5CSNA

S100b-rsk1 crystal structure c
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
94
structure length
94
Chain Sequence
GSHMSELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDNDGDGECDFQEFMAFVAMVTTACHEFFEH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis of Ribosomal S6 Kinase 1 (RSK1) Inhibition by S100B Protein: MODULATION OF THE EXTRACELLULAR SIGNAL-REGULATED KINASE (ERK) SIGNALING CASCADE IN A CALCIUM-DEPENDENT WAY.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Protein S100-B
total genus 30
structure length 94
sequence length 94
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-07-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 5csnA00
2P6BB 1NUBA 5I2QA 1MR8A 1XFVO 2ZFDA 3SG7A 1DJYA 3KO0A 2KBIA 3C1VA 1V1FA 1DJWA 1OQPA 2K8MB 1S5GY 2HETA 2BCAA 2L50A 1LXFC 3CR4X 4AQIA 2PVBA 1SRAA 1KK7Z 1UHIA 4QJ4B 1H4BA 3H4SE 3BYAA 1CM1A 5HYDA 3CZTX 5D69A 2H61A 1BR1B 1S26D 3TZ1A 2M29A 1HQVA 1SL8A 2PSRA 3CR5X 3EVRA 1CFFA 1PULA 1EG3A 4D1EA 1UHHA 3OB2B 2Y5IA 4MSPA 1WRLA 2KFFA 1RWYA 2M3WA 3EK8A 1EXRA 4I5LB 3LK0A 3SJSA 1AP4A 2LVKA 1XFXO 1SW8A 3OX5A 1KQMC 2K7OA 2GV5A 3PATA 2H61C 2VRGA 2KOTA 3DD4A 1G8IA 1KWOC 4MRXA 5HKZA 1SKTA 2LV7A 1S6IA 3PN7C 1K93D 3VRRA 1M63B 1KSOA 4N5XA 1CLLA 2PRUA 2WCEA 2LP3A 1QIWA 2O60A 2JQ6A 1B4CA 1J1DA 1QLSA 3RLZA 2TN4A 3K21A 3TDZA 1YUSA 3VRQA 4MZJA 4MEWA 4QJ5B 3AKAA 2SASA 1RECA 3JTDB 1J7OA 2KHNA 2BL0B 2K2AA 2ZN9A 1NCYA 4OV2A 3O6BA 1NCZA 1MWNA 2MJWB 5KTYA 1KCYA 1B47A 3LCPC 2LUXA 4UPGA 1YTZC 2LLSA 4GNKB 2LNKA 4IL1A 3I5GB 1WDCC 2GGZA 1KSMA 4PHNA 4ORCB 4HSZA 5AANA 1TNXA 2WOSA 1BR4B 1SBJA 4QJ3B 1MQ1A 1R2UA 1DJIA 1KFXL 1S6JA 3SIBA 3WXAA 1NCXA 2JXLA 1S36A 1K95A 2M7NA 2MAZA 1ZACA 1R6PA 2V53A 2ZNDA 2CNPA 2Y4QA 4ETOA 2O5GA 4ZCUA 1Y6WA 1XFWO 5HLVA 1CKKA 2M49B 1Y1XA 1CDMA 1UUSA 2EC6B 1QS7A 1EH2A 3OP0A 3BQ3A 1S1EA 1GGZA 4CFQA 1CLMA 2F3ZA 3TUYC 2FJUB 1BODA 2MHHA 4MZLA 1SPYA 2DOQA 1LINA 3FIAA 1S6CA 2LVVA 1KK8C 2CBLA 3VROA 1C07A 1F4QA 1ODBA 3BUMB 1KQMB 1XFYO 2JT8A 2IS9A 2I18A 1NWDA 2LC5A 1MUXA 3HCMA 2JTTA 1WLMA 2HF5A 3BUOB 1TRFA 1B9AA 5AXIA 1YRTB 3KEVA 3OX6A 4MN0A 3CS1A 1XO5A 4HRGA 3PSRA 2LLUA 2MA2A 3CWGA 4PHKA 3TS5B 4I5JA 5KU1A 3M0WA 4YGAA 2LAPA 1UP5A 2BKIB 4M2OA 1X02A 1KFXS 2L5XB 2ZRSA 5D7FA 5HKWA 1YRUB 1CFDA 2I94A 3ZNIA 2G9BA 5ER4X 2PASA 1C7VA 2KYFA 4PHMA 4WRIA 1DT7B 1YUTA 1B1GA 4GUKA 4MRYA 4DUQA 3JVTB 1EL4A 3PFVA 2JRFA 1AJ4A 2L51A 2SCPA 1QX5B 3CTNA 3NSIA 1QV0A 1F54A 1ALVA 1LKJA 5JOLA 1ALWA 1B7TY 1CLBA 1WDCB 1CMGA 4YI9A 3O2PA 1BG1A 1CFPA 1DGVA 1DTLA 1XK4C 3GK2A 3ZWHA 4E68A 3BUWB 4PCWA 2LLTA 4OVNF 1NPQA 1NX3A 1ZMZA 1PVBA 1TCOB 2JT3A 2WNDA 2CTNA 3I5FC 1TNWA 3SG5A 3I5IC 1B7TZ 1XFZO 3AAKA 1K94A 5DKQA 1J7RA 2HQ8A 3CGAA 1FI6A 1F4OA 1A29A 4DCKA 1J55A 1IWQA 2RGIA 1SL9A 1N2DA 1M46A 2FCDA 1SCMC 2EC6C 1BOCA 1J7PA 3KHEA 1IQ3A 1QIVA 1Q80A 1MHOA 2I7AA 1KK7Y 2E30A 2LVIA 1QX2A 3NSOA 1RK9A 2KGRA 1E8AA 3EVVA 2LCPA 5HLOA 1RFJA 1RTP1 1YX7A 1HT9A 4TNCA 1L2OB 4AQJA 1OSAA 5CSNA 2ZKMX 1YVHA 4M2PA 1UHJA 2KDHA 4MLWA 3LL8B 2M8UA 1FBVA 4I5NB 1ZOTB 2ZRTA 3FWBA 4GGFA 3BUXB 1OZOA 2KYCA 1F70A 3KPXA 3AKBA 4HRHA 4F0ZB 3NSKA 1IJ5A 1K9UA 1NYAA 3O78A 2BE4A 3VRPA 1QXPA 2LM5A 1FPWA 3DVKA 1QTXA 1FW4A 1XA5A 4WQ3A 5K89A 3D0YA 4FTGA 4JWQA 4CLNA 1PSBA 1AUIB 3OHMB 1DGUA 1JUOA 1SR6C 1C7WA 4BY5A 1B8RA 1QX7A 2BKHB 3SG3A 3O4YA 2K61A 1K90D 2KNEA 1AVSA 1V1GA 1N65A 4P5OE 2WCFA 1W7IB 2LMTA 2JPTA 4CIDA 1K9PA 2KAXA 3GK4X 1WY9A 2EHBA 3MSEB 4C0KA 4PE7A 5DKRA 5HKYA 3ICBA 1ZUZA 2BBMA 2BBNA 1SMGA 2Y1NA 1DVIA 2MLEC 1NP8A 1F55A 2AUCA 4ORBB 1PALA 5FYXA 3GOFA 1SCMB 2KI4B 3IQOA 2Q91A 1PVAA 4YBHB 5CSIA 1PSRA 1NX1A 2BE6A 2JNXA 2JU0A 2F2OA 1EJ3A 1K96A 2A4JA 3EK4A 5DKNA 1NSHA 1NX2A 2OTGB 3CR2A 3TDIA 1A4PA 3EVUA 4CFRA 1IH0A 3EKHA 4MZKA 1KQVA 2QACA 1G4YR 2AAOA 2KQYA 1XYDA 3FWCA 4YGDB 1BF5A 1UURA 4PE0A 1M39A 2ZNEA 1IKUA 2JXCA 4AOMA 1TCFA 2K7BA 1K2HA 1CFCA 1OZSA 1TTXA 2NCPA 1CTRA 3CLNA 1W7JB 2ISDA 1DJXA 2KFHA 1NX0A 3BOWB 1K9KA 3E3RA 1QVIY 3KF9A 1BLQA 2I2RE 2LHLA 4XYNA 1YR5A 1SCVA 2R2IA 2HQWA 1GQMA 2CXJA 3DVMA 4M2QA 1WLZA 1PRWA 1KFUS 2CT9A 3I5HC 2NXQA 2JZIA 1LVCD 2L98A 2M97A 1F71A 1PK0D 4N1GA 4WQ2A 5GQQC 1S3PA 3NXAA 5BPJA 4DRWA 3PN7B 1SK6D 5I8NA 4C0LA 1JF0A 1RJVA 3VGOA 2KQ6A 3EKJA 4GGFC 1UWOA 2L4IA 2ZN8A 2OS8B 1J1EA 1MXLC 1IRJA 1OMDA 1BJFA 2FOTA 5CSJA 2KAYA 1LA0A 2LMUA 4R1EA 1JFKA 1AHRA 2QPTA 2BCXA 2BECA 2KFGA 1BMOA 5G08A 1B8CA 3A4UB 1OOJA 4GGNA 2CCMA 1CDLA 4YGBB 2Q4UA 3PALA 4ORAB 1SL7A 2L2EA 1S5GZ 2LUCA 3TUYB 3LK1A 4GBAA 4PDZA 3DF0B 1CNPA 2Y1MA 1NIWA 4GAOA 2K7DA 1XFUO 5TNCA 1H8BA 5CPVA 2MBXA 1A2XA 3SIAA 1JFJA 4YRUA 1CDNA 3OB1B 2F33A 3WNXB 4GPLB 2K0JA 1OMRA 2OTGC 1N0YA 4NDBA 2K7CA 4N1FA 3LLEA 1IG5A 1F8HA 3BXKA 4DS7A 1KFUL 2M7LA 1VRKA 4HREE 2JT0A 2L4HA 1DJGA 3VRNA 3DVEA 2L0PA 2WC8A 1BT6A 1YX8A 1Y1AA 3TS5C 4NDDA 5I2OA 2NZ0A 2JULA 1CB1A 1YUUA 1IJ6A 1MXEA 4Q04A 1OMVA 2M0RA 2G2BA 4U8DA 4BY4A 4MVFA 1TOPA 1CMFA 1KK8B 5KSZA 1LA3A 3JVTC 4PHJA 4A4CA 4USLA 2B1UA 3I5HB 1QASA 4ICBA 1IGVA 1M45A 1DJHA 1RROA 4NQGA 1UHNA 1CM4A 2F3YA 2WORA 2K2FA 2KI6C 2JWWA 3IQQA 2KI6D 2JC2A 5I2LA 4YI8A 1WRKA 1JWDA 3HX4A 1JSAA 5J3XA 2JNFA 1TNPA 5CSFA 1JF2A 1AK8A 1SNLA 1XVJA 3TDUA 3IF7A 1EG4A 2OS8C 1YVLA 1U5IB 2JTZA 1Y1UA 4YGEB 2BCBA 3EK7A 2JOJA 3WHUB 3DVJA 4MBEA 1G33A 4FQOA 2OPOA 4XJKA 2LMVA 3SG6A 2COLB 3BOWA 4YGCB 3D0YB 2MRDA 2WCBA 1DF0A 2AMIA 3A8RA 1K8UA 4PE4A 3RM1A 1D1OA 1M31A 3AAJA 2KAVA 1SYMA 1WRZA 2M9GA 1L2OC 1XK4A 4P2YB 1GJYA 1QV1A 4PALA 5F6TA 4I5KA 1JC2A 2FCEA 4DIRA 4L9MA 5AFPA 1QVIZ 1B8LA 1L7ZA 3I5FB 3PLFB 3FS7A 1YURA 2GGMA 4CPVA 1A03A 1DMOA 1ZFSA 2M1KB 1A75B 4C0JA 2LHIA 3I5IB 3PM8A 1QLKA 2LP2A 4GFTA 4ZCVA 1CDPA 1OE9B 3DF0A 2E6WA 5AEQA 5IBWA 2H2KA 1SY9A 2KSPA 2NLNA 2MLFC 2PALA 2D8NA 1FI5A 2LVJA 1Y0VH 4A4BA 1GGWA 1MF8B 4JPZB 1DF0B 2KBMA 5AERA 4OCIA 5ER5A 1JBAA 1DJZA 2KGBC 3WHTB 1KWOB 5B8IB 1U5IA 1UHKA 1SR6B 4JQ0D 2F8PA 4PE1A 3SG2A 3SG4A 4XJKB 2EGDA 3BUNB 3GK1A 1A75A 2LE9B 4NDCA 1TN4A 2F2PA 1IQ5A 3F45A 2LANA 1FF1A 2M1UA 3D10A 1BU3A 3QRXA 1J7QA 3JTDC 1TNQA 3NSLA 5PALA 1AJ5A 1QJTA 1QATA 2BL0C 1TIZA 2NCOA 5JJGA 2PMYA 2HPSA 2KI4C 4OKHA 4OR9B 3I5GC
