2M8UA

Solution structure of the dictyostelium discodieum myosin light chain, mlcc
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
77
structure length
77
Chain Sequence
GSHMNHINTKAQVIEAFKVFDRDGNGYVTVDYLRKVLNELGDMMPADEIEEMIYEADPQNSGYVQYETFVGMLFLWD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Myosin Light Chain, MlcC
publication title Structure of the Single-lobe Myosin Light Chain C in Complex with the Light Chain-binding Domains of Myosin-1C Provides Insights into Divergent IQ Motif Recognition.
pubmed doi rcsb
source organism Dictyostelium discoideum
molecule tags Contractile protein
total genus 16
structure length 77
sequence length 77
ec nomenclature
pdb deposition date 2013-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2m8uA00
1UHIA 2NZ0A 5HKYA 3D0YA 5CSJA 3BUWB 1JBAA 1QASA 1UWOA 3AAKA 1F55A 1KQMB 5AXIA 1UHNA 1LKJA 2H61A 2ZRSA 4GGNA 1LA0A 2BECA 1MHOA 2OS8B 3O6BA 5ER4X 2E6WA 2M49B 1QJTA 1PULA 3H4SE 1A4PA 2JZIA 4WQ2A 1S3PA 3DVJA 1YUUA 1MXLC 1L2OC 1YRTB 3AAJA 1PSBA 4XJKA 2G9BA 1AK8A 3BOWA 1JC2A 1DJWA 3PATA 4U8DA 2PASA 1IWQA 3NXAA 3VGOA 3DVKA 2ZFDA 4PHKA 4MEWA 2EC6C 1EG4A 1SL9A 2ZN9A 5I2LA 1IRJA 5AERA 5KU1A 5AANA 4P2YB 5F6TA 1W7JB 4NDBA 4DIRA 1CDNA 1OMDA 1Y6WA 1B8LA 2JXCA 2K0JA 2LP3A 1WLMA 1IG5A 1SCVA 2WCFA 1FF1A 3SIAA 3I5HB 4OR9B 5GQQC 2PSRA 3SG2A 1B7TY 1BMOA 1KFUL 2K8MB 2KHNA 1RTP1 4USLA 2M7LA 1L2OB 3TS5C 4MZKA 3BUNB 1J1EA 3QRXA 3PLFB 1B4CA 3RM1A 2LP2A 2JULA 2OPOA 1KFXS 1G33A 4AQJA 1B7TZ 3RLZA 3CWGA 1CM1A 1PSRA 1UHKA 2K7BA 1A75A 1SRAA 1XK4C 3O78A 1K8UA 2EC6B 1DTLA 4BY5A 1PK0D 3FS7A 5CSFA 2GV5A 1QLSA 4GUKA 2KQYA 3VRPA 2MJWB 1K2HA 3A4UB 4MZLA 4MLWA 2A4JA 1WRLA 1MQ1A 1C7WA 1SY9A 1YUTA 4A4BA 3D10A 4D1EA 1KQVA 1BR4B 1YX8A 1M31A 3TS5B 3AKBA 4MRYA 2AMIA 3CZTX 5B8IB 1WLZA 5JJGA 2KQ6A 2F2OA 1TRFA 2JOJA 3SG6A 2LLUA 1DT7B 2P6BB 1BG1A 1DJGA 1FPWA 3HCMA 1CLLA 2HF5A 4YGCB 1BLQA 1CDPA 3EK4A 1YRUB 2K7CA 3BUOB 2WORA 4CFRA 1EG3A 1B8CA 4NDCA 4YGBB 1KFUS 1M63B 2Y1MA 2ZN8A 3IQOA 3O2PA 1NUBA 1KWOC 1XFWO 1BT6A 1LINA 1OQPA 1WDCC 2MAZA 2LNKA 2B1UA 3IQQA 1OMRA 3EKHA 1F70A 4FTGA 4BY4A 1N0YA 4YBHB 1SYMA 1IQ5A 1RJVA 1U5IA 2I18A 4AOMA 3LK0A 1R6PA 1EH2A 1C07A 1XFYO 2QACA 3BQ3A 1TTXA 1DF0B 1NX1A 1X02A 3GK1A 1NX2A 1NP8A 3PN7C 3WXAA 2KAXA 2KOTA 2EGDA 1UHHA 1CMFA 1F71A 1N2DA 2KBMA 1KWOB 1LXFC 1WDCB 2M9GA 2LUXA 1NX0A 1IQ3A 1XFVO 3LL8B 4GGFC 1XA5A 3LCPC 1NX3A 2KFFA 1TIZA 2FCEA 4GNKB 1SCMC 1K94A 4Q04A 3KEVA 5KTYA 1AP4A 1QIVA 4WRIA 4JPZB 4YGDB 4C0LA 1MF8B 1GGWA 2LC5A 3VRNA 1AVSA 1H8BA 1TCFA 1CTRA 1CM4A 1IGVA 4M2OA 3SJSA 3PN7B 2LHIA 2Q91A 4YI9A 5G08A 3MSEB 1GGZA 5I8NA 5HKWA 2LLTA 2BE6A 2LMVA 4L9MA 3SG7A 1Y1AA 1XFXO 3I5HC 1J7OA 2H61C 3NSLA 4ZCVA 2JXLA 1WRZA 1SCMB 2WC8A 3SIBA 4CFQA 1ZOTB 2WOSA 4N1GA 5D69A 1LA3A 4NDDA 3NSOA 2HPSA 3PSRA 1K95A 4ICBA 1CLBA 1YVHA 3FIAA 2M1UA 1KCYA 1SNLA 2JTZA 1UHJA 1DGUA 4OV2A 2MRDA 1AJ4A 2LV7A 3KO0A 4IL1A 1OOJA 3OX6A 1CKKA 2L0PA 5BPJA 2SCPA 1TCOB 3D0YB 3E3RA 3KHEA 5HLOA 1QIWA 2MLEC 4OVNF 1BOCA 2JPTA 3DF0A 5HLVA 1K9KA 2LMUA 3EVRA 1V1FA 1SL8A 3EKJA 1HQVA 1QS7A 2HETA 4MSPA 2BCXA 3DVMA 4A4CA 3OP0A 1NIWA 1CFFA 1AHRA 2KGBC 1ALWA 1QX2A 4ETOA 1AUIB 5DKNA 2AAOA 2M1KB 4F0ZB 1BODA 3BOWB 2KAVA 1F54A 2Y4QA 1YX7A 2LHLA 1MXEA 5CPVA 1NCYA 1Y1XA 4MRXA 2LMTA 2F3YA 2JWWA 4UPGA 2JU0A 1WY9A 1NCXA 1K9PA 3BUXB 2M97A 2WCBA 3KF9A 3NSIA 2GGMA 5I2QA 1GJYA 3DVEA 2LCPA 2WCEA 4I5NB 2OTGB 4PE1A 2BBNA 1EL4A 1BR1B 1YUSA 3GK4X 2LVJA 2ISDA 2CNPA 2BKHB 1NPQA 2PALA 4QJ4B 4NQGA 4M2PA 1DVIA 1GQMA 1PALA 3CTNA 5HKZA 1CFDA 1QX7A 4WQ3A 1WRKA 3SG3A 4AQIA 4PHMA 1A75B 4ORCB 3I5FC 2JQ6A 5AEQA 1RWYA 4GBAA 1JSAA 2CCMA 2KDHA 1OE9B 3HX4A 1M45A 2M0RA 3ZNIA 3IF7A 2L5XB 1CDMA 3TDUA 1VRKA 3WHUB 3ZWHA 4CPVA 2L4HA 2K2AA 2KYFA 3CLNA 2HQWA 1QX5B 4P5OE 2VRGA 2WNDA 4ORBB 1B47A 1JFKA 4YI8A 1S6JA 2BBMA 2BL0C 2F33A 3EK8A 3PALA 5D7FA 1KSOA 3SG5A 4ZCUA 2CXJA 1BF5A 1QXPA 3I5FB 2LVKA 2JT3A 2FJUB 1FI5A 1SKTA 5KSZA 1J7RA 4JWQA 3GOFA 2PVBA 3DD4A 1SL7A 2JC2A 2QPTA 1FI6A 3OX5A 3OB2B 5PALA 3ICBA 3CS1A 1NWDA 1QLKA 2L98A 1CMGA 1ALVA 1G4YR 2PRUA 3OHMB 4I5JA 1D1OA 2FOTA 3BUMB 1KK7Y 1TNXA 1JFJA 1DJYA 1JF0A 1SK6D 2L4IA 3NSKA 1U5IB 2DOQA 4PCWA 1E8AA 4N1FA 2RGIA 2BL0B 2GGZA 2BCBA 3WNXB 2I7AA 3PM8A 1S6CA 1G8IA 1XFUO 1DMOA 1KK7Z 2I2RE 3JVTC 4PHNA 2Q4UA 2O60A 3FWCA 1BU3A 2FCDA 2Y1NA 4DCKA 1XO5A 4PHJA 1KFXL 2M7NA 5K89A 1J7PA 1NCZA 1PVBA 4M2QA 2K2FA 1CB1A 1NSHA 2O5GA 3C1VA 4HRGA 1M46A 1W7IB 2ZKMX 3BYAA 1OMVA 1S5GY 1MWNA 1A2XA 2JT0A 5ER5A 2AUCA 3OB1B 4HREE 4E68A 1S36A 2K7DA 1B8RA 5J3XA 3K21A 2LVIA 2L51A 1ZMZA 1K93D 1Y1UA 4QJ5B 3TUYC 1S5GZ 1QVIY 1XVJA 2NCPA 4CLNA 1DJIA 1H4BA 1UUSA 1IJ6A 3I5IC 1J1DA 3JVTB 2JNFA 5JOLA 2G2BA 1SMGA 2BE4A 2R2IA 1AJ5A 2M29A 5AFPA 4MN0A 1F4OA 3JTDC 1B1GA 1QVIZ 2F2PA 3TDIA 2KFHA 3SG4A 4QJ3B 4GFTA 1EJ3A 2SASA 1YR5A 2OTGC 2NLNA 2MLFC 1KK8C 2KYCA 4MVFA 2CTNA 1F8HA 1IH0A 3EK7A 2ZNDA 2JNXA 2KI6C 1FW4A 4XJKB 3O4YA 1YTZC 1ZUZA 2L2EA 1XK4A 3KPXA 2LM5A 2HQ8A 3TUYB 2NCOA 1V1GA 1QV0A 1YVLA 5CSNA 3I5IB 4TNCA 4I5LB 1RROA 4PDZA 5DKQA 1SR6C 1K96A 1L7ZA 2D8NA 3VRQA 3JTDB 1MR8A 2E30A 1J55A 1YURA 1DJHA 2F8PA 1S6IA 2F3ZA 1UP5A 2KBIA 1CFCA 1QV1A 1RK9A 1JWDA 1KK8B 3TDZA 1A29A 3PFVA 4YRUA 3VRRA 1JUOA 3CR4X 5IBWA 1DJZA 4GPLB 3DF0B 2MBXA 4HRHA 4XYNA 1KSMA 4DRWA 1CFPA 2H2KA 5HYDA 3EVUA 1DJXA 3FWBA 4OCIA 2LAPA 2JRFA 1NYAA 2L50A 2NXQA 2JT8A 1JF2A 2M3WA 1DF0A 4MZJA 4CIDA 2IS9A 4GAOA 4JQ0D 2EHBA 4C0KA 3F45A 1HT9A 1TN4A 4FQOA 1SW8A 2I94A 3EVVA 1Q80A 3LLEA 5I2OA 1SR6B 1OZOA 1Y0VH 4PALA 2CT9A 2K7OA 1XYDA 3GK2A 2KI6D 1CDLA 1FBVA 1RECA 1TNQA 4R1EA 5CSIA 1QATA 2KGRA 1ODBA 4PE7A 1SPYA 3LK1A 5TNCA 1QTXA 4YGAA 2KAYA 1A03A 2LVVA 2BKIB 3VROA 2MHHA 1ZACA 2LANA 2MA2A 3M0WA 1DGVA 2LLSA 2CBLA 2Y5IA 1MUXA 1SBJA 1EXRA 2LE9B 1TNWA 2M8UA 3CR2A 2ZNEA 1PVAA 2KI4C 4YGEB 4DUQA 3A8RA 3I5GC 3WHTB 1RFJA 1K9UA 3CGAA 2LUCA 2PMYA 4PE0A 1CNPA 1B9AA 2COLB 1PRWA 3BXKA 1K90D 2BCAA 2TN4A 4C0JA 1OZSA 1C7VA 1TNPA 1KQMC 2ZRTA 4I5KA 1M39A 5DKRA 5FYXA 1OSAA 4GGFA 4DS7A 2JTTA 1CLMA 3AKAA 2OS8C 4ORAB 3CR5X 1N65A 4OKHA 4PE4A 1S26D 1R2UA 2KFGA 1BJFA 3TZ1A 2KNEA 1LVCD 2K61A 1UURA 2V53A 4HSZA 4MBEA 2KI4B 1F4QA 1S1EA 1IKUA 1ZFSA 3I5GB 1IJ5A 1J7QA 2KSPA 1XFZO 1TOPA 4N5XA
