2M8UA

Solution structure of the dictyostelium discodieum myosin light chain, mlcc
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
77
structure length
77
Chain Sequence
GSHMNHINTKAQVIEAFKVFDRDGNGYVTVDYLRKVLNELGDMMPADEIEEMIYEADPQNSGYVQYETFVGMLFLWD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Myosin Light Chain, MlcC
publication title Structure of the Single-lobe Myosin Light Chain C in Complex with the Light Chain-binding Domains of Myosin-1C Provides Insights into Divergent IQ Motif Recognition.
pubmed doi rcsb
source organism Dictyostelium discoideum
molecule tags Contractile protein
total genus 16
structure length 77
sequence length 77
ec nomenclature
pdb deposition date 2013-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2m8uA00
1WRLA 2BKIB 2HF5A 2PASA 1DJGA 2KAVA 1B4CA 1S3PA 4ORAB 5G08A 1CFFA 2QACA 2AMIA 2LM5A 1V1FA 1N2DA 2CCMA 3CGAA 2B1UA 4I5KA 3DVEA 1BT6A 1S6CA 4MZKA 2LMTA 1BJFA 1JUOA 2BECA 2HPSA 2NXQA 1K8UA 2K2AA 2ZRSA 5TNCA 1BG1A 1KFXL 2BCXA 1SCMB 2GGMA 4PE0A 1QV1A 4UPGA 2JT0A 1UHJA 2KFHA 2JC2A 1YR5A 2WCEA 1IJ5A 4OKHA 1U5IA 1K9UA 1F4QA 4Q04A 1IQ3A 1JF2A 1YX8A 2OTGC 2IS9A 1JF0A 3CTNA 1SL8A 5DKNA 2CNPA 1TOPA 1SKTA 2LC5A 5HKWA 1W7JB 5I8NA 2KHNA 2KYFA 2F3YA 2FOTA 3PATA 3LL8B 2LUCA 5JJGA 1K94A 3ZNIA 1B1GA 2SASA 1B8LA 1OZOA 1TIZA 3ICBA 1KFUS 4WRIA 3KHEA 1MWNA 3I5FC 1BMOA 3F45A 1XFZO 2I94A 2KI6D 2F8PA 1SYMA 1WLMA 1AJ5A 2MRDA 2KQ6A 4YGBB 2KDHA 1OQPA 1LA3A 1E8AA 1FW4A 1H8BA 1DJYA 3OX5A 4I5NB 1NX1A 1SK6D 2MBXA 3OP0A 2L0PA 1XFXO 3IQOA 1F8HA 1A4PA 3VRPA 3VGOA 4MLWA 2NLNA 1DT7B 2F3ZA 1M63B 3BUMB 3CR5X 1ZMZA 4P2YB 5D7FA 2H61C 2AAOA 4ZCVA 1RJVA 1TNWA 1GQMA 2I7AA 4ORBB 3BUXB 1K95A 2KI4C 2SCPA 3I5IB 4WQ3A 2L4HA 1Y1UA 2KFFA 3DF0A 2EGDA 1ALVA 1SL9A 2JNXA 2K61A 2LAPA 1DF0B 4C0JA 2L51A 5CSFA 3EKHA 1XA5A 5AFPA 1IGVA 5AERA 3KF9A 3TDZA 1DJZA 3OB1B 2KNEA 3SIAA 1N0YA 4GGFA 1JFKA 1DJHA 2NCPA 3OHMB 2M0RA 2LP3A 1EJ3A 4IL1A 3GOFA 1DGUA 1MHOA 2M9GA 2I18A 3C1VA 3LCPC 1BU3A 5AANA 1QX7A 3SIBA 2JT3A 3O4YA 1CDMA 1QLKA 4GUKA 4YGEB 1FF1A 3HCMA 4M2PA 2M97A 3BOWA 1PVAA 2LLTA 5KU1A 1TNQA 1B8RA 1ZUZA 3ZWHA 1AHRA 4DRWA 3LK0A 1N65A 3AKAA 3PALA 1WDCC 3WNXB 5DKQA 4U8DA 2BCBA 4CPVA 3TUYB 5I2QA 2K7BA 3CZTX 2M49B 2NZ0A 5CPVA 3TZ1A 3TS5B 2OS8C 2Y1MA 1Y0VH 4F0ZB 1KQMC 3JVTB 1B7TZ 1S6IA 4HSZA 4R1EA 2K2FA 3SG2A 2WOSA 4PHKA 3SG4A 3M0WA 2D8NA 1F4OA 1L2OB 1DJWA 5KSZA 2FJUB 3BUWB 4P5OE 2LCPA 4PCWA 4YRUA 1YRTB 3WHUB 1YUUA 2MHHA 2ZFDA 2ZKMX 1SNLA 3GK2A 1RK9A 2K7DA 2BE6A 4PE1A 1KFXS 1MXLC 1GJYA 3D0YA 2A4JA 3CLNA 1UHHA 4CFQA 4I5JA 2ZNEA 1B47A 1NUBA 4TNCA 2JT8A 3SG5A 3O2PA 5JOLA 2MA2A 4USLA 1QS7A 2RGIA 4NDCA 1CNPA 3HX4A 1PSRA 2M1UA 1A2XA 4C0KA 1SR6C 3A8RA 1KWOC 1KK8B 2LANA 4YI8A 2FCEA 3I5HC 1BLQA 4GBAA 2HQWA 3NSKA 5I2OA 1PSBA 1G4YR 1CDPA 1VRKA 2H61A 1U5IB 4DS7A 1F54A 3EK7A 1KQVA 1CM1A 1SCVA 2PSRA 5ER5A 1JC2A 4GAOA 2WC8A 2LV7A 2EC6B 3JTDB 1G33A 2ZN8A 1L7ZA 1MR8A 1QTXA 5HKYA 1ODBA 1W7IB 1J7PA 5F6TA 1RWYA 1XYDA 3SJSA 2ISDA 4QJ4B 3IQQA 2M8UA 3I5GB 1B8CA 5ER4X 2PALA 3VRQA 1YUTA 2KAYA 5I2LA 1K9PA 2M1KB 1MF8B 1XVJA 1CLMA 1K96A 2JPTA 1IRJA 3EKJA 1Q80A 1B9AA 5B8IB 1K9KA 1YVHA 2LLUA 2Y4QA 1NSHA 3E3RA 1EG4A 4MN0A 4PDZA 5DKRA 1K2HA 5D69A 2LMVA 4MVFA 4GNKB 1YTZC 4XJKA 4GFTA 1SCMC 1TRFA 2WNDA 2L4IA 1NWDA 1YUSA 1AP4A 1JSAA 1KK7Y 1DMOA 1QASA 2L98A 1JWDA 3TDIA 1QIVA 3DVJA 1KK7Z 1AJ4A 2BL0B 4PHMA 3PFVA 4NQGA 1CKKA 2PRUA 1FI6A 1OZSA 2CTNA 5PALA 2LP2A 2O5GA 4ZCUA 3SG7A 4HREE 1GGWA 3FWBA 3DVMA 4AOMA 2E30A 1PALA 2JQ6A 3DF0B 5GQQC 3PN7B 1ZOTB 4JWQA 1UUSA 1SL7A 1EL4A 1NPQA 3NXAA 2OPOA 3RM1A 1DVIA 4AQIA 1EG3A 4M2QA 3KPXA 2M3WA 2LUXA 2JXLA 4MZJA 4PHJA 1J7OA 1HQVA 4D1EA 1M39A 1A75A 2MAZA 2NCOA 1NX0A 2K7OA 3D10A 4ORCB 3SG3A 3KO0A 1F71A 1OMDA 1BOCA 2COLB 3IF7A 4N5XA 4NDDA 2MLEC 2L5XB 5CSJA 4QJ5B 3NSLA 1TCOB 2CT9A 1M45A 3WXAA 1X02A 2JTZA 3BXKA 1NX3A 2DOQA 2EHBA 2JOJA 1CLLA 3TDUA 1PVBA 3BOWB 1Y1AA 3A4UB 1HT9A 3QRXA 3CWGA 1S26D 3NSOA 4ETOA 2JXCA 2KGBC 4MSPA 1LKJA 4OVNF 1WRZA 1FPWA 2R2IA 3CR4X 3LK1A 3I5IC 3VRNA 1XFUO 1KCYA 3FWCA 1C7WA 2OTGB 1TCFA 2Q91A 2K0JA 1S1EA 1FI5A 2K8MB 2JWWA 3O78A 1MXEA 1RTP1 1IWQA 1S5GY 1WRKA 4CIDA 1OMRA 1DJIA 2Q4UA 1ZACA 1QX5B 2JULA 2LMUA 4PE7A 5HYDA 1CLBA 2JNFA 4N1FA 3EVVA 1PK0D 4FQOA 1CTRA 1J1DA 1K90D 3I5FB 1XFVO 3OX6A 2M7LA 2KAXA 2MLFC 1UHNA 4JQ0D 1ALWA 5K89A 3WHTB 1OSAA 1UHIA 2HQ8A 2F2PA 1MQ1A 4OR9B 4YI9A 1YRUB 2V53A 2CBLA 1PRWA 2LLSA 3BUOB 1AVSA 2BKHB 2AUCA 2KQYA 4MBEA 1XFWO 2M7NA 2G9BA 3LLEA 1OOJA 2LVJA 1NCYA 3TUYC 4MRXA 4NDBA 1CDLA 1LA0A 3EVRA 1QV0A 3BYAA 1BR4B 1ZFSA 3TS5C 4DUQA 3PLFB 2KI4B 3K21A 1SRAA 1EH2A 1XK4C 2CXJA 4L9MA 5IBWA 1WY9A 3JVTC 4GGNA 4BY4A 2KI6C 2L2EA 5FYXA 2JZIA 2HETA 3DVKA 1CFDA 2LVVA 1SY9A 1Y1XA 1BF5A 1L2OC 1SMGA 2E6WA 1Y6WA 4YGAA 4YGCB 4N1GA 1NYAA 1LINA 2LE9B 1SBJA 1UHKA 4DIRA 3O6BA 1CDNA 3BQ3A 1OE9B 1G8IA 1JFJA 1NCXA 1V1GA 2JTTA 1TNXA 2ZRTA 1A29A 1SW8A 1DGVA 1DJXA 1SPYA 3KEVA 2WORA 3EK8A 2L50A 3FS7A 1UP5A 1J7QA 1NX2A 1M31A 1NIWA 1TNPA 4PALA 1JBAA 1YX7A 1KFUL 4PE4A 1PULA 4CLNA 1WLZA 2KYCA 4XJKB 1DTLA 1KK8C 5J3XA 2KGRA 3BUNB 3PSRA 4A4BA 4DCKA 1CM4A 1WDCB 4FTGA 3SG6A 1KSOA 2LVKA 1IQ5A 1J7RA 1BODA 5HLOA 3VRRA 4OV2A 1QVIY 4C0LA 5CSIA 4HRHA 2OS8B 2BE4A 1K93D 2P6BB 3VROA 1QVIZ 1LVCD 2EC6C 2ZNDA 3GK1A 3JTDC 5AEQA 2H2KA 1KQMB 1TN4A 2VRGA 1DF0A 4MRYA 1QIWA 2KFGA 1CFPA 1IJ6A 3DD4A 1CMFA 2LHIA 1UURA 5BPJA 5HLVA 2I2RE 2O60A 3H4SE 2KBIA 3CS1A 4MEWA 1C7VA 3I5GC 4BY5A 1S36A 2F2OA 2BCAA 1A75B 2GV5A 5CSNA 3FIAA 4AQJA 2KOTA 2TN4A 3GK4X 2LVIA 3EK4A 2WCBA 1C07A 2FCDA 1IG5A 1NCZA 3MSEB 4JPZB 4QJ3B 4YGDB 1R2UA 2K7CA 3PM8A 4XYNA 1CB1A 3CR2A 2BBMA 1XFYO 1F55A 4M2OA 2GGZA 1IKUA 4HRGA 4YBHB 1D1OA 2BBNA 3AAKA 1QX2A 4I5LB 4PHNA 1RROA 1RFJA 1KWOB 1SR6B 5HKZA 1AUIB 3EVUA 1UWOA 3AKBA 1QJTA 2JU0A 2G2BA 4OCIA 2JRFA 1QLSA 3I5HB 1GGZA 1H4BA 1QATA 2BL0C 5AXIA 1R6PA 1QXPA 4CFRA 1CFCA 4A4CA 2MJWB 1M46A 5KTYA 2LHLA 1TTXA 1S5GZ 2LNKA 1BR1B 2PVBA 1XK4A 4ICBA 3PN7C 1FBVA 3OB2B 1YURA 2QPTA 3RLZA 1RECA 1EXRA 2Y5IA 2WCFA 2KBMA 4E68A 1LXFC 1KSMA 1B7TY 1F70A 1S6JA 3NSIA 4GPLB 1J55A 3AAJA 1OMVA 4GGFC 4MZLA 3D0YB 4WQ2A 1AK8A 1J1EA 2ZN9A 1IH0A 1MUXA 2M29A 2PMYA 1XO5A 1YVLA 1A03A 2F33A 1CMGA 1NP8A 2Y1NA 2KSPA