chains in the Genus database with same CATH superfamily
2P6BB 1NUBA 5I2QA 1MR8A 1XFVO 2ZFDA 3SG7A 1DJYA 3KO0A 2KBIA 3C1VA 1V1FA 3CZ1A 1DJWA 1OQPA 2K8MB 1S5GY 2HETA 2BCAA 2L50A 1LXFC 3CR4X 4AQIA 2GTEA 2QDIA 2PVBA 1SRAA 1KK7Z 1UHIA 4QJ4B 1H4BA 3H4SE 1P28A 1XFRA 3BYAA 1CM1A 5HYDA 3CZTX 5D69A 2H61A 3R1PA 3L4LA 1BR1B 1S26D 3TZ1A 2M29A 2JPOA 1HQVA 1SL8A 2PSRA 3CR5X 1TUJA 3EVRA 1PULA 1EG3A 1CFFA 5DICA 2KLDA 2KLEA 4D1EA 1UHHA 3OB2B 5I94A 2Y5IA 4MSPA 1WRLA 2KFFA 1RWYA 2M3WA 3EK8A 1EXRA 4I5LB 3LK0A 3SJSA 1AP4A 2LVKA 2ERBA 1XFXO 1SW8A 3OX5A 3PM2A 1KQMC 2K7OA 2GV5A 3PATA 3SS4A 2H61C 2VRGA 2KOTA 3DD4A 1G8IA 1KWOC 4MRXA 5HKZA 1SKTA 2LV7A 1S6IA 3PN7C 1K93D 3VRRA 1M63B 1KSOA 3BFAA 4N5XA 1CLLA 2PRUA 2WCEA 2LP3A 1QIWA 2O60A 2JQ6A 1B4CA 1J1DA 1QLSA 3RLZA 2TN4A 3K21A 3RZSA 3TDZA 1YUSA 3VRQA 4MZJA 4MEWA 4QJ5B 3AKAA 2SASA 1RECA 1C3ZA 3JTDB 2WC6A 2QEHA 1J7OA 2KHNA 3CYZA 2BL0B 2K2AA 2ZN9A 1NCYA 4OV2A 2WC5A 1NCZA 3O6BA 1MWNA 2MJWB 5KTYA 1KCYA 1B47A 1OOFA 3DY9A 3LCPC 2LUXA 3O4XA 4UPGA 1YTZC 2LLSA 4GNKB 2LNKA 4IL1A 3I5GB 1WDCC 3SS5A 2GGZA 1KSMA 1DC1A 4PHNA 2KPHA 4ORCB 4HSZA 3NHIA 5AANA 1TNXA 2WCLA 2WOSA 1BR4B 1SBJA 4QJ3B 1MQ1A 1R2UA 1DJIA 1KFXL 1DQEA 3NGVA 1S6JA 3SIBA 3WXAA 1NCXA 2JXLA 1S36A 1K95A 2M7NA 2MAZA 1ZACA 1R6PA 2V53A 2WCKA 2CNPA 2Y4QA 2ZNDA 4ETOA 2O5GA 4ZCUA 1Y6WA 1XFWO 5HLVA 1CKKA 2M49B 1Y1XA 1CDMA 1UUSA 2EC6B 1QS7A 1EH2A 3OP0A 3BQ3A 1S1EA 1GGZA 4CFQA 4INXA 1CLMA 2F3ZA 3TUYC 2FJUB 1GM0A 1BODA 2MHHA 4MZLA 1SPYA 2DOQA 1LINA 3FIAA 1S6CA 2LVVA 1KK8C 2CBLA 3VROA 1C07A 1F4QA 2BNXA 1ODBA 3BUMB 1KQMB 1XFYO 2JT8A 2IS9A 2I18A 2WCJA 3CABA 1NWDA 2LC5A 1MUXA 3HCMA 2JTTA 1WLMA 2HF5A 3BUOB 4JD9A 1TRFA 1B9AA 5AXIA 1YRTB 3KEVA 3OX6A 4MN0A 3CS1A 1XO5A 4HRGA 3PSRA 2LLUA 2MA2A 2PYQA 3CWGA 4PHKA 3TS5B 4I5JA 5KU1A 3M0WA 4YGAA 2LAPA 3VB1A 1UP5A 2BKIB 4M2OA 1X02A 1KFXS 2L5XB 2ZRSA 5D7FA 5HKWA 1YRUB 1CFDA 2I94A 1Z4HA 3ZNIA 2G9BA 5ER4X 2PASA 1C7VA 2KYFA 4PHMA 4WRIA 1DT7B 1YUTA 1B1GA 4GUKA 4MRYA 4DUQA 3JVTB 1EL4A 3PFVA 2JRFA 1AJ4A 2L51A 2SCPA 1QX5B 3CTNA 3NSIA 1QV0A 1F54A 1ALVA 1LKJA 5JOLA 1ALWA 1B7TY 1CLBA 1WDCB 1CMGA 4YI9A 3O2PA 1BG1A 1CFPA 1DGVA 1DTLA 1XK4C 3GK2A 3ZWHA 4E68A 3BUWB 4PCWA 2LLTA 4OVNF 1NPQA 1NX3A 1ZMZA 1PVBA 1TCOB 3K1EA 2JT3A 2WNDA 2CTNA 3I5FC 1DELA 3L47A 1TNWA 4JKTA 3SG5A 2P71A 3I5IC 1B7TZ 1XFZO 3AAKA 1K94A 5DKQA 1J7RA 1LS8A 2HQ8A 3CGAA 1FI6A 1F4OA 1A29A 1TWOA 4DCKA 1J55A 1IWQA 2RGIA 1SL9A 3CZ0A 1N2DA 3IVTA 1M46A 1T14A 1SCMC 2FCDA 2EC6C 1BOCA 5EL2A 1J7PA 3KHEA 1IQ3A 1QIVA 1Q80A 3BFHA 1MHOA 2I7AA 1KK7Y 2E30A 2H8VA 1QX2A 2LVIA 3NSOA 1RK9A 2KGRA 1E8AA 3EVVA 2LCPA 3B7AA 5HLOA 1RFJA 1RTP1 1YX7A 1HT9A 4TNCA 3FE8A 3PJIA 1L2OB 4AQJA 1OSAA 5CSNA 2ZKMX 1YVHA 4M2PA 1UHJA 2KDHA 4MLWA 3LL8B 3D77A 5FI7A 2M8UA 1FBVA 4I5NB 1ZOTB 2ZRTA 3FWBA 4GGFA 3BUXB 1OZOA 2KYCA 1F70A 3KPXA 3AKBA 4HRHA 4F0ZB 3NSKA 1IJ5A 1K9UA 2BAPA 1NYAA 3O78A 2BE4A 3VRPA 1QXPA 2LM5A 3B87A 4F7FA 1FPWA 1OOGA 1QWVA 3DVKA 1QTXA 1FW4A 1XA5A 4WQ3A 5K89A 3D0YA 4FTGA 4JWQA 4CLNA 1PSBA 1AUIB 3OHMB 1DGUA 1JUOA 1SR6C 1ORGA 3DZTA 1C7WA 4BY5A 1B8RA 1QX7A 2BKHB 3SG3A 3O4YA 2K61A 1K90D 3S0GA 2KNEA 1AVSA 1V1GA 1N65A 4P5OE 2QEOA 2WCFA 1OOHA 1W7IB 2LMTA 2JPTA 3BJHA 4CIDA 1K9PA 2KAXA 3GK4X 1WY9A 2EHBA 3EG5B 2FJYA 3MSEB 4C0KA 2QEBA 4PE7A 5DKRA 5HKYA 3ICBA 1TUZA 1ZUZA 2BBMA 2BBNA 1SMGA 2Y1NA 1DVIA 2MLEC 1NP8A 1F55A 2AUCA 4ORBB 1PALA 5FYXA 3GOFA 1SCMB 2KI4B 3IQOA 2Q91A 1PVAA 4YBHB 5CSIA 1PSRA 1NX1A 2BE6A 2L5YA 3FE6A 2JNXA 2WCMA 2JU0A 2F2OA 3CZ2A 1EJ3A 1K96A 2A4JA 3EK4A 5DKNA 1NSHA 1NX2A 2OTGB 3CR2A 3TDIA 1A4PA 3EVUA 4CFRA 1C3YA 1IH0A 3EKHA 4MZKA 1DEKA 1KQVA 2QACA 1G4YR 2AAOA 2KQYA 1XYDA 3FWCA 4YGDB 1BF5A 1UURA 4PE0A 1M39A 1OW4A 2ZNEA 1IKUA 2JXCA 2P70A 3V2LA 1TCFA 4AOMA 2K7BA 1K2HA 2WCHA 1CFCA 1OZSA 1TTXA 2NCPA 3L4AA 1CTRA 1OOIX 4OZDA 3CLNA 1W7JB 2ISDA 1DJXA 2KFHA 1NX0A 3BOWB 1K9KA 3E3RA 1QVIY 3KF9A 1BLQA 2I2RE 4PT1A 4KYNA 2LHLA 4XYNA 1YR5A 1SCVA 2R2IA 2HQWA 1GQMA 2CXJA 3DVMA 4M2QA 1WLZA 5D3OA 1PRWA 1KFUS 2CT9A 3I5HC 2NXQA 2JZIA 1LVCD 2L98A 2M97A 3R72A 1F71A 1PK0D 4N1GA 4WQ2A 5GQQC 1S3PA 3FE9A 3NXAA 4DRWA 3PN7B 5BPJA 1SK6D 5I8NA 4C0LA 1JF0A 1RJVA 3VGOA 3B6XA 2KQ6A 3EKJA 4GGFC 1UWOA 3D76A 2L4IA 2ZN8A 2OS8B 1J1EA 1MXLC 1IRJA 1OMDA 3UNWA 1BJFA 2FOTA 5CSJA 2KAYA 1LA0A 2LMUA 4R1EA 1JFKA 1AHRA 2QPTA 2BCXA 2BECA 2KFGA 1BMOA 5G08A 1B8CA 3A4UB 1OOJA 4GGNA 2CCMA 1CDLA 4YGBB 2YGUA 2Q4UA 3PALA 4ORAB 1SL7A 2L2EA 1S5GZ 2LUCA 3TUYB 3LK1A 4GBAA 4PDZA 3DF0B 1CNPA 2Y1MA 1NIWA 4GAOA 2K7DA 1XFUO 5TNCA 1H8BA 5CPVA 2MBXA 1A2XA 3SIAA 1JFJA 4YRUA 1CDNA 3OB1B 2F33A 3WNXB 4GPLB 2K0JA 1OMRA 2OTGC 1N0YA 3NHTA 3D74A 4NDBA 2K7CA 4N1FA 3LLEA 1IG5A 1F8HA 3BXKA 4DS7A 1KFUL 5FI2A 1VRKA 4HREE 2M7LA 2JT0A 3UO9A 2L4HA 1DJGA 2K60A 3DVEA 3VRNA 2L0PA 2WC8A 1BT6A 1YX8A 1Y1AA 3TS5C 4NDDA 