2M8UA

Solution structure of the dictyostelium discodieum myosin light chain, mlcc
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
77
structure length
77
Chain Sequence
GSHMNHINTKAQVIEAFKVFDRDGNGYVTVDYLRKVLNELGDMMPADEIEEMIYEADPQNSGYVQYETFVGMLFLWD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Contractile protein
molecule keywords Myosin Light Chain, MlcC
publication title Structure of the Single-lobe Myosin Light Chain C in Complex with the Light Chain-binding Domains of Myosin-1C Provides Insights into Divergent IQ Motif Recognition.
pubmed doi rcsb
source organism Dictyostelium discoideum
total genus 16
structure length 77
sequence length 77
ec nomenclature
pdb deposition date 2013-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2m8uA00
1CLLA 1BR4B 1K90D 1LVCD 1X02A 2JXCA 2MA2A 2PVBA 3GK4X 4BY4A 1QX7A 4CPVA 4DCKA 4P2YB 3KO0A 2TN4A 3ZWHA 4QJ3B 5KU1A 2NLNA 2I2RE 1FI5A 3KHEA 5PALA 5IBWA 2WC8A 2HQWA 1K9UA 1SW8A 1KFXS 1AP4A 2FOTA 2Y1NA 3MSEB 4MSPA 1FF1A 2AUCA 3EVRA 1A2XA 3JTDC 4JPZB 1CLMA 2ZFDA 3SG4A 4GUKA 1DJGA 1G4YR 2H2KA 3A4UB 2L0PA 4FQOA 5CSJA 1SR6C 4C0LA 2K7BA 2NCOA 2JT8A 1CDPA 1CMFA 2KFHA 3F45A 1TNPA 2JTTA 4OVNF 5AANA 3K21A 1ODBA 3JVTC 4IL1A 2MAZA 1NIWA 2M8UA 4CFRA 2KAXA 3BOWA 4YGEB 3I5IB 2CT9A 4YGAA 1XK4A 4YGBB 2I18A 4GGNA 2LMTA 3LK1A 1YURA 2LUCA 4ICBA 2K2FA 2K7DA 3TUYB 3I5FB 1EG4A 3VGOA 2ZKMX 2MHHA 1BR1B 1RECA 1B9AA 2BBMA 1M63B 2LVVA 2ZRSA 4P5OE 1F70A 1CKKA 1NX2A 2KBIA 3SG7A 2JNFA 3SG3A 1S1EA 2HQ8A 3OB2B 2WNDA 3DF0B 1BMOA 4CLNA 1U5IA 2MLEC 1JUOA 1PSRA 1PK0D 2F2OA 1EH2A 1MHOA 2KQ6A 1FPWA 1SR6B 1S6CA 1NP8A 4MN0A 4WQ2A 4DUQA 1NSHA 1RWYA 2KYCA 4XJKA 3DVJA 1SNLA 2L51A 1YRUB 3BUNB 1JC2A 3BYAA 4N1FA 1XVJA 2KYFA 1LXFC 1TCFA 1NCZA 2ZNEA 4WQ3A 1DF0A 4N1GA 2KSPA 1DTLA 1AVSA 1J1DA 2JT0A 3IF7A 3SG5A 1IWQA 4C0KA 2NCPA 1BLQA 2FCDA 1KQVA 2ZNDA 3CWGA 2WCEA 1M31A 3AKAA 3PN7B 1K9KA 1J7RA 1CLBA 3I5GB 1F54A 4UPGA 1NWDA 1SL7A 4I5JA 4PE7A 1XK4C 5HKWA 4PDZA 1CB1A 2KGBC 2F8PA 2JC2A 4HRGA 2M1KB 2WOSA 2L4IA 1SL9A 1AJ4A 3CR5X 1IRJA 3CZTX 1UHKA 1NPQA 3EKJA 2MRDA 2RGIA 3GK1A 4GPLB 4U8DA 1UHNA 4ETOA 1EJ3A 1UUSA 3WNXB 1WY9A 1B7TZ 2GGZA 3EVUA 4GGFA 4MRXA 1OSAA 3VRPA 1N65A 1IKUA 3ICBA 1OQPA 2A4JA 5DKRA 1KK8B 2F3ZA 4DRWA 1FW4A 2EC6B 2WCFA 1JWDA 1MWNA 4ORAB 2I94A 3AAJA 1YUUA 1J55A 1HQVA 2OTGC 2JULA 5JOLA 2R2IA 1OOJA 1MXEA 1DJXA 3I5HC 4MVFA 5ER4X 1CNPA 2KI6D 1TCOB 3BOWB 1QX5B 2G9BA 4PCWA 2NZ0A 1H8BA 1QASA 1LINA 3TDZA 1PVAA 4YI8A 2CBLA 2L5XB 1KFUS 2K61A 5HKZA 3TDIA 1W7IB 4YBHB 1B47A 2O60A 3PLFB 1F4OA 1XO5A 3SG6A 2BE4A 2LV7A 1OE9B 3BXKA 2K7CA 1LA0A 2K2AA 2Y1MA 1SK6D 1JFJA 2V53A 4OCIA 1MF8B 2Y5IA 2L50A 1WDCC 3LL8B 2QPTA 2JOJA 3FWCA 2KOTA 1S26D 1ZMZA 2AMIA 2JWWA 3FS7A 1L2OC 1QS7A 2AAOA 2KHNA 1QV0A 1N0YA 4FTGA 1TNWA 2LVIA 3O78A 1M39A 5I2QA 1OMDA 4CFQA 4AQJA 1L7ZA 1CM4A 1XFWO 1ZUZA 2L4HA 3NSOA 1IQ5A 3TS5C 2M0RA 2IS9A 1XFUO 1AHRA 2OTGB 4GGFC 1ZOTB 1KSOA 2LHLA 1NYAA 1SMGA 2OS8B 1SCMB 1DF0B 2L2EA 2F3YA 3PM8A 3CTNA 1C7VA 2Y4QA 1K2HA 1A75A 3FWBA 3PATA 1N2DA 3M0WA 5HLOA 2JZIA 2KI4C 5AEQA 3LCPC 3O6BA 2O5GA 4NDBA 1AUIB 2CNPA 3VRNA 5GQQC 1KFXL 1UWOA 2ZN8A 1K93D 5B8IB 2LHIA 3JTDB 4YGCB 1YR5A 3O2PA 3CR2A 1KSMA 4GNKB 1DJWA 3RLZA 2BE6A 4A4CA 2MJWB 4PE1A 1YVHA 1MUXA 1R6PA 1TIZA 2BCBA 1S6JA 1DJZA 5CSNA 3JVTB 1SYMA 4M2QA 1CFPA 4I5LB 4GFTA 2E30A 4MLWA 3AAKA 4CIDA 3CS1A 1J7QA 3AKBA 2DOQA 1XYDA 1GGWA 1JSAA 3WHTB 1PULA 1TRFA 5D69A 3D0YA 3BUOB 4AOMA 1KK7Z 2KI4B 2BL0C 1EG3A 5F6TA 2EGDA 2JRFA 1IG5A 3WHUB 4TNCA 1XFYO 3OX6A 5DKQA 2JXLA 1RROA 1B8LA 4ORCB 2LVKA 1KK7Y 5I2LA 1VRKA 2JU0A 3WXAA 4QJ5B 1GQMA 1RFJA 1NX0A 2LLSA 2NXQA 2OPOA 3KEVA 4NDCA 1K96A 4M2PA 4XYNA 1CM1A 2WCBA 2GV5A 2JPTA 1TOPA 1V1FA 5HYDA 3CR4X 1M45A 3TZ1A 1G8IA 1OMRA 3KPXA 5AERA 1YUSA 5I2OA 4E68A 1SRAA 4MZKA 3LK0A 2GGMA 3EK4A 3EVVA 3VRQA 3OHMB 4MZJA 1QLKA 1ALWA 2PMYA 4WRIA 1J7OA 3H4SE 2M7LA 2BKHB 1BU3A 1YVLA 2HETA 1OMVA 1YX7A 3DF0A 4HRHA 4GBAA 1H4BA 1B7TY 2BBNA 1IGVA 2JQ6A 2SCPA 4MEWA 1F71A 2LLTA 1BODA 1HT9A 2D8NA 3IQQA 2KGRA 2COLB 4DIRA 1F55A 3OB1B 1RJVA 2F2PA 2PRUA 3EKHA 1C7WA 1SKTA 3FIAA 1UP5A 3PSRA 1XFZO 5TNCA 1OZOA 3DVKA 4PHKA 2LMVA 2I7AA 1KQMC 1A03A 2LNKA 1A75B 4ZCVA 2MLFC 3O4YA 1DVIA 2HF5A 3GOFA 1NX3A 1S36A 5KSZA 2CTNA 2CCMA 3C1VA 1SY9A 1YRTB 3VRRA 2M7NA 3DVEA 1S3PA 3BUMB 1NX1A 1G33A 4MZLA 1ZFSA 4PE0A 3I5IC 2ISDA 3SIAA 2BCAA 1U5IB 2Q4UA 2K8MB 1BJFA 1MXLC 2L98A 5K89A 1C07A 4DS7A 2LAPA 1TNXA 1JF0A 4GAOA 3TUYC 1EL4A 1A4PA 1Y1XA 2ZRTA 5D7FA 3I5FC 2SASA 4ZCUA 3SJSA 1IH0A 1QVIZ 2JNXA 1V1GA 1KWOC 2EHBA 4XJKB 5HLVA 4AQIA 3PALA 3D10A 3A8RA 4USLA 1WRZA 3BUWB 5AXIA 2KBMA 5G08A 3E3RA 1JBAA 3I5HB 3TDUA 1QATA 2F33A 2FJUB 1QVIY 5CSFA 1LKJA 5CSIA 4R1EA 1LA3A 3LLEA 1J1EA 1DJYA 1M46A 3NXAA 1AJ5A 1KQMB 3HCMA 4YRUA 1IQ3A 1Y0VH 2LVJA 5I8NA 3D0YB 1KFUL 1FBVA 2LUXA 2B1UA 3EK7A 4JQ0D 2BKIB 1YTZC 1Y1UA 4I5KA 1BT6A 3BUXB 4NQGA 2E6WA 1Y6WA 2LCPA 1XFVO 1FI6A 1WDCB 3NSIA 1Y1AA 1CDNA 1BG1A 2LLUA 3SG2A 1PALA 5JJGA 1L2OB 2M9GA 1D1OA 1XFXO 2MBXA 2PSRA 1GGZA 3ZNIA 1UHHA 4HSZA 1SBJA 3HX4A 1ALVA 2KAVA 1MR8A 1QV1A 1UURA 1DMOA 5DKNA 2QACA 1WRLA 1KCYA 3PN7C 1B8RA 1TN4A 2WORA 1A29A 2Q91A 1QIVA 3TS5B 1KWOB 2G2BA 1R2UA 3I5GC 1PVBA 2M49B 1F4QA 2PALA 1EXRA 1UHJA 2PASA 5BPJA 2K7OA 2M29A 2LMUA 1AK8A 1NCYA 4N5XA 2JTZA 4OR9B 5AFPA 1IJ5A 3NSLA 4OV2A 1CDLA 1DGVA 5J3XA 1JF2A 1S5GZ 4QJ4B 3CGAA 1RTP1 3GK2A 4OKHA 4HREE 4I5NB 4ORBB 2BCXA 1CDMA 3RM1A 5HKYA 3NSKA 1SPYA 1SCVA 3SIBA 5FYXA 4MRYA 1S5GY 1DJHA 1B4CA 4PE4A 3VROA 5CPVA 2P6BB 4D1EA 2K0JA 1K94A 1BF5A 1BOCA 1F8HA 1KK8C 1CMGA 3CLNA 1WRKA 1CTRA 2EC6C 3IQOA 5ER5A 2BECA 4C0JA 2H61A 2JT3A 1QX2A 3BQ3A 1CFFA 1K8UA 1TNQA 2LC5A 1E8AA 1J7PA 1SL8A 1UHIA 3DVMA 3QRXA 1CFDA 3EK8A 2LM5A 3PFVA 4F0ZB 1MQ1A 4M2OA 1NUBA 1K9PA 1GJYA 4PHNA 1YX8A 4L9MA 4BY5A 1DT7B 2LE9B 1QXPA 1S6IA 3OX5A 4Q04A 1B8CA 1IJ6A 1ZACA 2KNEA 2KI6C 3OP0A 1K95A 2BL0B 2KQYA 2LANA 4JWQA 4MBEA 4YGDB 1JFKA 1QTXA 1PSBA 1WLZA 4PHJA 2LP2A 2M1UA 2KFFA 1W7JB 1XA5A 1PRWA 1DGUA 3KF9A 1QIWA 1QJTA 2M97A 2M3WA 4PALA 1Q80A 1B1GA 1DJIA 2ZN9A 2FCEA 2HPSA 4NDDA 5KTYA 1NCXA 3DD4A 2KAYA 1OZSA 4YI9A 4A4BA 2CXJA 1WLMA 2KDHA 1TTXA 1RK9A 2OS8C 1SCMC 2LP3A 1QLSA 1CFCA 1YUTA 2KFGA 4PHMA 2H61C 2VRGA
