;  2WOS A;  1WRK A;  1V1G A;  1B8C A;  1B7T Y;  1QS7 A;  2O5G A;  3HX4 A;  1XK4 C;  4NDD A;  4FTG A;  5I2O A;  3DF0 B;  3JVT C;  4OV2 A;  5DKN A;  2M49 B;  2F3Y A;  5CSI A;  4AQJ A;  4MRY A;  3I5H B;  3TDI A;  2BCA A;  4N1F A;  1SL8 A;  1SNL A;  1CDL A;  3EKJ A;  4I5L B;  4OR9 B;  1KK7 Z;  1G33 A;  1MHO A;  1IQ5 A;  3VRP A;  3FIA A;  3I5I B;  2ZKM X;  4PE4 A;  2NXQ A;  2JUL A;  2P6B B;  2LMT A;  4GNK B;  1YUU A;  2LUC A;  1TTX A;  1NX0 A;  1YVL A;  2BE4 A;  4N1G A;  3GK4 X;  3GK2 A;  1S3P A;  3O78 A;  4TNC A;  1K9P A;  1DMO A;  1U5I B;  2WC8 A;  1DTL A;  1S36 A;  2LMV A;  4D1E A;  2JWW A;  3KHE A;  2KI4 B;  5DKQ A;  2LCP A;  1TNQ A;  3TUY B;  3WHT B;  3D0Y A;  3D10 A;  2ZN9 A;  1J7R A;  2KDH A;  1CFP A;  1LA0 A;  1FI6 A;  1SY9 A;  1M46 A;  2BEC A;  1OMV A;  3DVM A;  1G4Y R;  4BY4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...