5I2OA 2NZ0A 2JULA 1CB1A 1YUUA 1IJ6A 3S0FA 1MXEA 4Q04A 5FI6A 1OMVA 2L2CA 2M0RA 2G2BA 4U8DA 4BY4A 4MVFA 1TOPA 1CMFA 1KK8B 3D75A 5KSZA 1LA3A 3JVTC 4PHJA 4A4CA 4USLA 2B1UA 3I5HB 1QASA 4ICBA 1IGVA 1M45A 1DJHA 1RROA 4NQGA 1DMOA 1UHNA 1CM4A 3OGNA 3QMEA 3N7HA 2F3YA 2WORA 2K2FA 2KI6C 2JWWA 3IQQA 2KI6D 2JC2A 5I2LA 4YI8A 1WRKA 1JWDA 3HX4A 3DYEA 1JSAA 5J3XA 2JNFA 3S0EA 1TNPA 5CSFA 1JF2A 1AK8A 1SNLA 1XVJA 3TDUA 3IF7A 1EG4A 2OS8C 1YVLA 1U5IB 2JTZA 1Y1UA 4YGEB 3S0BA 1IIOA 2BCBA 2PQLA 3EK7A 3OBVA 2JOJA 3WHUB 3DVJA 3D73A 1G33A 4FQOA 2OPOA 4MBEA 4XJKA 2LMVA 3SG6A 2COLB 3BOWA 5HL1A 1Z2CB 4YGCB 3D0YB 3Q8IA 2MRDA 2WCBA 1DF0A 2AMIA 3A8RA 3S0DA 1K8UA 4PE4A 3RM1A 1D1OA 1M31A 3AAJA 2KAVA 1SYMA 1WRZA 2M9GA 1L2OC 1XK4A 1SSEB 1GJYA 1QV1A 4P2YB 4PALA 4I5KA 5F6TA 1JC2A 2FCEA 4DIRA 4L9MA 5AFPA 1QVIZ 1B8LA 1L7ZA 3I5FB 3PLFB 1W9ZA 1YURA 2GGMA 3FS7A 4CPVA 1A03A 1ZFSA 2M1KB 1A75B 4C0JA 2LHIA 3I5IB 3PM8A 1QLKA 2LP2A 4GFTA 4ZCVA 1CDPA 1OE9B 3DF0A 2E6WA 5AEQA 5IBWA 2H2KA 2QEVA 1SY9A 2KSPA 2NLNA 2MLFC 2PALA 2D8NA 1FI5A 2LVJA 1Y0VH 4A4BA 3D78A 1GGWA 1MF8B 4JPZB 1DF0B 4IJ7A 2KBMA 5AERA 4OCIA 5ER5A 1JBAA 1DJZA 3SS3A 2KGBC 3WHTB 1KWOB 5B8IB 1U5IA 1UHKA 1SR6B 4JQ0D 2F8PA 4PE1A 3SG2A 3S0AA 3SG4A 4XJKB 4FQTA 2EGDA 3BUNB 3GK1A 1A75A 2LE9B 3CDNA 4NDCA 1TN4A 2F2PA 4INWA 3B86A 1IQ5A 3F45A 2LANA 1FF1A 2M1UA 3D10A 1BU3A 3QRXA 1J7QA 3BFBA 3JTDC 1TNQA 3NSLA 5PALA 1AJ5A 1QJTA 1QATA 2BL0C 1TIZA 2NCOA 5JJGA 2PMYA 3B88A 3R1OA 2HPSA 2KI4C 3R1VA 3DXLA 4OKHA 4OR9B 3I5GC
chains in the Genus database with same CATH topology
2P6BB 1NUBA 5I2QA 1MR8A 1XFVO 2ZFDA 3SG7A 1DJYA 3KO0A 2KBIA 3C1VA 1V1FA 1DJWA 1OQPA 2K8MB 1S5GY 2HETA 2BCAA 2L50A 1LXFC 3CR4X 4AQIA 2PVBA 1SRAA 1KK7Z 1UHIA 4QJ4B 1H4BA 3H4SE 3BYAA 1CM1A 5HYDA 3CZTX 5D69A 2H61A 1BR1B 1S26D 3TZ1A 2M29A 1HQVA 1SL8A 2PSRA 3CR5X 3EVRA 1CFFA 1PULA 1EG3A 4D1EA 1UHHA 3OB2B 2Y5IA 4MSPA 1WRLA 2KFFA 1RWYA 2M3WA 3EK8A 1EXRA 4I5LB 3LK0A 3SJSA 1AP4A 2LVKA 1XFXO 1SW8A 3OX5A 1KQMC 2K7OA 2GV5A 3PATA 2H61C 2VRGA 2KOTA 3DD4A 1G8IA 1KWOC 4MRXA 5HKZA 1SKTA 2LV7A 1S6IA 3PN7C 1K93D 3VRRA 1M63B 1KSOA 4N5XA 1CLLA 2PRUA 2WCEA 2LP3A 1QIWA 2O60A 2JQ6A 1B4CA 1J1DA 1QLSA 3RLZA 2TN4A 3K21A 3TDZA 1YUSA 3VRQA 4MZJA 4MEWA 4QJ5B 3AKAA 2SASA 1RECA 3JTDB 1J7OA 2KHNA 2BL0B 2K2AA 2ZN9A 1NCYA 4OV2A 3O6BA 1NCZA 1MWNA 2MJWB 5KTYA 1KCYA 1B47A 3LCPC 2LUXA 4UPGA 1YTZC 2LLSA 4GNKB 2LNKA 4IL1A 3I5GB 1WDCC 2GGZA 1KSMA 4PHNA 4ORCB 4HSZA 5AANA 1TNXA 2WOSA 1BR4B 1SBJA 4QJ3B 1MQ1A 1R2UA 1DJIA 1KFXL 1S6JA 3SIBA 3WXAA 1NCXA 2JXLA 1S36A 1K95A 2M7NA 2MAZA 1ZACA 1R6PA 2V53A 2ZNDA 2CNPA 2Y4QA 4ETOA 2O5GA 4ZCUA 1Y6WA 1XFWO 5HLVA 1CKKA 2M49B 1Y1XA 1CDMA 1UUSA 2EC6B 1QS7A 1EH2A 3OP0A 3BQ3A 1S1EA 1GGZA 4CFQA 1CLMA 2F3ZA 3TUYC 2FJUB 1BODA 2MHHA 4MZLA 1SPYA 2DOQA 1LINA 3FIAA 1S6CA 2LVVA 1KK8C 2CBLA 3VROA 1C07A 1F4QA 1ODBA 3BUMB 1KQMB 1XFYO 2JT8A 2IS9A 2I18A 1NWDA 2LC5A 1MUXA 3HCMA 2JTTA 1WLMA 2HF5A 3BUOB 1TRFA 1B9AA 5AXIA 1YRTB 3KEVA 3OX6A 4MN0A 3CS1A 1XO5A 4HRGA 3PSRA 2LLUA 2MA2A 3CWGA 4PHKA 3TS5B 4I5JA 5KU1A 3M0WA 4YGAA 2LAPA 1UP5A 2BKIB 4M2OA 1X02A 1KFXS 2L5XB 2ZRSA 5D7FA 5HKWA 1YRUB 1CFDA 2I94A 3ZNIA 2G9BA 5ER4X 2PASA 1C7VA 2KYFA 4PHMA 4WRIA 1DT7B 1YUTA 1B1GA 4GUKA 4MRYA 4DUQA 3JVTB 1EL4A 3PFVA 2JRFA 1AJ4A 2L51A 2SCPA 1QX5B 3CTNA 3NSIA 1QV0A 1F54A 1ALVA 1LKJA 5JOLA 1ALWA 1B7TY 1CLBA 1WDCB 1CMGA 4YI9A 3O2PA 1BG1A 1CFPA 1DGVA 1DTLA 1XK4C 3GK2A 3ZWHA 4E68A 3BUWB 4PCWA 2LLTA 4OVNF 1NPQA 1NX3A 1ZMZA 1PVBA 1TCOB 2JT3A 2WNDA 2CTNA 3I5FC 1TNWA 3SG5A 3I5IC 1B7TZ 1XFZO 3AAKA 1K94A 5DKQA 1J7RA 2HQ8A 3CGAA 1FI6A 1F4OA 1A29A 4DCKA 1J55A 1IWQA 2RGIA 1SL9A 1N2DA 1M46A 2FCDA 1SCMC 2EC6C 1BOCA 1J7PA 3KHEA 1IQ3A 1QIVA 1Q80A 1MHOA 2I7AA 1KK7Y 2E30A 2LVIA 1QX2A 3NSOA 1RK9A 2KGRA 1E8AA 3EVVA 2LCPA 5HLOA 1RFJA 1RTP1 1YX7A 1HT9A 4TNCA 1L2OB 4AQJA 1OSAA 5CSNA 2ZKMX 1YVHA 4M2PA 1UHJA 2KDHA 4MLWA 3LL8B 2M8UA 1FBVA 4I5NB 1ZOTB 2ZRTA 3FWBA 4GGFA 3BUXB 1OZOA 2KYCA 1F70A 3KPXA 3AKBA 4HRHA 4F0ZB 3NSKA 1IJ5A 1K9UA 1NYAA 3O78A 2BE4A 3VRPA 1QXPA 2LM5A 1FPWA 3DVKA 1QTXA 1FW4A 1XA5A 4WQ3A 5K89A 3D0YA 4FTGA 4JWQA 4CLNA 1PSBA 1AUIB 3OHMB 1DGUA 1JUOA 1SR6C 1C7WA 4BY5A 1B8RA 1QX7A 2BKHB 3SG3A 3O4YA 2K61A 1K90D 2KNEA 1AVSA 1V1GA 1N65A 4P5OE 2WCFA 1W7IB 2LMTA 2JPTA 4CIDA 1K9PA 2KAXA 3GK4X 1WY9A 2EHBA 3MSEB 4C0KA 4PE7A 5DKRA 5HKYA 3ICBA 1ZUZA 2BBMA 2BBNA 1SMGA 2Y1NA 1DVIA 2MLEC 1NP8A 1F55A 2AUCA 4ORBB 1PALA 5FYXA 3GOFA 1SCMB 2KI4B 3IQOA 2Q91A 1PVAA 4YBHB 5CSIA 1PSRA 1NX1A 2BE6A 2JNXA 2JU0A 2F2OA 1EJ3A 1K96A 2A4JA 3EK4A 5DKNA 1NSHA 1NX2A 2OTGB 3CR2A 3TDIA 1A4PA 3EVUA 4CFRA 1IH0A 3EKHA 4MZKA 1KQVA 2QACA 1G4YR 2AAOA 2KQYA 1XYDA 3FWCA 4YGDB 1BF5A 1UURA 4PE0A 1M39A 2ZNEA 1IKUA 2JXCA 4AOMA 1TCFA 2K7BA 1K2HA 1CFCA 1OZSA 1TTXA 2NCPA 1CTRA 3CLNA 1W7JB 2ISDA 1DJXA 2KFHA 1NX0A 3BOWB 1K9KA 3E3RA 1QVIY 3KF9A 1BLQA 2I2RE 2LHLA 4XYNA 1YR5A 1SCVA 2R2IA 2HQWA 1GQMA 2CXJA 3DVMA 4M2QA 1WLZA 1PRWA 1KFUS 2CT9A 3I5HC 2NXQA 2JZIA 1LVCD 2L98A 2M97A 1F71A 1PK0D 4N1GA 4WQ2A 5GQQC 1S3PA 3NXAA 5BPJA 4DRWA 3PN7B 1SK6D 5I8NA 4C0LA 1JF0A 1RJVA 3VGOA 2KQ6A 3EKJA 4GGFC 1UWOA 2L4IA 2ZN8A 2OS8B 1J1EA 1MXLC 1IRJA 1OMDA 1BJFA 2FOTA 5CSJA 2KAYA 1LA0A 2LMUA 4R1EA 1JFKA 1AHRA 2QPTA 2BCXA 2BECA 2KFGA 1BMOA 5G08A 1B8CA 3A4UB 1OOJA 4GGNA 2CCMA 1CDLA 4YGBB 2Q4UA 3PALA 4ORAB 1SL7A 2L2EA 1S5GZ 2LUCA 3TUYB 3LK1A 4GBAA 4PDZA 3DF0B 1CNPA 2Y1MA 1NIWA 4GAOA 2K7DA 1XFUO 5TNCA 1H8BA 5CPVA 2MBXA 1A2XA 3SIAA 1JFJA 4YRUA 1CDNA 