chains in the Genus database with same CATH superfamily
1CLLA 1BR4B 1K90D 1LVCD 1X02A 2JXCA 2MA2A 2PVBA 3GK4X 4BY4A 1QX7A 4CPVA 4DCKA 4P2YB 3KO0A 2TN4A 3ZWHA 4QJ3B 5KU1A 2NLNA 2I2RE 1FI5A 1OOHA 3KHEA 5PALA 5IBWA 2WC8A 2HQWA 1K9UA 1SW8A 1KFXS 1AP4A 2FOTA 2Y1NA 3MSEB 4MSPA 1FF1A 2AUCA 3EVRA 1OW4A 1A2XA 3IVTA 3JTDC 4JPZB 1CLMA 2ZFDA 3SG4A 4GUKA 1DJGA 1G4YR 2H2KA 3A4UB 2L0PA 4FQOA 5CSJA 1SR6C 4C0LA 2K7BA 2NCOA 2JT8A 5DICA 1CDPA 1CMFA 2KFHA 3F45A 1TNPA 2JTTA 4OVNF 5AANA 3K21A 3OGNA 1ODBA 1TUZA 3JVTC 4IJ7A 4IL1A 2MAZA 1NIWA 3BFAA 3OBVA 2M8UA 2BAPA 4CFRA 2KAXA 3BOWA 4YGEB 3BFBA 2CT9A 3I5IB 4YGAA 5I94A 1XK4A 4YGBB 2I18A 4GGNA 2LMTA 3LK1A 1YURA 2LUCA 4ICBA 2K2FA 2K7DA 3TUYB 3I5FB 1EG4A 3VGOA 1QWVA 2ZKMX 2MHHA 1BR1B 1RECA 1B9AA 2BBMA 1M63B 3PM2A 2LVVA 2ZRSA 4P5OE 1F70A 1CKKA 3D77A 1NX2A 2KBIA 3L47A 3SG7A 2JNFA 3SG3A 1S1EA 2HQ8A 3OB2B 2WNDA 3DF0B 1BMOA 4CLNA 1U5IA 2MLEC 5EL2A 1JUOA 1PSRA 1PK0D 2F2OA 1EH2A 3DZTA 1MHOA 2KQ6A 1FPWA 1SR6B 5FI6A 1S6CA 1NP8A 4MN0A 4WQ2A 4DUQA 1NSHA 1RWYA 2KYCA 4XJKA 3DVJA 1SNLA 2L51A 2WC5A 1YRUB 3BUNB 4PT1A 1JC2A 3BYAA 4N1FA 1XVJA 2KYFA 1LXFC 1TCFA 1NCZA 2ZNEA 4WQ3A 1DF0A 2L2CA 4N1GA 2KSPA 1DTLA 1AVSA 1J1DA 3CDNA 2JT0A 3IF7A 3SG5A 1IWQA 4C0KA 2NCPA 1BLQA 2FCDA 1KQVA 2H8VA 2ZNDA 1TWOA 3CWGA 2WCEA 1M31A 3AKAA 3PN7B 1K9KA 1J7RA 1CLBA 3I5GB 1F54A 4UPGA 1NWDA 1SL7A 4I5JA 2GTEA 3B86A 1XK4C 2WCLA 4PE7A 5HKWA 4JKTA 4PDZA 1CB1A 1T14A 4F7FA 2KGBC 2F8PA 2JC2A 4HRGA 1Z4HA 2M1KB 2WOSA 3V2LA 2L4IA 1SL9A 1AJ4A 3CR5X 3L4AA 1IRJA 3CZTX 1UHKA 1NPQA 3EKJA 1W9ZA 2MRDA 2RGIA 3GK1A 4GPLB 4U8DA 1UHNA 4ETOA 3S0BA 1EJ3A 1UUSA 3WNXB 1WY9A 1B7TZ 2GGZA 3EVUA 4GGFA 4MRXA 1OSAA 3VRPA 1N65A 1IKUA 3ICBA 1OQPA 2A4JA 5DKRA 1KK8B 2F3ZA 4DRWA 1FW4A 1OOIX 2EC6B 2WCFA 1JWDA 3Q8IA 1MWNA 4ORAB 2I94A 3AAJA 3CZ0A 1YUUA 1J55A 1HQVA 2OTGC 2JULA 5JOLA 3D74A 2R2IA 1OOJA 1MXEA 1DJXA 3I5HC 4MVFA 5ER4X 1CNPA 2KI6D 1TCOB 3BOWB 1QX5B 2G9BA 4PCWA 2NZ0A 1H8BA 1QASA 1LINA 3TDZA 1PVAA 4YI8A 2CBLA 2L5XB 1KFUS 2K61A 5HKZA 3TDIA 1W7IB 4YBHB 1B47A 2O60A 3PLFB 1F4OA 1XO5A 2QEBA 3SG6A 2BE4A 2LV7A 1Z2CB 1OE9B 1C3YA 3BXKA 2K7CA 1LA0A 2K2AA 2Y1MA 1SK6D 1JFJA 2V53A 4OCIA 1MF8B 2Y5IA 2L50A 1WDCC 3LL8B 2QPTA 2JOJA 3FWCA 2KOTA 1S26D 1ZMZA 2AMIA 2JWWA 4JD9A 3D75A 3FS7A 1L2OC 1QS7A 2AAOA 3SS3A 2KHNA 1QV0A 1N0YA 4FTGA 1TNWA 3QMEA 2LVIA 3O78A 1M39A 5I2QA 1OMDA 4CFQA 2YGUA 1L7ZA 1CM4A 1XFWO 1ZUZA 2L4HA 2WCMA 3NSOA 4AQJA 1IQ5A 3TS5C 3FE9A 2M0RA 2IS9A 3D73A 1XFUO 1AHRA 2OTGB 4GGFC 1ZOTB 1KSOA 2P71A 2LHLA 1NYAA 1SMGA 2OS8B 1SCMB 1DF0B 2L2EA 3D76A 3FE8A 2F3YA 3PM8A 3S0EA 3CTNA 1C7VA 2KPHA 2Y4QA 3BJHA 1K2HA 1A75A 3FWBA 3PATA 4OZDA 1N2DA 3M0WA 5HLOA 2JZIA 2KI4C 5AEQA 3LCPC 2JPOA 3O6BA 2O5GA 4NDBA 3CABA 1AUIB 2CNPA 2K60A 3S0DA 5GQQC 3VRNA 1KFXL 1UWOA 2ZN8A 3B7AA 1K93D 5B8IB 2LHIA 3JTDB 4YGCB 1YR5A 3O2PA 3CR2A 1KSMA 4GNKB 1DJWA 3RLZA 3SS4A 2BE6A 4A4CA 2MJWB 4PE1A 1YVHA 1MUXA 1R6PA 1TIZA 2BCBA 3BFHA 1DC1A 1S6JA 1DJZA 5CSNA 3JVTB 3R1OA 1SYMA 3N7HA 4M2QA 1CFPA 4I5LB 4GFTA 1LS8A 2E30A 4MLWA 3AAKA 4CIDA 3CS1A 1J7QA 2ERBA 3AKBA 2DOQA 1XYDA 1GGWA 1JSAA 3WHTB 1PULA 1TRFA 5D69A 3D0YA 2KLDA 3BUOB 4AOMA 1KK7Z 2QEHA 2KI4B 2BL0C 3SS5A 1EG3A 3UNWA 5F6TA 2EGDA 2JRFA 1IG5A 3WHUB 2WCHA 4TNCA 1ORGA 1XFYO 3OX6A 5DKQA 2JXLA 1RROA 1B8LA 4ORCB 2LVKA 1KK7Y 5I2LA 1VRKA 2JU0A 1TUJA 3WXAA 4QJ5B 1GQMA 3B88A 1RFJA 1NX0A 2LLSA 2NXQA 2OPOA 3KEVA 4NDCA 1K96A 4M2PA 4XYNA 1CM1A 2WCBA 2GV5A 3R72A 2JPTA 1TOPA 1V1FA 3FE6A 5HYDA 3CR4X 1M45A 3DY9A 1G8IA 1OMRA 3KPXA 3TZ1A 1YUSA 5AERA 5I2OA 4E68A 1C3ZA 1SRAA 4MZKA 3VB1A 3LK0A 2GGMA 3EK4A 3B6XA 1IH0A 3EVVA 3VRQA 3OHMB 4MZJA 1QLKA 1ALWA 2PMYA 3CZ1A 3K1EA 3H4SE 4WRIA 1J7OA 2M7LA 2BKHB 1BU3A 1YVLA 2HETA 1OMVA 1YX7A 3DF0A 4HRHA 4GBAA 1H4BA 4INXA 1B7TY 2BBNA 1IGVA 2JQ6A 2SCPA 4MEWA 5FI2A 1F71A 2LLTA 1BODA 1HT9A 2D8NA 3IQQA 2KGRA 2COLB 3DYEA 3O4XA 4DIRA 1OOGA 3OB1B 1F55A 1RJVA 2F2PA 2PRUA 3EKHA 1C7WA 1SKTA 1GM0A 3FIAA 1UP5A 3PSRA 1XFZO 5TNCA 1OZOA 3DVKA 3CZ2A 4PHKA 2LMVA 2I7AA 1KQMC 1A03A 2LNKA 1A75B 4ZCVA 2MLFC 3O4YA 3UO9A 1DVIA 2HF5A 3GOFA 1NX3A 1S36A 4FQTA 5KSZA 3R1PA 2CTNA 2CCMA 3C1VA 1SY9A 1YRTB 2PQLA 3VRRA 2M7NA 3DVEA 1S3PA 3BUMB 1NX1A 1G33A 4MZLA 1ZFSA 4PE0A 3I5IC 2ISDA 3SIAA 2BCAA 1U5IB 2Q4UA 3EG5B 2K8MB 1BJFA 1MXLC 2L98A 5K89A 1C07A 4DS7A 2LAPA 1TNXA 1JF0A 4GAOA 3TUYC 1EL4A 1A4PA 1Y1XA 2WC6A 2ZRTA 3I5FC 2SASA 4KYNA 5D7FA 4ZCUA 1QVIZ 2JNXA 2WCJA 3SJSA 1V1GA 1KWOC 2EHBA 4XJKB 5FI7A 5HLVA 3PALA 4AQIA 3D10A 3A8RA 4USLA 1WRZA 3BUWB 5AXIA 2KBMA 5G08A 3E3RA 1JBAA 3I5HB 3TDUA 1QATA 3S0FA 2QDIA 2F33A 2FJUB 1QVIY 5CSFA 1LKJA 5CSIA 4R1EA 1LA3A 3LLEA 3S0GA 3S0AA 1J1EA 1DJYA 1M46A 2KLEA 3NXAA 1AJ5A 1KQMB 3HCMA 4YRUA 1IQ3A 1Y0VH 2LVJA 5I8NA 3D0YB 1KFUL 1FBVA 