chains in the Genus database with same CATH superfamily
3FE8A 1UHIA 4INXA 2NZ0A 3BFBA 5HKYA 2L2CA 3D0YA 5CSJA 3BUWB 1JBAA 1QASA 1UWOA 3AAKA 1F55A 1KQMB 5AXIA 1UHNA 3L4AA 1LKJA 2H61A 2ZRSA 4GGNA 1LA0A 2BECA 1MHOA 2OS8B 3O6BA 5ER4X 2E6WA 2M49B 1QJTA 1PULA 3H4SE 3PM2A 1A4PA 2JZIA 4WQ2A 1S3PA 3DVJA 1YUUA 1MXLC 3D77A 1L2OC 1YRTB 3AAJA 1QWVA 3D76A 1XFRA 1PSBA 4XJKA 2G9BA 1AK8A 3BOWA 1JC2A 1DJWA 3PATA 4U8DA 2PASA 1IWQA 3NXAA 3VGOA 3DVKA 2ZFDA 3L4LA 4PHKA 2GTEA 4MEWA 2EC6C 1EG4A 1SL9A 2ZN9A 5I2LA 1IRJA 5AERA 5KU1A 5AANA 4P2YB 5F6TA 1W7JB 1DQEA 4NDBA 4DIRA 1CDNA 1OMDA 1Y6WA 1B8LA 2JXCA 2K0JA 2LP3A 2WC5A 5EL2A 1WLMA 1IG5A 1SCVA 2WCFA 1FF1A 3SIAA 3I5HB 4OR9B 5GQQC 2PSRA 3SG2A 1B7TY 1BMOA 1KFUL 2K8MB 2KHNA 1RTP1 4USLA 2M7LA 3UO9A 1L2OB 3TS5C 4MZKA 3BUNB 1J1EA 3QRXA 3PLFB 3S0EA 1B4CA 2WCJA 2LP2A 2JULA 2OPOA 1KFXS 1P28A 3RM1A 3RZSA 1G33A 4AQJA 1B7TZ 3RLZA 3CWGA 1CM1A 1PSRA 1UHKA 3OBVA 2K7BA 1A75A 1SRAA 1XK4C 3O78A 1K8UA 5FI6A 2EC6B 1DTLA 4BY5A 1PK0D 3FS7A 5CSFA 2GV5A 1QLSA 4GUKA 2KQYA 3VRPA 2MJWB 1K2HA 3A4UB 4MZLA 4MLWA 2A4JA 1WRLA 1MQ1A 1C7WA 1SY9A 1YUTA 4A4BA 3D10A 4D1EA 1KQVA 1IIOA 1BR4B 1YX8A 1M31A 3TS5B 3AKBA 4MRYA 2AMIA 3CZTX 5B8IB 1WLZA 5JJGA 2KQ6A 2F2OA 1TRFA 2JOJA 3SG6A 2LLUA 5HL1A 1DT7B 2P6BB 1BG1A 1DJGA 1FPWA 3HCMA 1CLLA 2HF5A 3B86A 4YGCB 1BLQA 1CDPA 3EK4A 1YRUB 2K7CA 3B87A 3BUOB 2WORA 4CFRA 1EG3A 1B8CA 4NDCA 3S0FA 4YGBB 1KFUS 1M63B 2Y1MA 2ZN8A 3D74A 3IQOA 3O2PA 1NUBA 1KWOC 1XFWO 1BT6A 1LINA 1OQPA 1WDCC 2MAZA 2LNKA 2B1UA 3IQQA 1OMRA 3EKHA 1F70A 3FE6A 4FTGA 4BY4A 1N0YA 2PQLA 4YBHB 1SYMA 1IQ5A 1RJVA 1U5IA 2BAPA 2I18A 4AOMA 3LK0A 1R6PA 5FI2A 2P71A 1EH2A 1C07A 1XFYO 2QACA 3BQ3A 1TTXA 1DF0B 3VB1A 1NX1A 1X02A 3GK1A 1NX2A 1NP8A 3PN7C 3WXAA 3B7AA 2KAXA 2KOTA 2EGDA 1UHHA 1CMFA 1F71A 1N2DA 2KBMA 3R1OA 1KWOB 1DELA 1LXFC 1WDCB 2M9GA 2LUXA 1NX0A 1IQ3A 1XFVO 4INWA 4JKTA 3Q8IA 3LL8B 4GGFC 1XA5A 3LCPC 1NX3A 2KFFA 1TIZA 2FCEA 4GNKB 1SCMC 1K94A 4Q04A 3KEVA 5KTYA 1AP4A 1QIVA 3CZ1A 4WRIA 4JPZB 4YGDB 3S0GA 1MF8B 3R72A 4C0LA 2LC5A 3VRNA 1AVSA 1GGWA 1H8BA 1TCFA 1CTRA 1CM4A 1IGVA 4M2OA 3SJSA 1DEKA 3PN7B 2QEBA 1OOFA 2LHIA 2ERBA 2Q91A 3NHIA 4YI9A 5G08A 3MSEB 1GGZA 3BFAA 5I8NA 5HKWA 2LLTA 2BE6A 2LMVA 4JD9A 4L9MA 3SG7A 1Y1AA 1XFXO 3I5HC 1J7OA 2H61C 3NSLA 4ZCVA 4FQTA 2JXLA 1WRZA 1SCMB 2WC8A 3R1VA 3SIBA 4CFQA 1ZOTB 2WOSA 4N1GA 5D69A 1LA3A 4NDDA 3NSOA 2HPSA 3PSRA 1K95A 4ICBA 1CLBA 3PJIA 1YVHA 3FIAA 3DYEA 2M1UA 1KCYA 1SNLA 2JTZA 1UHJA 1DGUA 3D73A 4OV2A 2QDIA 3V2LA 2MRDA 3CDNA 1AJ4A 2LV7A 3KO0A 4IL1A 1OOJA 3OX6A 1CKKA 2L0PA 5BPJA 2SCPA 1TCOB 3D0YB 3E3RA 3KHEA 5HLOA 1QIWA 2MLEC 3QMEA 4OVNF 1BOCA 2JPTA 3DF0A 5HLVA 1K9KA 2LMUA 1TUJA 3EVRA 1V1FA 1SL8A 3EKJA 1HQVA 3IVTA 1DC1A 1QS7A 2HETA 4MSPA 2BCXA 3DVMA 4A4CA 3OP0A 3SS4A 1NIWA 1TWOA 1CFFA 1AHRA 2KGBC 1ALWA 1QX2A 1OOHA 4ETOA 1AUIB 3CABA 2KLEA 5DKNA 2AAOA 2M1KB 5DICA 4F0ZB 1BODA 2L5YA 3BOWB 2KAVA 1F54A 2Y4QA 1YX7A 2LHLA 1MXEA 3CZ2A 1NCYA 1Y1XA 5CPVA 4MRXA 2LMTA 3NHTA 2F3YA 2JWWA 4UPGA 2JU0A 2QEVA 1WY9A 1GM0A 1NCXA 1K9PA 1C3ZA 3BUXB 2M97A 2WCBA 3KF9A 3NSIA 2GGMA 5I2QA 1GJYA 3DVEA 2LCPA 3DY9A 1ORGA 2WCEA 4I5NB 2OTGB 4PE1A 2BBNA 1EL4A 1BR1B 1YUSA 3GK4X 2LVJA 2ISDA 2CNPA 2BKHB 1NPQA 2PALA 4QJ4B 4NQGA 4M2PA 1DVIA 1GQMA 1PALA 3CTNA 5HKZA 1CFDA 1QX7A 1Z4HA 4WQ3A 3D78A 1WRKA 3SS5A 3SG3A 4PHMA 1A75B 4AQIA 2QEHA 2PYQA 4ORCB 3I5FC 4IJ7A 2JQ6A 2YGUA 5AEQA 1RWYA 4GBAA 1JSAA 2CCMA 2KDHA 1OE9B 3HX4A 1M45A 2M0RA 3ZNIA 3IF7A 2L5XB 1C3YA 1CDMA 3TDUA 3O4XA 1VRKA 3WHUB 1LS8A 3ZWHA 4CPVA 2L4HA 2K2AA 2KYFA 1SSEB 3CLNA 3N7HA 2HQWA 1QX5B 2KLDA 4P5OE 2VRGA 2WNDA 4ORBB 1B47A 1JFKA 4YI8A 1S6JA 2BBMA 2BL0C 2F33A 3EK8A 3PALA 4OZDA 1KSOA 5D7FA 4ZCUA 3SG5A 2CXJA 1BF5A 2JPOA 1QXPA 3I5FB 2LVKA 2JT3A 2FJUB 2BNXA 1FI5A 1SKTA 5KSZA 1J7RA 3B6XA 4JWQA 3GOFA 2PVBA 3DD4A 1SL7A 3CZ0A 2JC2A 2QPTA 1FI6A 3OX5A 3OB2B 5PALA 3ICBA 3CS1A 1NWDA 1QLKA 2L98A 3K1EA 1CMGA 1ALVA 1G4YR 2PRUA 3BJHA 3OHMB 4I5JA 2FOTA 1D1OA 3BUMB 1KK7Y 3NGVA 1TNXA 1JFJA 1DJYA 1JF0A 1SK6D 2L4IA 3NSKA 1U5IB 2DOQA 3BFHA 4PCWA 3SS3A 1E8AA 4N1FA 2RGIA 2BL0B 2GGZA 2BCBA 3WNXB 2I7AA 3PM8A 1S6CA 1G8IA 1XFUO 1DMOA 1KK7Z 2I2RE 3JVTC 4PHNA 2Q4UA 2O60A 3FWCA 1BU3A 2FCDA 2Y1NA 4DCKA 1XO5A 4PHJA 1KFXL 2M7NA 5K89A 1J7PA 1NCZA 1PVBA 4M2QA 2K2FA 1CB1A 1NSHA 2O5GA 3C1VA 4HRGA 1M46A 1W7IB 2ZKMX 3BYAA 1OMVA 1Z2CB 1S5GY 1MWNA 1A2XA 2JT0A 5ER5A 2AUCA 3D75A 3OB1B 4HREE 4E68A 1S36A 2K7DA 1B8RA 5J3XA 3K21A 2LVIA 2L51A 1ZMZA 1K93D 1Y1UA 4QJ5B 3TUYC 1S5GZ 1QVIY 1XVJA 2NCPA 4CLNA 1DJIA 1H4BA 1UUSA 1IJ6A 3I5IC 1J1DA 3JVTB 2JNFA 5JOLA 2G2BA 1SMGA 2BE4A 2R2IA 1AJ5A 2M29A 5AFPA 4MN0A 1F4OA 3JTDC 1B1GA 1QVIZ 2F2PA 3TDIA 2KFHA 3SG4A 4QJ3B 4GFTA 2K60A 1EJ3A 2SASA 1YR5A 2OTGC 2NLNA 2MLFC 1KK8C 