3OB1B 2F33A 3WNXB 4GPLB 2K0JA 1OMRA 2OTGC 1N0YA 4NDBA 2K7CA 4N1FA 3LLEA 1IG5A 1F8HA 3BXKA 4DS7A 1KFUL 2M7LA 1VRKA 4HREE 2JT0A 2L4HA 1DJGA 3VRNA 3DVEA 2L0PA 2WC8A 1BT6A 1YX8A 1Y1AA 3TS5C 4NDDA 5I2OA 2NZ0A 2JULA 1CB1A 1YUUA 1IJ6A 1MXEA 4Q04A 1OMVA 2M0RA 2G2BA 4U8DA 4BY4A 4MVFA 1TOPA 1CMFA 1KK8B 5KSZA 1LA3A 3JVTC 4PHJA 4A4CA 4USLA 2B1UA 3I5HB 1QASA 4ICBA 1IGVA 1M45A 1DJHA 1RROA 4NQGA 1UHNA 1CM4A 2F3YA 2WORA 2K2FA 2KI6C 2JWWA 3IQQA 2KI6D 2JC2A 5I2LA 4YI8A 1WRKA 1JWDA 3HX4A 1JSAA 5J3XA 2JNFA 1TNPA 5CSFA 1JF2A 1AK8A 1SNLA 1XVJA 3TDUA 3IF7A 1EG4A 2OS8C 1YVLA 1U5IB 2JTZA 1Y1UA 4YGEB 2BCBA 3EK7A 2JOJA 3WHUB 3DVJA 4MBEA 1G33A 4FQOA 2OPOA 4XJKA 2LMVA 3SG6A 2COLB 3BOWA 4YGCB 3D0YB 2MRDA 2WCBA 1DF0A 2AMIA 3A8RA 1K8UA 4PE4A 3RM1A 1D1OA 1M31A 3AAJA 2KAVA 1SYMA 1WRZA 2M9GA 1L2OC 1XK4A 4P2YB 1GJYA 1QV1A 4PALA 5F6TA 4I5KA 1JC2A 2FCEA 4DIRA 4L9MA 5AFPA 1QVIZ 1B8LA 1L7ZA 3I5FB 3PLFB 3FS7A 1YURA 2GGMA 4CPVA 1A03A 1DMOA 1ZFSA 2M1KB 1A75B 4C0JA 2LHIA 3I5IB 3PM8A 1QLKA 2LP2A 4GFTA 4ZCVA 1CDPA 1OE9B 3DF0A 2E6WA 5AEQA 5IBWA 2H2KA 1SY9A 2KSPA 2NLNA 2MLFC 2PALA 2D8NA 1FI5A 2LVJA 1Y0VH 4A4BA 1GGWA 1MF8B 4JPZB 1DF0B 2KBMA 5AERA 4OCIA 5ER5A 1JBAA 1DJZA 2KGBC 3WHTB 1KWOB 5B8IB 1U5IA 1UHKA 1SR6B 4JQ0D 2F8PA 4PE1A 3SG2A 3SG4A 4XJKB 2EGDA 3BUNB 3GK1A 1A75A 2LE9B 4NDCA 1TN4A 2F2PA 1IQ5A 3F45A 2LANA 1FF1A 2M1UA 3D10A 1BU3A 3QRXA 1J7QA 3JTDC 1TNQA 3NSLA 5PALA 1AJ5A 1QJTA 1QATA 2BL0C 1TIZA 2NCOA 5JJGA 2PMYA 2HPSA 2KI4C 4OKHA 4OR9B 3I5GC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2P6B B;  1NUB A;  5I2Q A;  1MR8 A;  1XFV O;  2ZFD A;  3SG7 A;  1DJY A;  3KO0 A;  2KBI A;  3C1V A;  1V1F A;  1DJW A;  1OQP A;  2K8M B;  1S5G Y;  2HET A;  2BCA A;  2L50 A;  1LXF C;  3CR4 X;  4AQI A;  2PVB A;  1SRA A;  1KK7 Z;  1UHI A;  4QJ4 B;  1H4B A;  3H4S E;  3BYA A;  1CM1 A;  5HYD A;  3CZT X;  5D69 A;  2H61 A;  1BR1 B;  1S26 D;  3TZ1 A;  2M29 A;  1HQV A;  1SL8 A;  2PSR A;  3CR5 X;  3EVR A;  1CFF A;  1PUL A;  1EG3 A;  4D1E A;  1UHH A;  3OB2 B;  2Y5I A;  4MSP A;  1WRL A;  2KFF A;  1RWY A;  2M3W A;  3EK8 A;  1EXR A;  4I5L B;  3LK0 A;  3SJS A;  1AP4 A;  2LVK A;  1XFX O;  1SW8 A;  3OX5 A;  1KQM C;  2K7O A;  2GV5 A;  3PAT A;  2H61 C;  2VRG A;  2KOT A;  3DD4 A;  1G8I A;  1KWO C;  4MRX A;  5HKZ A;  1SKT A;  2LV7 A;  1S6I A;  3PN7 C;  1K93 D;  3VRR A;  1M63 B;  1KSO A;  4N5X A;  1CLL A;  2PRU A;  2WCE A;  2LP3 A;  1QIW A;  2O60 A;  2JQ6 A;  1B4C A;  1J1D A;  1QLS A;  3RLZ A;  2TN4 A;  3K21 A;  3TDZ A;  1YUS A;  3VRQ A;  4MZJ A;  4MEW A;  4QJ5 B;  3AKA A;  2SAS A;  1REC A;  3JTD B;  1J7O A;  2KHN A;  2BL0 B;  2K2A A;  2ZN9 A;  1NCY A;  4OV2 A;  3O6B A;  1NCZ A;  1MWN A;  2MJW B;  5KTY A;  1KCY A;  1B47 A;  3LCP C;  2LUX A;  4UPG A;  1YTZ C;  2LLS A;  4GNK B;  2LNK A;  4IL1 A;  3I5G B;  1WDC C;  2GGZ A;  1KSM A;  4PHN A;  4ORC B;  4HSZ A;  5AAN A;  1TNX A;  2WOS A;  1BR4 B;  1SBJ A;  4QJ3 B;  1MQ1 A;  1R2U A;  1DJI A;  1KFX L;  1S6J A;  3SIB A;  3WXA A;  1NCX A;  2JXL A;  1S36 A;  1K95 A;  2M7N A;  2MAZ A;  1ZAC A;  1R6P A;  2V53 A;  2ZND A;  2CNP A;  2Y4Q A;  4ETO A;  2O5G A;  4ZCU A;  1Y6W A;  1XFW O;  5HLV A;  1CKK A;  2M49 B;  1Y1X A;  1CDM A;  1UUS A;  2EC6 B;  1QS7 A;  1EH2 A;  3OP0 A;  3BQ3 A;  1S1E A;  1GGZ A;  4CFQ A;  1CLM A;  2F3Z A;  3TUY C;  2FJU B;  1BOD A;  2MHH A;  4MZL A;  1SPY A;  2DOQ A;  1LIN A;  3FIA A;  1S6C A;  2LVV A;  1KK8 C;  2CBL A;  3VRO A;  1C07 A;  1F4Q A;  1ODB A;  3BUM B;  1KQM B;  1XFY O;  2JT8 A;  2IS9 A;  2I18 A;  1NWD A;  2LC5 A;  1MUX A;  3HCM A;  2JTT A;  1WLM A;  2HF5 A;  3BUO B;  1TRF A;  1B9A A;  5AXI A;  1YRT B;  3KEV A;  3OX6 A;  4MN0 A;  3CS1 A;  1XO5 A;  4HRG A;  3PSR A;  2LLU A;  2MA2 A;  3CWG A;  4PHK A;  3TS5 B;  4I5J A;  5KU1 A;  3M0W A;  4YGA A;  2LAP A;  1UP5 A;  2BKI B;  4M2O A;  1X02 A;  1KFX S;  2L5X B;  2ZRS A;  5D7F A;  5HKW A;  1YRU B;  1CFD A;  2I94 A;  3ZNI A;  2G9B A;  5ER4 X;  2PAS A;  1C7V A;  2KYF A;  4PHM A;  4WRI A;  1DT7 B;  1YUT A;  1B1G A;  4GUK A;  4MRY A;  4DUQ A;  3JVT B;  1EL4 A;  3PFV A;  2JRF A;  1AJ4 A;  2L51 A;  2SCP A;  1QX5 B;  3CTN A;  3NSI A;  1QV0 A;  1F54 A;  1ALV A;  1LKJ A;  5JOL A;  1ALW A;  1B7T Y;  1CLB A;  1WDC B;  1CMG A;  4YI9 A;  3O2P A;  1BG1 A;  1CFP A;  1DGV A;  1DTL A;  1XK4 C;  3GK2 A;  3ZWH A;  4E68 A;  3BUW B;  4PCW A;  2LLT A;  4OVN F;  1NPQ A;  1NX3 A;  1ZMZ A;  1PVB A;  1TCO B;  2JT3 A;  2WND A;  2CTN A;  3I5F C;  1TNW A;  3SG5 A;  3I5I C;  1B7T Z;  1XFZ O;  3AAK A;  1K94 A;  5DKQ A;  1J7R A;  2HQ8 A;  3CGA A;  1FI6 A;  1F4O A;  1A29 A;  4DCK A;  1J55 A;  1IWQ A;  2RGI A;  1SL9 A;  1N2D A;  1M46 A;  2FCD A;  1SCM C;  2EC6 C;  1BOC A;  1J7P A;  3KHE A;  1IQ3 A;  1QIV A;  1Q80 A;  1MHO A;  2I7A A;  1KK7 Y;  2E30 A;  2LVI A;  1QX2 A;  3NSO A;  1RK9 A;  2KGR A;  1E8A A;  3EVV A;  2LCP A;  5HLO A;  1RFJ A;  1RTP 1;  1YX7 A;  1HT9 A;  4TNC A;  1L2O B;  4AQJ A;  1OSA A;  5CSN A;  2ZKM X;  1YVH A;  4M2P A;  1UHJ A;  2KDH A;  4MLW A;  3LL8 B;  2M8U A;  1FBV A;  4I5N B;  1ZOT B;  2ZRT A;  3FWB A;  4GGF A;  3BUX B;  1OZO A;  2KYC A;  1F70 A;  3KPX A;  3AKB A;  4HRH A;  4F0Z B;  3NSK A;  1IJ5 A;  1K9U A;  1NYA A;  3O78 A;  2BE4 A;  3VRP A;  1QXP A;  2LM5 A;  1FPW A;  3DVK A;  1QTX A;  1FW4 A;  1XA5 A;  4WQ3 A;  5K89 A;  3D0Y A;  4FTG A;  4JWQ A;  4CLN A;  1PSB A;  1AUI B;  3OHM B;  1DGU A;  1JUO A;  1SR6 C;  1C7W A;  4BY5 A;  1B8R A;  1QX7 