3RZSA 2LUXA 2B1UA 3EK7A 4JQ0D 2BKIB 1Y1UA 1YTZC 4I5KA 1BT6A 3BUXB 4NQGA 2E6WA 1Y6WA 2LCPA 1XFVO 1FI6A 1WDCB 3NSIA 1Y1AA 1OOFA 1BG1A 2LLUA 1CDNA 3SG2A 1PALA 5JJGA 1L2OB 2M9GA 1D1OA 1XFXO 2MBXA 2PSRA 1GGZA 3ZNIA 1UHHA 4HSZA 1SBJA 3HX4A 1ALVA 2KAVA 1MR8A 1QV1A 1UURA 2BNXA 1DMOA 5DKNA 2QACA 1WRLA 1KCYA 3PN7C 1B8RA 1TN4A 2WORA 1A29A 2Q91A 1QIVA 3TS5B 1KWOB 2G2BA 1R2UA 3I5GC 1PVBA 2M49B 1F4QA 2PALA 1EXRA 2FJYA 1UHJA 2QEOA 3L4LA 3NGVA 2PASA 5BPJA 2K7OA 2M29A 2LMUA 2WCKA 1AK8A 1NCYA 4N5XA 2JTZA 4OR9B 5AFPA 1IJ5A 3NSLA 4OV2A 1CDLA 1DGVA 3CYZA 5J3XA 1JF2A 1S5GZ 4QJ4B 3CGAA 1RTP1 3GK2A 4OKHA 4HREE 4I5NB 4ORBB 2BCXA 1CDMA 3RM1A 1P28A 3NSKA 5HKYA 1SPYA 1SCVA 3SIBA 5FYXA 4MRYA 1S5GY 1DJHA 1B4CA 4PE4A 3VROA 5CPVA 2P6BB 4D1EA 2K0JA 1K94A 1DQEA 3PJIA 5D3OA 1BF5A 1BOCA 1F8HA 1KK8C 1CMGA 3CLNA 1WRKA 1CTRA 2EC6C 3IQOA 5ER5A 2BECA 4C0JA 2H61A 1IIOA 1SSEB 2JT3A 1QX2A 3BQ3A 1CFFA 1K8UA 1TNQA 2LC5A 1E8AA 1J7PA 1SL8A 1UHIA 3DVMA 3QRXA 1CFDA 3EK8A 3R1VA 2LM5A 3PFVA 4F0ZB 1MQ1A 4M2OA 1NUBA 1K9PA 1GJYA 4PHNA 1YX8A 4L9MA 4BY5A 2PYQA 1DT7B 2LE9B 1QXPA 1S6IA 3OX5A 4Q04A 1B8CA 1IJ6A 1ZACA 2KNEA 2KI6C 3OP0A 2L5YA 1K95A 2BL0B 2KQYA 2LANA 3D78A 3NHTA 4JWQA 4MBEA 4YGDB 1JFKA 1QTXA 1PSBA 1WLZA 2P70A 4PHJA 2LP2A 2M1UA 2KFFA 1W7JB 1XA5A 3NHIA 1PRWA 1DGUA 3KF9A 1QIWA 1QJTA 2M97A 2M3WA 3B87A 4PALA 5HL1A 3DXLA 1Q80A 1DEKA 1DJIA 1B1GA 2ZN9A 2QEVA 2FCEA 2HPSA 4INWA 4NDDA 5KTYA 1NCXA 3DD4A 2KAYA 1OZSA 1XFRA 4YI9A 4A4BA 2CXJA 1WLMA 2KDHA 1TTXA 1RK9A 1DELA 2OS8C 1SCMC 2LP3A 1QLSA 1CFCA 1YUTA 2KFGA 4PHMA 2H61C 2VRGA
chains in the Genus database with same CATH topology
1CLLA 1BR4B 1K90D 1LVCD 1X02A 2JXCA 2MA2A 2PVBA 3GK4X 4BY4A 1QX7A 4CPVA 4DCKA 4P2YB 3KO0A 2TN4A 3ZWHA 4QJ3B 5KU1A 2NLNA 2I2RE 1FI5A 3KHEA 5PALA 5IBWA 2WC8A 2HQWA 1K9UA 1SW8A 1KFXS 1AP4A 2FOTA 2Y1NA 3MSEB 4MSPA 1FF1A 2AUCA 3EVRA 1A2XA 3JTDC 4JPZB 1CLMA 2ZFDA 3SG4A 4GUKA 1DJGA 1G4YR 2H2KA 3A4UB 2L0PA 4FQOA 5CSJA 1SR6C 4C0LA 2K7BA 2NCOA 2JT8A 1CDPA 1CMFA 2KFHA 3F45A 1TNPA 2JTTA 4OVNF 5AANA 3K21A 1ODBA 3JVTC 4IL1A 2MAZA 1NIWA 2M8UA 4CFRA 2KAXA 3BOWA 4YGEB 3I5IB 2CT9A 4YGAA 1XK4A 4YGBB 2I18A 4GGNA 2LMTA 3LK1A 1YURA 2LUCA 4ICBA 2K2FA 2K7DA 3TUYB 3I5FB 1EG4A 3VGOA 2ZKMX 2MHHA 1BR1B 1RECA 1B9AA 2BBMA 1M63B 2LVVA 2ZRSA 4P5OE 1F70A 1CKKA 1NX2A 2KBIA 3SG7A 2JNFA 3SG3A 1S1EA 2HQ8A 3OB2B 2WNDA 3DF0B 1BMOA 4CLNA 1U5IA 2MLEC 1JUOA 1PSRA 1PK0D 2F2OA 1EH2A 1MHOA 2KQ6A 1FPWA 1SR6B 1S6CA 1NP8A 4MN0A 4WQ2A 4DUQA 1NSHA 1RWYA 2KYCA 4XJKA 3DVJA 1SNLA 2L51A 1YRUB 3BUNB 1JC2A 3BYAA 4N1FA 1XVJA 2KYFA 1LXFC 1TCFA 1NCZA 2ZNEA 4WQ3A 1DF0A 4N1GA 2KSPA 1DTLA 1AVSA 1J1DA 2JT0A 3IF7A 3SG5A 1IWQA 4C0KA 2NCPA 1BLQA 2FCDA 1KQVA 2ZNDA 3CWGA 2WCEA 1M31A 3AKAA 3PN7B 1K9KA 1J7RA 1CLBA 3I5GB 1F54A 4UPGA 1NWDA 1SL7A 4I5JA 4PE7A 1XK4C 5HKWA 4PDZA 1CB1A 2KGBC 2F8PA 2JC2A 4HRGA 2M1KB 2WOSA 2L4IA 1SL9A 1AJ4A 3CR5X 1IRJA 3CZTX 1UHKA 1NPQA 3EKJA 2MRDA 2RGIA 3GK1A 4GPLB 4U8DA 1UHNA 4ETOA 1EJ3A 1UUSA 3WNXB 1WY9A 1B7TZ 2GGZA 3EVUA 4GGFA 4MRXA 1OSAA 3VRPA 1N65A 1IKUA 3ICBA 1OQPA 2A4JA 5DKRA 1KK8B 2F3ZA 4DRWA 1FW4A 2EC6B 2WCFA 1JWDA 1MWNA 4ORAB 2I94A 3AAJA 1YUUA 1J55A 1HQVA 2OTGC 2JULA 5JOLA 2R2IA 1OOJA 1MXEA 1DJXA 3I5HC 4MVFA 5ER4X 1CNPA 2KI6D 1TCOB 3BOWB 1QX5B 2G9BA 4PCWA 2NZ0A 1H8BA 1QASA 1LINA 3TDZA 1PVAA 4YI8A 2CBLA 2L5XB 1KFUS 2K61A 5HKZA 3TDIA 1W7IB 4YBHB 1B47A 2O60A 3PLFB 1F4OA 1XO5A 3SG6A 2BE4A 2LV7A 1OE9B 3BXKA 2K7CA 1LA0A 2K2AA 2Y1MA 1SK6D 1JFJA 2V53A 4OCIA 1MF8B 2Y5IA 2L50A 1WDCC 3LL8B 2QPTA 2JOJA 3FWCA 2KOTA 1S26D 1ZMZA 2AMIA 2JWWA 3FS7A 1L2OC 1QS7A 2AAOA 2KHNA 1QV0A 1N0YA 4FTGA 1TNWA 2LVIA 3O78A 1M39A 5I2QA 1OMDA 4CFQA 4AQJA 1L7ZA 1CM4A 1XFWO 1ZUZA 2L4HA 3NSOA 1IQ5A 3TS5C 2M0RA 2IS9A 1XFUO 1AHRA 2OTGB 4GGFC 1ZOTB 1KSOA 2LHLA 1NYAA 1SMGA 2OS8B 1SCMB 1DF0B 2L2EA 2F3YA 3PM8A 3CTNA 1C7VA 2Y4QA 1K2HA 1A75A 3FWBA 3PATA 1N2DA 3M0WA 5HLOA 2JZIA 2KI4C 5AEQA 3LCPC 3O6BA 2O5GA 4NDBA 1AUIB 2CNPA 3VRNA 5GQQC 1KFXL 1UWOA 2ZN8A 1K93D 5B8IB 2LHIA 3JTDB 4YGCB 1YR5A 3O2PA 3CR2A 1KSMA 4GNKB 1DJWA 3RLZA 2BE6A 4A4CA 2MJWB 4PE1A 1YVHA 1MUXA 1R6PA 1TIZA 2BCBA 1S6JA 1DJZA 5CSNA 3JVTB 1SYMA 4M2QA 1CFPA 4I5LB 4GFTA 2E30A 4MLWA 3AAKA 4CIDA 3CS1A 1J7QA 3AKBA 2DOQA 1XYDA 1GGWA 1JSAA 3WHTB 1PULA 1TRFA 5D69A 3D0YA 3BUOB 4AOMA 1KK7Z 2KI4B 2BL0C 1EG3A 5F6TA 2EGDA 2JRFA 1IG5A 3WHUB 4TNCA 1XFYO 3OX6A 5DKQA 2JXLA 1RROA 1B8LA 4ORCB 2LVKA 1KK7Y 5I2LA 1VRKA 2JU0A 3WXAA 4QJ5B 1GQMA 1RFJA 1NX0A 2LLSA 2NXQA 2OPOA 3KEVA 4NDCA 1K96A 4M2PA 4XYNA 1CM1A 2WCBA 2GV5A 2JPTA 1TOPA 1V1FA 5HYDA 3CR4X 1M45A 3TZ1A 1G8IA 1OMRA 3KPXA 5AERA 1YUSA 5I2OA 4E68A 1SRAA 4MZKA 3LK0A 2GGMA 3EK4A 3EVVA 3VRQA 3OHMB 4MZJA 1QLKA 1ALWA 2PMYA 4WRIA 1J7OA 3H4SE 2M7LA 2BKHB 1BU3A 1YVLA 2HETA 1OMVA 1YX7A 3DF0A 4HRHA 4GBAA 1H4BA 1B7TY 2BBNA 1IGVA 2JQ6A 2SCPA 4MEWA 1F71A 2LLTA 1BODA 1HT9A 2D8NA 3IQQA 2KGRA 2COLB 4DIRA 1F55A 3OB1B 1RJVA 2F2PA 2PRUA 3EKHA 1C7WA 1SKTA 3FIAA 1UP5A 3PSRA 1XFZO 5TNCA 1OZOA 3DVKA 4PHKA 2LMVA 2I7AA 1KQMC 1A03A 2LNKA 1A75B 4ZCVA 2MLFC 3O4YA 1DVIA 2HF5A 3GOFA 1NX3A 1S36A 5KSZA 2CTNA 2CCMA 3C1VA 1SY9A 1YRTB 3VRRA 2M7NA 3DVEA 1S3PA 3BUMB 1NX1A 1G33A 4MZLA 1ZFSA 4PE0A 3I5IC 2ISDA 3SIAA 2BCAA 1U5IB 2Q4UA 2K8MB 1BJFA 1MXLC 2L98A 5K89A 1C07A 4DS7A 2LAPA 1TNXA 1JF0A 4GAOA 3TUYC 1EL4A 1A4PA 1Y1XA 2ZRTA 5D7FA 3I5FC 2SASA 4ZCUA 3SJSA 1IH0A 1QVIZ 2JNXA 1V1GA 1KWOC 2EHBA 4XJKB 5HLVA 4AQIA 3PALA 3D10A 3A8RA 4USLA 1WRZA 3BUWB 5AXIA 2KBMA 5G08A 3E3RA 1JBAA 