chains in the Genus database with same CATH superfamily
1WRLA 2BKIB 2HF5A 2PASA 1DJGA 2KAVA 1B4CA 1S3PA 4ORAB 5G08A 1CFFA 2BNXA 2QACA 2AMIA 1OOIX 2LM5A 1V1FA 1N2DA 2CCMA 3CGAA 2B1UA 4I5KA 3DVEA 1BT6A 1S6CA 4MZKA 2LMTA 1BJFA 1JUOA 2BECA 2HPSA 2NXQA 1K8UA 2K2AA 2ZRSA 5TNCA 3FE9A 1KFXL 2BCXA 1SCMB 2GGMA 4PE0A 1QV1A 4UPGA 2JT0A 1UHJA 2KFHA 2JC2A 3BJHA 1YR5A 2WCEA 1IJ5A 4OKHA 1U5IA 1K9UA 1F4QA 4Q04A 1IQ3A 1JF2A 1YX8A 3S0BA 2OTGC 2IS9A 1JF0A 3CTNA 1SL8A 5DKNA 2CNPA 1TOPA 1SKTA 3DZTA 2LC5A 5HKWA 1W7JB 5I8NA 2KHNA 2KYFA 2F3YA 2FOTA 3PATA 3LL8B 2LUCA 5JJGA 1K94A 3ZNIA 1B1GA 2SASA 1B8LA 1OZOA 1TIZA 3ICBA 1KFUS 4WRIA 3KHEA 1MWNA 3I5FC 1BMOA 3F45A 1XFZO 2I94A 2KI6D 2WCMA 3B88A 2WC6A 2F8PA 1SYMA 1OOGA 1WLMA 1AJ5A 2MRDA 2KQ6A 4YGBB 2KDHA 1OQPA 1LA3A 1E8AA 1FW4A 1H8BA 1DJYA 3OX5A 4I5NB 1NX1A 1SK6D 2MBXA 3OP0A 2L0PA 1XFXO 3IQOA 1F8HA 1A4PA 3VRPA 3VGOA 1TUJA 4MLWA 2NLNA 1TUZA 1DT7B 2F3ZA 1M63B 3BUMB 3CR5X 1ZMZA 4P2YB 5D7FA 2H61C 2AAOA 4ZCVA 3S0EA 1RJVA 1TNWA 1GQMA 2I7AA 4ORBB 3BUXB 1K95A 2KI4C 2SCPA 2QDIA 3I5IB 4WQ3A 2L4HA 1Y1UA 2KFFA 3DF0A 2EGDA 1ALVA 1SL9A 2JNXA 2K61A 2LAPA 1DF0B 4C0JA 2L51A 5CSFA 3EKHA 1XA5A 5AFPA 1IGVA 5AERA 3KF9A 3TDZA 1DJZA 2H8VA 1OOHA 3OB1B 2KNEA 3SIAA 3L4LA 1N0YA 4GGFA 1JFKA 1DJHA 2NCPA 3OHMB 2M0RA 3SS4A 1DQEA 1EJ3A 2LP3A 4IL1A 3GOFA 2QEBA 1DGUA 1MHOA 2M9GA 2I18A 3C1VA 3LCPC 3B86A 1BU3A 5AANA 1QX7A 3N7HA 3SIBA 2JT3A 3O4YA 1CDMA 1QLKA 4GUKA 4YGEB 1FF1A 3HCMA 4M2PA 3VB1A 2M97A 5FI2A 3BOWA 1PVAA 2LLTA 5KU1A 4INWA 1TNQA 1B8RA 1ZUZA 3ZWHA 1AHRA 1C3YA 3CZ1A 3LK0A 4DRWA 1N65A 3AKAA 3PALA 1WDCC 3R1OA 3WNXB 5DKQA 4U8DA 2BCBA 4CPVA 3TUYB 5I2QA 1OOFA 2KPHA 3L4AA 2K7BA 3CZTX 2M49B 2NZ0A 5CPVA 3TZ1A 3B7AA 2OS8C 3TS5B 2Y1MA 5EL2A 1Y0VH 4F0ZB 1KQMC 3JVTB 1B7TZ 1S6IA 4HSZA 4R1EA 2K2FA 3SG2A 2QEVA 2WOSA 4PHKA 3M0WA 2L5YA 3SG4A 2D8NA 1F4OA 1L2OB 1DJWA 5KSZA 2FJUB 3BUWB 4P5OE 2LCPA 4PCWA 4YRUA 1YRTB 3DY9A 3WHUB 1YUUA 2MHHA 2PYQA 2ZFDA 2ZKMX 1BG1A 1SNLA 3GK2A 1RK9A 2K7DA 2BE6A 3NHIA 4PE1A 1KFXS 1MXLC 1GJYA 3D0YA 2A4JA 3CLNA 1UHHA 3D76A 4CFQA 4I5JA 2ZNEA 1B47A 1DC1A 1NUBA 4TNCA 2JT8A 3SG5A 2WCKA 3O2PA 5JOLA 1GM0A 2MA2A 4USLA 3S0DA 1QS7A 2RGIA 4NDCA 1CNPA 3HX4A 1PSRA 2M1UA 1A2XA 4C0KA 1SR6C 1W9ZA 1KWOC 3A8RA 3CZ0A 1KK8B 3CYZA 2LANA 3CABA 3FE6A 4YI8A 2FCEA 3I5HC 1BLQA 4GBAA 2HQWA 3NSKA 5I2OA 1PSBA 1G4YR 1CDPA 1VRKA 2H61A 1U5IB 3V2LA 4DS7A 5HL1A 1F54A 3EK7A 1KQVA 1CM1A 1SCVA 1TWOA 2PSRA 5ER5A 1JC2A 3NGVA 4GAOA 2WC8A 2LV7A 2EC6B 3JTDB 1G33A 2GTEA 2ZN8A 3OGNA 3SS3A 1L7ZA 1MR8A 1QTXA 3DYEA 5HKYA 1ODBA 1W7IB 1J7PA 5F6TA 1RWYA 1XYDA 3SJSA 2ISDA 4QJ4B 3IQQA 2M8UA 3I5GB 1B8CA 5ER4X 2ERBA 2PALA 3VRQA 1YUTA 2KAYA 5I2LA 1K9PA 2M1KB 1MF8B 1XVJA 1CLMA 1K96A 2JPTA 1IRJA 3EKJA 1Q80A 1B9AA 2YGUA 1K9KA 1YVHA 4OZDA 5B8IB 2LLUA 2Y4QA 1NSHA 3E3RA 1EG4A 4MN0A 4PDZA 5DKRA 1K2HA 5D69A 2LMVA 4MVFA 4GNKB 1YTZC 4KYNA 4XJKA 4GFTA 1SCMC 1TRFA 2WNDA 2L4IA 1NWDA 1YUSA 1AP4A 3UO9A 1KK7Y 1DMOA 1QASA 2L98A 3R72A 1JSAA 3TDIA 1JWDA 1QIVA 3DVJA 2KLEA 1IIOA 2WCLA 1KK7Z 1AJ4A 2BL0B 4PHMA 3PFVA 4NQGA 1CKKA 2PRUA 1FI6A 1OZSA 2CTNA 5PALA 2LP2A 2O5GA 4ZCUA 3SG7A 4HREE 1GGWA 3FWBA 3DVMA 4JD9A 2E30A 1PALA 2JQ6A 3DF0B 5GQQC 4AOMA 3PN7B 1ZOTB 4JWQA 1UUSA 1SL7A 2QEHA 4PT1A 1EL4A 1P28A 1NPQA 3DXLA 2OPOA 3NXAA 3RM1A 1DVIA 4AQIA 1EG3A 4M2QA 3KPXA 2M3WA 2LUXA 2JXLA 4MZJA 4PHJA 1J7OA 1HQVA 4D1EA 2K60A 1M39A 1A75A 2MAZA 2NCOA 1NX0A 2K7OA 2L2CA 3D10A 4ORCB 3KO0A 3SG3A 1F71A 1OMDA 3NHTA 1DEKA 1BOCA 2COLB 3IF7A 4N5XA 4NDDA 5FI6A 4F7FA 1OW4A 2L5XB 2MLEC 5CSJA 4QJ5B 3CZ2A 3NSLA 1TCOB 2CT9A 1M45A 3WXAA 1X02A 2JTZA 3BXKA 3PM2A 1NX3A 2DOQA 2EHBA 2JOJA 1CLLA 3TDUA 1PVBA 3BOWB 1Y1AA 3A4UB 1HT9A 3QRXA 3CWGA 3CDNA 3R1PA 1S26D 3BFHA 3NSOA 2JXCA 2KGBC 4ETOA 4MSPA 2WCJA 1LKJA 4OVNF 1WRZA 1FPWA 2R2IA 3CR4X 3LK1A 3I5IC 3VRNA 1XFUO 1KCYA 3FWCA 1C7WA 2OTGB 1TCFA 2Q91A 2K0JA 1S1EA 1FI5A 2K8MB 2JWWA 3O78A 1MXEA 1RTP1 1WRKA 1IWQA 1S5GY 3IVTA 4CIDA 1C3ZA 1OMRA 3PJIA 1DJIA 2Q4UA 1ZACA 1QX5B 2JULA 2LMUA 4PE7A 5HYDA 1CLBA 2JNFA 4N1FA 3EVVA 5I94A 1PK0D 3BFBA 4FQOA 1CTRA 1J1DA 1K90D 3D74A 1DELA 3D77A 3I5FB 1XFVO 2P71A 3EG5B 3OX6A 1T14A 3S0FA 3K1EA 2M7LA 2KAXA 2MLFC 1UHNA 4JQ0D 3UNWA 1ALWA 5K89A 2KLDA 1OSAA 3WHTB 1UHIA 5DICA 2HQ8A 2F2PA 1MQ1A 4OR9B 4YI9A 1YRUB 2V53A 2CBLA 1PRWA 1ORGA 2LLSA 3BUOB 1AVSA 2BKHB 2AUCA 2KQYA 4MBEA 2P70A 1XFWO 2M7NA 2G9BA 3LLEA 1OOJA 2LVJA 1NCYA 3TUYC 4MRXA 4NDBA 1CDLA 1LA0A 3EVRA 1QV0A 3BYAA 1BR4B 1Z4HA 1ZFSA 3TS5C 4DUQA 3PLFB 3Q8IA 2KI4B 3K21A 1SRAA 1EH2A 1XK4C 2CXJA 3B87A 4L9MA 5IBWA 1WY9A 3JVTC 4GGNA 4BY4A 2KI6C 2BAPA 2L2EA 3QMEA 2JZIA 5FYXA 2HETA 3DVKA 1CFDA 2LVVA 1SY9A 1Y1XA 1BF5A 1L2OC 1SMGA 2E6WA 1Y6WA 4YGAA 4YGCB 4N1GA 1NYAA 5FI7A 1LINA 2LE9B 3S0AA 1SBJA 