A;  2BKH B;  3SG3 A;  3O4Y A;  2K61 A;  1K90 D;  2KNE A;  1AVS A;  1V1G A;  1N65 A;  4P5O E;  2WCF A;  1W7I B;  2LMT A;  2JPT A;  4CID A;  1K9P A;  2KAX A;  3GK4 X;  1WY9 A;  2EHB A;  3MSE B;  4C0K A;  4PE7 A;  5DKR A;  5HKY A;  3ICB A;  1ZUZ A;  2BBM A;  2BBN A;  1SMG A;  2Y1N A;  1DVI A;  2MLE C;  1NP8 A;  1F55 A;  2AUC A;  4ORB B;  1PAL A;  5FYX A;  3GOF A;  1SCM B;  2KI4 B;  3IQO A;  2Q91 A;  1PVA A;  4YBH B;  5CSI A;  1PSR A;  1NX1 A;  2BE6 A;  2JNX A;  2JU0 A;  2F2O A;  1EJ3 A;  1K96 A;  2A4J A;  3EK4 A;  5DKN A;  1NSH A;  1NX2 A;  2OTG B;  3CR2 A;  3TDI A;  1A4P A;  3EVU A;  4CFR A;  1IH0 A;  3EKH A;  4MZK A;  1KQV A;  2QAC A;  1G4Y R;  2AAO A;  2KQY A;  1XYD A;  3FWC A;  4YGD B;  1BF5 A;  1UUR A;  4PE0 A;  1M39 A;  2ZNE A;  1IKU A;  2JXC A;  4AOM A;  1TCF A;  2K7B A;  1K2H A;  1CFC A;  1OZS A;  1TTX A;  2NCP A;  1CTR A;  3CLN A;  1W7J B;  2ISD A;  1DJX A;  2KFH A;  1NX0 A;  3BOW B;  1K9K A;  3E3R A;  1QVI Y;  3KF9 A;  1BLQ A;  2I2R E;  2LHL A;  4XYN A;  1YR5 A;  1SCV A;  2R2I A;  2HQW A;  1GQM A;  2CXJ A;  3DVM A;  4M2Q A;  1WLZ A;  1PRW A;  1KFU S;  2CT9 A;  3I5H C;  2NXQ A;  2JZI A;  1LVC D;  2L98 A;  2M97 A;  1F71 A;  1PK0 D;  4N1G A;  4WQ2 A;  5GQQ C;  1S3P A;  3NXA A;  5BPJ A;  4DRW A;  3PN7 B;  1SK6 D;  5I8N A;  4C0L A;  1JF0 A;  1RJV A;  3VGO A;  2KQ6 A;  3EKJ A;  4GGF C;  1UWO A;  2L4I A;  2ZN8 A;  2OS8 B;  1J1E A;  1MXL C;  1IRJ A;  1OMD A;  1BJF A;  2FOT A;  5CSJ A;  2KAY A;  1LA0 A;  2LMU A;  4R1E A;  1JFK A;  1AHR A;  2QPT A;  2BCX A;  2BEC A;  2KFG A;  1BMO A;  5G08 A;  1B8C A;  3A4U B;  1OOJ A;  4GGN A;  2CCM A;  1CDL A;  4YGB B;  2Q4U A;  3PAL A;  4ORA B;  1SL7 A;  2L2E A;  1S5G Z;  2LUC A;  3TUY B;  3LK1 A;  4GBA A;  4PDZ A;  3DF0 B;  1CNP A;  2Y1M A;  1NIW A;  4GAO A;  2K7D A;  1XFU O;  5TNC A;  1H8B A;  5CPV A;  2MBX A;  1A2X A;  3SIA A;  1JFJ A;  4YRU A;  1CDN A;  3OB1 B;  2F33 A;  3WNX B;  4GPL B;  2K0J A;  1OMR A;  2OTG C;  1N0Y A;  4NDB A;  2K7C A;  4N1F A;  3LLE A;  1IG5 A;  1F8H A;  3BXK A;  4DS7 A;  1KFU L;  2M7L A;  1VRK A;  4HRE E;  2JT0 A;  2L4H A;  1DJG A;  3VRN A;  3DVE A;  2L0P A;  2WC8 A;  1BT6 A;  1YX8 A;  1Y1A A;  3TS5 C;  4NDD A;  5I2O A;  2NZ0 A;  2JUL A;  1CB1 A;  1YUU A;  1IJ6 A;  1MXE A;  4Q04 A;  1OMV A;  2M0R A;  2G2B A;  4U8D A;  4BY4 A;  4MVF A;  1TOP A;  1CMF A;  1KK8 B;  5KSZ A;  1LA3 A;  3JVT C;  4PHJ A;  4A4C A;  4USL A;  2B1U A;  3I5H B;  1QAS A;  4ICB A;  1IGV A;  1M45 A;  1DJH A;  1RRO A;  4NQG A;  1UHN A;  1CM4 A;  2F3Y A;  2WOR A;  2K2F A;  2KI6 C;  2JWW A;  3IQQ A;  2KI6 D;  2JC2 A;  5I2L A;  4YI8 A;  1WRK A;  1JWD A;  3HX4 A;  1JSA A;  5J3X A;  2JNF A;  1TNP A;  5CSF A;  1JF2 A;  1AK8 A;  1SNL A;  1XVJ A;  3TDU A;  3IF7 A;  1EG4 A;  2OS8 C;  1YVL A;  1U5I B;  2JTZ A;  1Y1U A;  4YGE B;  2BCB A;  3EK7 A;  2JOJ A;  3WHU B;  3DVJ A;  4MBE A;  1G33 A;  4FQO A;  2OPO A;  4XJK A;  2LMV A;  3SG6 A;  2COL B;  3BOW A;  4YGC B;  3D0Y B;  2MRD A;  2WCB A;  1DF0 A;  2AMI A;  3A8R A;  1K8U A;  4PE4 A;  3RM1 A;  1D1O A;  1M31 A;  3AAJ A;  2KAV A;  1SYM A;  1WRZ A;  2M9G A;  1L2O C;  1XK4 A;  4P2Y B;  1GJY A;  1QV1 A;  4PAL A;  5F6T A;  4I5K A;  1JC2 A;  2FCE A;  4DIR A;  4L9M A;  5AFP A;  1QVI Z;  1B8L A;  1L7Z A;  3I5F B;  3PLF B;  3FS7 A;  1YUR A;  2GGM A;  4CPV A;  1A03 A;  1DMO A;  1ZFS A;  2M1K B;  1A75 B;  4C0J A;  2LHI A;  3I5I B;  3PM8 A;  1QLK A;  2LP2 A;  4GFT A;  4ZCV A;  1CDP A;  1OE9 B;  3DF0 A;  2E6W A;  5AEQ A;  5IBW A;  2H2K A;  1SY9 A;  2KSP A;  2NLN A;  2MLF C;  2PAL A;  2D8N A;  1FI5 A;  2LVJ A;  1Y0V H;  4A4B A;  1GGW A;  1MF8 B;  4JPZ B;  1DF0 B;  2KBM A;  5AER A;  4OCI A;  5ER5 A;  1JBA A;  1DJZ A;  2KGB C;  3WHT B;  1KWO B;  5B8I B;  1U5I A;  1UHK A;  1SR6 B;  4JQ0 D;  2F8P A;  4PE1 A;  3SG2 A;  3SG4 A;  4XJK B;  2EGD A;  3BUN B;  3GK1 A;  1A75 A;  2LE9 B;  4NDC A;  1TN4 A;  2F2P A;  1IQ5 A;  3F45 A;  2LAN A;  1FF1 A;  2M1U A;  3D10 A;  1BU3 A;  3QRX A;  1J7Q A;  3JTD C;  1TNQ A;  3NSL A;  5PAL A;  1AJ5 A;  1QJT A;  1QAT A;  2BL0 C;  1TIZ A;  2NCO A;  5JJG A;  2PMY A;  2HPS A;  2KI4 C;  4OKH A;  4OR9 B;  3I5G C; 
#chains in the Genus database with same CATH topology
 2P6B B;  1NUB A;  5I2Q A;  1MR8 A;  1XFV O;  2ZFD A;  3SG7 A;  1DJY A;  3KO0 A;  2KBI A;  3C1V A;  1V1F A;  3CZ1 A;  1DJW A;  1OQP A;  2K8M B;  1S5G Y;  2HET A;  2BCA A;  2L50 A;  1LXF C;  3CR4 X;  4AQI A;  2GTE A;  2QDI A;  2PVB A;  1SRA A;  1KK7 Z;  1UHI A;  4QJ4 B;  1H4B A;  3H4S E;  1P28 A;  1XFR A;  3BYA A;  1CM1 A;  5HYD A;  3CZT X;  5D69 A;  2H61 A;  3R1P A;  3L4L A;  1BR1 B;  1S26 D;  3TZ1 A;  2M29 A;  2JPO A;  1HQV A;  1SL8 A;  2PSR A;  3CR5 X;  1TUJ A;  3EVR A;  1PUL A;  1EG3 A;  1CFF A;  5DIC A;  2KLD A;  2KLE A;  4D1E A;  1UHH A;  3OB2 B;  5I94 A;  2Y5I A;  4MSP A;  1WRL A;  2KFF A;  1RWY A;  2M3W A;  3EK8 A;  1EXR A;  4I5L B;  3LK0 A;  3SJS A;  1AP4 A;  2LVK A;  2ERB A;  1XFX O;  1SW8 A;  3OX5 A;  3PM2 A;  1KQM C;  2K7O A;  2GV5 A;  3PAT A;  3SS4 A;  2H61 C;  2VRG A;  2KOT A;  3DD4 A;  1G8I A;  1KWO C;  4MRX A;  5HKZ A;  1SKT A;  2LV7 A;  1S6I A;  3PN7 C;  1K93 D;  3VRR A;  1M63 B;  1KSO A;  3BFA A;  4N5X A;  1CLL A;  2PRU A;  2WCE A;  2LP3 A;  1QIW A;  2O60 A;  2JQ6 A;  1B4C A;  1J1D A;  1QLS A;  3RLZ A;  2TN4 A;  3K21 A;  3RZS A;  3TDZ A;  1YUS A;  3VRQ A;  4MZJ A;  4MEW A;  4QJ5 B;  3AKA A;  2SAS A;  1REC A;  1C3Z