2KYCA 4MVFA 2CTNA 3B88A 1F8HA 3EK7A 1IH0A 2ZNDA 2JNXA 5FI7A 2WCMA 2H8VA 2KI6C 2KPHA 1FW4A 4XJKB 3O4YA 1YTZC 1ZUZA 3S0BA 2L2EA 1XK4A 3KPXA 2LM5A 2HQ8A 2WC6A 3TUYB 3FE9A 2NCOA 1V1GA 1QV0A 1YVLA 5CSNA 3I5IB 4TNCA 1OW4A 4I5LB 1RROA 4PDZA 5DKQA 1SR6C 1K96A 2WCKA 1L7ZA 2D8NA 3VRQA 3JTDB 1MR8A 2E30A 1J55A 1YURA 1DJHA 2F8PA 5I94A 1S6IA 2F3ZA 1UP5A 2FJYA 2KBIA 3S0DA 1CFCA 1QV1A 1RK9A 1JWDA 1KK8B 3TDZA 1A29A 3PFVA 5D3OA 3VRRA 1JUOA 3CR4X 4YRUA 5IBWA 1DJZA 4GPLB 3DF0B 2MBXA 4HRHA 4XYNA 1KSMA 4DRWA 1CFPA 2H2KA 5HYDA 3EVUA 3CYZA 1DJXA 3FWBA 4OCIA 2LAPA 3EG5B 2JRFA 1NYAA 2L50A 2NXQA 2JT8A 1JF2A 3S0AA 2M3WA 1DF0A 4MZJA 4CIDA 2IS9A 4GAOA 4JQ0D 2EHBA 2WCLA 4C0KA 3F45A 1HT9A 1TN4A 4FQOA 1SW8A 2I94A 3EVVA 1Q80A 3LLEA 5I2OA 1SR6B 1OZOA 1Y0VH 4PALA 2CT9A 2K7OA 1XYDA 3GK2A 2KI6D 1CDLA 1FBVA 1RECA 1TNQA 4R1EA 5CSIA 1QATA 2KGRA 1ODBA 2QEOA 1SPYA 4PE7A 3LK1A 5TNCA 1QTXA 4YGAA 2KAYA 1A03A 2LVVA 2BKIB 3VROA 2WCHA 2MHHA 1ZACA 2LANA 2MA2A 3M0WA 1DGVA 1T14A 2LLSA 2CBLA 2Y5IA 1MUXA 1SBJA 1EXRA 3R1PA 2LE9B 1TNWA 2M8UA 3CR2A 2ZNEA 1PVAA 2KI4C 4YGEB 4DUQA 3A8RA 3I5GC 3WHTB 1RFJA 1K9UA 4PT1A 3CGAA 2LUCA 2PMYA 4PE0A 1CNPA 1B9AA 2COLB 1PRWA 3BXKA 1K90D 2BCAA 4KYNA 2TN4A 4C0JA 1OZSA 1C7VA 1TNPA 3DXLA 1KQMC 2ZRTA 4I5KA 1M39A 5DKRA 5FYXA 1OSAA 3UNWA 4GGFA 4DS7A 2JTTA 1CLMA 3AKAA 2OS8C 4ORAB 3CR5X 1N65A 4OKHA 4PE4A 1S26D 1R2UA 1OOGA 1BJFA 2KFGA 3TZ1A 3DZTA 2KNEA 4F7FA 1LVCD 2K61A 1UURA 2V53A 4HSZA 4MBEA 1OOIX 1W9ZA 2KI4B 1F4QA 1S1EA 3L47A 1IKUA 1ZFSA 1TUZA 3I5GB 1IJ5A 1J7QA 3OGNA 2P70A 2KSPA 1XFZO 1TOPA 4N5XA
chains in the Genus database with same CATH topology
1UHIA 2NZ0A 5HKYA 3D0YA 5CSJA 3BUWB 1JBAA 1QASA 1UWOA 3AAKA 1F55A 1KQMB 5AXIA 1UHNA 1LKJA 2H61A 2ZRSA 4GGNA 1LA0A 2BECA 1MHOA 2OS8B 3O6BA 5ER4X 2E6WA 2M49B 1QJTA 1PULA 3H4SE 1A4PA 2JZIA 4WQ2A 1S3PA 3DVJA 1YUUA 1MXLC 1L2OC 1YRTB 3AAJA 1PSBA 4XJKA 2G9BA 1AK8A 3BOWA 1JC2A 1DJWA 3PATA 4U8DA 2PASA 1IWQA 3NXAA 3VGOA 3DVKA 2ZFDA 4PHKA 4MEWA 2EC6C 1EG4A 1SL9A 2ZN9A 5I2LA 1IRJA 5AERA 5KU1A 5AANA 4P2YB 5F6TA 1W7JB 4NDBA 4DIRA 1CDNA 1OMDA 1Y6WA 1B8LA 2JXCA 2K0JA 2LP3A 1WLMA 1IG5A 1SCVA 2WCFA 1FF1A 3SIAA 3I5HB 4OR9B 5GQQC 2PSRA 3SG2A 1B7TY 1BMOA 1KFUL 2K8MB 2KHNA 1RTP1 4USLA 2M7LA 1L2OB 3TS5C 4MZKA 3BUNB 1J1EA 3QRXA 3PLFB 1B4CA 3RM1A 2LP2A 2JULA 2OPOA 1KFXS 1G33A 4AQJA 1B7TZ 3RLZA 3CWGA 1CM1A 1PSRA 1UHKA 2K7BA 1A75A 1SRAA 1XK4C 3O78A 1K8UA 2EC6B 1DTLA 4BY5A 1PK0D 3FS7A 5CSFA 2GV5A 1QLSA 4GUKA 2KQYA 3VRPA 2MJWB 1K2HA 3A4UB 4MZLA 4MLWA 2A4JA 1WRLA 1MQ1A 1C7WA 1SY9A 1YUTA 4A4BA 3D10A 4D1EA 1KQVA 1BR4B 1YX8A 1M31A 3TS5B 3AKBA 4MRYA 2AMIA 3CZTX 5B8IB 1WLZA 5JJGA 2KQ6A 2F2OA 1TRFA 2JOJA 3SG6A 2LLUA 1DT7B 2P6BB 1BG1A 1DJGA 1FPWA 3HCMA 1CLLA 2HF5A 4YGCB 1BLQA 1CDPA 3EK4A 1YRUB 2K7CA 3BUOB 2WORA 4CFRA 1EG3A 1B8CA 4NDCA 4YGBB 1KFUS 1M63B 2Y1MA 2ZN8A 3IQOA 3O2PA 1NUBA 1KWOC 1XFWO 1BT6A 1LINA 1OQPA 1WDCC 2MAZA 2LNKA 2B1UA 3IQQA 1OMRA 3EKHA 1F70A 4FTGA 4BY4A 1N0YA 4YBHB 1SYMA 1IQ5A 1RJVA 1U5IA 2I18A 4AOMA 3LK0A 1R6PA 1EH2A 1C07A 1XFYO 2QACA 3BQ3A 1TTXA 1DF0B 1NX1A 1X02A 3GK1A 1NX2A 1NP8A 3PN7C 3WXAA 2KAXA 2KOTA 2EGDA 1UHHA 1CMFA 1F71A 1N2DA 2KBMA 1KWOB 1LXFC 1WDCB 2M9GA 2LUXA 1NX0A 1IQ3A 1XFVO 3LL8B 4GGFC 1XA5A 3LCPC 1NX3A 2KFFA 1TIZA 2FCEA 4GNKB 1SCMC 1K94A 4Q04A 3KEVA 5KTYA 1AP4A 1QIVA 4WRIA 4JPZB 4YGDB 4C0LA 1MF8B 1GGWA 2LC5A 3VRNA 1AVSA 1H8BA 1TCFA 1CTRA 1CM4A 1IGVA 4M2OA 3SJSA 3PN7B 2LHIA 2Q91A 4YI9A 5G08A 3MSEB 1GGZA 5I8NA 5HKWA 2LLTA 2BE6A 2LMVA 4L9MA 3SG7A 1Y1AA 1XFXO 3I5HC 1J7OA 2H61C 3NSLA 4ZCVA 2JXLA 1WRZA 1SCMB 2WC8A 3SIBA 4CFQA 1ZOTB 2WOSA 4N1GA 5D69A 1LA3A 4NDDA 3NSOA 2HPSA 3PSRA 1K95A 4ICBA 1CLBA 1YVHA 3FIAA 2M1UA 1KCYA 1SNLA 2JTZA 1UHJA 1DGUA 4OV2A 2MRDA 1AJ4A 2LV7A 3KO0A 4IL1A 1OOJA 3OX6A 1CKKA 2L0PA 5BPJA 2SCPA 1TCOB 3D0YB 3E3RA 3KHEA 5HLOA 1QIWA 2MLEC 4OVNF 1BOCA 2JPTA 3DF0A 5HLVA 1K9KA 2LMUA 3EVRA 1V1FA 1SL8A 3EKJA 1HQVA 1QS7A 2HETA 4MSPA 2BCXA 3DVMA 4A4CA 3OP0A 1NIWA 1CFFA 1AHRA 2KGBC 1ALWA 1QX2A 4ETOA 1AUIB 5DKNA 2AAOA 2M1KB 4F0ZB 1BODA 3BOWB 2KAVA 1F54A 2Y4QA 1YX7A 2LHLA 1MXEA 5CPVA 1NCYA 1Y1XA 4MRXA 2LMTA 2F3YA 2JWWA 4UPGA 2JU0A 1WY9A 1NCXA 1K9PA 3BUXB 2M97A 2WCBA 3KF9A 3NSIA 2GGMA 5I2QA 1GJYA 3DVEA 2LCPA 2WCEA 4I5NB 2OTGB 4PE1A 2BBNA 1EL4A 1BR1B 1YUSA 3GK4X 2LVJA 2ISDA 2CNPA 2BKHB 1NPQA 2PALA 4QJ4B 4NQGA 4M2PA 1DVIA 1GQMA 1PALA 3CTNA 5HKZA 1CFDA 1QX7A 4WQ3A 1WRKA 3SG3A 4AQIA 4PHMA 1A75B 4ORCB 3I5FC 2JQ6A 5AEQA 1RWYA 4GBAA 1JSAA 2CCMA 2KDHA 1OE9B 3HX4A 1M45A 2M0RA 3ZNIA 3IF7A 2L5XB 1CDMA 3TDUA 1VRKA 3WHUB 3ZWHA 4CPVA 2L4HA 2K2AA 2KYFA 3CLNA 2HQWA 1QX5B 4P5OE 2VRGA 2WNDA 4ORBB 1B47A 1JFKA 4YI8A 1S6JA 2BBMA 2BL0C 2F33A 3EK8A 3PALA 5D7FA 1KSOA 3SG5A 4ZCUA 2CXJA 1BF5A 1QXPA 3I5FB 2LVKA 2JT3A 2FJUB 1FI5A 1SKTA 5KSZA 1J7RA 4JWQA 3GOFA 2PVBA 3DD4A 1SL7A 2JC2A 2QPTA 1FI6A 3OX5A 3OB2B 5PALA 3ICBA 3CS1A 1NWDA 1QLKA 2L98A 1CMGA 1ALVA 1G4YR 2PRUA 3OHMB 4I5JA 1D1OA 2FOTA 3BUMB 1KK7Y 1TNXA 1JFJA 1DJYA 1JF0A 1SK6D 2L4IA 3NSKA 1U5IB 2DOQA 4PCWA 1E8AA 4N1FA 2RGIA 2BL0B 2GGZA 2BCBA 3WNXB 2I7AA 3PM8A 1S6CA 1G8IA 1XFUO 1DMOA 1KK7Z 2I2RE 3JVTC 4PHNA 2Q4UA 2O60A 3FWCA 1BU3A 2FCDA 2Y1NA 4DCKA 1XO5A 4PHJA 1KFXL 2M7NA 5K89A 1J7PA 1NCZA 1PVBA 4M2QA 2K2FA 1CB1A 1NSHA 2O5GA 3C1VA 4HRGA 1M46A 1W7IB 2ZKMX 3BYAA 1OMVA 1S5GY 1MWNA 1A2XA 2JT0A 5ER5A 2AUCA 3OB1B 4HREE 4E68A 1S36A 2K7DA 1B8RA 5J3XA 3K21A 2LVIA 2L51A 1ZMZA 1K93D 1Y1UA 4QJ5B 3TUYC 1S5GZ 1QVIY 1XVJA 2NCPA 4CLNA 1DJIA 1H4BA 1UUSA 