3I5HB 3TDUA 1QATA 2F33A 2FJUB 1QVIY 5CSFA 1LKJA 5CSIA 4R1EA 1LA3A 3LLEA 1J1EA 1DJYA 1M46A 3NXAA 1AJ5A 1KQMB 3HCMA 4YRUA 1IQ3A 1Y0VH 2LVJA 5I8NA 3D0YB 1KFUL 1FBVA 2LUXA 2B1UA 3EK7A 4JQ0D 2BKIB 1YTZC 1Y1UA 4I5KA 1BT6A 3BUXB 4NQGA 2E6WA 1Y6WA 2LCPA 1XFVO 1FI6A 1WDCB 3NSIA 1Y1AA 1CDNA 1BG1A 2LLUA 3SG2A 1PALA 5JJGA 1L2OB 2M9GA 1D1OA 1XFXO 2MBXA 2PSRA 1GGZA 3ZNIA 1UHHA 4HSZA 1SBJA 3HX4A 1ALVA 2KAVA 1MR8A 1QV1A 1UURA 1DMOA 5DKNA 2QACA 1WRLA 1KCYA 3PN7C 1B8RA 1TN4A 2WORA 1A29A 2Q91A 1QIVA 3TS5B 1KWOB 2G2BA 1R2UA 3I5GC 1PVBA 2M49B 1F4QA 2PALA 1EXRA 1UHJA 2PASA 5BPJA 2K7OA 2M29A 2LMUA 1AK8A 1NCYA 4N5XA 2JTZA 4OR9B 5AFPA 1IJ5A 3NSLA 4OV2A 1CDLA 1DGVA 5J3XA 1JF2A 1S5GZ 4QJ4B 3CGAA 1RTP1 3GK2A 4OKHA 4HREE 4I5NB 4ORBB 2BCXA 1CDMA 3RM1A 5HKYA 3NSKA 1SPYA 1SCVA 3SIBA 5FYXA 4MRYA 1S5GY 1DJHA 1B4CA 4PE4A 3VROA 5CPVA 2P6BB 4D1EA 2K0JA 1K94A 1BF5A 1BOCA 1F8HA 1KK8C 1CMGA 3CLNA 1WRKA 1CTRA 2EC6C 3IQOA 5ER5A 2BECA 4C0JA 2H61A 2JT3A 1QX2A 3BQ3A 1CFFA 1K8UA 1TNQA 2LC5A 1E8AA 1J7PA 1SL8A 1UHIA 3DVMA 3QRXA 1CFDA 3EK8A 2LM5A 3PFVA 4F0ZB 1MQ1A 4M2OA 1NUBA 1K9PA 1GJYA 4PHNA 1YX8A 4L9MA 4BY5A 1DT7B 2LE9B 1QXPA 1S6IA 3OX5A 4Q04A 1B8CA 1IJ6A 1ZACA 2KNEA 2KI6C 3OP0A 1K95A 2BL0B 2KQYA 2LANA 4JWQA 4MBEA 4YGDB 1JFKA 1QTXA 1PSBA 1WLZA 4PHJA 2LP2A 2M1UA 2KFFA 1W7JB 1XA5A 1PRWA 1DGUA 3KF9A 1QIWA 1QJTA 2M97A 2M3WA 4PALA 1Q80A 1B1GA 1DJIA 2ZN9A 2FCEA 2HPSA 4NDDA 5KTYA 1NCXA 3DD4A 2KAYA 1OZSA 4YI9A 4A4BA 2CXJA 1WLMA 2KDHA 1TTXA 1RK9A 2OS8C 1SCMC 2LP3A 1QLSA 1CFCA 1YUTA 2KFGA 4PHMA 2H61C 2VRGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CLL A;  1BR4 B;  1K90 D;  1LVC D;  1X02 A;  2JXC A;  2MA2 A;  2PVB A;  3GK4 X;  4BY4 A;  1QX7 A;  4CPV A;  4DCK A;  4P2Y B;  3KO0 A;  2TN4 A;  3ZWH A;  4QJ3 B;  5KU1 A;  2NLN A;  2I2R E;  1FI5 A;  3KHE A;  5PAL A;  5IBW A;  2WC8 A;  2HQW A;  1K9U A;  1SW8 A;  1KFX S;  1AP4 A;  2FOT A;  2Y1N A;  3MSE B;  4MSP A;  1FF1 A;  2AUC A;  3EVR A;  1A2X A;  3JTD C;  4JPZ B;  1CLM A;  2ZFD A;  3SG4 A;  4GUK A;  1DJG A;  1G4Y R;  2H2K A;  3A4U B;  2L0P A;  4FQO A;  5CSJ A;  1SR6 C;  4C0L A;  2K7B A;  2NCO A;  2JT8 A;  1CDP A;  1CMF A;  2KFH A;  3F45 A;  1TNP A;  2JTT A;  4OVN F;  5AAN A;  3K21 A;  1ODB A;  3JVT C;  4IL1 A;  2MAZ A;  1NIW A;  2M8U A;  4CFR A;  2KAX A;  3BOW A;  4YGE B;  3I5I B;  2CT9 A;  4YGA A;  1XK4 A;  4YGB B;  2I18 A;  4GGN A;  2LMT A;  3LK1 A;  1YUR A;  2LUC A;  4ICB A;  2K2F A;  2K7D A;  3TUY B;  3I5F B;  1EG4 A;  3VGO A;  2ZKM X;  2MHH A;  1BR1 B;  1REC A;  1B9A A;  2BBM A;  1M63 B;  2LVV A;  2ZRS A;  4P5O E;  1F70 A;  1CKK A;  1NX2 A;  2KBI A;  3SG7 A;  2JNF A;  3SG3 A;  1S1E A;  2HQ8 A;  3OB2 B;  2WND A;  3DF0 B;  1BMO A;  4CLN A;  1U5I A;  2MLE C;  1JUO A;  1PSR A;  1PK0 D;  2F2O A;  1EH2 A;  1MHO A;  2KQ6 A;  1FPW A;  1SR6 B;  1S6C A;  1NP8 A;  4MN0 A;  4WQ2 A;  4DUQ A;  1NSH A;  1RWY A;  2KYC A;  4XJK A;  3DVJ A;  1SNL A;  2L51 A;  1YRU B;  3BUN B;  1JC2 A;  3BYA A;  4N1F A;  1XVJ A;  2KYF A;  1LXF C;  1TCF A;  1NCZ A;  2ZNE A;  4WQ3 A;  1DF0 A;  4N1G A;  2KSP A;  1DTL A;  1AVS A;  1J1D A;  2JT0 A;  3IF7 A;  3SG5 A;  1IWQ A;  4C0K A;  2NCP A;  1BLQ A;  2FCD A;  1KQV A;  2ZND A;  3CWG A;  2WCE A;  1M31 A;  3AKA A;  3PN7 B;  1K9K A;  1J7R A;  1CLB A;  3I5G B;  1F54 A;  4UPG A;  1NWD A;  1SL7 A;  4I5J A;  4PE7 A;  1XK4 C;  5HKW A;  4PDZ A;  1CB1 A;  2KGB C;  2F8P A;  2JC2 A;  4HRG A;  2M1K B;  2WOS A;  2L4I A;  1SL9 A;  1AJ4 A;  3CR5 X;  1IRJ A;  3CZT X;  1UHK A;  1NPQ A;  3EKJ A;  2MRD A;  2RGI A;  3GK1 A;  4GPL B;  4U8D A;  1UHN A;  4ETO A;  1EJ3 A;  1UUS A;  3WNX B;  1WY9 A;  1B7T Z;  2GGZ A;  3EVU A;  4GGF A;  4MRX A;  1OSA A;  3VRP A;  1N65 A;  1IKU A;  3ICB A;  1OQP A;  2A4J A;  5DKR A;  1KK8 B;  2F3Z A;  4DRW A;  1FW4 A;  2EC6 B;  2WCF A;  1JWD A;  1MWN A;  4ORA B;  2I94 A;  3AAJ A;  1YUU A;  1J55 A;  1HQV A;  2OTG C;  2JUL A;  5JOL A;  2R2I A;  1OOJ A;  1MXE A;  1DJX A;  3I5H C;  4MVF A;  5ER4 X;  1CNP A;  2KI6 D;  1TCO B;  3BOW B;  1QX5 B;  2G9B A;  4PCW A;  2NZ0 A;  1H8B A;  1QAS A;  1LIN A;  3TDZ A;  1PVA A;  4YI8 A;  2CBL A;  2L5X B;  1KFU S;  2K61 A;  5HKZ A;  3TDI A;  1W7I B;  4YBH B;  1B47 A;  2O60 A;  3PLF B;  1F4O A;  1XO5 A;  3SG6 A;  2BE4 A;  2LV7 A;  1OE9 B;  3BXK A;  2K7C A;  1LA0 A;  2K2A A;  2Y1M A;  1SK6 D;  1JFJ A;  2V53 A;  4OCI A;  1MF8 B;  2Y5I A;  2L50 A;  1WDC C;  3LL8 B;  2QPT A;  2JOJ A;  3FWC A;  2KOT A;  1S26 D;  1ZMZ A;  2AMI A;  2JWW A;  3FS7 A;  1L2O C;  1QS7 A;  2AAO A;  2KHN A;  1QV0 A;  1N0Y A;  4FTG A;  1TNW A;  2LVI A;  3O78 A;  1M39 A;  5I2Q A;  1OMD A;  4CFQ A;  4AQJ A;  1L7Z A;  1CM4 A;  1XFW O;  1ZUZ A;  2L4H A;  3NSO A;  1IQ5 A;  3TS5 C;  2M0R A;  2IS9 A;  1XFU O;  1AHR A;  2OTG B;  4GGF C;  1ZOT B;  1KSO A;  2LHL A;  1NYA A;  1SMG A;  2OS8 B;  1SCM B;  1DF0 B;  2L2E A;  2F3Y A;  3PM8 A;  3CTN A;  1C7V A;  2Y4Q A;  1K2H A;  1A75 A;  3FWB A;  3PAT A;  1N2D A;  3M0W A;  5HLO A;  2JZI A;  2KI4 C;  5AEQ A;  3LCP C;  3O6B A;  2O5G A;  4NDB A;  1AUI B;  2CNP A;  3VRN A;  5GQQ C;  1KFX L;  1UWO A;  2ZN8 A;  1K93 D;  5B8I B;  2LHI A;  3JTD B;  4YGC B;  1YR5 A;  3O2P A;  3CR2 A;  1KSM A;  4GNK B;  1DJW A;  3RLZ A;  2BE6 A;  4A4C A;  2MJW B;  4PE1 A;  1YVH A;  1MUX A;  1R6P A;  1TIZ A;  2BCB A;  1S6J A;  1DJZ A;  5CSN A;  3JVT B;  1SYM A;  4M2Q A;  1CFP A;  4I5L B;  4GFT A;  2E30 A;  4MLW A;  3AAK A;  4CID A;  3CS1 A;  1J7Q A;  