2M8UA

Solution structure of the dictyostelium discodieum myosin light chain, mlcc
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
77
structure length
77
Chain Sequence
b'GSHMNHINTKAQVIEAFKVFDRDGNGYVTVDYLRKVLNELGDMMPADEIEEMIYEADPQNSGYVQYETFVGMLFLWD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Myosin Light Chain, MlcC
publication title Structure of the Single-lobe Myosin Light Chain C in Complex with the Light Chain-binding Domains of Myosin-1C Provides Insights into Divergent IQ Motif Recognition.
pubmed doi rcsb
source organism Dictyostelium discoideum
molecule tags Contractile protein
total genus 16
structure length 77
sequence length 77
ec nomenclature
pdb deposition date 2013-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2m8uA00
1S26D 3VGOA 4JQ0D 1XA5A 2IS9A 3I5GB 4GGNA 3TUYC 4XYNA 3KF9A 1SKTA 1CDMA 2BKHB 1NPQA 2ZRTA 1S5GZ 2M0RA 3BUOB 1H4BA 2KAVA 2I7AA 2LVJA 2HQ8A 2LMTA 1DGUA 1J7RA 1KCYA 5GQQC 1TCFA 3NSKA 3OB2B 2LVVA 1JSAA 3D0YA 1SPYA 3NXAA 2EC6C 1J7PA 1JF0A 2EGDA 5AEQA 1L2OC 2MHHA 1F4OA 1V1GA 1OMVA 1NX0A 1B8CA 1KK8B 4PHJA 3A8RA 1F4QA 2KYFA 3VROA 3WHTB 2L4IA 1TCOB 3NSIA 4I5KA 1KQVA 1QTXA 5JOLA 1D1OA 1F71A 5HLVA 1PRWA 2B1UA 1CLMA 1KWOB 1CDLA 2PVBA 1EJ3A 1QASA 2I94A 2KFFA 3BQ3A 2KYCA 2KAXA 2L0PA 2L50A 5HKWA 2LNKA 5DKRA 2Q4UA 1QATA 1DJGA 1IWQA 5ER5A 1YRTB 5B8IB 1M45A 1JWDA 4N1GA 4OCIA 3PN7B 4GGFC 1QS7A 1A29A 3KEVA 2WNDA 1PVBA 2KI6C 1WY9A 1FW4A 2H61C 4PHKA 1XFWO 2RGIA 1BMOA 1DVIA 1K9PA 1KK7Z 1GQMA 3KHEA 2F8PA 1OZOA 1SNLA 2KDHA 3OX5A 3IQQA 3GK4X 4WRIA 4ZCVA 3DVKA 1FF1A 1NP8A 1ALWA 1K9UA 2K0JA 2K61A 3RM1A 1F55A 3FWBA 1YVHA 1F70A 1Y6WA 4MRXA 1JBAA 3TDZA 2K7CA 2BECA 2BCBA 2JC2A 2LM5A 1IH0A 2LP2A 4MBEA 2GGMA 2BBMA 4IL1A 1EG4A 2M9GA 4GGFA 4TNCA 4AOMA 1TNWA 1CDPA 3TDUA 2BCAA 2JT0A 3PALA 2JTTA 2H61A 4QJ4B 1A75B 1CB1A 1UHIA 2PALA 1IJ5A 1EG3A 2KOTA 3BOWA 2WC8A 2MLEC 1CFDA 1XVJA 3AKAA 1SR6B 