1UHKA 3FE8A 4DIRA 3O6BA 1CDNA 3BQ3A 1OE9B 1G8IA 1JFJA 1NCXA 1V1GA 2JTTA 2QEOA 1TNXA 2ZRTA 2WC5A 1A29A 1SW8A 1DGVA 1DJXA 1SPYA 3KEVA 2WORA 3EK8A 2L50A 3FS7A 1UP5A 1J7QA 1NX2A 1M31A 1NIWA 1TNPA 4PALA 1JBAA 1YX7A 1KFUL 4PE4A 1PULA 4CLNA 1WLZA 2KYCA 4XJKB 1DTLA 1KK8C 5J3XA 2KGRA 3BUNB 3O4XA 3PSRA 4A4BA 3S0GA 4DCKA 1CM4A 1WDCB 4FTGA 3SG6A 1KSOA 2LVKA 1IQ5A 1J7RA 1BODA 5HLOA 3VRRA 4OV2A 1QVIY 4C0LA 5CSIA 4HRHA 2OS8B 2BE4A 1K93D 3OBVA 4JKTA 2P6BB 3VROA 1QVIZ 3L47A 1LVCD 2JPOA 1Z2CB 2EC6C 2ZNDA 3GK1A 3JTDC 2H2KA 1KQMB 1TN4A 5AEQA 2VRGA 5D3OA 1DF0A 4MRYA 1QIWA 2KFGA 4INXA 1CFPA 1IJ6A 2WCHA 3DD4A 1CMFA 2LHIA 1UURA 5BPJA 5HLVA 2I2RE 2O60A 1XFRA 2KBIA 3CS1A 3H4SE 4MEWA 1C7VA 3I5GC 4BY5A 1S36A 2F2OA 1A75B 2BCAA 2GV5A 5CSNA 3D78A 3FIAA 3D75A 4AQJA 2KOTA 2TN4A 3GK4X 2LVIA 3EK4A 3D73A 2WCBA 3SS5A 2FCDA 1IG5A 1NCZA 3MSEB 4JPZB 4QJ3B 4YGDB 1C07A 1R2UA 2K7CA 3PM8A 4XYNA 1CB1A 3CR2A 2BBMA 3R1VA 1XFYO 1F55A 4M2OA 2FJYA 2GGZA 1IKUA 4HRGA 4YBHB 1D1OA 2BBNA 3AAKA 1QX2A 1LS8A 4I5LB 4PHNA 1RROA 1RFJA 1KWOB 1SR6B 5HKZA 1AUIB 3EVUA 1UWOA 3AKBA 4FQTA 1QJTA 2JU0A 2G2BA 4OCIA 2JRFA 1QLSA 3B6XA 3I5HB 1GGZA 3BFAA 1QATA 1H4BA 2BL0C 5AXIA 1R6PA 1QXPA 4CFRA 4IJ7A 4A4CA 1CFCA 2MJWB 1M46A 5KTYA 2LHLA 1QWVA 1TTXA 1S5GZ 2LNKA 1BR1B 2PVBA 1XK4A 4ICBA 3PN7C 1FBVA 3OB2B 1YURA 2QPTA 3RLZA 1RECA 1EXRA 2Y5IA 2WCFA 2KBMA 4E68A 1LXFC 1KSMA 1B7TY 1SSEB 1F70A 2PQLA 1S6JA 3NSIA 4GPLB 1J55A 3AAJA 1OMVA 4GGFC 4MZLA 3D0YB 4WQ2A 1AK8A 1J1EA 2ZN9A 1IH0A 1MUXA 2M29A 2PMYA 1XO5A 1YVLA 1A03A 3RZSA 2F33A 1CMGA 1NP8A 2Y1NA 2KSPA
chains in the Genus database with same CATH topology
1WRLA 2BKIB 2HF5A 2PASA 1DJGA 2KAVA 1B4CA 1S3PA 4ORAB 5G08A 1CFFA 2QACA 2AMIA 2LM5A 1V1FA 1N2DA 2CCMA 3CGAA 2B1UA 4I5KA 3DVEA 1BT6A 1S6CA 4MZKA 2LMTA 1BJFA 1JUOA 2BECA 2HPSA 2NXQA 1K8UA 2K2AA 2ZRSA 5TNCA 1BG1A 1KFXL 2BCXA 1SCMB 2GGMA 4PE0A 1QV1A 4UPGA 2JT0A 1UHJA 2KFHA 2JC2A 1YR5A 2WCEA 1IJ5A 4OKHA 1U5IA 1K9UA 1F4QA 4Q04A 1IQ3A 1JF2A 1YX8A 2OTGC 2IS9A 1JF0A 3CTNA 1SL8A 5DKNA 2CNPA 1TOPA 1SKTA 2LC5A 5HKWA 1W7JB 5I8NA 2KHNA 2KYFA 2F3YA 2FOTA 3PATA 3LL8B 2LUCA 5JJGA 1K94A 3ZNIA 1B1GA 2SASA 1B8LA 1OZOA 1TIZA 3ICBA 1KFUS 4WRIA 3KHEA 1MWNA 3I5FC 1BMOA 3F45A 1XFZO 2I94A 2KI6D 2F8PA 1SYMA 1WLMA 1AJ5A 2MRDA 2KQ6A 4YGBB 2KDHA 1OQPA 1LA3A 1E8AA 1FW4A 1H8BA 1DJYA 3OX5A 4I5NB 1NX1A 1SK6D 2MBXA 3OP0A 2L0PA 1XFXO 3IQOA 1F8HA 1A4PA 3VRPA 3VGOA 4MLWA 2NLNA 1DT7B 2F3ZA 1M63B 3BUMB 3CR5X 1ZMZA 4P2YB 5D7FA 2H61C 2AAOA 4ZCVA 1RJVA 1TNWA 1GQMA 2I7AA 4ORBB 3BUXB 1K95A 2KI4C 2SCPA 3I5IB 4WQ3A 2L4HA 1Y1UA 2KFFA 3DF0A 2EGDA 1ALVA 1SL9A 2JNXA 2K61A 2LAPA 1DF0B 4C0JA 2L51A 5CSFA 3EKHA 1XA5A 5AFPA 1IGVA 5AERA 3KF9A 3TDZA 1DJZA 3OB1B 2KNEA 3SIAA 1N0YA 4GGFA 1JFKA 1DJHA 2NCPA 3OHMB 2M0RA 2LP3A 1EJ3A 4IL1A 3GOFA 1DGUA 1MHOA 2M9GA 2I18A 3C1VA 3LCPC 1BU3A 5AANA 1QX7A 3SIBA 2JT3A 3O4YA 1CDMA 1QLKA 4GUKA 4YGEB 1FF1A 3HCMA 4M2PA 2M97A 3BOWA 1PVAA 2LLTA 5KU1A 1TNQA 1B8RA 1ZUZA 3ZWHA 1AHRA 4DRWA 3LK0A 1N65A 3AKAA 3PALA 1WDCC 3WNXB 5DKQA 4U8DA 2BCBA 4CPVA 3TUYB 5I2QA 2K7BA 3CZTX 2M49B 2NZ0A 5CPVA 3TZ1A 3TS5B 2OS8C 2Y1MA 1Y0VH 4F0ZB 1KQMC 3JVTB 1B7TZ 1S6IA 4HSZA 4R1EA 2K2FA 3SG2A 2WOSA 4PHKA 3SG4A 3M0WA 2D8NA 1F4OA 1L2OB 1DJWA 5KSZA 2FJUB 3BUWB 4P5OE 2LCPA 4PCWA 4YRUA 1YRTB 3WHUB 1YUUA 2MHHA 2ZFDA 2ZKMX 1SNLA 3GK2A 1RK9A 2K7DA 2BE6A 4PE1A 1KFXS 1MXLC 1GJYA 3D0YA 2A4JA 3CLNA 1UHHA 4CFQA 4I5JA 2ZNEA 1B47A 1NUBA 4TNCA 2JT8A 3SG5A 3O2PA 5JOLA 2MA2A 4USLA 1QS7A 2RGIA 4NDCA 1CNPA 3HX4A 1PSRA 2M1UA 1A2XA 4C0KA 1SR6C 3A8RA 1KWOC 1KK8B 2LANA 4YI8A 2FCEA 3I5HC 1BLQA 4GBAA 2HQWA 3NSKA 5I2OA 1PSBA 1G4YR 1CDPA 1VRKA 2H61A 1U5IB 4DS7A 1F54A 3EK7A 1KQVA 1CM1A 1SCVA 2PSRA 5ER5A 1JC2A 4GAOA 2WC8A 2LV7A 2EC6B 3JTDB 1G33A 2ZN8A 1L7ZA 1MR8A 1QTXA 5HKYA 1ODBA 1W7IB 1J7PA 5F6TA 1RWYA 1XYDA 3SJSA 2ISDA 4QJ4B 3IQQA 2M8UA 3I5GB 1B8CA 5ER4X 2PALA 3VRQA 1YUTA 2KAYA 5I2LA 1K9PA 2M1KB 1MF8B 1XVJA 1CLMA 1K96A 2JPTA 1IRJA 3EKJA 1Q80A 1B9AA 5B8IB 1K9KA 1YVHA 2LLUA 2Y4QA 1NSHA 3E3RA 1EG4A 4MN0A 4PDZA 5DKRA 1K2HA 5D69A 2LMVA 4MVFA 4GNKB 1YTZC 4XJKA 4GFTA 1SCMC 1TRFA 2WNDA 2L4IA 1NWDA 1YUSA 1AP4A 1JSAA 1KK7Y 1DMOA 1QASA 2L98A 1JWDA 3TDIA 1QIVA 3DVJA 1KK7Z 1AJ4A 2BL0B 4PHMA 3PFVA 4NQGA 1CKKA 2PRUA 1FI6A 1OZSA 2CTNA 5PALA 2LP2A 2O5GA 4ZCUA 3SG7A 4HREE 1GGWA 3FWBA 3DVMA 4AOMA 2E30A 1PALA 2JQ6A 3DF0B 5GQQC 3PN7B 1ZOTB 4JWQA 1UUSA 1SL7A 1EL4A 1NPQA 3NXAA 2OPOA 3RM1A 1DVIA 4AQIA 1EG3A 4M2QA 3KPXA 2M3WA 2LUXA 2JXLA 4MZJA 4PHJA 1J7OA 1HQVA 4D1EA 1M39A 1A75A 2MAZA 2NCOA 1NX0A 2K7OA 3D10A 4ORCB 3SG3A 3KO0A 1F71A 1OMDA 1BOCA 2COLB 3IF7A 4N5XA 4NDDA 2MLEC 2L5XB 5CSJA 4QJ5B 3NSLA 1TCOB 2CT9A 1M45A 3WXAA 1X02A 2JTZA 3BXKA 1NX3A 2DOQA 2EHBA 2JOJA 1CLLA 3TDUA 1PVBA 3BOWB 1Y1AA 3A4UB 1HT9A 3QRXA 3CWGA 1S26D 3NSOA 4ETOA 2JXCA 2KGBC 4MSPA 1LKJA 4OVNF 1WRZA 1FPWA 2R2IA 3CR4X 3LK1A 3I5IC 3VRNA 1XFUO 1KCYA 3FWCA 1C7WA 2OTGB 1TCFA 2Q91A 2K0JA 1S1EA 1FI5A 2K8MB 2JWWA 3O78A 1MXEA 1RTP1 1IWQA 1S5GY 1WRKA 4CIDA 1OMRA 1DJIA 2Q4UA 1ZACA 1QX5B 2JULA 2LMUA 4PE7A 5HYDA 1CLBA 2JNFA 4N1FA 3EVVA 1PK0D 4FQOA 1CTRA 1J1DA 1K90D 3I5FB 1XFVO 3OX6A 2M7LA 2KAXA 2MLFC 1UHNA 4JQ0D 1ALWA 5K89A 3WHTB 1OSAA 1UHIA 2HQ8A 2F2PA 1MQ1A 4OR9B 4YI9A 1YRUB 2V53A 2CBLA 1PRWA 2LLSA 3BUOB 1AVSA 2BKHB 2AUCA 2KQYA 4MBEA 1XFWO 2M7NA 2G9BA 3LLEA 1OOJA 2LVJA 1NCYA 3TUYC 4MRXA 4NDBA 1CDLA 1LA0A 3EVRA 1QV0A 3BYAA 1BR4B 1ZFSA 3TS5C 4DUQA 3PLFB 2KI4B 3K21A 1SRAA 1EH2A 1XK4C 2CXJA 4L9MA 5IBWA 1WY9A 