3AKB A;  2DOQ A;  1XYD A;  1GGW A;  1JSA A;  3WHT B;  1PUL A;  1TRF A;  5D69 A;  3D0Y A;  3BUO B;  4AOM A;  1KK7 Z;  2KI4 B;  2BL0 C;  1EG3 A;  5F6T A;  2EGD A;  2JRF A;  1IG5 A;  3WHU B;  4TNC A;  1XFY O;  3OX6 A;  5DKQ A;  2JXL A;  1RRO A;  1B8L A;  4ORC B;  2LVK A;  1KK7 Y;  5I2L A;  1VRK A;  2JU0 A;  3WXA A;  4QJ5 B;  1GQM A;  1RFJ A;  1NX0 A;  2LLS A;  2NXQ A;  2OPO A;  3KEV A;  4NDC A;  1K96 A;  4M2P A;  4XYN A;  1CM1 A;  2WCB A;  2GV5 A;  2JPT A;  1TOP A;  1V1F A;  5HYD A;  3CR4 X;  1M45 A;  3TZ1 A;  1G8I A;  1OMR A;  3KPX A;  5AER A;  1YUS A;  5I2O A;  4E68 A;  1SRA A;  4MZK A;  3LK0 A;  2GGM A;  3EK4 A;  3EVV A;  3VRQ A;  3OHM B;  4MZJ A;  1QLK A;  1ALW A;  2PMY A;  4WRI A;  1J7O A;  3H4S E;  2M7L A;  2BKH B;  1BU3 A;  1YVL A;  2HET A;  1OMV A;  1YX7 A;  3DF0 A;  4HRH A;  4GBA A;  1H4B A;  1B7T Y;  2BBN A;  1IGV A;  2JQ6 A;  2SCP A;  4MEW A;  1F71 A;  2LLT A;  1BOD A;  1HT9 A;  2D8N A;  3IQQ A;  2KGR A;  2COL B;  4DIR A;  1F55 A;  3OB1 B;  1RJV A;  2F2P A;  2PRU A;  3EKH A;  1C7W A;  1SKT A;  3FIA A;  1UP5 A;  3PSR A;  1XFZ O;  5TNC A;  1OZO A;  3DVK A;  4PHK A;  2LMV A;  2I7A A;  1KQM C;  1A03 A;  2LNK A;  1A75 B;  4ZCV A;  2MLF C;  3O4Y A;  1DVI A;  2HF5 A;  3GOF A;  1NX3 A;  1S36 A;  5KSZ A;  2CTN A;  2CCM A;  3C1V A;  1SY9 A;  1YRT B;  3VRR A;  2M7N A;  3DVE A;  1S3P A;  3BUM B;  1NX1 A;  1G33 A;  4MZL A;  1ZFS A;  4PE0 A;  3I5I C;  2ISD A;  3SIA A;  2BCA A;  1U5I B;  2Q4U A;  2K8M B;  1BJF A;  1MXL C;  2L98 A;  5K89 A;  1C07 A;  4DS7 A;  2LAP A;  1TNX A;  1JF0 A;  4GAO A;  3TUY C;  1EL4 A;  1A4P A;  1Y1X A;  2ZRT A;  5D7F A;  3I5F C;  2SAS A;  4ZCU A;  3SJS A;  1IH0 A;  1QVI Z;  2JNX A;  1V1G A;  1KWO C;  2EHB A;  4XJK B;  5HLV A;  4AQI A;  3PAL A;  3D10 A;  3A8R A;  4USL A;  1WRZ A;  3BUW B;  5AXI A;  2KBM A;  5G08 A;  3E3R A;  1JBA A;  3I5H B;  3TDU A;  1QAT A;  2F33 A;  2FJU B;  1QVI Y;  5CSF A;  1LKJ A;  5CSI A;  4R1E A;  1LA3 A;  3LLE A;  1J1E A;  1DJY A;  1M46 A;  3NXA A;  1AJ5 A;  1KQM B;  3HCM A;  4YRU A;  1IQ3 A;  1Y0V H;  2LVJ A;  5I8N A;  3D0Y B;  1KFU L;  1FBV A;  2LUX A;  2B1U A;  3EK7 A;  4JQ0 D;  2BKI B;  1YTZ C;  1Y1U A;  4I5K A;  1BT6 A;  3BUX B;  4NQG A;  2E6W A;  1Y6W A;  2LCP A;  1XFV O;  1FI6 A;  1WDC B;  3NSI A;  1Y1A A;  1CDN A;  1BG1 A;  2LLU A;  3SG2 A;  1PAL A;  5JJG A;  1L2O B;  2M9G A;  1D1O A;  1XFX O;  2MBX A;  2PSR A;  1GGZ A;  3ZNI A;  1UHH A;  4HSZ A;  1SBJ A;  3HX4 A;  1ALV A;  2KAV A;  1MR8 A;  1QV1 A;  1UUR A;  1DMO A;  5DKN A;  2QAC A;  1WRL A;  1KCY A;  3PN7 C;  1B8R A;  1TN4 A;  2WOR A;  1A29 A;  2Q91 A;  1QIV A;  3TS5 B;  1KWO B;  2G2B A;  1R2U A;  3I5G C;  1PVB A;  2M49 B;  1F4Q A;  2PAL A;  1EXR A;  1UHJ A;  2PAS A;  5BPJ A;  2K7O A;  2M29 A;  2LMU A;  1AK8 A;  1NCY A;  4N5X A;  2JTZ A;  4OR9 B;  5AFP A;  1IJ5 A;  3NSL A;  4OV2 A;  1CDL A;  1DGV A;  5J3X A;  1JF2 A;  1S5G Z;  4QJ4 B;  3CGA A;  1RTP 1;  3GK2 A;  4OKH A;  4HRE E;  4I5N B;  4ORB B;  2BCX A;  1CDM A;  3RM1 A;  5HKY A;  3NSK A;  1SPY A;  1SCV A;  3SIB A;  5FYX A;  4MRY A;  1S5G Y;  1DJH A;  1B4C A;  4PE4 A;  3VRO A;  5CPV A;  2P6B B;  4D1E A;  2K0J A;  1K94 A;  1BF5 A;  1BOC A;  1F8H A;  1KK8 C;  1CMG A;  3CLN A;  1WRK A;  1CTR A;  2EC6 C;  3IQO A;  5ER5 A;  2BEC A;  4C0J A;  2H61 A;  2JT3 A;  1QX2 A;  3BQ3 A;  1CFF A;  1K8U A;  1TNQ A;  2LC5 A;  1E8A A;  1J7P A;  1SL8 A;  1UHI A;  3DVM A;  3QRX A;  1CFD A;  3EK8 A;  2LM5 A;  3PFV A;  4F0Z B;  1MQ1 A;  4M2O A;  1NUB A;  1K9P A;  1GJY A;  4PHN A;  1YX8 A;  4L9M A;  4BY5 A;  1DT7 B;  2LE9 B;  1QXP A;  1S6I A;  3OX5 A;  4Q04 A;  1B8C A;  1IJ6 A;  1ZAC A;  2KNE A;  2KI6 C;  3OP0 A;  1K95 A;  2BL0 B;  2KQY A;  2LAN A;  4JWQ A;  4MBE A;  4YGD B;  1JFK A;  1QTX A;  1PSB A;  1WLZ A;  4PHJ A;  2LP2 A;  2M1U A;  2KFF A;  1W7J B;  1XA5 A;  1PRW A;  1DGU A;  3KF9 A;  1QIW A;  1QJT A;  2M97 A;  2M3W A;  4PAL A;  1Q80 A;  1B1G A;  1DJI A;  2ZN9 A;  2FCE A;  2HPS A;  4NDD A;  5KTY A;  1NCX A;  3DD4 A;  2KAY A;  1OZS A;  4YI9 A;  4A4B A;  2CXJ A;  1WLM A;  2KDH A;  1TTX A;  1RK9 A;  2OS8 C;  1SCM C;  2LP3 A;  1QLS A;  1CFC A;  1YUT A;  2KFG A;  4PHM A;  2H61 C;  2VRG A; 
#chains in the Genus database with same CATH topology
 1CLL A;  1BR4 B;  1K90 D;  1LVC D;  1X02 A;  2JXC A;  2MA2 A;  2PVB A;  3GK4 X;  4BY4 A;  1QX7 A;  4CPV A;  4DCK A;  4P2Y B;  3KO0 A;  2TN4 A;  3ZWH A;  4QJ3 B;  5KU1 A;  2NLN A;  2I2R E;  1FI5 A;  1OOH A;  3KHE A;  5PAL A;  5IBW A;  2WC8 A;  2HQW A;  1K9U A;  1SW8 A;  1KFX S;  1AP4 A;  2FOT A;  2Y1N A;  3MSE B;  4MSP A;  1FF1 A;  2AUC A;  3EVR A;  1OW4 A;  1A2X A;  3IVT A;  3JTD C;  4JPZ B;  1CLM A;  2ZFD A;  3SG4 A;  4GUK A;  1DJG A;  1G4Y R;  2H2K A;  3A4U B;  2L0P A;  4FQO A;  5CSJ A;  1SR6 C;  4C0L A;  2K7B A;  2NCO A;  2JT8 A;  5DIC A;  1CDP A;  1CMF A;  2KFH A;  3F45 A;  1TNP A;  2JTT A;  4OVN F;  5AAN A;  3K21 A;  3OGN A;  1ODB A;  1TUZ A;  3JVT C;  4IJ7 A;  4IL1 A;  2MAZ A;  1NIW A;  3BFA A;  3OBV A;  2M8U A;  2BAP A;  4CFR A;  2KAX A;  3BOW A;  4YGE B;  3BFB A;  2CT9 A;  3I5I B;  4YGA A;  5I94 A;  1XK4 A;  4YGB B;  2I18 A;  4GGN A;  2LMT A;  3LK1 A;  1YUR A;  2LUC A;  4ICB A;  2K2F A;  2K7D A;  3TUY B;  3I5F B;  1EG4 A;  3VGO A;  1QWV A;  2ZKM X;  2MHH A;  1BR1 B;  1REC A;  1B9A A;  2BBM A;  1M63 B;  3PM2 A;  2LVV A;  2ZRS A;  4P5O E;  1F70 A;  1CKK A;  3D77 A;  1NX2 A;  2KBI A;  3L47 A;  