1IJ6A 3I5IC 1J1DA 3JVTB 2JNFA 5JOLA 2G2BA 1SMGA 2BE4A 2R2IA 1AJ5A 2M29A 5AFPA 4MN0A 1F4OA 3JTDC 1B1GA 1QVIZ 2F2PA 3TDIA 2KFHA 3SG4A 4QJ3B 4GFTA 1EJ3A 2SASA 1YR5A 2OTGC 2NLNA 2MLFC 1KK8C 2KYCA 4MVFA 2CTNA 1F8HA 1IH0A 3EK7A 2ZNDA 2JNXA 2KI6C 1FW4A 4XJKB 3O4YA 1YTZC 1ZUZA 2L2EA 1XK4A 3KPXA 2LM5A 2HQ8A 3TUYB 2NCOA 1V1GA 1QV0A 1YVLA 5CSNA 3I5IB 4TNCA 4I5LB 1RROA 4PDZA 5DKQA 1SR6C 1K96A 1L7ZA 2D8NA 3VRQA 3JTDB 1MR8A 2E30A 1J55A 1YURA 1DJHA 2F8PA 1S6IA 2F3ZA 1UP5A 2KBIA 1CFCA 1QV1A 1RK9A 1JWDA 1KK8B 3TDZA 1A29A 3PFVA 4YRUA 3VRRA 1JUOA 3CR4X 5IBWA 1DJZA 4GPLB 3DF0B 2MBXA 4HRHA 4XYNA 1KSMA 4DRWA 1CFPA 2H2KA 5HYDA 3EVUA 1DJXA 3FWBA 4OCIA 2LAPA 2JRFA 1NYAA 2L50A 2NXQA 2JT8A 1JF2A 2M3WA 1DF0A 4MZJA 4CIDA 2IS9A 4GAOA 4JQ0D 2EHBA 4C0KA 3F45A 1HT9A 1TN4A 4FQOA 1SW8A 2I94A 3EVVA 1Q80A 3LLEA 5I2OA 1SR6B 1OZOA 1Y0VH 4PALA 2CT9A 2K7OA 1XYDA 3GK2A 2KI6D 1CDLA 1FBVA 1RECA 1TNQA 4R1EA 5CSIA 1QATA 2KGRA 1ODBA 4PE7A 1SPYA 3LK1A 5TNCA 1QTXA 4YGAA 2KAYA 1A03A 2LVVA 2BKIB 3VROA 2MHHA 1ZACA 2LANA 2MA2A 3M0WA 1DGVA 2LLSA 2CBLA 2Y5IA 1MUXA 1SBJA 1EXRA 2LE9B 1TNWA 2M8UA 3CR2A 2ZNEA 1PVAA 2KI4C 4YGEB 4DUQA 3A8RA 3I5GC 3WHTB 1RFJA 1K9UA 3CGAA 2LUCA 2PMYA 4PE0A 1CNPA 1B9AA 2COLB 1PRWA 3BXKA 1K90D 2BCAA 2TN4A 4C0JA 1OZSA 1C7VA 1TNPA 1KQMC 2ZRTA 4I5KA 1M39A 5DKRA 5FYXA 1OSAA 4GGFA 4DS7A 2JTTA 1CLMA 3AKAA 2OS8C 4ORAB 3CR5X 1N65A 4OKHA 4PE4A 1S26D 1R2UA 2KFGA 1BJFA 3TZ1A 2KNEA 1LVCD 2K61A 1UURA 2V53A 4HSZA 4MBEA 2KI4B 1F4QA 1S1EA 1IKUA 1ZFSA 3I5GB 1IJ5A 1J7QA 2KSPA 1XFZO 1TOPA 4N5XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UHI A;  2NZ0 A;  5HKY A;  3D0Y A;  5CSJ A;  3BUW B;  1JBA A;  1QAS A;  1UWO A;  3AAK A;  1F55 A;  1KQM B;  5AXI A;  1UHN A;  1LKJ A;  2H61 A;  2ZRS A;  4GGN A;  1LA0 A;  2BEC A;  1MHO A;  2OS8 B;  3O6B A;  5ER4 X;  2E6W A;  2M49 B;  1QJT A;  1PUL A;  3H4S E;  1A4P A;  2JZI A;  4WQ2 A;  1S3P A;  3DVJ A;  1YUU A;  1MXL C;  1L2O C;  1YRT B;  3AAJ A;  1PSB A;  4XJK A;  2G9B A;  1AK8 A;  3BOW A;  1JC2 A;  1DJW A;  3PAT A;  4U8D A;  2PAS A;  1IWQ A;  3NXA A;  3VGO A;  3DVK A;  2ZFD A;  4PHK A;  4MEW A;  2EC6 C;  1EG4 A;  1SL9 A;  2ZN9 A;  5I2L A;  1IRJ A;  5AER A;  5KU1 A;  5AAN A;  4P2Y B;  5F6T A;  1W7J B;  4NDB A;  4DIR A;  1CDN A;  1OMD A;  1Y6W A;  1B8L A;  2JXC A;  2K0J A;  2LP3 A;  1WLM A;  1IG5 A;  1SCV A;  2WCF A;  1FF1 A;  3SIA A;  3I5H B;  4OR9 B;  5GQQ C;  2PSR A;  3SG2 A;  1B7T Y;  1BMO A;  1KFU L;  2K8M B;  2KHN A;  1RTP 1;  4USL A;  2M7L A;  1L2O B;  3TS5 C;  4MZK A;  3BUN B;  1J1E A;  3QRX A;  3PLF B;  1B4C A;  3RM1 A;  2LP2 A;  2JUL A;  2OPO A;  1KFX S;  1G33 A;  4AQJ A;  1B7T Z;  3RLZ A;  3CWG A;  1CM1 A;  1PSR A;  1UHK A;  2K7B A;  1A75 A;  1SRA A;  1XK4 C;  3O78 A;  1K8U A;  2EC6 B;  1DTL A;  4BY5 A;  1PK0 D;  3FS7 A;  5CSF A;  2GV5 A;  1QLS A;  4GUK A;  2KQY A;  3VRP A;  2MJW B;  1K2H A;  3A4U B;  4MZL A;  4MLW A;  2A4J A;  1WRL A;  1MQ1 A;  1C7W A;  1SY9 A;  1YUT A;  4A4B A;  3D10 A;  4D1E A;  1KQV A;  1BR4 B;  1YX8 A;  1M31 A;  3TS5 B;  3AKB A;  4MRY A;  2AMI A;  3CZT X;  5B8I B;  1WLZ A;  5JJG A;  2KQ6 A;  2F2O A;  1TRF A;  2JOJ A;  3SG6 A;  2LLU A;  1DT7 B;  2P6B B;  1BG1 A;  1DJG A;  1FPW A;  3HCM A;  1CLL A;  2HF5 A;  4YGC B;  1BLQ A;  1CDP A;  3EK4 A;  1YRU B;  2K7C A;  3BUO B;  2WOR A;  4CFR A;  1EG3 A;  1B8C A;  4NDC A;  4YGB B;  1KFU S;  1M63 B;  2Y1M A;  2ZN8 A;  3IQO A;  3O2P A;  1NUB A;  1KWO C;  1XFW O;  1BT6 A;  1LIN A;  1OQP A;  1WDC C;  2MAZ A;  2LNK A;  2B1U A;  3IQQ A;  1OMR A;  3EKH A;  1F70 A;  4FTG A;  4BY4 A;  1N0Y A;  4YBH B;  1SYM A;  1IQ5 A;  1RJV A;  1U5I A;  2I18 A;  4AOM A;  3LK0 A;  1R6P A;  1EH2 A;  1C07 A;  1XFY O;  2QAC A;  3BQ3 A;  1TTX A;  1DF0 B;  1NX1 A;  1X02 A;  3GK1 A;  1NX2 A;  1NP8 A;  3PN7 C;  3WXA A;  2KAX A;  2KOT A;  2EGD A;  1UHH A;  1CMF A;  1F71 A;  1N2D A;  2KBM A;  1KWO B;  1LXF C;  1WDC B;  2M9G A;  2LUX A;  1NX0 A;  1IQ3 A;  1XFV O;  3LL8 B;  4GGF C;  1XA5 A;  3LCP C;  1NX3 A;  2KFF A;  1TIZ A;  2FCE A;  4GNK B;  1SCM C;  1K94 A;  4Q04 A;  3KEV A;  5KTY A;  1AP4 A;  1QIV A;  4WRI A;  4JPZ B;  4YGD B;  4C0L A;  1MF8 B;  1GGW A;  2LC5 A;  3VRN A;  1AVS A;  1H8B A;  1TCF A;  1CTR A;  1CM4 A;  1IGV A;  4M2O A;  3SJS A;  3PN7 B;  2LHI A;  2Q91 A;  4YI9 A;  5G08 A;  3MSE B;  1GGZ A;  5I8N A;  5HKW A;  2LLT A;  2BE6 A;  2LMV A;  4L9M A;  3SG7 A;  1Y1A A;  1XFX O;  3I5H C;  1J7O A;  2H61 C;  3NSL A;  4ZCV A;  2JXL A;  1WRZ A;  1SCM B;  2WC8 A;  3SIB A;  4CFQ A;  1ZOT B;  2WOS A;  4N1G A;  5D69 A;  1LA3 A;  4NDD A;  3NSO A;  2HPS A;  3PSR A;  1K95 A;  4ICB A;  1CLB A;  1YVH A;  3FIA A;  2M1U A;  1KCY A;  1SNL A;  2JTZ A;  1UHJ A;  1DGU A;  4OV2 A;  2MRD A;  1AJ4 A;  2LV7 A;  3KO0 A;  4IL1 A;  1OOJ A;  3OX6 A;  1CKK A;  2L0P A;  5BPJ A;  2SCP A;  1TCO B;  3D0Y B;  3E3R A;  3KHE A;  5HLO A;  1QIW A;  2MLE C;  4OVN F;  1BOC A;  2JPT A;  3DF0 A;  5HLV A;  1K9K A;  2LMU A;  3EVR A;  1V1F A;  1SL8 A;  3EKJ A;  1HQV A;  1QS7 A;  2HET A;  4MSP A;  2BCX A;  3DVM A;  4A4C A;  3OP0 A;  1NIW A;  1CFF A;  1AHR A;  2KGB C;  1ALW A;  1QX2 A;  4ETO A;  1AUI B;  5DKN A;  2AAO A;  2M1K B;  4F0Z B;  1BOD A;  3BOW B;  2KAV A;  1F54 A;  2Y4Q A;  1YX7 A;  2LHL A;  1MXE A;  5CPV A;  1NCY A;  1Y1X A;  4MRX A;  2LMT A;  2F3Y A;  2JWW A;  4UPG A;  2JU0 A;  1WY9 A;  1NCX A;  1K9P A;  3BUX B;  2M97 A;  2WCB A;  3KF9 A;  3NSI A;  2GGM A;  5I2Q A;  