A;  3JTD B;  2WC6 A;  2QEH A;  1J7O A;  2KHN A;  3CYZ A;  2BL0 B;  2K2A A;  2ZN9 A;  1NCY A;  4OV2 A;  2WC5 A;  1NCZ A;  3O6B A;  1MWN A;  2MJW B;  5KTY A;  1KCY A;  1B47 A;  1OOF A;  3DY9 A;  3LCP C;  2LUX A;  3O4X A;  4UPG A;  1YTZ C;  2LLS A;  4GNK B;  2LNK A;  4IL1 A;  3I5G B;  1WDC C;  3SS5 A;  2GGZ A;  1KSM A;  1DC1 A;  4PHN A;  2KPH A;  4ORC B;  4HSZ A;  3NHI A;  5AAN A;  1TNX A;  2WCL A;  2WOS A;  1BR4 B;  1SBJ A;  4QJ3 B;  1MQ1 A;  1R2U A;  1DJI A;  1KFX L;  1DQE A;  3NGV A;  1S6J A;  3SIB A;  3WXA A;  1NCX A;  2JXL A;  1S36 A;  1K95 A;  2M7N A;  2MAZ A;  1ZAC A;  1R6P A;  2V53 A;  2WCK A;  2CNP A;  2Y4Q A;  2ZND A;  4ETO A;  2O5G A;  4ZCU A;  1Y6W A;  1XFW O;  5HLV A;  1CKK A;  2M49 B;  1Y1X A;  1CDM A;  1UUS A;  2EC6 B;  1QS7 A;  1EH2 A;  3OP0 A;  3BQ3 A;  1S1E A;  1GGZ A;  4CFQ A;  4INX A;  1CLM A;  2F3Z A;  3TUY C;  2FJU B;  1GM0 A;  1BOD A;  2MHH A;  4MZL A;  1SPY A;  2DOQ A;  1LIN A;  3FIA A;  1S6C A;  2LVV A;  1KK8 C;  2CBL A;  3VRO A;  1C07 A;  1F4Q A;  2BNX A;  1ODB A;  3BUM B;  1KQM B;  1XFY O;  2JT8 A;  2IS9 A;  2I18 A;  2WCJ A;  3CAB A;  1NWD A;  2LC5 A;  1MUX A;  3HCM A;  2JTT A;  1WLM A;  2HF5 A;  3BUO B;  4JD9 A;  1TRF A;  1B9A A;  5AXI A;  1YRT B;  3KEV A;  3OX6 A;  4MN0 A;  3CS1 A;  1XO5 A;  4HRG A;  3PSR A;  2LLU A;  2MA2 A;  2PYQ A;  3CWG A;  4PHK A;  3TS5 B;  4I5J A;  5KU1 A;  3M0W A;  4YGA A;  2LAP A;  3VB1 A;  1UP5 A;  2BKI B;  4M2O A;  1X02 A;  1KFX S;  2L5X B;  2ZRS A;  5D7F A;  5HKW A;  1YRU B;  1CFD A;  2I94 A;  1Z4H A;  3ZNI A;  2G9B A;  5ER4 X;  2PAS A;  1C7V A;  2KYF A;  4PHM A;  4WRI A;  1DT7 B;  1YUT A;  1B1G A;  4GUK A;  4MRY A;  4DUQ A;  3JVT B;  1EL4 A;  3PFV A;  2JRF A;  1AJ4 A;  2L51 A;  2SCP A;  1QX5 B;  3CTN A;  3NSI A;  1QV0 A;  1F54 A;  1ALV A;  1LKJ A;  5JOL A;  1ALW A;  1B7T Y;  1CLB A;  1WDC B;  1CMG A;  4YI9 A;  3O2P A;  1BG1 A;  1CFP A;  1DGV A;  1DTL A;  1XK4 C;  3GK2 A;  3ZWH A;  4E68 A;  3BUW B;  4PCW A;  2LLT A;  4OVN F;  1NPQ A;  1NX3 A;  1ZMZ A;  1PVB A;  1TCO B;  3K1E A;  2JT3 A;  2WND A;  2CTN A;  3I5F C;  1DEL A;  3L47 A;  1TNW A;  4JKT A;  3SG5 A;  2P71 A;  3I5I C;  1B7T Z;  1XFZ O;  3AAK A;  1K94 A;  5DKQ A;  1J7R A;  1LS8 A;  2HQ8 A;  3CGA A;  1FI6 A;  1F4O A;  1A29 A;  1TWO A;  4DCK A;  1J55 A;  1IWQ A;  2RGI A;  1SL9 A;  3CZ0 A;  1N2D A;  3IVT A;  1M46 A;  1T14 A;  1SCM C;  2FCD A;  2EC6 C;  1BOC A;  5EL2 A;  1J7P A;  3KHE A;  1IQ3 A;  1QIV A;  1Q80 A;  3BFH A;  1MHO A;  2I7A A;  1KK7 Y;  2E30 A;  2H8V A;  1QX2 A;  2LVI A;  3NSO A;  1RK9 A;  2KGR A;  1E8A A;  3EVV A;  2LCP A;  3B7A A;  5HLO A;  1RFJ A;  1RTP 1;  1YX7 A;  1HT9 A;  4TNC A;  3FE8 A;  3PJI A;  1L2O B;  4AQJ A;  1OSA A;  5CSN A;  2ZKM X;  1YVH A;  4M2P A;  1UHJ A;  2KDH A;  4MLW A;  3LL8 B;  3D77 A;  5FI7 A;  2M8U A;  1FBV A;  4I5N B;  1ZOT B;  2ZRT A;  3FWB A;  4GGF A;  3BUX B;  1OZO A;  2KYC A;  1F70 A;  3KPX A;  3AKB A;  4HRH A;  4F0Z B;  3NSK A;  1IJ5 A;  1K9U A;  2BAP A;  1NYA A;  3O78 A;  2BE4 A;  3VRP A;  1QXP A;  2LM5 A;  3B87 A;  4F7F A;  1FPW A;  1OOG A;  1QWV A;  3DVK A;  1QTX A;  1FW4 A;  1XA5 A;  4WQ3 A;  5K89 A;  3D0Y A;  4FTG A;  4JWQ A;  4CLN A;  1PSB A;  1AUI B;  3OHM B;  1DGU A;  1JUO A;  1SR6 C;  1ORG A;  3DZT A;  1C7W A;  4BY5 A;  1B8R A;  1QX7 A;  2BKH B;  3SG3 A;  3O4Y A;  2K61 A;  1K90 D;  3S0G A;  2KNE A;  1AVS A;  1V1G A;  1N65 A;  4P5O E;  2QEO A;  2WCF A;  1OOH A;  1W7I B;  2LMT A;  2JPT A;  3BJH A;  4CID A;  1K9P A;  2KAX A;  3GK4 X;  1WY9 A;  2EHB A;  3EG5 B;  2FJY A;  3MSE B;  4C0K A;  2QEB A;  4PE7 A;  5DKR A;  5HKY A;  3ICB A;  1TUZ A;  1ZUZ A;  2BBM A;  2BBN A;  1SMG A;  2Y1N A;  1DVI A;  2MLE C;  1NP8 A;  1F55 A;  2AUC A;  4ORB B;  1PAL A;  5FYX A;  3GOF A;  1SCM B;  2KI4 B;  3IQO A;  2Q91 A;  1PVA A;  4YBH B;  5CSI A;  1PSR A;  1NX1 A;  2BE6 A;  2L5Y A;  3FE6 A;  2JNX A;  2WCM A;  2JU0 A;  2F2O A;  3CZ2 A;  1EJ3 A;  1K96 A;  2A4J A;  3EK4 A;  5DKN A;  1NSH A;  1NX2 A;  2OTG B;  3CR2 A;  3TDI A;  1A4P A;  3EVU A;  4CFR A;  1C3Y A;  1IH0 A;  3EKH A;  4MZK A;  1DEK A;  1KQV A;  2QAC A;  1G4Y R;  2AAO A;  2KQY A;  1XYD A;  3FWC A;  4YGD B;  1BF5 A;  1UUR A;  4PE0 A;  1M39 A;  1OW4 A;  2ZNE A;  1IKU A;  2JXC A;  2P70 A;  3V2L A;  1TCF A;  4AOM A;  2K7B A;  1K2H A;  2WCH A;  1CFC A;  1OZS A;  1TTX A;  2NCP A;  3L4A A;  1CTR A;  1OOI X;  4OZD A;  3CLN A;  1W7J B;  2ISD A;  1DJX A;  2KFH A;  1NX0 A;  3BOW B;  1K9K A;  3E3R A;  1QVI Y;  3KF9 A;  1BLQ A;  2I2R E;  4PT1 A;  4KYN A;  2LHL A;  4XYN A;  1YR5 A;  1SCV A;  2R2I A;  2HQW A;  1GQM A;  2CXJ A;  3DVM A;  4M2Q A;  1WLZ A;  5D3O A;  1PRW A;  1KFU S;  2CT9 A;  3I5H C;  2NXQ A;  2JZI A;  1LVC D;  2L98 A;  2M97 A;  3R72 A;  1F71 A;  1PK0 D;  4N1G A;  4WQ2 A;  5GQQ C;  1S3P A;  3FE9 A;  3NXA A;  4DRW A;  3PN7 B;  5BPJ A;  1SK6 D;  5I8N A;  4C0L A;  1JF0 A;  1RJV A;  3VGO A;  3B6X A;  2KQ6 A;  3EKJ A;  4GGF C;  1UWO A;  3D76 A;  2L4I A;  2ZN8 A;  2OS8 B;  1J1E A;  1MXL C;  1IRJ A;  1OMD A;  3UNW A;  1BJF A;  2FOT A;  5CSJ A;  2KAY A;  1LA0 A;  2LMU A;  4R1E A;  1JFK A;  1AHR A;  2QPT A;  2BCX A;  2BEC A;  2KFG A;  1BMO A;  5G08 A;  1B8C A;  3A4U B;  1OOJ A;  4GGN A;  2CCM A;  1CDL A;  4YGB B;  2YGU A;  2Q4U A;  3PAL A;  4ORA B;  1SL7 A;  2L2E A;  1S5G Z;  2LUC A;  3TUY B;  3LK1 A;  4GBA A;  4PDZ A;  3DF0 B;  1CNP A;  2Y1M A;  1NIW A;  4GAO A;  2K7D A;  1XFU