3JVTC 4GGNA 4BY4A 2KI6C 2L2EA 5FYXA 2JZIA 2HETA 3DVKA 1CFDA 2LVVA 1SY9A 1Y1XA 1BF5A 1L2OC 1SMGA 2E6WA 1Y6WA 4YGAA 4YGCB 4N1GA 1NYAA 1LINA 2LE9B 1SBJA 1UHKA 4DIRA 3O6BA 1CDNA 3BQ3A 1OE9B 1G8IA 1JFJA 1NCXA 1V1GA 2JTTA 1TNXA 2ZRTA 1A29A 1SW8A 1DGVA 1DJXA 1SPYA 3KEVA 2WORA 3EK8A 2L50A 3FS7A 1UP5A 1J7QA 1NX2A 1M31A 1NIWA 1TNPA 4PALA 1JBAA 1YX7A 1KFUL 4PE4A 1PULA 4CLNA 1WLZA 2KYCA 4XJKB 1DTLA 1KK8C 5J3XA 2KGRA 3BUNB 3PSRA 4A4BA 4DCKA 1CM4A 1WDCB 4FTGA 3SG6A 1KSOA 2LVKA 1IQ5A 1J7RA 1BODA 5HLOA 3VRRA 4OV2A 1QVIY 4C0LA 5CSIA 4HRHA 2OS8B 2BE4A 1K93D 2P6BB 3VROA 1QVIZ 1LVCD 2EC6C 2ZNDA 3GK1A 3JTDC 5AEQA 2H2KA 1KQMB 1TN4A 2VRGA 1DF0A 4MRYA 1QIWA 2KFGA 1CFPA 1IJ6A 3DD4A 1CMFA 2LHIA 1UURA 5BPJA 5HLVA 2I2RE 2O60A 3H4SE 2KBIA 3CS1A 4MEWA 1C7VA 3I5GC 4BY5A 1S36A 2F2OA 2BCAA 1A75B 2GV5A 5CSNA 3FIAA 4AQJA 2KOTA 2TN4A 3GK4X 2LVIA 3EK4A 2WCBA 1C07A 2FCDA 1IG5A 1NCZA 3MSEB 4JPZB 4QJ3B 4YGDB 1R2UA 2K7CA 3PM8A 4XYNA 1CB1A 3CR2A 2BBMA 1XFYO 1F55A 4M2OA 2GGZA 1IKUA 4HRGA 4YBHB 1D1OA 2BBNA 3AAKA 1QX2A 4I5LB 4PHNA 1RROA 1RFJA 1KWOB 1SR6B 5HKZA 1AUIB 3EVUA 1UWOA 3AKBA 1QJTA 2JU0A 2G2BA 4OCIA 2JRFA 1QLSA 3I5HB 1GGZA 1H4BA 1QATA 2BL0C 5AXIA 1R6PA 1QXPA 4CFRA 1CFCA 4A4CA 2MJWB 1M46A 5KTYA 2LHLA 1TTXA 1S5GZ 2LNKA 1BR1B 2PVBA 1XK4A 4ICBA 3PN7C 1FBVA 3OB2B 1YURA 2QPTA 3RLZA 1RECA 1EXRA 2Y5IA 2WCFA 2KBMA 4E68A 1LXFC 1KSMA 1B7TY 1F70A 1S6JA 3NSIA 4GPLB 1J55A 3AAJA 1OMVA 4GGFC 4MZLA 3D0YB 4WQ2A 1AK8A 1J1EA 2ZN9A 1IH0A 1MUXA 2M29A 2PMYA 1XO5A 1YVLA 1A03A 2F33A 1CMGA 1NP8A 2Y1NA 2KSPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WRL A;  2BKI B;  2HF5 A;  2PAS A;  1DJG A;  2KAV A;  1B4C A;  1S3P A;  4ORA B;  5G08 A;  1CFF A;  2QAC A;  2AMI A;  2LM5 A;  1V1F A;  1N2D A;  2CCM A;  3CGA A;  2B1U A;  4I5K A;  3DVE A;  1BT6 A;  1S6C A;  4MZK A;  2LMT A;  1BJF A;  1JUO A;  2BEC A;  2HPS A;  2NXQ A;  1K8U A;  2K2A A;  2ZRS A;  5TNC A;  1BG1 A;  1KFX L;  2BCX A;  1SCM B;  2GGM A;  4PE0 A;  1QV1 A;  4UPG A;  2JT0 A;  1UHJ A;  2KFH A;  2JC2 A;  1YR5 A;  2WCE A;  1IJ5 A;  4OKH A;  1U5I A;  1K9U A;  1F4Q A;  4Q04 A;  1IQ3 A;  1JF2 A;  1YX8 A;  2OTG C;  2IS9 A;  1JF0 A;  3CTN A;  1SL8 A;  5DKN A;  2CNP A;  1TOP A;  1SKT A;  2LC5 A;  5HKW A;  1W7J B;  5I8N A;  2KHN A;  2KYF A;  2F3Y A;  2FOT A;  3PAT A;  3LL8 B;  2LUC A;  5JJG A;  1K94 A;  3ZNI A;  1B1G A;  2SAS A;  1B8L A;  1OZO A;  1TIZ A;  3ICB A;  1KFU S;  4WRI A;  3KHE A;  1MWN A;  3I5F C;  1BMO A;  3F45 A;  1XFZ O;  2I94 A;  2KI6 D;  2F8P A;  1SYM A;  1WLM A;  1AJ5 A;  2MRD A;  2KQ6 A;  4YGB B;  2KDH A;  1OQP A;  1LA3 A;  1E8A A;  1FW4 A;  1H8B A;  1DJY A;  3OX5 A;  4I5N B;  1NX1 A;  1SK6 D;  2MBX A;  3OP0 A;  2L0P A;  1XFX O;  3IQO A;  1F8H A;  1A4P A;  3VRP A;  3VGO A;  4MLW A;  2NLN A;  1DT7 B;  2F3Z A;  1M63 B;  3BUM B;  3CR5 X;  1ZMZ A;  4P2Y B;  5D7F A;  2H61 C;  2AAO A;  4ZCV A;  1RJV A;  1TNW A;  1GQM A;  2I7A A;  4ORB B;  3BUX B;  1K95 A;  2KI4 C;  2SCP A;  3I5I B;  4WQ3 A;  2L4H A;  1Y1U A;  2KFF A;  3DF0 A;  2EGD A;  1ALV A;  1SL9 A;  2JNX A;  2K61 A;  2LAP A;  1DF0 B;  4C0J A;  2L51 A;  5CSF A;  3EKH A;  1XA5 A;  5AFP A;  1IGV A;  5AER A;  3KF9 A;  3TDZ A;  1DJZ A;  3OB1 B;  2KNE A;  3SIA A;  1N0Y A;  4GGF A;  1JFK A;  1DJH A;  2NCP A;  3OHM B;  2M0R A;  2LP3 A;  1EJ3 A;  4IL1 A;  3GOF A;  1DGU A;  1MHO A;  2M9G A;  2I18 A;  3C1V A;  3LCP C;  1BU3 A;  5AAN A;  1QX7 A;  3SIB A;  2JT3 A;  3O4Y A;  1CDM A;  1QLK A;  4GUK A;  4YGE B;  1FF1 A;  3HCM A;  4M2P A;  2M97 A;  3BOW A;  1PVA A;  2LLT A;  5KU1 A;  1TNQ A;  1B8R A;  1ZUZ A;  3ZWH A;  1AHR A;  4DRW A;  3LK0 A;  1N65 A;  3AKA A;  3PAL A;  1WDC C;  3WNX B;  5DKQ A;  4U8D A;  2BCB A;  4CPV A;  3TUY B;  5I2Q A;  2K7B A;  3CZT X;  2M49 B;  2NZ0 A;  5CPV A;  3TZ1 A;  3TS5 B;  2OS8 C;  2Y1M A;  1Y0V H;  4F0Z B;  1KQM C;  3JVT B;  1B7T Z;  1S6I A;  4HSZ A;  4R1E A;  2K2F A;  3SG2 A;  2WOS A;  4PHK A;  3SG4 A;  3M0W A;  2D8N A;  1F4O A;  1L2O B;  1DJW A;  5KSZ A;  2FJU B;  3BUW B;  4P5O E;  2LCP A;  4PCW A;  4YRU A;  1YRT B;  3WHU B;  1YUU A;  2MHH A;  2ZFD A;  2ZKM X;  1SNL A;  3GK2 A;  1RK9 A;  2K7D A;  2BE6 A;  4PE1 A;  1KFX S;  1MXL C;  1GJY A;  3D0Y A;  2A4J A;  3CLN A;  1UHH A;  4CFQ A;  4I5J A;  2ZNE A;  1B47 A;  1NUB A;  4TNC A;  2JT8 A;  3SG5 A;  3O2P A;  5JOL A;  2MA2 A;  4USL A;  1QS7 A;  2RGI A;  4NDC A;  1CNP A;  3HX4 A;  1PSR A;  2M1U A;  1A2X A;  4C0K A;  1SR6 C;  3A8R A;  1KWO C;  1KK8 B;  2LAN A;  4YI8 A;  2FCE A;  3I5H C;  1BLQ A;  4GBA A;  2HQW A;  3NSK A;  5I2O A;  1PSB A;  1G4Y R;  1CDP A;  1VRK A;  2H61 A;  1U5I B;  4DS7 A;  1F54 A;  3EK7 A;  1KQV A;  1CM1 A;  1SCV A;  2PSR A;  5ER5 A;  1JC2 A;  4GAO A;  2WC8 A;  2LV7 A;  2EC6 B;  3JTD B;  1G33 A;  2ZN8 A;  1L7Z A;  1MR8 A;  1QTX A;  5HKY A;  1ODB A;  1W7I B;  1J7P A;  5F6T A;  1RWY A;  1XYD A;  3SJS A;  2ISD A;  4QJ4 B;  3IQQ A;  2M8U A;  3I5G B;  1B8C A;  5ER4 X;  2PAL A;  3VRQ A;  1YUT A;  2KAY A;  5I2L A;  1K9P A;  2M1K B;  1MF8 B;  1XVJ A;  1CLM A;  1K96 A;  2JPT A;  1IRJ A;  3EKJ A;  1Q80 A;  1B9A A;  5B8I B;  1K9K A;  1YVH A;  2LLU A;  2Y4Q A;  1NSH A;  3E3R A;  1EG4 A;  4MN0 A;  4PDZ A;  5DKR A;  1K2H A;  5D69 A;  2LMV A;  4MVF A;  4GNK B;  1YTZ C;  4XJK A;  4GFT A;  1SCM C;  1TRF A;  2WND A;  2L4I A;  1NWD A;  1YUS A;  1AP4 A;  1JSA A;  1KK7 Y;  1DMO A;  1QAS A;  2L98 A;  1JWD A;  3TDI A;  1QIV A;  3DVJ A;  1KK7 Z;  1AJ4 A;  