1GJY A;  3DVE A;  2LCP A;  2WCE A;  4I5N B;  2OTG B;  4PE1 A;  2BBN A;  1EL4 A;  1BR1 B;  1YUS A;  3GK4 X;  2LVJ A;  2ISD A;  2CNP A;  2BKH B;  1NPQ A;  2PAL A;  4QJ4 B;  4NQG A;  4M2P A;  1DVI A;  1GQM A;  1PAL A;  3CTN A;  5HKZ A;  1CFD A;  1QX7 A;  4WQ3 A;  1WRK A;  3SG3 A;  4AQI A;  4PHM A;  1A75 B;  4ORC B;  3I5F C;  2JQ6 A;  5AEQ A;  1RWY A;  4GBA A;  1JSA A;  2CCM A;  2KDH A;  1OE9 B;  3HX4 A;  1M45 A;  2M0R A;  3ZNI A;  3IF7 A;  2L5X B;  1CDM A;  3TDU A;  1VRK A;  3WHU B;  3ZWH A;  4CPV A;  2L4H A;  2K2A A;  2KYF A;  3CLN A;  2HQW A;  1QX5 B;  4P5O E;  2VRG A;  2WND A;  4ORB B;  1B47 A;  1JFK A;  4YI8 A;  1S6J A;  2BBM A;  2BL0 C;  2F33 A;  3EK8 A;  3PAL A;  5D7F A;  1KSO A;  3SG5 A;  4ZCU A;  2CXJ A;  1BF5 A;  1QXP A;  3I5F B;  2LVK A;  2JT3 A;  2FJU B;  1FI5 A;  1SKT A;  5KSZ A;  1J7R A;  4JWQ A;  3GOF A;  2PVB A;  3DD4 A;  1SL7 A;  2JC2 A;  2QPT A;  1FI6 A;  3OX5 A;  3OB2 B;  5PAL A;  3ICB A;  3CS1 A;  1NWD A;  1QLK A;  2L98 A;  1CMG A;  1ALV A;  1G4Y R;  2PRU A;  3OHM B;  4I5J A;  1D1O A;  2FOT A;  3BUM B;  1KK7 Y;  1TNX A;  1JFJ A;  1DJY A;  1JF0 A;  1SK6 D;  2L4I A;  3NSK A;  1U5I B;  2DOQ A;  4PCW A;  1E8A A;  4N1F A;  2RGI A;  2BL0 B;  2GGZ A;  2BCB A;  3WNX B;  2I7A A;  3PM8 A;  1S6C A;  1G8I A;  1XFU O;  1DMO A;  1KK7 Z;  2I2R E;  3JVT C;  4PHN A;  2Q4U A;  2O60 A;  3FWC A;  1BU3 A;  2FCD A;  2Y1N A;  4DCK A;  1XO5 A;  4PHJ A;  1KFX L;  2M7N A;  5K89 A;  1J7P A;  1NCZ A;  1PVB A;  4M2Q A;  2K2F A;  1CB1 A;  1NSH A;  2O5G A;  3C1V A;  4HRG A;  1M46 A;  1W7I B;  2ZKM X;  3BYA A;  1OMV A;  1S5G Y;  1MWN A;  1A2X A;  2JT0 A;  5ER5 A;  2AUC A;  3OB1 B;  4HRE E;  4E68 A;  1S36 A;  2K7D A;  1B8R A;  5J3X A;  3K21 A;  2LVI A;  2L51 A;  1ZMZ A;  1K93 D;  1Y1U A;  4QJ5 B;  3TUY C;  1S5G Z;  1QVI Y;  1XVJ A;  2NCP A;  4CLN A;  1DJI A;  1H4B A;  1UUS A;  1IJ6 A;  3I5I C;  1J1D A;  3JVT B;  2JNF A;  5JOL A;  2G2B A;  1SMG A;  2BE4 A;  2R2I A;  1AJ5 A;  2M29 A;  5AFP A;  4MN0 A;  1F4O A;  3JTD C;  1B1G A;  1QVI Z;  2F2P A;  3TDI A;  2KFH A;  3SG4 A;  4QJ3 B;  4GFT A;  1EJ3 A;  2SAS A;  1YR5 A;  2OTG C;  2NLN A;  2MLF C;  1KK8 C;  2KYC A;  4MVF A;  2CTN A;  1F8H A;  1IH0 A;  3EK7 A;  2ZND A;  2JNX A;  2KI6 C;  1FW4 A;  4XJK B;  3O4Y A;  1YTZ C;  1ZUZ A;  2L2E A;  1XK4 A;  3KPX A;  2LM5 A;  2HQ8 A;  3TUY B;  2NCO A;  1V1G A;  1QV0 A;  1YVL A;  5CSN A;  3I5I B;  4TNC A;  4I5L B;  1RRO A;  4PDZ A;  5DKQ A;  1SR6 C;  1K96 A;  1L7Z A;  2D8N A;  3VRQ A;  3JTD B;  1MR8 A;  2E30 A;  1J55 A;  1YUR A;  1DJH A;  2F8P A;  1S6I A;  2F3Z A;  1UP5 A;  2KBI A;  1CFC A;  1QV1 A;  1RK9 A;  1JWD A;  1KK8 B;  3TDZ A;  1A29 A;  3PFV A;  4YRU A;  3VRR A;  1JUO A;  3CR4 X;  5IBW A;  1DJZ A;  4GPL B;  3DF0 B;  2MBX A;  4HRH A;  4XYN A;  1KSM A;  4DRW A;  1CFP A;  2H2K A;  5HYD A;  3EVU A;  1DJX A;  3FWB A;  4OCI A;  2LAP A;  2JRF A;  1NYA A;  2L50 A;  2NXQ A;  2JT8 A;  1JF2 A;  2M3W A;  1DF0 A;  4MZJ A;  4CID A;  2IS9 A;  4GAO A;  4JQ0 D;  2EHB A;  4C0K A;  3F45 A;  1HT9 A;  1TN4 A;  4FQO A;  1SW8 A;  2I94 A;  3EVV A;  1Q80 A;  3LLE A;  5I2O A;  1SR6 B;  1OZO A;  1Y0V H;  4PAL A;  2CT9 A;  2K7O A;  1XYD A;  3GK2 A;  2KI6 D;  1CDL A;  1FBV A;  1REC A;  1TNQ A;  4R1E A;  5CSI A;  1QAT A;  2KGR A;  1ODB A;  4PE7 A;  1SPY A;  3LK1 A;  5TNC A;  1QTX A;  4YGA A;  2KAY A;  1A03 A;  2LVV A;  2BKI B;  3VRO A;  2MHH A;  1ZAC A;  2LAN A;  2MA2 A;  3M0W A;  1DGV A;  2LLS A;  2CBL A;  2Y5I A;  1MUX A;  1SBJ A;  1EXR A;  2LE9 B;  1TNW A;  2M8U A;  3CR2 A;  2ZNE A;  1PVA A;  2KI4 C;  4YGE B;  4DUQ A;  3A8R A;  3I5G C;  3WHT B;  1RFJ A;  1K9U A;  3CGA A;  2LUC A;  2PMY A;  4PE0 A;  1CNP A;  1B9A A;  2COL B;  1PRW A;  3BXK A;  1K90 D;  2BCA A;  2TN4 A;  4C0J A;  1OZS A;  1C7V A;  1TNP A;  1KQM C;  2ZRT A;  4I5K A;  1M39 A;  5DKR A;  5FYX A;  1OSA A;  4GGF A;  4DS7 A;  2JTT A;  1CLM A;  3AKA A;  2OS8 C;  4ORA B;  3CR5 X;  1N65 A;  4OKH A;  4PE4 A;  1S26 D;  1R2U A;  2KFG A;  1BJF A;  3TZ1 A;  2KNE A;  1LVC D;  2K61 A;  1UUR A;  2V53 A;  4HSZ A;  4MBE A;  2KI4 B;  1F4Q A;  1S1E A;  1IKU A;  1ZFS A;  3I5G B;  1IJ5 A;  1J7Q A;  2KSP A;  1XFZ O;  1TOP A;  4N5X A; 
#chains in the Genus database with same CATH topology
 3FE8 A;  1UHI A;  4INX A;  2NZ0 A;  3BFB A;  5HKY A;  2L2C A;  3D0Y A;  5CSJ A;  3BUW B;  1JBA A;  1QAS A;  1UWO A;  3AAK A;  1F55 A;  1KQM B;  5AXI A;  1UHN A;  3L4A A;  1LKJ A;  2H61 A;  2ZRS A;  4GGN A;  1LA0 A;  2BEC A;  1MHO A;  2OS8 B;  3O6B A;  5ER4 X;  2E6W A;  2M49 B;  1QJT A;  1PUL A;  3H4S E;  3PM2 A;  1A4P A;  2JZI A;  4WQ2 A;  1S3P A;  3DVJ A;  1YUU A;  1MXL C;  3D77 A;  1L2O C;  1YRT B;  3AAJ A;  1QWV A;  3D76 A;  1XFR A;  1PSB A;  4XJK A;  2G9B A;  1AK8 A;  3BOW A;  1JC2 A;  1DJW A;  3PAT A;  4U8D A;  2PAS A;  1IWQ A;  3NXA A;  3VGO A;  3DVK A;  2ZFD A;  3L4L A;  4PHK A;  2GTE A;  4MEW A;  2EC6 C;  1EG4 A;  1SL9 A;  2ZN9 A;  5I2L A;  1IRJ A;  5AER A;  5KU1 A;  5AAN A;  4P2Y B;  5F6T A;  1W7J B;  1DQE A;  4NDB A;  4DIR A;  1CDN A;  1OMD A;  1Y6W A;  1B8L A;  2JXC A;  2K0J A;  2LP3 A;  2WC5 A;  5EL2 A;  1WLM A;  1IG5 A;  1SCV A;  2WCF A;  1FF1 A;  3SIA A;  3I5H B;  4OR9 B;  5GQQ C;  2PSR A;  3SG2 A;  1B7T Y;  1BMO A;  1KFU L;  2K8M B;  2KHN A;  1RTP 1;  4USL A;  2M7L A;  3UO9 A;  1L2O B;  3TS5 C;  4MZK A;  3BUN B;  1J1E A;  3QRX A;  3PLF B;  3S0E A;  1B4C A;  2WCJ A;  2LP2 A;  2JUL A;  