3SG7 A;  2JNF A;  3SG3 A;  1S1E A;  2HQ8 A;  3OB2 B;  2WND A;  3DF0 B;  1BMO A;  4CLN A;  1U5I A;  2MLE C;  5EL2 A;  1JUO A;  1PSR A;  1PK0 D;  2F2O A;  1EH2 A;  3DZT A;  1MHO A;  2KQ6 A;  1FPW A;  1SR6 B;  5FI6 A;  1S6C A;  1NP8 A;  4MN0 A;  4WQ2 A;  4DUQ A;  1NSH A;  1RWY A;  2KYC A;  4XJK A;  3DVJ A;  1SNL A;  2L51 A;  2WC5 A;  1YRU B;  3BUN B;  4PT1 A;  1JC2 A;  3BYA A;  4N1F A;  1XVJ A;  2KYF A;  1LXF C;  1TCF A;  1NCZ A;  2ZNE A;  4WQ3 A;  1DF0 A;  2L2C A;  4N1G A;  2KSP A;  1DTL A;  1AVS A;  1J1D A;  3CDN A;  2JT0 A;  3IF7 A;  3SG5 A;  1IWQ A;  4C0K A;  2NCP A;  1BLQ A;  2FCD A;  1KQV A;  2H8V A;  2ZND A;  1TWO A;  3CWG A;  2WCE A;  1M31 A;  3AKA A;  3PN7 B;  1K9K A;  1J7R A;  1CLB A;  3I5G B;  1F54 A;  4UPG A;  1NWD A;  1SL7 A;  4I5J A;  2GTE A;  3B86 A;  1XK4 C;  2WCL A;  4PE7 A;  5HKW A;  4JKT A;  4PDZ A;  1CB1 A;  1T14 A;  4F7F A;  2KGB C;  2F8P A;  2JC2 A;  4HRG A;  1Z4H A;  2M1K B;  2WOS A;  3V2L A;  2L4I A;  1SL9 A;  1AJ4 A;  3CR5 X;  3L4A A;  1IRJ A;  3CZT X;  1UHK A;  1NPQ A;  3EKJ A;  1W9Z A;  2MRD A;  2RGI A;  3GK1 A;  4GPL B;  4U8D A;  1UHN A;  4ETO A;  3S0B A;  1EJ3 A;  1UUS A;  3WNX B;  1WY9 A;  1B7T Z;  2GGZ A;  3EVU A;  4GGF A;  4MRX A;  1OSA A;  3VRP A;  1N65 A;  1IKU A;  3ICB A;  1OQP A;  2A4J A;  5DKR A;  1KK8 B;  2F3Z A;  4DRW A;  1FW4 A;  1OOI X;  2EC6 B;  2WCF A;  1JWD A;  3Q8I A;  1MWN A;  4ORA B;  2I94 A;  3AAJ A;  3CZ0 A;  1YUU A;  1J55 A;  1HQV A;  2OTG C;  2JUL A;  5JOL A;  3D74 A;  2R2I A;  1OOJ A;  1MXE A;  1DJX A;  3I5H C;  4MVF A;  5ER4 X;  1CNP A;  2KI6 D;  1TCO B;  3BOW B;  1QX5 B;  2G9B A;  4PCW A;  2NZ0 A;  1H8B A;  1QAS A;  1LIN A;  3TDZ A;  1PVA A;  4YI8 A;  2CBL A;  2L5X B;  1KFU S;  2K61 A;  5HKZ A;  3TDI A;  1W7I B;  4YBH B;  1B47 A;  2O60 A;  3PLF B;  1F4O A;  1XO5 A;  2QEB A;  3SG6 A;  2BE4 A;  2LV7 A;  1Z2C B;  1OE9 B;  1C3Y A;  3BXK A;  2K7C A;  1LA0 A;  2K2A A;  2Y1M A;  1SK6 D;  1JFJ A;  2V53 A;  4OCI A;  1MF8 B;  2Y5I A;  2L50 A;  1WDC C;  3LL8 B;  2QPT A;  2JOJ A;  3FWC A;  2KOT A;  1S26 D;  1ZMZ A;  2AMI A;  2JWW A;  4JD9 A;  3D75 A;  3FS7 A;  1L2O C;  1QS7 A;  2AAO A;  3SS3 A;  2KHN A;  1QV0 A;  1N0Y A;  4FTG A;  1TNW A;  3QME A;  2LVI A;  3O78 A;  1M39 A;  5I2Q A;  1OMD A;  4CFQ A;  2YGU A;  1L7Z A;  1CM4 A;  1XFW O;  1ZUZ A;  2L4H A;  2WCM A;  3NSO A;  4AQJ A;  1IQ5 A;  3TS5 C;  3FE9 A;  2M0R A;  2IS9 A;  3D73 A;  1XFU O;  1AHR A;  2OTG B;  4GGF C;  1ZOT B;  1KSO A;  2P71 A;  2LHL A;  1NYA A;  1SMG A;  2OS8 B;  1SCM B;  1DF0 B;  2L2E A;  3D76 A;  3FE8 A;  2F3Y A;  3PM8 A;  3S0E A;  3CTN A;  1C7V A;  2KPH A;  2Y4Q A;  3BJH A;  1K2H A;  1A75 A;  3FWB A;  3PAT A;  4OZD A;  1N2D A;  3M0W A;  5HLO A;  2JZI A;  2KI4 C;  5AEQ A;  3LCP C;  2JPO A;  3O6B A;  2O5G A;  4NDB A;  3CAB A;  1AUI B;  2CNP A;  2K60 A;  3S0D A;  5GQQ C;  3VRN A;  1KFX L;  1UWO A;  2ZN8 A;  3B7A A;  1K93 D;  5B8I B;  2LHI A;  3JTD B;  4YGC B;  1YR5 A;  3O2P A;  3CR2 A;  1KSM A;  4GNK B;  1DJW A;  3RLZ A;  3SS4 A;  2BE6 A;  4A4C A;  2MJW B;  4PE1 A;  1YVH A;  1MUX A;  1R6P A;  1TIZ A;  2BCB A;  3BFH A;  1DC1 A;  1S6J A;  1DJZ A;  5CSN A;  3JVT B;  3R1O A;  1SYM A;  3N7H A;  4M2Q A;  1CFP A;  4I5L B;  4GFT A;  1LS8 A;  2E30 A;  4MLW A;  3AAK A;  4CID A;  3CS1 A;  1J7Q A;  2ERB A;  3AKB A;  2DOQ A;  1XYD A;  1GGW A;  1JSA A;  3WHT B;  1PUL A;  1TRF A;  5D69 A;  3D0Y A;  2KLD A;  3BUO B;  4AOM A;  1KK7 Z;  2QEH A;  2KI4 B;  2BL0 C;  3SS5 A;  1EG3 A;  3UNW A;  5F6T A;  2EGD A;  2JRF A;  1IG5 A;  3WHU B;  2WCH A;  4TNC A;  1ORG A;  1XFY O;  3OX6 A;  5DKQ A;  2JXL A;  1RRO A;  1B8L A;  4ORC B;  2LVK A;  1KK7 Y;  5I2L A;  1VRK A;  2JU0 A;  1TUJ A;  3WXA A;  4QJ5 B;  1GQM A;  3B88 A;  1RFJ A;  1NX0 A;  2LLS A;  2NXQ A;  2OPO A;  3KEV A;  4NDC A;  1K96 A;  4M2P A;  4XYN A;  1CM1 A;  2WCB A;  2GV5 A;  3R72 A;  2JPT A;  1TOP A;  1V1F A;  3FE6 A;  5HYD A;  3CR4 X;  1M45 A;  3DY9 A;  1G8I A;  1OMR A;  3KPX A;  3TZ1 A;  1YUS A;  5AER A;  5I2O A;  4E68 A;  1C3Z A;  1SRA A;  4MZK A;  3VB1 A;  3LK0 A;  2GGM A;  3EK4 A;  3B6X A;  1IH0 A;  3EVV A;  3VRQ A;  3OHM B;  4MZJ A;  1QLK A;  1ALW A;  2PMY A;  3CZ1 A;  3K1E A;  3H4S E;  4WRI A;  1J7O A;  2M7L A;  2BKH B;  1BU3 A;  1YVL A;  2HET A;  1OMV A;  1YX7 A;  3DF0 A;  4HRH A;  4GBA A;  1H4B A;  4INX A;  1B7T Y;  2BBN A;  1IGV A;  2JQ6 A;  2SCP A;  4MEW A;  5FI2 A;  1F71 A;  2LLT A;  1BOD A;  1HT9 A;  2D8N A;  3IQQ A;  2KGR A;  2COL B;  3DYE A;  3O4X A;  4DIR A;  1OOG A;  3OB1 B;  1F55 A;  1RJV A;  2F2P A;  2PRU A;  3EKH A;  1C7W A;  1SKT A;  1GM0 A;  3FIA A;  1UP5 A;  3PSR A;  1XFZ O;  5TNC A;  1OZO A;  3DVK A;  3CZ2 A;  4PHK A;  2LMV A;  2I7A A;  1KQM C;  1A03 A;  2LNK A;  1A75 B;  4ZCV A;  2MLF C;  3O4Y A;  3UO9 A;  1DVI A;  2HF5 A;  3GOF A;  1NX3 A;  1S36 A;  4FQT A;  5KSZ A;  3R1P A;  2CTN A;  2CCM A;  3C1V A;  1SY9 A;  1YRT B;  2PQL A;  3VRR A;  2M7N A;  3DVE A;  1S3P A;  3BUM B;  1NX1 A;  1G33 A;  4MZL A;  1ZFS A;  4PE0 A;  3I5I C;  2ISD A;  3SIA A;  2BCA A;  1U5I B;  2Q4U A;  3EG5 B;  2K8M B;  1BJF A;  1MXL C;  2L98 A;  5K89 A;  1C07 A;  4DS7 A;  2LAP A;  1TNX A;  1JF0 A;  4GAO A;  3TUY C;  1EL4 A;  1A4P A;  1Y1X A;  2WC6 A;  2ZRT A;  3I5F C;  2SAS A;  4KYN A;  5D7F A;  4ZCU A;  1QVI Z;  2JNX A;  2WCJ A;  3SJS A;  1V1G A;  1KWO C;  2EHB A;  4XJK B;  5FI7 A;  5HLV A;  3PAL A;  4AQI A;  3D10 A;  3A8R A;  4USL A;  1WRZ A;  3BUW B;  5AXI A;  2KBM A;  5G08 A;  3E3R A;  1JBA A;  3I5H B;  3TDU A;  1QAT A;  3S0F A;  2QDI A;  2F33 A;  2FJU B;  1QVI Y;  5CSF A;  1LKJ A;  5CSI A;  4R1E A;  1LA3 A;  3LLE A;  3S0G A;  3S0A A;  1J1E A;  1DJY A;  1M46 A;  2KLE A;  3NXA A;  1AJ5 A;  1KQM B;  3HCM A;  4YRU A;  1IQ3 A;  1Y0V H;  2LVJ A;  5I8N A;  3D0Y B;  1KFU L;  1FBV A;  3RZS A;  2LUX A;  2B1U A;  3EK7 A;  4JQ0 D;  2BKI B;  1Y1U A;  1YTZ C;  4I5K A;  1BT6 A;  3BUX B;  4NQG A;  2E6W A;  1Y6W A;  2LCP A;  1XFV O;  1FI6 A;  1WDC B;  3NSI A;  1Y1A A;  1OOF A;  1BG1 A;  2LLU A;  1CDN A;  3SG2 A;  1PAL A;  5JJG A;  1L2O B;  2M9G A;  1D1O A;  1XFX O;  2MBX A;  2PSR A;  1GGZ A;  3ZNI A;  1UHH A;  4HSZ A;  1SBJ A;  3HX4 A;  1ALV A;  2KAV A;  1MR8 A;  1QV1 A;  1UUR A;  2BNX A;  1DMO A;  5DKN A;  2QAC A;  1WRL A;  1KCY A;  3PN7 C;  1B8R A;  1TN4 A;  2WOR A;  1A29 A;  2Q91 A;  1QIV A;  3TS5 B;  1KWO B;  2G2B A;  1R2U A;  3I5G C;  1PVB A;  2M49 B;  1F4Q A;  2PAL A;  1EXR A;  2FJY A;  1UHJ A;  2QEO A;  3L4L A;  3NGV A;  2PAS A;  5BPJ A;  2K7O A;  2M29 A;  2LMU A;  2WCK A;  1AK8 A;  1NCY A;  4N5X A;  2JTZ A;  4OR9 B;  5AFP A;  1IJ5 A;  3NSL A;  4OV2 A;  1CDL A;  1DGV A;  3CYZ A;  5J3X A;  1JF2 A;  1S5G Z;  4QJ4 B;  3CGA A;  1RTP 1;  3GK2 A;  4OKH A;  4HRE E;  4I5N B;  4ORB B;  2BCX A;  1CDM A;  3RM1 A;  1P28 A;  3NSK A;  5HKY A;  1SPY A;  1SCV A;  3SIB A;  5FYX A;  4MRY A;  1S5G Y;  1DJH A;  1B4C A;  4PE4 A;  3VRO A;  5CPV A;  2P6B B;  4D1E A;  2K0J A;  1K94 A;  1DQE A;  3PJI A;  5D3O A;  1BF5 A;  1BOC A;  1F8H A;  1KK8 C;  1CMG A;  3CLN A;  1WRK A;  1CTR A;  2EC6 C;  3IQO A;  5ER5 A;  2BEC A;  4C0J A;  2H61 A;  1IIO A;  1SSE B;  2JT3 A;  1QX2 A;  3BQ3 A;  1CFF A;  1K8U A;  1TNQ A;  2LC5 A;  1E8A A;  1J7P A;  1SL8 A;  1UHI A;  3DVM A;  3QRX A;  1CFD A;  3EK8 A;  3R1V A;  2LM5 A;  3PFV A;  4F0Z B;  1MQ1 A;  4M2O A;  1NUB A;  1K9P A;  1GJY A;  4PHN A;  1YX8 A;  4L9M A;  4BY5 A;  2PYQ A;  1DT7 B;  2LE9 B;  1QXP A;  1S6I A;  3OX5 A;  4Q04 A;  1B8C A;  1IJ6 A;  1ZAC A;  2KNE A;  2KI6 C;  3OP0 A;  2L5Y A;  1K95 A;  2BL0 B;  2KQY A;  2LAN A;  3D78 A;  3NHT A;  4JWQ A;  4MBE A;  4YGD B;  1JFK A;  1QTX A;  1PSB A;  1WLZ A;  2P70 A;  4PHJ A;  2LP2 A;  2M1U A;  2KFF A;  1W7J B;  1XA5 A;  3NHI A;  1PRW A;  1DGU A;  3KF9 A;  1QIW A;  1QJT A;  2M97 A;  2M3W A;  3B87 A;  4PAL A;  5HL1 A;  3DXL A;  1Q80 A;  1DEK A;  1DJI A;  1B1G A;  2ZN9 A;  2QEV A;  2FCE A;  2HPS A;  4INW A;  4NDD A;  5KTY A;  1NCX A;  3DD4 A;  2KAY A;  1OZS A;  1XFR A;  4YI9 A;  4A4B A;  2CXJ A;  1WLM A;  2KDH A;  1TTX A;  1RK9 A;  1DEL A;  2OS8 C;  1SCM C;  2LP3 A;  1QLS A;  1CFC A;  1YUT A;  2KFG A;  4PHM A;  2H61 C;  2VRG A; 
#chains in the Genus database with same CATH homology
 1CLL A;  1BR4 B;  1K90 D;  1LVC D;  1X02 A;  2JXC A;  2MA2 A;  2PVB A;  3GK4 X;  4BY4 A;  1QX7 A;  4CPV A;  4DCK A;  4P2Y B;  3KO0 A;  2TN4 A;  3ZWH A;  4QJ3 B;  5KU1 A;  2NLN A;  2I2R E;  1FI5 A;  3KHE A;  5PAL A;  5IBW A;  2WC8 A;  2HQW A;  1K9U A;  1SW8 A;  1KFX S;  1AP4 A;  2FOT A;  2Y1N A;  3MSE B;  4MSP A;  1FF1 A;  2AUC A;  3EVR A;  1A2X A;  3JTD C;  4JPZ B;  1CLM A;  2ZFD A;  3SG4 A;  4GUK A;  1DJG A;  1G4Y R;  2H2K A;  3A4U B;  2L0P A;  4FQO A;  5CSJ A;  1SR6 C;  4C0L A;  2K7B A;  2NCO A;  2JT8 A;  1CDP A;  1CMF A;  2KFH A;  3F45 A;  1TNP A;  2JTT A;  4OVN F;  5AAN A;  3K21 A;  1ODB A;  3JVT C;  4IL1 A;  2MAZ A;  1NIW A;  2M8U A;  4CFR A;  2KAX A;  3BOW A;  4YGE B;  3I5I B;  2CT9 A;  4YGA A;  1XK4 A;  4YGB B;  2I18 A;  4GGN A;  2LMT A;  3LK1 A;  1YUR A;  2LUC A;  4ICB A;  2K2F A;  2K7D A;  3TUY B;  3I5F B;  1EG4 A;  3VGO A;  2ZKM X;  2MHH A;  1BR1 B;  1REC A;  1B9A A;  2BBM A;  1M63 B;  2LVV A;  2ZRS A;  4P5O E;  1F70 A;  1CKK A;  1NX2 A;  2KBI A;  3SG7 A;  2JNF A;  3SG3 A;  1S1E A;  2HQ8 A;  3OB2 B;  2WND A;  3DF0 B;  1BMO A;  4CLN A;  1U5I A;  2MLE C;  1JUO A;  1PSR A;  1PK0 D;  2F2O A;  1EH2 A;  1MHO A;  2KQ6 A;  1FPW A;  1SR6 B;  1S6C A;  1NP8 A;  4MN0 A;  4WQ2 A;  4DUQ A;  1NSH A;  1RWY A;  2KYC A;  4XJK A;  3DVJ A;  1SNL A;  2L51 A;  1YRU B;  3BUN B;  1JC2 A;  3BYA A;  4N1F A;  1XVJ A;  2KYF A;  1LXF C;  1TCF A;  1NCZ A;  2ZNE A;  4WQ3 A;  1DF0 A;  4N1G A;  2KSP A;  1DTL A;  1AVS A;  1J1D A;  2JT0 A;  3IF7 A;  3SG5 A;  1IWQ A;  4C0K A;  2NCP A;  1BLQ A;  2FCD A;  1KQV A;  2ZND A;  3CWG A;  2WCE A;  1M31 A;  3AKA A;  3PN7 B;  1K9K A;  1J7R A;  1CLB A;  3I5G B;  1F54 A;  4UPG A;  1NWD A;  1SL7 A;  4I5J A;  4PE7 A;  1XK4 C;  5HKW A;  4PDZ A;  1CB1 A;  2KGB C;  2F8P A;  2JC2 A;  4HRG A;  2M1K B;  2WOS A;  2L4I A;  1SL9 A;  1AJ4 A;  3CR5 X;  1IRJ A;  3CZT X;  1UHK A;  1NPQ A;  3EKJ A;  2MRD A;  2RGI A;  3GK1 A;  4GPL B;  4U8D A;  1UHN A;  4ETO A;  1EJ3 A;  1UUS A;  3WNX B;  1WY9 A;  1B7T Z;  2GGZ A;  3EVU A;  4GGF A;  4MRX A;  1OSA A;  3VRP A;  1N65 A;  1IKU A;  3ICB A;  1OQP A;  2A4J A;  5DKR A;  1KK8 B;  2F3Z A;  4DRW A;  1FW4 A;  2EC6 B;  2WCF A;  1JWD A;  1MWN A;  4ORA B;  2I94 A;  3AAJ A;  1YUU A;  1J55 A;  1HQV A;  2OTG C;  2JUL A;  5JOL A;  2R2I A;  1OOJ A;  1MXE A;  1DJX A;  3I5H C;  4MVF A;  5ER4 X;  1CNP A;  2KI6 D;  1TCO B;  3BOW B;  1QX5 B;  2G9B A;  4PCW A;  2NZ0 A;  1H8B A;  1QAS A;  1LIN A;  3TDZ A;  1PVA A;  4YI8 A;  2CBL A;  2L5X B;  1KFU S;  2K61 A;  5HKZ A;  3TDI A;  1W7I B;  4YBH B;  1B47 A;  2O60 A;  3PLF B;  1F4O A;  1XO5 A;  3SG6 A;  2BE4 A;  2LV7 