2BL0 B;  4PHM A;  3PFV A;  4NQG A;  1CKK A;  2PRU A;  1FI6 A;  1OZS A;  2CTN A;  5PAL A;  2LP2 A;  2O5G A;  4ZCU A;  3SG7 A;  4HRE E;  1GGW A;  3FWB A;  3DVM A;  4AOM A;  2E30 A;  1PAL A;  2JQ6 A;  3DF0 B;  5GQQ C;  3PN7 B;  1ZOT B;  4JWQ A;  1UUS A;  1SL7 A;  1EL4 A;  1NPQ A;  3NXA A;  2OPO A;  3RM1 A;  1DVI A;  4AQI A;  1EG3 A;  4M2Q A;  3KPX A;  2M3W A;  2LUX A;  2JXL A;  4MZJ A;  4PHJ A;  1J7O A;  1HQV A;  4D1E A;  1M39 A;  1A75 A;  2MAZ A;  2NCO A;  1NX0 A;  2K7O A;  3D10 A;  4ORC B;  3SG3 A;  3KO0 A;  1F71 A;  1OMD A;  1BOC A;  2COL B;  3IF7 A;  4N5X A;  4NDD A;  2MLE C;  2L5X B;  5CSJ A;  4QJ5 B;  3NSL A;  1TCO B;  2CT9 A;  1M45 A;  3WXA A;  1X02 A;  2JTZ A;  3BXK A;  1NX3 A;  2DOQ A;  2EHB A;  2JOJ A;  1CLL A;  3TDU A;  1PVB A;  3BOW B;  1Y1A A;  3A4U B;  1HT9 A;  3QRX A;  3CWG A;  1S26 D;  3NSO A;  4ETO A;  2JXC A;  2KGB C;  4MSP A;  1LKJ A;  4OVN F;  1WRZ A;  1FPW A;  2R2I A;  3CR4 X;  3LK1 A;  3I5I C;  3VRN A;  1XFU O;  1KCY A;  3FWC A;  1C7W A;  2OTG B;  1TCF A;  2Q91 A;  2K0J A;  1S1E A;  1FI5 A;  2K8M B;  2JWW A;  3O78 A;  1MXE A;  1RTP 1;  1IWQ A;  1S5G Y;  1WRK A;  4CID A;  1OMR A;  1DJI A;  2Q4U A;  1ZAC A;  1QX5 B;  2JUL A;  2LMU A;  4PE7 A;  5HYD A;  1CLB A;  2JNF A;  4N1F A;  3EVV A;  1PK0 D;  4FQO A;  1CTR A;  1J1D A;  1K90 D;  3I5F B;  1XFV O;  3OX6 A;  2M7L A;  2KAX A;  2MLF C;  1UHN A;  4JQ0 D;  1ALW A;  5K89 A;  3WHT B;  1OSA A;  1UHI A;  2HQ8 A;  2F2P A;  1MQ1 A;  4OR9 B;  4YI9 A;  1YRU B;  2V53 A;  2CBL A;  1PRW A;  2LLS A;  3BUO B;  1AVS A;  2BKH B;  2AUC A;  2KQY A;  4MBE A;  1XFW O;  2M7N A;  2G9B A;  3LLE A;  1OOJ A;  2LVJ A;  1NCY A;  3TUY C;  4MRX A;  4NDB A;  1CDL A;  1LA0 A;  3EVR A;  1QV0 A;  3BYA A;  1BR4 B;  1ZFS A;  3TS5 C;  4DUQ A;  3PLF B;  2KI4 B;  3K21 A;  1SRA A;  1EH2 A;  1XK4 C;  2CXJ A;  4L9M A;  5IBW A;  1WY9 A;  3JVT C;  4GGN A;  4BY4 A;  2KI6 C;  2L2E A;  5FYX A;  2JZI A;  2HET A;  3DVK A;  1CFD A;  2LVV A;  1SY9 A;  1Y1X A;  1BF5 A;  1L2O C;  1SMG A;  2E6W A;  1Y6W A;  4YGA A;  4YGC B;  4N1G A;  1NYA A;  1LIN A;  2LE9 B;  1SBJ A;  1UHK A;  4DIR A;  3O6B A;  1CDN A;  3BQ3 A;  1OE9 B;  1G8I A;  1JFJ A;  1NCX A;  1V1G A;  2JTT A;  1TNX A;  2ZRT A;  1A29 A;  1SW8 A;  1DGV A;  1DJX A;  1SPY A;  3KEV A;  2WOR A;  3EK8 A;  2L50 A;  3FS7 A;  1UP5 A;  1J7Q A;  1NX2 A;  1M31 A;  1NIW A;  1TNP A;  4PAL A;  1JBA A;  1YX7 A;  1KFU L;  4PE4 A;  1PUL A;  4CLN A;  1WLZ A;  2KYC A;  4XJK B;  1DTL A;  1KK8 C;  5J3X A;  2KGR A;  3BUN B;  3PSR A;  4A4B A;  4DCK A;  1CM4 A;  1WDC B;  4FTG A;  3SG6 A;  1KSO A;  2LVK A;  1IQ5 A;  1J7R A;  1BOD A;  5HLO A;  3VRR A;  4OV2 A;  1QVI Y;  4C0L A;  5CSI A;  4HRH A;  2OS8 B;  2BE4 A;  1K93 D;  2P6B B;  3VRO A;  1QVI Z;  1LVC D;  2EC6 C;  2ZND A;  3GK1 A;  3JTD C;  5AEQ A;  2H2K A;  1KQM B;  1TN4 A;  2VRG A;  1DF0 A;  4MRY A;  1QIW A;  2KFG A;  1CFP A;  1IJ6 A;  3DD4 A;  1CMF A;  2LHI A;  1UUR A;  5BPJ A;  5HLV A;  2I2R E;  2O60 A;  3H4S E;  2KBI A;  3CS1 A;  4MEW A;  1C7V A;  3I5G C;  4BY5 A;  1S36 A;  2F2O A;  2BCA A;  1A75 B;  2GV5 A;  5CSN A;  3FIA A;  4AQJ A;  2KOT A;  2TN4 A;  3GK4 X;  2LVI A;  3EK4 A;  2WCB A;  1C07 A;  2FCD A;  1IG5 A;  1NCZ A;  3MSE B;  4JPZ B;  4QJ3 B;  4YGD B;  1R2U A;  2K7C A;  3PM8 A;  4XYN A;  1CB1 A;  3CR2 A;  2BBM A;  1XFY O;  1F55 A;  4M2O A;  2GGZ A;  1IKU A;  4HRG A;  4YBH B;  1D1O A;  2BBN A;  3AAK A;  1QX2 A;  4I5L B;  4PHN A;  1RRO A;  1RFJ A;  1KWO B;  1SR6 B;  5HKZ A;  1AUI B;  3EVU A;  1UWO A;  3AKB A;  1QJT A;  2JU0 A;  2G2B A;  4OCI A;  2JRF A;  1QLS A;  3I5H B;  1GGZ A;  1H4B A;  1QAT A;  2BL0 C;  5AXI A;  1R6P A;  1QXP A;  4CFR A;  1CFC A;  4A4C A;  2MJW B;  1M46 A;  5KTY A;  2LHL A;  1TTX A;  1S5G Z;  2LNK A;  1BR1 B;  2PVB A;  1XK4 A;  4ICB A;  3PN7 C;  1FBV A;  3OB2 B;  1YUR A;  2QPT A;  3RLZ A;  1REC A;  1EXR A;  2Y5I A;  2WCF A;  2KBM A;  4E68 A;  1LXF C;  1KSM A;  1B7T Y;  1F70 A;  1S6J A;  3NSI A;  4GPL B;  1J55 A;  3AAJ A;  1OMV A;  4GGF C;  4MZL A;  3D0Y B;  4WQ2 A;  1AK8 A;  1J1E A;  2ZN9 A;  1IH0 A;  1MUX A;  2M29 A;  2PMY A;  1XO5 A;  1YVL A;  1A03 A;  2F33 A;  1CMG A;  1NP8 A;  2Y1N A;  2KSP A; 
#chains in the Genus database with same CATH topology
 1WRL A;  2BKI B;  2HF5 A;  2PAS A;  1DJG A;  2KAV A;  1B4C A;  1S3P A;  4ORA B;  5G08 A;  1CFF A;  2BNX A;  2QAC A;  2AMI A;  1OOI X;  2LM5 A;  1V1F A;  1N2D A;  2CCM A;  3CGA A;  2B1U A;  4I5K A;  3DVE A;  1BT6 A;  1S6C A;  4MZK A;  2LMT A;  1BJF A;  1JUO A;  2BEC A;  2HPS A;  2NXQ A;  1K8U A;  2K2A A;  2ZRS A;  5TNC A;  3FE9 A;  1KFX L;  2BCX A;  1SCM B;  2GGM A;  4PE0 A;  1QV1 A;  4UPG A;  2JT0 A;  1UHJ A;  2KFH A;  2JC2 A;  3BJH A;  1YR5 A;  2WCE A;  1IJ5 A;  4OKH A;  1U5I A;  1K9U A;  1F4Q A;  4Q04 A;  1IQ3 A;  1JF2 A;  1YX8 A;  3S0B A;  2OTG C;  2IS9 A;  1JF0 A;  3CTN A;  1SL8 A;  5DKN A;  2CNP A;  1TOP A;  1SKT A;  3DZT A;  2LC5 A;  5HKW A;  1W7J B;  5I8N A;  2KHN A;  2KYF A;  2F3Y A;  2FOT A;  3PAT A;  3LL8 B;  2LUC A;  5JJG A;  1K94 A;  3ZNI A;  1B1G A;  2SAS A;  1B8L A;  1OZO A;  1TIZ A;  3ICB A;  1KFU S;  4WRI A;  3KHE A;  1MWN A;  3I5F C;  1BMO A;  3F45 A;  1XFZ O;  2I94 A;  2KI6 D;  2WCM A;  3B88 A;  2WC6 A;  2F8P A;  1SYM A;  1OOG A;  1WLM A;  1AJ5 A;  2MRD A;  2KQ6 A;  4YGB B;  2KDH A;  1OQP A;  1LA3 A;  1E8A A;  1FW4 A;  1H8B A;  1DJY A;  3OX5 A;  4I5N B;  1NX1 A;  1SK6 D;  2MBX A;  