2OPO A;  1KFX S;  1P28 A;  3RM1 A;  3RZS A;  1G33 A;  4AQJ A;  1B7T Z;  3RLZ A;  3CWG A;  1CM1 A;  1PSR A;  1UHK A;  3OBV A;  2K7B A;  1A75 A;  1SRA A;  1XK4 C;  3O78 A;  1K8U A;  5FI6 A;  2EC6 B;  1DTL A;  4BY5 A;  1PK0 D;  3FS7 A;  5CSF A;  2GV5 A;  1QLS A;  4GUK A;  2KQY A;  3VRP A;  2MJW B;  1K2H A;  3A4U B;  4MZL A;  4MLW A;  2A4J A;  1WRL A;  1MQ1 A;  1C7W A;  1SY9 A;  1YUT A;  4A4B A;  3D10 A;  4D1E A;  1KQV A;  1IIO A;  1BR4 B;  1YX8 A;  1M31 A;  3TS5 B;  3AKB A;  4MRY A;  2AMI A;  3CZT X;  5B8I B;  1WLZ A;  5JJG A;  2KQ6 A;  2F2O A;  1TRF A;  2JOJ A;  3SG6 A;  2LLU A;  5HL1 A;  1DT7 B;  2P6B B;  1BG1 A;  1DJG A;  1FPW A;  3HCM A;  1CLL A;  2HF5 A;  3B86 A;  4YGC B;  1BLQ A;  1CDP A;  3EK4 A;  1YRU B;  2K7C A;  3B87 A;  3BUO B;  2WOR A;  4CFR A;  1EG3 A;  1B8C A;  4NDC A;  3S0F A;  4YGB B;  1KFU S;  1M63 B;  2Y1M A;  2ZN8 A;  3D74 A;  3IQO A;  3O2P A;  1NUB A;  1KWO C;  1XFW O;  1BT6 A;  1LIN A;  1OQP A;  1WDC C;  2MAZ A;  2LNK A;  2B1U A;  3IQQ A;  1OMR A;  3EKH A;  1F70 A;  3FE6 A;  4FTG A;  4BY4 A;  1N0Y A;  2PQL A;  4YBH B;  1SYM A;  1IQ5 A;  1RJV A;  1U5I A;  2BAP A;  2I18 A;  4AOM A;  3LK0 A;  1R6P A;  5FI2 A;  2P71 A;  1EH2 A;  1C07 A;  1XFY O;  2QAC A;  3BQ3 A;  1TTX A;  1DF0 B;  3VB1 A;  1NX1 A;  1X02 A;  3GK1 A;  1NX2 A;  1NP8 A;  3PN7 C;  3WXA A;  3B7A A;  2KAX A;  2KOT A;  2EGD A;  1UHH A;  1CMF A;  1F71 A;  1N2D A;  2KBM A;  3R1O A;  1KWO B;  1DEL A;  1LXF C;  1WDC B;  2M9G A;  2LUX A;  1NX0 A;  1IQ3 A;  1XFV O;  4INW A;  4JKT A;  3Q8I A;  3LL8 B;  4GGF C;  1XA5 A;  3LCP C;  1NX3 A;  2KFF A;  1TIZ A;  2FCE A;  4GNK B;  1SCM C;  1K94 A;  4Q04 A;  3KEV A;  5KTY A;  1AP4 A;  1QIV A;  3CZ1 A;  4WRI A;  4JPZ B;  4YGD B;  3S0G A;  1MF8 B;  3R72 A;  4C0L A;  2LC5 A;  3VRN A;  1AVS A;  1GGW A;  1H8B A;  1TCF A;  1CTR A;  1CM4 A;  1IGV A;  4M2O A;  3SJS A;  1DEK A;  3PN7 B;  2QEB A;  1OOF A;  2LHI A;  2ERB A;  2Q91 A;  3NHI A;  4YI9 A;  5G08 A;  3MSE B;  1GGZ A;  3BFA A;  5I8N A;  5HKW A;  2LLT A;  2BE6 A;  2LMV A;  4JD9 A;  4L9M A;  3SG7 A;  1Y1A A;  1XFX O;  3I5H C;  1J7O A;  2H61 C;  3NSL A;  4ZCV A;  4FQT A;  2JXL A;  1WRZ A;  1SCM B;  2WC8 A;  3R1V A;  3SIB A;  4CFQ A;  1ZOT B;  2WOS A;  4N1G A;  5D69 A;  1LA3 A;  4NDD A;  3NSO A;  2HPS A;  3PSR A;  1K95 A;  4ICB A;  1CLB A;  3PJI A;  1YVH A;  3FIA A;  3DYE A;  2M1U A;  1KCY A;  1SNL A;  2JTZ A;  1UHJ A;  1DGU A;  3D73 A;  4OV2 A;  2QDI A;  3V2L A;  2MRD A;  3CDN A;  1AJ4 A;  2LV7 A;  3KO0 A;  4IL1 A;  1OOJ A;  3OX6 A;  1CKK A;  2L0P A;  5BPJ A;  2SCP A;  1TCO B;  3D0Y B;  3E3R A;  3KHE A;  5HLO A;  1QIW A;  2MLE C;  3QME A;  4OVN F;  1BOC A;  2JPT A;  3DF0 A;  5HLV A;  1K9K A;  2LMU A;  1TUJ A;  3EVR A;  1V1F A;  1SL8 A;  3EKJ A;  1HQV A;  3IVT A;  1DC1 A;  1QS7 A;  2HET A;  4MSP A;  2BCX A;  3DVM A;  4A4C A;  3OP0 A;  3SS4 A;  1NIW A;  1TWO A;  1CFF A;  1AHR A;  2KGB C;  1ALW A;  1QX2 A;  1OOH A;  4ETO A;  1AUI B;  3CAB A;  2KLE A;  5DKN A;  2AAO A;  2M1K B;  5DIC A;  4F0Z B;  1BOD A;  2L5Y A;  3BOW B;  2KAV A;  1F54 A;  2Y4Q A;  1YX7 A;  2LHL A;  1MXE A;  3CZ2 A;  1NCY A;  1Y1X A;  5CPV A;  4MRX A;  2LMT A;  3NHT A;  2F3Y A;  2JWW A;  4UPG A;  2JU0 A;  2QEV A;  1WY9 A;  1GM0 A;  1NCX A;  1K9P A;  1C3Z A;  3BUX B;  2M97 A;  2WCB A;  3KF9 A;  3NSI A;  2GGM A;  5I2Q A;  1GJY A;  3DVE A;  2LCP A;  3DY9 A;  1ORG A;  2WCE A;  4I5N B;  2OTG B;  4PE1 A;  2BBN A;  1EL4 A;  1BR1 B;  1YUS A;  3GK4 X;  2LVJ A;  2ISD A;  2CNP A;  2BKH B;  1NPQ A;  2PAL A;  4QJ4 B;  4NQG A;  4M2P A;  1DVI A;  1GQM A;  1PAL A;  3CTN A;  5HKZ A;  1CFD A;  1QX7 A;  1Z4H A;  4WQ3 A;  3D78 A;  1WRK A;  3SS5 A;  3SG3 A;  4PHM A;  1A75 B;  4AQI A;  2QEH A;  2PYQ A;  4ORC B;  3I5F C;  4IJ7 A;  2JQ6 A;  2YGU A;  5AEQ A;  1RWY A;  4GBA A;  1JSA A;  2CCM A;  2KDH A;  1OE9 B;  3HX4 A;  1M45 A;  2M0R A;  3ZNI A;  3IF7 A;  2L5X B;  1C3Y A;  1CDM A;  3TDU A;  3O4X A;  1VRK A;  3WHU B;  1LS8 A;  3ZWH A;  4CPV A;  2L4H A;  2K2A A;  2KYF A;  1SSE B;  3CLN A;  3N7H A;  2HQW A;  1QX5 B;  2KLD A;  4P5O E;  2VRG A;  2WND A;  4ORB B;  1B47 A;  1JFK A;  4YI8 A;  1S6J A;  2BBM A;  2BL0 C;  2F33 A;  3EK8 A;  3PAL A;  4OZD A;  1KSO A;  5D7F A;  4ZCU A;  3SG5 A;  2CXJ A;  1BF5 A;  2JPO A;  1QXP A;  3I5F B;  2LVK A;  2JT3 A;  2FJU B;  2BNX A;  1FI5 A;  1SKT A;  5KSZ A;  1J7R A;  3B6X A;  4JWQ A;  3GOF A;  2PVB A;  3DD4 A;  1SL7 A;  3CZ0 A;  2JC2 A;  2QPT A;  1FI6 A;  3OX5 A;  3OB2 B;  5PAL A;  3ICB A;  3CS1 A;  1NWD A;  1QLK A;  2L98 A;  3K1E A;  1CMG A;  1ALV A;  1G4Y R;  2PRU A;  3BJH A;  3OHM B;  4I5J A;  2FOT A;  1D1O A;  3BUM B;  1KK7 Y;  3NGV A;  1TNX A;  1JFJ A;  1DJY A;  1JF0 A;  1SK6 D;  2L4I A;  3NSK A;  1U5I B;  2DOQ A;  3BFH A;  4PCW A;  3SS3 A;  1E8A A;  4N1F A;  2RGI A;  2BL0 B;  2GGZ A;  2BCB A;  3WNX B;  2I7A A;  3PM8 A;  1S6C A;  1G8I A;  1XFU O;  1DMO A;  1KK7 Z;  2I2R E;  3JVT C;  4PHN A;  2Q4U A;  2O60 A;  3FWC A;  1BU3 A;  2FCD A;  2Y1N A;  4DCK A;  1XO5 A;  4PHJ A;  1KFX L;  2M7N A;  5K89 A;  1J7P A;  1NCZ A;  1PVB A;  4M2Q A;  2K2F A;  1CB1 A;  1NSH A;  2O5G A;  3C1V A;  4HRG A;  1M46 A;  1W7I B;  2ZKM X;  3BYA A;  1OMV A;  1Z2C B;  1S5G Y;  1MWN A;  1A2X A;  2JT0 A;  5ER5 A;  2AUC A;  3D75 A;  3OB1 B;  4HRE E;  4E68 A;  1S36 A;  2K7D A;  1B8R A;  5J3X A;  3K21 A;  2LVI A;  2L51 A;  1ZMZ A;  1K93 D;  1Y1U A;  4QJ5 B;  3TUY C;  1S5G Z;  1QVI