O;  5TNC A;  1H8B A;  5CPV A;  2MBX A;  1A2X A;  3SIA A;  1JFJ A;  4YRU A;  1CDN A;  3OB1 B;  2F33 A;  3WNX B;  4GPL B;  2K0J A;  1OMR A;  2OTG C;  1N0Y A;  3NHT A;  3D74 A;  4NDB A;  2K7C A;  4N1F A;  3LLE A;  1IG5 A;  1F8H A;  3BXK A;  4DS7 A;  1KFU L;  5FI2 A;  1VRK A;  4HRE E;  2M7L A;  2JT0 A;  3UO9 A;  2L4H A;  1DJG A;  2K60 A;  3DVE A;  3VRN A;  2L0P A;  2WC8 A;  1BT6 A;  1YX8 A;  1Y1A A;  3TS5 C;  4NDD A;  5I2O A;  2NZ0 A;  2JUL A;  1CB1 A;  1YUU A;  1IJ6 A;  3S0F A;  1MXE A;  4Q04 A;  5FI6 A;  1OMV A;  2L2C A;  2M0R A;  2G2B A;  4U8D A;  4BY4 A;  4MVF A;  1TOP A;  1CMF A;  1KK8 B;  3D75 A;  5KSZ A;  1LA3 A;  3JVT C;  4PHJ A;  4A4C A;  4USL A;  2B1U A;  3I5H B;  1QAS A;  4ICB A;  1IGV A;  1M45 A;  1DJH A;  1RRO A;  4NQG A;  1DMO A;  1UHN A;  1CM4 A;  3OGN A;  3QME A;  3N7H A;  2F3Y A;  2WOR A;  2K2F A;  2KI6 C;  2JWW A;  3IQQ A;  2KI6 D;  2JC2 A;  5I2L A;  4YI8 A;  1WRK A;  1JWD A;  3HX4 A;  3DYE A;  1JSA A;  5J3X A;  2JNF A;  3S0E A;  1TNP A;  5CSF A;  1JF2 A;  1AK8 A;  1SNL A;  1XVJ A;  3TDU A;  3IF7 A;  1EG4 A;  2OS8 C;  1YVL A;  1U5I B;  2JTZ A;  1Y1U A;  4YGE B;  3S0B A;  1IIO A;  2BCB A;  2PQL A;  3EK7 A;  3OBV A;  2JOJ A;  3WHU B;  3DVJ A;  3D73 A;  1G33 A;  4FQO A;  2OPO A;  4MBE A;  4XJK A;  2LMV A;  3SG6 A;  2COL B;  3BOW A;  5HL1 A;  1Z2C B;  4YGC B;  3D0Y B;  3Q8I A;  2MRD A;  2WCB A;  1DF0 A;  2AMI A;  3A8R A;  3S0D A;  1K8U A;  4PE4 A;  3RM1 A;  1D1O A;  1M31 A;  3AAJ A;  2KAV A;  1SYM A;  1WRZ A;  2M9G A;  1L2O C;  1XK4 A;  1SSE B;  1GJY A;  1QV1 A;  4P2Y B;  4PAL A;  4I5K A;  5F6T A;  1JC2 A;  2FCE A;  4DIR A;  4L9M A;  5AFP A;  1QVI Z;  1B8L A;  1L7Z A;  3I5F B;  3PLF B;  1W9Z A;  1YUR A;  2GGM A;  3FS7 A;  4CPV A;  1A03 A;  1ZFS A;  2M1K B;  1A75 B;  4C0J A;  2LHI A;  3I5I B;  3PM8 A;  1QLK A;  2LP2 A;  4GFT A;  4ZCV A;  1CDP A;  1OE9 B;  3DF0 A;  2E6W A;  5AEQ A;  5IBW A;  2H2K A;  2QEV A;  1SY9 A;  2KSP A;  2NLN A;  2MLF C;  2PAL A;  2D8N A;  1FI5 A;  2LVJ A;  1Y0V H;  4A4B A;  3D78 A;  1GGW A;  1MF8 B;  4JPZ B;  1DF0 B;  4IJ7 A;  2KBM A;  5AER A;  4OCI A;  5ER5 A;  1JBA A;  1DJZ A;  3SS3 A;  2KGB C;  3WHT B;  1KWO B;  5B8I B;  1U5I A;  1UHK A;  1SR6 B;  4JQ0 D;  2F8P A;  4PE1 A;  3SG2 A;  3S0A A;  3SG4 A;  4XJK B;  4FQT A;  2EGD A;  3BUN B;  3GK1 A;  1A75 A;  2LE9 B;  3CDN A;  4NDC A;  1TN4 A;  2F2P A;  4INW A;  3B86 A;  1IQ5 A;  3F45 A;  2LAN A;  1FF1 A;  2M1U A;  3D10 A;  1BU3 A;  3QRX A;  1J7Q A;  3BFB A;  3JTD C;  1TNQ A;  3NSL A;  5PAL A;  1AJ5 A;  1QJT A;  1QAT A;  2BL0 C;  1TIZ A;  2NCO A;  5JJG A;  2PMY A;  3B88 A;  3R1O A;  2HPS A;  2KI4 C;  3R1V A;  3DXL A;  4OKH A;  4OR9 B;  3I5G C; 
#chains in the Genus database with same CATH homology
 2P6B B;  1NUB A;  5I2Q A;  1MR8 A;  1XFV O;  2ZFD A;  3SG7 A;  1DJY A;  3KO0 A;  2KBI A;  3C1V A;  1V1F A;  1DJW A;  1OQP A;  2K8M B;  1S5G Y;  2HET A;  2BCA A;  2L50 A;  1LXF C;  3CR4 X;  4AQI A;  2PVB A;  1SRA A;  1KK7 Z;  1UHI A;  4QJ4 B;  1H4B A;  3H4S E;  3BYA A;  1CM1 A;  5HYD A;  3CZT X;  5D69 A;  2H61 A;  1BR1 B;  1S26 D;  3TZ1 A;  2M29 A;  1HQV A;  1SL8 A;  2PSR A;  3CR5 X;  3EVR A;  1CFF A;  1PUL A;  1EG3 A;  4D1E A;  1UHH A;  3OB2 B;  2Y5I A;  4MSP A;  1WRL A;  2KFF A;  1RWY A;  2M3W A;  3EK8 A;  1EXR A;  4I5L B;  3LK0 A;  3SJS A;  1AP4 A;  2LVK A;  1XFX O;  1SW8 A;  3OX5 A;  1KQM C;  2K7O A;  2GV5 A;  3PAT A;  2H61 C;  2VRG A;  2KOT A;  3DD4 A;  1G8I A;  1KWO C;  4MRX A;  5HKZ A;  1SKT A;  2LV7 A;  1S6I A;  3PN7 C;  1K93 D;  3VRR A;  1M63 B;  1KSO A;  4N5X A;  1CLL A;  2PRU A;  2WCE A;  2LP3 A;  1QIW A;  2O60 A;  2JQ6 A;  1B4C A;  1J1D A;  1QLS A;  3RLZ A;  2TN4 A;  3K21 A;  3TDZ A;  1YUS A;  3VRQ A;  4MZJ A;  4MEW A;  4QJ5 B;  3AKA A;  2SAS A;  1REC A;  3JTD B;  1J7O A;  2KHN A;  2BL0 B;  2K2A A;  2ZN9 A;  1NCY A;  4OV2 A;  3O6B A;  1NCZ A;  1MWN A;  2MJW B;  5KTY A;  1KCY A;  1B47 A;  3LCP C;  2LUX A;  4UPG A;  1YTZ C;  2LLS A;  4GNK B;  2LNK A;  4IL1 A;  3I5G B;  1WDC C;  2GGZ A;  1KSM A;  4PHN A;  4ORC B;  4HSZ A;  5AAN A;  1TNX A;  2WOS A;  1BR4 B;  1SBJ A;  4QJ3 B;  1MQ1 A;  1R2U A;  1DJI A;  1KFX L;  1S6J A;  3SIB A;  3WXA A;  1NCX A;  2JXL A;  1S36 A;  1K95 A;  2M7N A;  2MAZ A;  1ZAC A;  1R6P A;  2V53 A;  2ZND A;  2CNP A;  2Y4Q A;  4ETO A;  2O5G A;  4ZCU A;  1Y6W A;  1XFW O;  5HLV A;  1CKK A;  2M49 B;  1Y1X A;  1CDM A;  1UUS A;  2EC6 B;  1QS7 A;  1EH2 A;  3OP0 A;  3BQ3 A;  1S1E A;  1GGZ A;  4CFQ A;  1CLM A;  2F3Z A;  3TUY C;  2FJU B;  1BOD A;  2MHH A;  4MZL A;  1SPY A;  2DOQ A;  1LIN A;  3FIA A;  1S6C A;  2LVV A;  1KK8 C;  2CBL A;  3VRO A;  1C07 A;  1F4Q A;  1ODB A;  3BUM B;  1KQM B;  1XFY O;  2JT8 A;  2IS9 A;  2I18 A;  1NWD A;  2LC5 A;  1MUX A;  3HCM A;  2JTT A;  1WLM A;  2HF5 A;  3BUO B;  1TRF A;  1B9A A;  5AXI A;  1YRT B;  3KEV A;  3OX6 A;  4MN0 A;  3CS1 A;  1XO5 A;  4HRG A;  3PSR A;  2LLU A;  2MA2 A;  3CWG A;  4PHK A;  3TS5 B;  4I5J A;  5KU1 A;  3M0W A;  4YGA A;  2LAP A;  1UP5 A;  2BKI B;  4M2O A;  1X02 A;  1KFX S;  2L5X B;  2ZRS A;  5D7F A;  5HKW A;  1YRU B;  1CFD A;  2I94 A;  3ZNI A;  2G9B A;  5ER4 X;  2PAS A;  1C7V A;  2KYF A;  4PHM A;  4WRI A;  1DT7 B;  1YUT A;  1B1G A;  4GUK A;  4MRY A;  4DUQ A;  3JVT B;  1EL4 A;  3PFV A;  2JRF A;  1AJ4 A;  2L51 A;  2SCP A;  1QX5 B;  3CTN A;  3NSI A;  1QV0 A;  1F54 A;  1ALV A;  1LKJ A;  5JOL A;  1ALW A;  1B7T Y;  1CLB A;  1WDC