3OP0 A;  2L0P A;  1XFX O;  3IQO A;  1F8H A;  1A4P A;  3VRP A;  3VGO A;  1TUJ A;  4MLW A;  2NLN A;  1TUZ A;  1DT7 B;  2F3Z A;  1M63 B;  3BUM B;  3CR5 X;  1ZMZ A;  4P2Y B;  5D7F A;  2H61 C;  2AAO A;  4ZCV A;  3S0E A;  1RJV A;  1TNW A;  1GQM A;  2I7A A;  4ORB B;  3BUX B;  1K95 A;  2KI4 C;  2SCP A;  2QDI A;  3I5I B;  4WQ3 A;  2L4H A;  1Y1U A;  2KFF A;  3DF0 A;  2EGD A;  1ALV A;  1SL9 A;  2JNX A;  2K61 A;  2LAP A;  1DF0 B;  4C0J A;  2L51 A;  5CSF A;  3EKH A;  1XA5 A;  5AFP A;  1IGV A;  5AER A;  3KF9 A;  3TDZ A;  1DJZ A;  2H8V A;  1OOH A;  3OB1 B;  2KNE A;  3SIA A;  3L4L A;  1N0Y A;  4GGF A;  1JFK A;  1DJH A;  2NCP A;  3OHM B;  2M0R A;  3SS4 A;  1DQE A;  1EJ3 A;  2LP3 A;  4IL1 A;  3GOF A;  2QEB A;  1DGU A;  1MHO A;  2M9G A;  2I18 A;  3C1V A;  3LCP C;  3B86 A;  1BU3 A;  5AAN A;  1QX7 A;  3N7H A;  3SIB A;  2JT3 A;  3O4Y A;  1CDM A;  1QLK A;  4GUK A;  4YGE B;  1FF1 A;  3HCM A;  4M2P A;  3VB1 A;  2M97 A;  5FI2 A;  3BOW A;  1PVA A;  2LLT A;  5KU1 A;  4INW A;  1TNQ A;  1B8R A;  1ZUZ A;  3ZWH A;  1AHR A;  1C3Y A;  3CZ1 A;  3LK0 A;  4DRW A;  1N65 A;  3AKA A;  3PAL A;  1WDC C;  3R1O A;  3WNX B;  5DKQ A;  4U8D A;  2BCB A;  4CPV A;  3TUY B;  5I2Q A;  1OOF A;  2KPH A;  3L4A A;  2K7B A;  3CZT X;  2M49 B;  2NZ0 A;  5CPV A;  3TZ1 A;  3B7A A;  2OS8 C;  3TS5 B;  2Y1M A;  5EL2 A;  1Y0V H;  4F0Z B;  1KQM C;  3JVT B;  1B7T Z;  1S6I A;  4HSZ A;  4R1E A;  2K2F A;  3SG2 A;  2QEV A;  2WOS A;  4PHK A;  3M0W A;  2L5Y A;  3SG4 A;  2D8N A;  1F4O A;  1L2O B;  1DJW A;  5KSZ A;  2FJU B;  3BUW B;  4P5O E;  2LCP A;  4PCW A;  4YRU A;  1YRT B;  3DY9 A;  3WHU B;  1YUU A;  2MHH A;  2PYQ A;  2ZFD A;  2ZKM X;  1BG1 A;  1SNL A;  3GK2 A;  1RK9 A;  2K7D A;  2BE6 A;  3NHI A;  4PE1 A;  1KFX S;  1MXL C;  1GJY A;  3D0Y A;  2A4J A;  3CLN A;  1UHH A;  3D76 A;  4CFQ A;  4I5J A;  2ZNE A;  1B47 A;  1DC1 A;  1NUB A;  4TNC A;  2JT8 A;  3SG5 A;  2WCK A;  3O2P A;  5JOL A;  1GM0 A;  2MA2 A;  4USL A;  3S0D A;  1QS7 A;  2RGI A;  4NDC A;  1CNP A;  3HX4 A;  1PSR A;  2M1U A;  1A2X A;  4C0K A;  1SR6 C;  1W9Z A;  1KWO C;  3A8R A;  3CZ0 A;  1KK8 B;  3CYZ A;  2LAN A;  3CAB A;  3FE6 A;  4YI8 A;  2FCE A;  3I5H C;  1BLQ A;  4GBA A;  2HQW A;  3NSK A;  5I2O A;  1PSB A;  1G4Y R;  1CDP A;  1VRK A;  2H61 A;  1U5I B;  3V2L A;  4DS7 A;  5HL1 A;  1F54 A;  3EK7 A;  1KQV A;  1CM1 A;  1SCV A;  1TWO A;  2PSR A;  5ER5 A;  1JC2 A;  3NGV A;  4GAO A;  2WC8 A;  2LV7 A;  2EC6 B;  3JTD B;  1G33 A;  2GTE A;  2ZN8 A;  3OGN A;  3SS3 A;  1L7Z A;  1MR8 A;  1QTX A;  3DYE A;  5HKY A;  1ODB A;  1W7I B;  1J7P A;  5F6T A;  1RWY A;  1XYD A;  3SJS A;  2ISD A;  4QJ4 B;  3IQQ A;  2M8U A;  3I5G B;  1B8C A;  5ER4 X;  2ERB A;  2PAL A;  3VRQ A;  1YUT A;  2KAY A;  5I2L A;  1K9P A;  2M1K B;  1MF8 B;  1XVJ A;  1CLM A;  1K96 A;  2JPT A;  1IRJ A;  3EKJ A;  1Q80 A;  1B9A A;  2YGU A;  1K9K A;  1YVH A;  4OZD A;  5B8I B;  2LLU A;  2Y4Q A;  1NSH A;  3E3R A;  1EG4 A;  4MN0 A;  4PDZ A;  5DKR A;  1K2H A;  5D69 A;  2LMV A;  4MVF A;  4GNK B;  1YTZ C;  4KYN A;  4XJK A;  4GFT A;  1SCM C;  1TRF A;  2WND A;  2L4I A;  1NWD A;  1YUS A;  1AP4 A;  3UO9 A;  1KK7 Y;  1DMO A;  1QAS A;  2L98 A;  3R72 A;  1JSA A;  3TDI A;  1JWD A;  1QIV A;  3DVJ A;  2KLE A;  1IIO A;  2WCL A;  1KK7 Z;  1AJ4 A;  2BL0 B;  4PHM A;  3PFV A;  4NQG A;  1CKK A;  2PRU A;  1FI6 A;  1OZS A;  2CTN A;  5PAL A;  2LP2 A;  2O5G A;  4ZCU A;  3SG7 A;  4HRE E;  1GGW A;  3FWB A;  3DVM A;  4JD9 A;  2E30 A;  1PAL A;  2JQ6 A;  3DF0 B;  5GQQ C;  4AOM A;  3PN7 B;  1ZOT B;  4JWQ A;  1UUS A;  1SL7 A;  2QEH A;  4PT1 A;  1EL4 A;  1P28 A;  1NPQ A;  3DXL A;  2OPO A;  3NXA A;  3RM1 A;  1DVI A;  4AQI A;  1EG3 A;  4M2Q A;  3KPX A;  2M3W A;  2LUX A;  2JXL A;  4MZJ A;  4PHJ A;  1J7O A;  1HQV A;  4D1E A;  2K60 A;  1M39 A;  1A75 A;  2MAZ A;  2NCO A;  1NX0 A;  2K7O A;  2L2C A;  3D10 A;  4ORC B;  3KO0 A;  3SG3 A;  1F71 A;  1OMD A;  3NHT A;  1DEK A;  1BOC A;  2COL B;  3IF7 A;  4N5X A;  4NDD A;  5FI6 A;  4F7F A;  1OW4 A;  2L5X B;  2MLE C;  5CSJ A;  4QJ5 B;  3CZ2 A;  3NSL A;  1TCO B;  2CT9 A;  1M45 A;  3WXA A;  1X02 A;  2JTZ A;  3BXK A;  3PM2 A;  1NX3 A;  2DOQ A;  2EHB A;  2JOJ A;  1CLL A;  3TDU A;  1PVB A;  3BOW B;  1Y1A A;  3A4U B;  1HT9 A;  3QRX A;  3CWG A;  3CDN A;  3R1P A;  1S26 D;  3BFH A;  3NSO A;  2JXC A;  2KGB C;  4ETO A;  4MSP A;  2WCJ A;  1LKJ A;  4OVN F;  1WRZ A;  1FPW A;  2R2I A;  3CR4 X;  3LK1 A;  3I5I C;  3VRN A;  1XFU O;  1KCY A;  3FWC A;  1C7W A;  2OTG B;  1TCF A;  2Q91 A;  2K0J A;  1S1E A;  1FI5 A;  2K8M B;  2JWW A;  3O78 A;  1MXE A;  1RTP 1;  1WRK A;  1IWQ A;  1S5G Y;  3IVT A;  4CID A;  1C3Z A;  1OMR A;  3PJI A;  1DJI A;  2Q4U A;  1ZAC A;  1QX5 B;  2JUL A;  2LMU A;  4PE7 A;  5HYD A;  1CLB A;  2JNF A;  4N1F A;  3EVV A;  5I94 A;  1PK0 D;  3BFB A;  4FQO A;  1CTR A;  1J1D A;  1K90 D;  3D74 A;  1DEL A;  3D77 A;  3I5F B;  1XFV O;  2P71 A;  3EG5 B;  3OX6 A;  1T14 A;  3S0F A;  3K1E A;  2M7L A;  2KAX A;  2MLF C;  1UHN A;  4JQ0 D;  3UNW A;  1ALW A;  5K89 A;  2KLD A;  1OSA A;  3WHT B;  1UHI A;  5DIC A;  2HQ8 A;  2F2P A;  1MQ1 A;  4OR9 B;  4YI9 A;  1YRU B;  2V53 A;  2CBL A;  1PRW A;  1ORG A;  2LLS A;  3BUO B;  1AVS A;  2BKH B;  2AUC A;  2KQY A;  4MBE A;  2P70 A;  1XFW O;  2M7N A;  2G9B A;  3LLE A;  1OOJ A;  2LVJ A;  1NCY A;  3TUY C;  4MRX A;  4NDB A;  1CDL A;  1LA0 A;  3EVR A;  1QV0 A;  3BYA A;  1BR4 B;  1Z4H A;  1ZFS A;  3TS5 C;  4DUQ A;  3PLF B;  3Q8I A;  2KI4 B;  3K21 A;  1SRA A;  1EH2 A;  1XK4 C;  2CXJ A;  3B87 A;  4L9M A;  5IBW A;  1WY9 A;  3JVT C;  4GGN A;  4BY4 A;  2KI6 C;  2BAP A;  2L2E A;  3QME A;  2JZI A;  5FYX A;  2HET A;  3DVK A;  1CFD A;  2LVV A;  1SY9 A;  1Y1X A;  1BF5 A;  1L2O C;  1SMG A;  2E6W A;  1Y6W A;  4YGA A;  4YGC B;  4N1G A;  1NYA A;  5FI7 A;  1LIN A;  2LE9 B;  3S0A A;  1SBJ A;  1UHK A;  3FE8 A;  4DIR A;  3O6B A;  1CDN A;  3BQ3 A;  1OE9 B;  1G8I A;  1JFJ A;  1NCX A;  1V1G A;  2JTT A;  2QEO A;  1TNX A;  2ZRT A;  2WC5 A;  1A29 A;  1SW8 A;  1DGV A;  1DJX A;  1SPY A;  3KEV A;  2WOR A;  3EK8 A;  2L50 A;  3FS7 A;  1UP5 A;  1J7Q A;  1NX2 A;  1M31 A;  1NIW A;  1TNP A;  4PAL A;  1JBA A;  1YX7 A;  1KFU L;  4PE4 A;  1PUL A;  4CLN A;  1WLZ A;  2KYC A;  4XJK B;  1DTL A;  1KK8 C;  5J3X A;  2KGR A;  3BUN B;  3O4X A;  3PSR A;  4A4B A;  3S0G A;  4DCK A;  1CM4 A;  1WDC B;  4FTG A;  3SG6 A;  1KSO A;  2LVK A;  1IQ5 A;  1J7R A;  1BOD A;  5HLO A;  3VRR A;  4OV2 A;  1QVI Y;  4C0L A;  5CSI A;  4HRH A;  2OS8 B;  2BE4 A;  1K93 D;  3OBV A;  4JKT A;  2P6B B;  3VRO A;  1QVI Z;  3L47 A;  1LVC D;  2JPO A;  1Z2C B;  2EC6 C;  2ZND A;  3GK1 A;  3JTD C;  2H2K A;  1KQM B;  1TN4 A;  5AEQ A;  2VRG A;  5D3O A;  1DF0 A;  4MRY A;  1QIW A;  2KFG A;  4INX A;  1CFP A;  1IJ6 A;  2WCH A;  3DD4 A;  1CMF A;  2LHI A;  1UUR A;  5BPJ A;  5HLV A;  2I2R E;  2O60 A;  1XFR A;  2KBI A;  3CS1 A;  3H4S E;  4MEW A;  1C7V A;  3I5G C;  4BY5 A;  1S36 A;  2F2O A;  1A75 B;  2BCA A;  2GV5 A;  5CSN A;  3D78 A;  3FIA A;  3D75 A;  4AQJ A;  2KOT A;  2TN4 A;  3GK4 X;  2LVI A;  3EK4 A;  3D73 A;  2WCB A;  3SS5 A;  2FCD A;  1IG5 A;  1NCZ A;  3MSE B;  4JPZ B;  4QJ3 B;  4YGD B;  1C07 A;  1R2U A;  2K7C A;  3PM8 A;  4XYN A;  1CB1 A;  3CR2 A;  2BBM A;  3R1V A;  1XFY O;  1F55 A;  4M2O A;  2FJY A;  2GGZ A;  1IKU A;  4HRG A;  4YBH B;  1D1O A;  2BBN A;  3AAK A;  1QX2 A;  1LS8 A;  4I5L B;  4PHN A;  1RRO A;  1RFJ A;  1KWO B;  1SR6 B;  5HKZ A;  1AUI B;  3EVU A;  1UWO A;  3AKB A;  4FQT A;  1QJT A;  2JU0 A;  2G2B A;  4OCI A;  2JRF A;  1QLS A;  3B6X A;  3I5H B;  1GGZ A;  3BFA A;  1QAT A;  1H4B A;  2BL0 C;  5AXI A;  1R6P A;  1QXP A;  4CFR A;  4IJ7 A;  4A4C A;  1CFC A;  2MJW B;  1M46 A;  5KTY A;  2LHL A;  1QWV A;  1TTX A;  1S5G Z;  2LNK A;  1BR1 B;  2PVB A;  1XK4 A;  4ICB A;  3PN7 C;  1FBV A;  3OB2 B;  1YUR A;  2QPT A;  3RLZ A;  1REC A;  1EXR A;  2Y5I A;  2WCF A;  2KBM A;  4E68 A;  1LXF C;  1KSM A;  1B7T Y;  1SSE B;  1F70 A;  2PQL A;  1S6J A;  3NSI A;  4GPL B;  1J55 A;  3AAJ A;  1OMV A;  4GGF C;  4MZL A;  3D0Y B;  4WQ2 A;  1AK8 A;  1J1E A;  2ZN9 A;  1IH0 A;  1MUX A;  2M29 A;  2PMY A;  1XO5 A;  1YVL A;  1A03 A;  3RZS A;  2F33 A;  1CMG A;  1NP8 A;  2Y1N A;  2KSP A; 
#chains in the Genus database with same CATH homology
 1WRL A;  2BKI B;  2HF5 A;  2PAS A;  1DJG A;  2KAV A;  1B4C A;  1S3P A;  4ORA B;  5G08 A;  1CFF A;  2QAC A;  2AMI A;  2LM5 A;  1V1F A;  1N2D A;  2CCM A;  3CGA A;  2B1U A;  4I5K A;  3DVE A;  1BT6 A;  1S6C A;  4MZK A;  2LMT A;  1BJF A;  1JUO A;  2BEC A;  2HPS A;  2NXQ A;  1K8U A;  2K2A A;  2ZRS A;  5TNC A;  1BG1 A;  1KFX L;  2BCX A;  1SCM B;  2GGM A;  4PE0 A;  1QV1 A;  4UPG A;  2JT0 A;  1UHJ A;  2KFH A;  2JC2 A;  1YR5 A;  2WCE A;  1IJ5 A;  4OKH A;  1U5I A;  1K9U A;  1F4Q A;  4Q04 A;  1IQ3 A;  1JF2 A;  1YX8 A;  2OTG C;  2IS9 A;  1JF0 A;  3CTN A;  1SL8 A;  5DKN A;  2CNP A;  1TOP A;  1SKT A;  2LC5 A;  5HKW A;  1W7J B;  5I8N A;  2KHN A;  2KYF A;  2F3Y A;  2FOT A;  3PAT A;  3LL8 B;  2LUC A;  5JJG A;  1K94 A;  3ZNI A;  1B1G A;  2SAS A;  1B8L A;  1OZO A;  1TIZ A;  3ICB A;  1KFU S;  4WRI A;  3KHE A;  1MWN A;  3I5F C;  1BMO A;  3F45 A;  1XFZ O;  2I94 A;  2KI6 D;  2F8P A;  1SYM A;  1WLM A;  1AJ5 A;  2MRD A;  2KQ6 A;  4YGB B;  2KDH A;  1OQP A;  1LA3 A;  1E8A A;  1FW4 A;  1H8B A;  1DJY A;  3OX5 A;  4I5N B;  1NX1 A;  1SK6 D;  2MBX A;  3OP0 A;  2L0P A;  1XFX O;  3IQO A;  1F8H A;  1A4P A;  3VRP A;  3VGO A;  4MLW A;  2NLN A;  1DT7 B;  2F3Z A;  1M63 B;  3BUM B;  3CR5 X;  1ZMZ A;  4P2Y B;  5D7F A;  2H61 C;  2AAO A;  4ZCV A;  1RJV A;  1TNW A;  1GQM A;  2I7A A;  4ORB B;  3BUX B;  1K95 A;  2KI4 C;  2SCP A;  3I5I B;  4WQ3 A;  2L4H A;  1Y1U A;  2KFF A;  3DF0 A;  2EGD A;  1ALV A;  1SL9 A;  2JNX A;  2K61 A;  2LAP A;  1DF0 B;  4C0J A;  2L51 A;  5CSF A;  3EKH A;  1XA5 A;  5AFP A;  1IGV A;  5AER A;  3KF9 A;  3TDZ A;  1DJZ A;  3OB1 B;  2KNE A;  3SIA A;  1N0Y A;  4GGF A;  1JFK A;  1DJH A;  2NCP A;  3OHM B;  2M0R A;  2LP3 A;  1EJ3 A;  4IL1 A;  3GOF A;  1DGU A;  1MHO A;  2M9G A;  2I18 A;  3C1V A;  3LCP C;  1BU3 A;  5AAN A;  1QX7 A;  3SIB A;  2JT3 A;  3O4Y A;  1CDM A;  1QLK A;  4GUK A;  4YGE B;  1FF1 A;  3HCM A;  4M2P A;  2M97 A;  3BOW A;  1PVA A;  2LLT A;  5KU1 A;  1TNQ A;  1B8R A;  1ZUZ A;  3ZWH A;  1AHR A;  4DRW A;  3LK0 A;  1N65 A;  3AKA A;  3PAL A;  1WDC C;  3WNX B;  5DKQ A;  4U8D A;  2BCB A;  4CPV A;  3TUY B;  5I2Q A;  2K7B A;  3CZT X;  2M49 B;  2NZ0 A;  5CPV A;  3TZ1 A;  3TS5 B;  2OS8 C;  2Y1M A;  1Y0V H;  4F0Z B;  1KQM C;  3JVT B;  1B7T Z;  1S6I A;  4HSZ A;  4R1E A;  2K2F A;  3SG2 A;  2WOS A;  4PHK A;  3SG4 A;  3M0W A;  2D8N A;  1F4O A;  1L2O B;  1DJW A;  5KSZ A;  2FJU B;  3BUW B;  4P5O E;  2LCP A;  4PCW A;  4YRU A;  1YRT B;  3WHU B;  1YUU A;  2MHH A;  2ZFD A;  2ZKM X;  1SNL A;  3GK2 A;  1RK9 A;  2K7D A;  2BE6 A;  4PE1 A;  1KFX S;  1MXL C;  1GJY A;  3D0Y A;  2A4J A;  3CLN A;  1UHH A;  4CFQ A;  4I5J A;  2ZNE