Y;  1XVJ A;  2NCP A;  4CLN A;  1DJI A;  1H4B A;  1UUS A;  1IJ6 A;  3I5I C;  1J1D A;  3JVT B;  2JNF A;  5JOL A;  2G2B A;  1SMG A;  2BE4 A;  2R2I A;  1AJ5 A;  2M29 A;  5AFP A;  4MN0 A;  1F4O A;  3JTD C;  1B1G A;  1QVI Z;  2F2P A;  3TDI A;  2KFH A;  3SG4 A;  4QJ3 B;  4GFT A;  2K60 A;  1EJ3 A;  2SAS A;  1YR5 A;  2OTG C;  2NLN A;  2MLF C;  1KK8 C;  2KYC A;  4MVF A;  2CTN A;  3B88 A;  1F8H A;  3EK7 A;  1IH0 A;  2ZND A;  2JNX A;  5FI7 A;  2WCM A;  2H8V A;  2KI6 C;  2KPH A;  1FW4 A;  4XJK B;  3O4Y A;  1YTZ C;  1ZUZ A;  3S0B A;  2L2E A;  1XK4 A;  3KPX A;  2LM5 A;  2HQ8 A;  2WC6 A;  3TUY B;  3FE9 A;  2NCO A;  1V1G A;  1QV0 A;  1YVL A;  5CSN A;  3I5I B;  4TNC A;  1OW4 A;  4I5L B;  1RRO A;  4PDZ A;  5DKQ A;  1SR6 C;  1K96 A;  2WCK A;  1L7Z A;  2D8N A;  3VRQ A;  3JTD B;  1MR8 A;  2E30 A;  1J55 A;  1YUR A;  1DJH A;  2F8P A;  5I94 A;  1S6I A;  2F3Z A;  1UP5 A;  2FJY A;  2KBI A;  3S0D A;  1CFC A;  1QV1 A;  1RK9 A;  1JWD A;  1KK8 B;  3TDZ A;  1A29 A;  3PFV A;  5D3O A;  3VRR A;  1JUO A;  3CR4 X;  4YRU A;  5IBW A;  1DJZ A;  4GPL B;  3DF0 B;  2MBX A;  4HRH A;  4XYN A;  1KSM A;  4DRW A;  1CFP A;  2H2K A;  5HYD A;  3EVU A;  3CYZ A;  1DJX A;  3FWB A;  4OCI A;  2LAP A;  3EG5 B;  2JRF A;  1NYA A;  2L50 A;  2NXQ A;  2JT8 A;  1JF2 A;  3S0A A;  2M3W A;  1DF0 A;  4MZJ A;  4CID A;  2IS9 A;  4GAO A;  4JQ0 D;  2EHB A;  2WCL A;  4C0K A;  3F45 A;  1HT9 A;  1TN4 A;  4FQO A;  1SW8 A;  2I94 A;  3EVV A;  1Q80 A;  3LLE A;  5I2O A;  1SR6 B;  1OZO A;  1Y0V H;  4PAL A;  2CT9 A;  2K7O A;  1XYD A;  3GK2 A;  2KI6 D;  1CDL A;  1FBV A;  1REC A;  1TNQ A;  4R1E A;  5CSI A;  1QAT A;  2KGR A;  1ODB A;  2QEO A;  1SPY A;  4PE7 A;  3LK1 A;  5TNC A;  1QTX A;  4YGA A;  2KAY A;  1A03 A;  2LVV A;  2BKI B;  3VRO A;  2WCH A;  2MHH A;  1ZAC A;  2LAN A;  2MA2 A;  3M0W A;  1DGV A;  1T14 A;  2LLS A;  2CBL A;  2Y5I A;  1MUX A;  1SBJ A;  1EXR A;  3R1P A;  2LE9 B;  1TNW A;  2M8U A;  3CR2 A;  2ZNE A;  1PVA A;  2KI4 C;  4YGE B;  4DUQ A;  3A8R A;  3I5G C;  3WHT B;  1RFJ A;  1K9U A;  4PT1 A;  3CGA A;  2LUC A;  2PMY A;  4PE0 A;  1CNP A;  1B9A A;  2COL B;  1PRW A;  3BXK A;  1K90 D;  2BCA A;  4KYN A;  2TN4 A;  4C0J A;  1OZS A;  1C7V A;  1TNP A;  3DXL A;  1KQM C;  2ZRT A;  4I5K A;  1M39 A;  5DKR A;  5FYX A;  1OSA A;  3UNW A;  4GGF A;  4DS7 A;  2JTT A;  1CLM A;  3AKA A;  2OS8 C;  4ORA B;  3CR5 X;  1N65 A;  4OKH A;  4PE4 A;  1S26 D;  1R2U A;  1OOG A;  1BJF A;  2KFG A;  3TZ1 A;  3DZT A;  2KNE A;  4F7F A;  1LVC D;  2K61 A;  1UUR A;  2V53 A;  4HSZ A;  4MBE A;  1OOI X;  1W9Z A;  2KI4 B;  1F4Q A;  1S1E A;  3L47 A;  1IKU A;  1ZFS A;  1TUZ A;  3I5G B;  1IJ5 A;  1J7Q A;  3OGN A;  2P70 A;  2KSP A;  1XFZ O;  1TOP A;  4N5X A; 
#chains in the Genus database with same CATH homology
 1UHI A;  2NZ0 A;  5HKY A;  3D0Y A;  5CSJ A;  3BUW B;  1JBA A;  1QAS A;  1UWO A;  3AAK A;  1F55 A;  1KQM B;  5AXI A;  1UHN A;  1LKJ A;  2H61 A;  2ZRS A;  4GGN A;  1LA0 A;  2BEC A;  1MHO A;  2OS8 B;  3O6B A;  5ER4 X;  2E6W A;  2M49 B;  1QJT A;  1PUL A;  3H4S E;  1A4P A;  2JZI A;  4WQ2 A;  1S3P A;  3DVJ A;  1YUU A;  1MXL C;  1L2O C;  1YRT B;  3AAJ A;  1PSB A;  4XJK A;  2G9B A;  1AK8 A;  3BOW A;  1JC2 A;  1DJW A;  3PAT A;  4U8D A;  2PAS A;  1IWQ A;  3NXA A;  3VGO A;  3DVK A;  2ZFD A;  4PHK A;  4MEW A;  2EC6 C;  1EG4 A;  1SL9 A;  2ZN9 A;  5I2L A;  1IRJ A;  5AER A;  5KU1 A;  5AAN A;  4P2Y B;  5F6T A;  1W7J B;  4NDB A;  4DIR A;  1CDN A;  1OMD A;  1Y6W A;  1B8L A;  2JXC A;  2K0J A;  2LP3 A;  1WLM A;  1IG5 A;  1SCV A;  2WCF A;  1FF1 A;  3SIA A;  3I5H B;  4OR9 B;  5GQQ C;  2PSR A;  3SG2 A;  1B7T Y;  1BMO A;  1KFU L;  2K8M B;  2KHN A;  1RTP 1;  4USL A;  2M7L A;  1L2O B;  3TS5 C;  4MZK A;  3BUN B;  1J1E A;  3QRX A;  3PLF B;  1B4C A;  3RM1 A;  2LP2 A;  2JUL A;  2OPO A;  1KFX S;  1G33 A;  4AQJ A;  1B7T Z;  3RLZ A;  3CWG A;  1CM1 A;  1PSR A;  1UHK A;  2K7B A;  1A75 A;  1SRA A;  1XK4 C;  3O78 A;  1K8U A;  2EC6 B;  1DTL A;  4BY5 A;  1PK0 D;  3FS7 A;  5CSF A;  2GV5 A;  1QLS A;  4GUK A;  2KQY A;  3VRP A;  2MJW B;  1K2H A;  3A4U B;  4MZL A;  4MLW A;  2A4J A;  1WRL A;  1MQ1 A;  1C7W A;  1SY9 A;  1YUT A;  4A4B A;  3D10 A;  4D1E A;  1KQV A;  1BR4 B;  1YX8 A;  1M31 A;  3TS5 B;  3AKB A;  4MRY A;  2AMI A;  3CZT X;  5B8I B;  1WLZ A;  5JJG A;  2KQ6 A;  2F2O A;  1TRF A;  2JOJ A;  3SG6 A;  2LLU A;  1DT7 B;  2P6B B;  1BG1 A;  1DJG A;  1FPW A;  3HCM A;  1CLL A;  2HF5 A;  4YGC B;  1BLQ A;  1CDP A;  3EK4 A;  1YRU B;  2K7C A;  3BUO B;  2WOR A;  4CFR A;  1EG3 A;  1B8C A;  4NDC A;  4YGB B;  1KFU S;  1M63 B;  2Y1M A;  2ZN8 A;  3IQO A;  3O2P A;  1NUB A;  1KWO C;  1XFW O;  1BT6 A;  1LIN A;  1OQP A;  1WDC C;  2MAZ A;  2LNK A;  2B1U A;  3IQQ A;  1OMR A;  3EKH A;  1F70 A;  4FTG A;  4BY4 A;  1N0Y A;  4YBH B;  1SYM A;  1IQ5 A;  1RJV A;  1U5I A;  2I18 A;  4AOM A;  3LK0 A;  1R6P A;  1EH2 A;  1C07 A;  1XFY O;  2QAC A;  3BQ3 A;  1TTX A;  1DF0 B;  1NX1 A;  1X02 A;  3GK1 A;  1NX2 A;  1NP8 A;  3PN7 C;  3WXA A;  2KAX A;  2KOT A;  2EGD A;  1UHH A;  1CMF A;  1F71 A;  1N2D A;  2KBM A;  1KWO B;  1LXF C;  1WDC B;  2M9G A;  2LUX A;  1NX0 A;  1IQ3 A;  1XFV O;  3LL8 B;  4GGF C;  1XA5 A;  3LCP C;  1NX3 A;  2KFF A;  1TIZ A;  2FCE A;  4GNK B;  1SCM C;  1K94 A;  4Q04 A;  3KEV A;  5KTY A;  1AP4 A;  1QIV A;  4WRI A;  4JPZ B;  4YGD B;  4C0L A;  1MF8 B;  1GGW A;  2LC5 A;  3VRN A;  1AVS A;  1H8B A;  1TCF A;  1CTR A;  1CM4 A;  1IGV A;  4M2O A;  3SJS