B;  1CMG A;  4YI9 A;  3O2P A;  1BG1 A;  1CFP A;  1DGV A;  1DTL A;  1XK4 C;  3GK2 A;  3ZWH A;  4E68 A;  3BUW B;  4PCW A;  2LLT A;  4OVN F;  1NPQ A;  1NX3 A;  1ZMZ A;  1PVB A;  1TCO B;  2JT3 A;  2WND A;  2CTN A;  3I5F C;  1TNW A;  3SG5 A;  3I5I C;  1B7T Z;  1XFZ O;  3AAK A;  1K94 A;  5DKQ A;  1J7R A;  2HQ8 A;  3CGA A;  1FI6 A;  1F4O A;  1A29 A;  4DCK A;  1J55 A;  1IWQ A;  2RGI A;  1SL9 A;  1N2D A;  1M46 A;  2FCD A;  1SCM C;  2EC6 C;  1BOC A;  1J7P A;  3KHE A;  1IQ3 A;  1QIV A;  1Q80 A;  1MHO A;  2I7A A;  1KK7 Y;  2E30 A;  2LVI A;  1QX2 A;  3NSO A;  1RK9 A;  2KGR A;  1E8A A;  3EVV A;  2LCP A;  5HLO A;  1RFJ A;  1RTP 1;  1YX7 A;  1HT9 A;  4TNC A;  1L2O B;  4AQJ A;  1OSA A;  5CSN A;  2ZKM X;  1YVH A;  4M2P A;  1UHJ A;  2KDH A;  4MLW A;  3LL8 B;  2M8U A;  1FBV A;  4I5N B;  1ZOT B;  2ZRT A;  3FWB A;  4GGF A;  3BUX B;  1OZO A;  2KYC A;  1F70 A;  3KPX A;  3AKB A;  4HRH A;  4F0Z B;  3NSK A;  1IJ5 A;  1K9U A;  1NYA A;  3O78 A;  2BE4 A;  3VRP A;  1QXP A;  2LM5 A;  1FPW A;  3DVK A;  1QTX A;  1FW4 A;  1XA5 A;  4WQ3 A;  5K89 A;  3D0Y A;  4FTG A;  4JWQ A;  4CLN A;  1PSB A;  1AUI B;  3OHM B;  1DGU A;  1JUO A;  1SR6 C;  1C7W A;  4BY5 A;  1B8R A;  1QX7 A;  2BKH B;  3SG3 A;  3O4Y A;  2K61 A;  1K90 D;  2KNE A;  1AVS A;  1V1G A;  1N65 A;  4P5O E;  2WCF A;  1W7I B;  2LMT A;  2JPT A;  4CID A;  1K9P A;  2KAX A;  3GK4 X;  1WY9 A;  2EHB A;  3MSE B;  4C0K A;  4PE7 A;  5DKR A;  5HKY A;  3ICB A;  1ZUZ A;  2BBM A;  2BBN A;  1SMG A;  2Y1N A;  1DVI A;  2MLE C;  1NP8 A;  1F55 A;  2AUC A;  4ORB B;  1PAL A;  5FYX A;  3GOF A;  1SCM B;  2KI4 B;  3IQO A;  2Q91 A;  1PVA A;  4YBH B;  5CSI A;  1PSR A;  1NX1 A;  2BE6 A;  2JNX A;  2JU0 A;  2F2O A;  1EJ3 A;  1K96 A;  2A4J A;  3EK4 A;  5DKN A;  1NSH A;  1NX2 A;  2OTG B;  3CR2 A;  3TDI A;  1A4P A;  3EVU A;  4CFR A;  1IH0 A;  3EKH A;  4MZK A;  1KQV A;  2QAC A;  1G4Y R;  2AAO A;  2KQY A;  1XYD A;  3FWC A;  4YGD B;  1BF5 A;  1UUR A;  4PE0 A;  1M39 A;  2ZNE A;  1IKU A;  2JXC A;  4AOM A;  1TCF A;  2K7B A;  1K2H A;  1CFC A;  1OZS A;  1TTX A;  2NCP A;  1CTR A;  3CLN A;  1W7J B;  2ISD A;  1DJX A;  2KFH A;  1NX0 A;  3BOW B;  1K9K A;  3E3R A;  1QVI Y;  3KF9 A;  1BLQ A;  2I2R E;  2LHL A;  4XYN A;  1YR5 A;  1SCV A;  2R2I A;  2HQW A;  1GQM A;  2CXJ A;  3DVM A;  4M2Q A;  1WLZ A;  1PRW A;  1KFU S;  2CT9 A;  3I5H C;  2NXQ A;  2JZI A;  1LVC D;  2L98 A;  2M97 A;  1F71 A;  1PK0 D;  4N1G A;  4WQ2 A;  5GQQ C;  1S3P A;  3NXA A;  5BPJ A;  4DRW A;  3PN7 B;  1SK6 D;  5I8N A;  4C0L A;  1JF0 A;  1RJV A;  3VGO A;  2KQ6 A;  3EKJ A;  4GGF C;  1UWO A;  2L4I A;  2ZN8 A;  2OS8 B;  1J1E A;  1MXL C;  1IRJ A;  1OMD A;  1BJF A;  2FOT A;  5CSJ A;  2KAY A;  1LA0 A;  2LMU A;  4R1E A;  1JFK A;  1AHR A;  2QPT A;  2BCX A;  2BEC A;  2KFG A;  1BMO A;  5G08 A;  1B8C A;  3A4U B;  1OOJ A;  4GGN A;  2CCM A;  1CDL A;  4YGB B;  2Q4U A;  3PAL A;  4ORA B;  1SL7 A;  2L2E A;  1S5G Z;  2LUC A;  3TUY B;  3LK1 A;  4GBA A;  4PDZ A;  3DF0 B;  1CNP A;  2Y1M A;  1NIW A;  4GAO A;  2K7D A;  1XFU O;  5TNC A;  1H8B A;  5CPV A;  2MBX A;  1A2X A;  3SIA A;  1JFJ A;  4YRU A;  1CDN A;  3OB1 B;  2F33 A;  3WNX B;  4GPL B;  2K0J A;  1OMR A;  2OTG C;  1N0Y A;  4NDB A;  2K7C A;  4N1F A;  3LLE A;  1IG5 A;  1F8H A;  3BXK A;  4DS7 A;  1KFU L;  2M7L A;  1VRK A;  4HRE E;  2JT0 A;  2L4H A;  1DJG A;  3VRN A;  3DVE A;  2L0P A;  2WC8 A;  1BT6 A;  1YX8 A;  1Y1A A;  3TS5 C;  4NDD A;  5I2O A;  2NZ0 A;  2JUL A;  1CB1 A;  1YUU A;  1IJ6 A;  1MXE A;  4Q04 A;  1OMV A;  2M0R A;  2G2B A;  4U8D A;  4BY4 A;  4MVF A;  1TOP A;  1CMF A;  1KK8 B;  5KSZ A;  1LA3 A;  3JVT C;  4PHJ A;  4A4C A;  4USL A;  2B1U A;  3I5H B;  1QAS A;  4ICB A;  1IGV A;  1M45 A;  1DJH A;  1RRO A;  4NQG A;  1UHN A;  1CM4 A;  2F3Y A;  2WOR A;  2K2F A;  2KI6 C;  2JWW A;  3IQQ A;  2KI6 D;  2JC2 A;  5I2L A;  4YI8 A;  1WRK A;  1JWD A;  3HX4 A;  1JSA A;  5J3X A;  2JNF A;  1TNP A;  5CSF A;  1JF2 A;  1AK8 A;  1SNL A;  1XVJ A;  3TDU A;  3IF7 A;  1EG4 A;  2OS8 C;  1YVL A;  1U5I B;  2JTZ A;  1Y1U A;  4YGE B;  2BCB A;  3EK7 A;  2JOJ A;  3WHU B;  3DVJ A;  4MBE A;  1G33 A;  4FQO A;  2OPO A;  4XJK A;  2LMV A;  3SG6 A;  2COL B;  3BOW A;  4YGC B;  3D0Y B;  2MRD A;  2WCB A;  1DF0 A;  2AMI A;  3A8R A;  1K8U A;  4PE4 A;  3RM1 A;  1D1O A;  1M31 A;  3AAJ A;  2KAV A;  1SYM A;  1WRZ A;  2M9G A;  1L2O C;  1XK4 A;  4P2Y B;  1GJY A;  1QV1 A;  4PAL A;  5F6T A;  4I5K A;  1JC2 A;  2FCE A;  4DIR A;  4L9M A;  5AFP A;  1QVI Z;  1B8L A;  1L7Z A;  3I5F B;  3PLF B;  3FS7 A;  1YUR A;  2GGM A;  4CPV A;  1A03 A;  1DMO A;  1ZFS A;  2M1K B;  1A75 B;  4C0J A;  2LHI A;  3I5I B;  3PM8 A;  1QLK A;  2LP2 A;  4GFT A;  4ZCV A;  1CDP A;  1OE9 B;  3DF0 A;  2E6W A;  5AEQ A;  5IBW A;  2H2K A;  1SY9 A;  2KSP A;  2NLN A;  2MLF C;  2PAL A;  2D8N A;  1FI5 A;  2LVJ A;  1Y0V H;  4A4B A;  1GGW A;  1MF8 B;  4JPZ B;  1DF0 B;  2KBM A;  5AER A;  4OCI A;  5ER5 A;  1JBA A;  1DJZ A;  2KGB C;  3WHT B;  1KWO B;  5B8I B;  1U5I A;  1UHK A;  1SR6 B;  4JQ0 D;  2F8P A;  4PE1 A;  3SG2 A;  3SG4 A;  4XJK B;  2EGD A;  3BUN B;  3GK1 A;  1A75 A;  2LE9 B;  4NDC A;  1TN4 A;  2F2P A;  1IQ5 A;  3F45 A;  2LAN A;  1FF1 A;  2M1U A;  3D10 A;  1BU3 A;  3QRX A;  1J7Q A;  3JTD C;  1TNQ A;  3NSL A;  5PAL A;  1AJ5 A;  1QJT A;  1QAT A;  2BL0 C;  1TIZ A;  2NCO A;  5JJG A;  2PMY A;  2HPS A;  2KI4 C;  4OKH A;  4OR9 B;  3I5G C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...