A;  1B47 A;  1NUB A;  4TNC A;  2JT8 A;  3SG5 A;  3O2P A;  5JOL A;  2MA2 A;  4USL A;  1QS7 A;  2RGI A;  4NDC A;  1CNP A;  3HX4 A;  1PSR A;  2M1U A;  1A2X A;  4C0K A;  1SR6 C;  3A8R A;  1KWO C;  1KK8 B;  2LAN A;  4YI8 A;  2FCE A;  3I5H C;  1BLQ A;  4GBA A;  2HQW A;  3NSK A;  5I2O A;  1PSB A;  1G4Y R;  1CDP A;  1VRK A;  2H61 A;  1U5I B;  4DS7 A;  1F54 A;  3EK7 A;  1KQV A;  1CM1 A;  1SCV A;  2PSR A;  5ER5 A;  1JC2 A;  4GAO A;  2WC8 A;  2LV7 A;  2EC6 B;  3JTD B;  1G33 A;  2ZN8 A;  1L7Z A;  1MR8 A;  1QTX A;  5HKY A;  1ODB A;  1W7I B;  1J7P A;  5F6T A;  1RWY A;  1XYD A;  3SJS A;  2ISD A;  4QJ4 B;  3IQQ A;  2M8U A;  3I5G B;  1B8C A;  5ER4 X;  2PAL A;  3VRQ A;  1YUT A;  2KAY A;  5I2L A;  1K9P A;  2M1K B;  1MF8 B;  1XVJ A;  1CLM A;  1K96 A;  2JPT A;  1IRJ A;  3EKJ A;  1Q80 A;  1B9A A;  5B8I B;  1K9K A;  1YVH A;  2LLU A;  2Y4Q A;  1NSH A;  3E3R A;  1EG4 A;  4MN0 A;  4PDZ A;  5DKR A;  1K2H A;  5D69 A;  2LMV A;  4MVF A;  4GNK B;  1YTZ C;  4XJK A;  4GFT A;  1SCM C;  1TRF A;  2WND A;  2L4I A;  1NWD A;  1YUS A;  1AP4 A;  1JSA A;  1KK7 Y;  1DMO A;  1QAS A;  2L98 A;  1JWD A;  3TDI A;  1QIV A;  3DVJ A;  1KK7 Z;  1AJ4 A;  2BL0 B;  4PHM A;  3PFV A;  4NQG A;  1CKK A;  2PRU A;  1FI6 A;  1OZS A;  2CTN A;  5PAL A;  2LP2 A;  2O5G A;  4ZCU A;  3SG7 A;  4HRE E;  1GGW A;  3FWB A;  3DVM A;  4AOM A;  2E30 A;  1PAL A;  2JQ6 A;  3DF0 B;  5GQQ C;  3PN7 B;  1ZOT B;  4JWQ A;  1UUS A;  1SL7 A;  1EL4 A;  1NPQ A;  3NXA A;  2OPO A;  3RM1 A;  1DVI A;  4AQI A;  1EG3 A;  4M2Q A;  3KPX A;  2M3W A;  2LUX A;  2JXL A;  4MZJ A;  4PHJ A;  1J7O A;  1HQV A;  4D1E A;  1M39 A;  1A75 A;  2MAZ A;  2NCO A;  1NX0 A;  2K7O A;  3D10 A;  4ORC B;  3SG3 A;  3KO0 A;  1F71 A;  1OMD A;  1BOC A;  2COL B;  3IF7 A;  4N5X A;  4NDD A;  2MLE C;  2L5X B;  5CSJ A;  4QJ5 B;  3NSL A;  1TCO B;  2CT9 A;  1M45 A;  3WXA A;  1X02 A;  2JTZ A;  3BXK A;  1NX3 A;  2DOQ A;  2EHB A;  2JOJ A;  1CLL A;  3TDU A;  1PVB A;  3BOW B;  1Y1A A;  3A4U B;  1HT9 A;  3QRX A;  3CWG A;  1S26 D;  3NSO A;  4ETO A;  2JXC A;  2KGB C;  4MSP A;  1LKJ A;  4OVN F;  1WRZ A;  1FPW A;  2R2I A;  3CR4 X;  3LK1 A;  3I5I C;  3VRN A;  1XFU O;  1KCY A;  3FWC A;  1C7W A;  2OTG B;  1TCF A;  2Q91 A;  2K0J A;  1S1E A;  1FI5 A;  2K8M B;  2JWW A;  3O78 A;  1MXE A;  1RTP 1;  1IWQ A;  1S5G Y;  1WRK A;  4CID A;  1OMR A;  1DJI A;  2Q4U A;  1ZAC A;  1QX5 B;  2JUL A;  2LMU A;  4PE7 A;  5HYD A;  1CLB A;  2JNF A;  4N1F A;  3EVV A;  1PK0 D;  4FQO A;  1CTR A;  1J1D A;  1K90 D;  3I5F B;  1XFV O;  3OX6 A;  2M7L A;  2KAX A;  2MLF C;  1UHN A;  4JQ0 D;  1ALW A;  5K89 A;  3WHT B;  1OSA A;  1UHI A;  2HQ8 A;  2F2P A;  1MQ1 A;  4OR9 B;  4YI9 A;  1YRU B;  2V53 A;  2CBL A;  1PRW A;  2LLS A;  3BUO B;  1AVS A;  2BKH B;  2AUC A;  2KQY A;  4MBE A;  1XFW O;  2M7N A;  2G9B A;  3LLE A;  1OOJ A;  2LVJ A;  1NCY A;  3TUY C;  4MRX A;  4NDB A;  1CDL A;  1LA0 A;  3EVR A;  1QV0 A;  3BYA A;  1BR4 B;  1ZFS A;  3TS5 C;  4DUQ A;  3PLF B;  2KI4 B;  3K21 A;  1SRA A;  1EH2 A;  1XK4 C;  2CXJ A;  4L9M A;  5IBW A;  1WY9 A;  3JVT C;  4GGN A;  4BY4 A;  2KI6 C;  2L2E A;  5FYX A;  2JZI A;  2HET A;  3DVK A;  1CFD A;  2LVV A;  1SY9 A;  1Y1X A;  1BF5 A;  1L2O C;  1SMG A;  2E6W A;  1Y6W A;  4YGA A;  4YGC B;  4N1G A;  1NYA A;  1LIN A;  2LE9 B;  1SBJ A;  1UHK A;  4DIR A;  3O6B A;  1CDN A;  3BQ3 A;  1OE9 B;  1G8I A;  1JFJ A;  1NCX A;  1V1G A;  2JTT A;  1TNX A;  2ZRT A;  1A29 A;  1SW8 A;  1DGV A;  1DJX A;  1SPY A;  3KEV A;  2WOR A;  3EK8 A;  2L50 A;  3FS7 A;  1UP5 A;  1J7Q A;  1NX2 A;  1M31 A;  1NIW A;  1TNP A;  4PAL A;  1JBA A;  1YX7 A;  1KFU L;  4PE4 A;  1PUL A;  4CLN A;  1WLZ A;  2KYC A;  4XJK B;  1DTL A;  1KK8 C;  5J3X A;  2KGR A;  3BUN B;  3PSR A;  4A4B A;  4DCK A;  1CM4 A;  1WDC B;  4FTG A;  3SG6 A;  1KSO A;  2LVK A;  1IQ5 A;  1J7R A;  1BOD A;  5HLO A;  3VRR A;  4OV2 A;  1QVI Y;  4C0L A;  5CSI A;  4HRH A;  2OS8 B;  2BE4 A;  1K93 D;  2P6B B;  3VRO A;  1QVI Z;  1LVC D;  2EC6 C;  2ZND A;  3GK1 A;  3JTD C;  5AEQ A;  2H2K A;  1KQM B;  1TN4 A;  2VRG A;  1DF0 A;  4MRY A;  1QIW A;  2KFG A;  1CFP A;  1IJ6 A;  3DD4 A;  1CMF A;  2LHI A;  1UUR A;  5BPJ A;  5HLV A;  2I2R E;  2O60 A;  3H4S E;  2KBI A;  3CS1 A;  4MEW A;  1C7V A;  3I5G C;  4BY5 A;  1S36 A;  2F2O A;  2BCA A;  1A75 B;  2GV5 A;  5CSN A;  3FIA A;  4AQJ A;  2KOT A;  2TN4 A;  3GK4 X;  2LVI A;  3EK4 A;  2WCB A;  1C07 A;  2FCD A;  1IG5 A;  1NCZ A;  3MSE B;  4JPZ B;  4QJ3 B;  4YGD B;  1R2U A;  2K7C A;  3PM8 A;  4XYN A;  1CB1 A;  3CR2 A;  2BBM A;  1XFY O;  1F55 A;  4M2O A;  2GGZ A;  1IKU A;  4HRG A;  4YBH B;  1D1O A;  2BBN A;  3AAK A;  1QX2 A;  4I5L B;  4PHN A;  1RRO A;  1RFJ A;  1KWO B;  1SR6 B;  5HKZ A;  1AUI B;  3EVU A;  1UWO A;  3AKB A;  1QJT A;  2JU0 A;  2G2B A;  4OCI A;  2JRF A;  1QLS A;  3I5H B;  1GGZ A;  1H4B A;  1QAT A;  2BL0 C;  5AXI A;  1R6P A;  1QXP A;  4CFR A;  1CFC A;  4A4C A;  2MJW B;  1M46 A;  5KTY A;  2LHL A;  1TTX A;  1S5G Z;  2LNK A;  1BR1 B;  2PVB A;  1XK4 A;  4ICB A;  3PN7 C;  1FBV A;  3OB2 B;  1YUR A;  2QPT A;  3RLZ A;  1REC A;  1EXR A;  2Y5I A;  2WCF A;  2KBM A;  4E68 A;  1LXF C;  1KSM A;  1B7T Y;  1F70 A;  1S6J A;  3NSI A;  4GPL B;  1J55 A;  3AAJ A;  1OMV A;  4GGF C;  4MZL A;  3D0Y B;  4WQ2 A;  1AK8 A;  1J1E A;  2ZN9 A;  1IH0 A;  1MUX A;  2M29 A;  2PMY A;  1XO5 A;  1YVL A;  1A03 A;  2F33 A;  1CMG A;  1NP8 A;  2Y1N A;  2KSP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...