A;  3PN7 B;  2LHI A;  2Q91 A;  4YI9 A;  5G08 A;  3MSE B;  1GGZ A;  5I8N A;  5HKW A;  2LLT A;  2BE6 A;  2LMV A;  4L9M A;  3SG7 A;  1Y1A A;  1XFX O;  3I5H C;  1J7O A;  2H61 C;  3NSL A;  4ZCV A;  2JXL A;  1WRZ A;  1SCM B;  2WC8 A;  3SIB A;  4CFQ A;  1ZOT B;  2WOS A;  4N1G A;  5D69 A;  1LA3 A;  4NDD A;  3NSO A;  2HPS A;  3PSR A;  1K95 A;  4ICB A;  1CLB A;  1YVH A;  3FIA A;  2M1U A;  1KCY A;  1SNL A;  2JTZ A;  1UHJ A;  1DGU A;  4OV2 A;  2MRD A;  1AJ4 A;  2LV7 A;  3KO0 A;  4IL1 A;  1OOJ A;  3OX6 A;  1CKK A;  2L0P A;  5BPJ A;  2SCP A;  1TCO B;  3D0Y B;  3E3R A;  3KHE A;  5HLO A;  1QIW A;  2MLE C;  4OVN F;  1BOC A;  2JPT A;  3DF0 A;  5HLV A;  1K9K A;  2LMU A;  3EVR A;  1V1F A;  1SL8 A;  3EKJ A;  1HQV A;  1QS7 A;  2HET A;  4MSP A;  2BCX A;  3DVM A;  4A4C A;  3OP0 A;  1NIW A;  1CFF A;  1AHR A;  2KGB C;  1ALW A;  1QX2 A;  4ETO A;  1AUI B;  5DKN A;  2AAO A;  2M1K B;  4F0Z B;  1BOD A;  3BOW B;  2KAV A;  1F54 A;  2Y4Q A;  1YX7 A;  2LHL A;  1MXE A;  5CPV A;  1NCY A;  1Y1X A;  4MRX A;  2LMT A;  2F3Y A;  2JWW A;  4UPG A;  2JU0 A;  1WY9 A;  1NCX A;  1K9P A;  3BUX B;  2M97 A;  2WCB A;  3KF9 A;  3NSI A;  2GGM A;  5I2Q A;  1GJY A;  3DVE A;  2LCP A;  2WCE A;  4I5N B;  2OTG B;  4PE1 A;  2BBN A;  1EL4 A;  1BR1 B;  1YUS A;  3GK4 X;  2LVJ A;  2ISD A;  2CNP A;  2BKH B;  1NPQ A;  2PAL A;  4QJ4 B;  4NQG A;  4M2P A;  1DVI A;  1GQM A;  1PAL A;  3CTN A;  5HKZ A;  1CFD A;  1QX7 A;  4WQ3 A;  1WRK A;  3SG3 A;  4AQI A;  4PHM A;  1A75 B;  4ORC B;  3I5F C;  2JQ6 A;  5AEQ A;  1RWY A;  4GBA A;  1JSA A;  2CCM A;  2KDH A;  1OE9 B;  3HX4 A;  1M45 A;  2M0R A;  3ZNI A;  3IF7 A;  2L5X B;  1CDM A;  3TDU A;  1VRK A;  3WHU B;  3ZWH A;  4CPV A;  2L4H A;  2K2A A;  2KYF A;  3CLN A;  2HQW A;  1QX5 B;  4P5O E;  2VRG A;  2WND A;  4ORB B;  1B47 A;  1JFK A;  4YI8 A;  1S6J A;  2BBM A;  2BL0 C;  2F33 A;  3EK8 A;  3PAL A;  5D7F A;  1KSO A;  3SG5 A;  4ZCU A;  2CXJ A;  1BF5 A;  1QXP A;  3I5F B;  2LVK A;  2JT3 A;  2FJU B;  1FI5 A;  1SKT A;  5KSZ A;  1J7R A;  4JWQ A;  3GOF A;  2PVB A;  3DD4 A;  1SL7 A;  2JC2 A;  2QPT A;  1FI6 A;  3OX5 A;  3OB2 B;  5PAL A;  3ICB A;  3CS1 A;  1NWD A;  1QLK A;  2L98 A;  1CMG A;  1ALV A;  1G4Y R;  2PRU A;  3OHM B;  4I5J A;  1D1O A;  2FOT A;  3BUM B;  1KK7 Y;  1TNX A;  1JFJ A;  1DJY A;  1JF0 A;  1SK6 D;  2L4I A;  3NSK A;  1U5I B;  2DOQ A;  4PCW A;  1E8A A;  4N1F A;  2RGI A;  2BL0 B;  2GGZ A;  2BCB A;  3WNX B;  2I7A A;  3PM8 A;  1S6C A;  1G8I A;  1XFU O;  1DMO A;  1KK7 Z;  2I2R E;  3JVT C;  4PHN A;  2Q4U A;  2O60 A;  3FWC A;  1BU3 A;  2FCD A;  2Y1N A;  4DCK A;  1XO5 A;  4PHJ A;  1KFX L;  2M7N A;  5K89 A;  1J7P A;  1NCZ A;  1PVB A;  4M2Q A;  2K2F A;  1CB1 A;  1NSH A;  2O5G A;  3C1V A;  4HRG A;  1M46 A;  1W7I B;  2ZKM X;  3BYA A;  1OMV A;  1S5G Y;  1MWN A;  1A2X A;  2JT0 A;  5ER5 A;  2AUC A;  3OB1 B;  4HRE E;  4E68 A;  1S36 A;  2K7D A;  1B8R A;  5J3X A;  3K21 A;  2LVI A;  2L51 A;  1ZMZ A;  1K93 D;  1Y1U A;  4QJ5 B;  3TUY C;  1S5G Z;  1QVI Y;  1XVJ A;  2NCP A;  4CLN A;  1DJI A;  1H4B A;  1UUS A;  1IJ6 A;  3I5I C;  1J1D A;  3JVT B;  2JNF A;  5JOL A;  2G2B A;  1SMG A;  2BE4 A;  2R2I A;  1AJ5 A;  2M29 A;  5AFP A;  4MN0 A;  1F4O A;  3JTD C;  1B1G A;  1QVI Z;  2F2P A;  3TDI A;  2KFH A;  3SG4 A;  4QJ3 B;  4GFT A;  1EJ3 A;  2SAS A;  1YR5 A;  2OTG C;  2NLN A;  2MLF C;  1KK8 C;  2KYC A;  4MVF A;  2CTN A;  1F8H A;  1IH0 A;  3EK7 A;  2ZND A;  2JNX A;  2KI6 C;  1FW4 A;  4XJK B;  3O4Y A;  1YTZ C;  1ZUZ A;  2L2E A;  1XK4 A;  3KPX A;  2LM5 A;  2HQ8 A;  3TUY B;  2NCO A;  1V1G A;  1QV0 A;  1YVL A;  5CSN A;  3I5I B;  4TNC A;  4I5L B;  1RRO A;  4PDZ A;  5DKQ A;  1SR6 C;  1K96 A;  1L7Z A;  2D8N A;  3VRQ A;  3JTD B;  1MR8 A;  2E30 A;  1J55 A;  1YUR A;  1DJH A;  2F8P A;  1S6I A;  2F3Z A;  1UP5 A;  2KBI A;  1CFC A;  1QV1 A;  1RK9 A;  1JWD A;  1KK8 B;  3TDZ A;  1A29 A;  3PFV A;  4YRU A;  3VRR A;  1JUO A;  3CR4 X;  5IBW A;  1DJZ A;  4GPL B;  3DF0 B;  2MBX A;  4HRH A;  4XYN A;  1KSM A;  4DRW A;  1CFP A;  2H2K A;  5HYD A;  3EVU A;  1DJX A;  3FWB A;  4OCI A;  2LAP A;  2JRF A;  1NYA A;  2L50 A;  2NXQ A;  2JT8 A;  1JF2 A;  2M3W A;  1DF0 A;  4MZJ A;  4CID A;  2IS9 A;  4GAO A;  4JQ0 D;  2EHB A;  4C0K A;  3F45 A;  1HT9 A;  1TN4 A;  4FQO A;  1SW8 A;  2I94 A;  3EVV A;  1Q80 A;  3LLE A;  5I2O A;  1SR6 B;  1OZO A;  1Y0V H;  4PAL A;  2CT9 A;  2K7O A;  1XYD A;  3GK2 A;  2KI6 D;  1CDL A;  1FBV A;  1REC A;  1TNQ A;  4R1E A;  5CSI A;  1QAT A;  2KGR A;  1ODB A;  4PE7 A;  1SPY A;  3LK1 A;  5TNC A;  1QTX A;  4YGA A;  2KAY A;  1A03 A;  2LVV A;  2BKI B;  3VRO A;  2MHH A;  1ZAC A;  2LAN A;  2MA2 A;  3M0W A;  1DGV A;  2LLS A;  2CBL A;  2Y5I A;  1MUX A;  1SBJ A;  1EXR A;  2LE9 B;  1TNW A;  2M8U A;  3CR2 A;  2ZNE A;  1PVA A;  2KI4 C;  4YGE B;  4DUQ A;  3A8R A;  3I5G C;  3WHT B;  1RFJ A;  1K9U A;  3CGA A;  2LUC A;  2PMY A;  4PE0 A;  1CNP A;  1B9A A;  2COL B;  1PRW A;  3BXK A;  1K90 D;  2BCA A;  2TN4 A;  4C0J A;  1OZS A;  1C7V A;  1TNP A;  1KQM C;  2ZRT A;  4I5K A;  1M39 A;  5DKR A;  5FYX A;  1OSA A;  4GGF A;  4DS7 A;  2JTT A;  1CLM A;  3AKA A;  2OS8 C;  4ORA B;  3CR5 X;  1N65 A;  4OKH A;  4PE4 A;  1S26 D;  1R2U A;  2KFG A;  1BJF A;  3TZ1 A;  2KNE A;  1LVC D;  2K61 A;  1UUR A;  2V53 A;  4HSZ A;  4MBE A;  2KI4 B;  1F4Q A;  1S1E A;  1IKU A;  1ZFS A;  3I5G B;  1IJ5 A;  1J7Q A;  2KSP A;  1XFZ O;  1TOP A;  4N5X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...