A;  1OE9 B;  3BXK A;  2K7C A;  1LA0 A;  2K2A A;  2Y1M A;  1SK6 D;  1JFJ A;  2V53 A;  4OCI A;  1MF8 B;  2Y5I A;  2L50 A;  1WDC C;  3LL8 B;  2QPT A;  2JOJ A;  3FWC A;  2KOT A;  1S26 D;  1ZMZ A;  2AMI A;  2JWW A;  3FS7 A;  1L2O C;  1QS7 A;  2AAO A;  2KHN A;  1QV0 A;  1N0Y A;  4FTG A;  1TNW A;  2LVI A;  3O78 A;  1M39 A;  5I2Q A;  1OMD A;  4CFQ A;  4AQJ A;  1L7Z A;  1CM4 A;  1XFW O;  1ZUZ A;  2L4H A;  3NSO A;  1IQ5 A;  3TS5 C;  2M0R A;  2IS9 A;  1XFU O;  1AHR A;  2OTG B;  4GGF C;  1ZOT B;  1KSO A;  2LHL A;  1NYA A;  1SMG A;  2OS8 B;  1SCM B;  1DF0 B;  2L2E A;  2F3Y A;  3PM8 A;  3CTN A;  1C7V A;  2Y4Q A;  1K2H A;  1A75 A;  3FWB A;  3PAT A;  1N2D A;  3M0W A;  5HLO A;  2JZI A;  2KI4 C;  5AEQ A;  3LCP C;  3O6B A;  2O5G A;  4NDB A;  1AUI B;  2CNP A;  3VRN A;  5GQQ C;  1KFX L;  1UWO A;  2ZN8 A;  1K93 D;  5B8I B;  2LHI A;  3JTD B;  4YGC B;  1YR5 A;  3O2P A;  3CR2 A;  1KSM A;  4GNK B;  1DJW A;  3RLZ A;  2BE6 A;  4A4C A;  2MJW B;  4PE1 A;  1YVH A;  1MUX A;  1R6P A;  1TIZ A;  2BCB A;  1S6J A;  1DJZ A;  5CSN A;  3JVT B;  1SYM A;  4M2Q A;  1CFP A;  4I5L B;  4GFT A;  2E30 A;  4MLW A;  3AAK A;  4CID A;  3CS1 A;  1J7Q A;  3AKB A;  2DOQ A;  1XYD A;  1GGW A;  1JSA A;  3WHT B;  1PUL A;  1TRF A;  5D69 A;  3D0Y A;  3BUO B;  4AOM A;  1KK7 Z;  2KI4 B;  2BL0 C;  1EG3 A;  5F6T A;  2EGD A;  2JRF A;  1IG5 A;  3WHU B;  4TNC A;  1XFY O;  3OX6 A;  5DKQ A;  2JXL A;  1RRO A;  1B8L A;  4ORC B;  2LVK A;  1KK7 Y;  5I2L A;  1VRK A;  2JU0 A;  3WXA A;  4QJ5 B;  1GQM A;  1RFJ A;  1NX0 A;  2LLS A;  2NXQ A;  2OPO A;  3KEV A;  4NDC A;  1K96 A;  4M2P A;  4XYN A;  1CM1 A;  2WCB A;  2GV5 A;  2JPT A;  1TOP A;  1V1F A;  5HYD A;  3CR4 X;  1M45 A;  3TZ1 A;  1G8I A;  1OMR A;  3KPX A;  5AER A;  1YUS A;  5I2O A;  4E68 A;  1SRA A;  4MZK A;  3LK0 A;  2GGM A;  3EK4 A;  3EVV A;  3VRQ A;  3OHM B;  4MZJ A;  1QLK A;  1ALW A;  2PMY A;  4WRI A;  1J7O A;  3H4S E;  2M7L A;  2BKH B;  1BU3 A;  1YVL A;  2HET A;  1OMV A;  1YX7 A;  3DF0 A;  4HRH A;  4GBA A;  1H4B A;  1B7T Y;  2BBN A;  1IGV A;  2JQ6 A;  2SCP A;  4MEW A;  1F71 A;  2LLT A;  1BOD A;  1HT9 A;  2D8N A;  3IQQ A;  2KGR A;  2COL B;  4DIR A;  1F55 A;  3OB1 B;  1RJV A;  2F2P A;  2PRU A;  3EKH A;  1C7W A;  1SKT A;  3FIA A;  1UP5 A;  3PSR A;  1XFZ O;  5TNC A;  1OZO A;  3DVK A;  4PHK A;  2LMV A;  2I7A A;  1KQM C;  1A03 A;  2LNK A;  1A75 B;  4ZCV A;  2MLF C;  3O4Y A;  1DVI A;  2HF5 A;  3GOF A;  1NX3 A;  1S36 A;  5KSZ A;  2CTN A;  2CCM A;  3C1V A;  1SY9 A;  1YRT B;  3VRR A;  2M7N A;  3DVE A;  1S3P A;  3BUM B;  1NX1 A;  1G33 A;  4MZL A;  1ZFS A;  4PE0 A;  3I5I C;  2ISD A;  3SIA A;  2BCA A;  1U5I B;  2Q4U A;  2K8M B;  1BJF A;  1MXL C;  2L98 A;  5K89 A;  1C07 A;  4DS7 A;  2LAP A;  1TNX A;  1JF0 A;  4GAO A;  3TUY C;  1EL4 A;  1A4P A;  1Y1X A;  2ZRT A;  5D7F A;  3I5F C;  2SAS A;  4ZCU A;  3SJS A;  1IH0 A;  1QVI Z;  2JNX A;  1V1G A;  1KWO C;  2EHB A;  4XJK B;  5HLV A;  4AQI A;  3PAL A;  3D10 A;  3A8R A;  4USL A;  1WRZ A;  3BUW B;  5AXI A;  2KBM A;  5G08 A;  3E3R A;  1JBA A;  3I5H B;  3TDU A;  1QAT A;  2F33 A;  2FJU B;  1QVI Y;  5CSF A;  1LKJ A;  5CSI A;  4R1E A;  1LA3 A;  3LLE A;  1J1E A;  1DJY A;  1M46 A;  3NXA A;  1AJ5 A;  1KQM B;  3HCM A;  4YRU A;  1IQ3 A;  1Y0V H;  2LVJ A;  5I8N A;  3D0Y B;  1KFU L;  1FBV A;  2LUX A;  2B1U A;  3EK7 A;  4JQ0 D;  2BKI B;  1YTZ C;  1Y1U A;  4I5K A;  1BT6 A;  3BUX B;  4NQG A;  2E6W A;  1Y6W A;  2LCP A;  1XFV O;  1FI6 A;  1WDC B;  3NSI A;  1Y1A A;  1CDN A;  1BG1 A;  2LLU A;  3SG2 A;  1PAL A;  5JJG A;  1L2O B;  2M9G A;  1D1O A;  1XFX O;  2MBX A;  2PSR A;  1GGZ A;  3ZNI A;  1UHH A;  4HSZ A;  1SBJ A;  3HX4 A;  1ALV A;  2KAV A;  1MR8 A;  1QV1 A;  1UUR A;  1DMO A;  5DKN A;  2QAC A;  1WRL A;  1KCY A;  3PN7 C;  1B8R A;  1TN4 A;  2WOR A;  1A29 A;  2Q91 A;  1QIV A;  3TS5 B;  1KWO B;  2G2B A;  1R2U A;  3I5G C;  1PVB A;  2M49 B;  1F4Q A;  2PAL A;  1EXR A;  1UHJ A;  2PAS A;  5BPJ A;  2K7O A;  2M29 A;  2LMU A;  1AK8 A;  1NCY A;  4N5X A;  2JTZ A;  4OR9 B;  5AFP A;  1IJ5 A;  3NSL A;  4OV2 A;  1CDL A;  1DGV A;  5J3X A;  1JF2 A;  1S5G Z;  4QJ4 B;  3CGA A;  1RTP 1;  3GK2 A;  4OKH A;  4HRE E;  4I5N B;  4ORB B;  2BCX A;  1CDM A;  3RM1 A;  5HKY A;  3NSK A;  1SPY A;  1SCV A;  3SIB A;  5FYX A;  4MRY A;  1S5G Y;  1DJH A;  1B4C A;  4PE4 A;  3VRO A;  5CPV A;  2P6B B;  4D1E A;  2K0J A;  1K94 A;  1BF5 A;  1BOC A;  1F8H A;  1KK8 C;  1CMG A;  3CLN A;  1WRK A;  1CTR A;  2EC6 C;  3IQO A;  5ER5 A;  2BEC A;  4C0J A;  2H61 A;  2JT3 A;  1QX2 A;  3BQ3 A;  1CFF A;  1K8U A;  1TNQ A;  2LC5 A;  1E8A A;  1J7P A;  1SL8 A;  1UHI A;  3DVM A;  3QRX A;  1CFD A;  3EK8 A;  2LM5 A;  3PFV A;  4F0Z B;  1MQ1 A;  4M2O A;  1NUB A;  1K9P A;  1GJY A;  4PHN A;  1YX8 A;  4L9M A;  4BY5 A;  1DT7 B;  2LE9 B;  1QXP A;  1S6I A;  3OX5 A;  4Q04 A;  1B8C A;  1IJ6 A;  1ZAC A;  2KNE A;  2KI6 C;  3OP0 A;  1K95 A;  2BL0 B;  2KQY A;  2LAN A;  4JWQ A;  4MBE A;  4YGD B;  1JFK A;  1QTX A;  1PSB A;  1WLZ A;  4PHJ A;  2LP2 A;  2M1U A;  2KFF A;  1W7J B;  1XA5 A;  1PRW A;  1DGU A;  3KF9 A;  1QIW A;  1QJT A;  2M97 A;  2M3W A;  4PAL A;  1Q80 A;  1B1G A;  1DJI A;  2ZN9 A;  2FCE A;  2HPS A;  4NDD A;  5KTY A;  1NCX A;  3DD4 A;  2KAY A;  1OZS A;  4YI9 A;  4A4B A;  2CXJ A;  1WLM A;  2KDH A;  1TTX A;  1RK9 A;  2OS8 C;  1SCM C;  2LP3 A;  1QLS A;  1CFC A;  1YUT A;  2KFG A;  4PHM A;  2H61 C;  2VRG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...