1KWOC 1IQ3A 1HQVA 1FI5A 4M2OA 3I5HB 2M49B 3CR4X 1DF0A 3DD4A 1AJ5A 2Y4QA 4M2PA 4PE1A 1CKKA 2L4HA 2ZN8A 5CPVA 1CM4A 2KGRA 4GBAA 1BF5A 1BJFA 1SRAA 2OS8C 4YBHB 1M39A 4UPGA 1AP4A 1NX1A 2TN4A 2G9BA 1UHHA 1UUSA 2K7BA 2E30A 1QIWA 3OX6A 3CZTX 4YGDB 1GGWA 2AAOA 2JWWA 2HETA 2L51A 3TZ1A 2SASA 1NWDA 1S36A 4P5OE 2M1KB 3OB1B 4ZCUA 4C0LA 3VRQA 1MWNA 3O6BA 1UHJA 2NXQA 3EK7A 2NLNA 3JTDB 4ORBB 5AXIA 1XFXO 2MBXA 5D69A 5DKQA 1A03A 3AAKA 3FWCA 1L7ZA 5I2OA 2L5XB 1QLKA 2OTGC 5J3XA 4OKHA 3NSOA 5AERA 3EVRA 4PHMA 3VRRA 2BE4A 3SIAA 1ZFSA 3CWGA 1J1EA 2JXCA 3BUXB 1S6JA 1WRZA 1QV1A 2M97A 1Y1XA 1YUTA 4PHNA 1SYMA 3DVEA 2AMIA 2K8MB 3SG6A 1DGVA 2COLB 5I8NA 2JT8A 1QIVA 1MUXA 1IRJA 1TN4A 4MLWA 2LUCA 1PALA 1JC2A 1PK0D 3I5HC 1EXRA 2KQ6A 2WCFA 1A75A 4AQIA 2M7NA 5AANA 1ZMZA 1TNPA 1RECA 1X02A 3EVUA 3FS7A 3IF7A 4M2QA 1NIWA 2K7DA 4NDDA 4MEWA 3RLZA 2FCDA 1N65A 3IQOA 1DJYA 4N1FA 1BR4B 4NDCA 3GK2A 1YR5A 3SG2A 1IKUA 4GNKB 5DKNA 2BL0B 2KNEA 1PULA 1SCMB 1MXEA 2O60A 1A4PA 1CTRA 3I5FC 4BY4A 1AHRA 1DMOA 2JULA 4DS7A 5F6TA 4FTGA 2LANA 1BOCA 4XJKA 1K93D 3BUMB 1YTZC 4YRUA 4Q04A 2M29A 1M46A 1SMGA 1XK4C 1ZACA 2GV5A 3I5GC 1QJTA 1DT7B 3NSLA 1W7IB 1KFUS 1AUIB 3LCPC 3WHUB 1KQMB 1V1FA 3TS5B 4YGCB 3DF0B 5K89A 2K2AA 1R2UA 2HQWA 1ZUZA 1TTXA 1K94A 4PE7A 2LV7A 4YGBB 3PSRA 1J1DA 1G8IA 5HLOA 1TIZA 5JJGA 2L98A 1SCVA 1XYDA 2QPTA 3KPXA 2CBLA 5CSIA 2JT3A 4WQ2A 4MSPA 2BKIB 2PSRA 1MXLC 1K90D 3BYAA 5PALA 1AJ4A 4DCKA 2CTNA 1TNXA 1YUUA 1ODBA 2WCBA 1PSRA 1OZSA 1RK9A 2JZIA 1VRKA 1KK8C 5IBWA 1LXFC 1RFJA 4JPZB 4ICBA 1NUBA 2ZNDA 3WXAA 4D1EA 1OSAA 2GGZA 1IJ6A 1LKJA 1B4CA 2F2PA 1PSBA 4ORCB 4AQJA 4CIDA 1SW8A 2BL0C 1J7QA 2WCEA 3GOFA 3FIAA 1SCMC 3O2PA 2I18A 3LK1A 3D0YB 1U5IB 1RJVA 4I5LB 1NCYA 1FPWA 4NQGA 1B47A 5BPJA 4MVFA 4CFRA 1UURA 1XFUO 3AKBA 3TUYB 3VRNA 3PN7C 1BR1B 5FYXA 2LLUA 3ZNIA 3A4UB 2M1UA 2ZNEA 1QX5B 5HKZA 3LK0A 1DJWA 4GUKA 1M63B 3QRXA 1S6CA 1NCZA 2Y1NA 4HRHA 4PDZA 5I2LA 3EKJA 3GK1A 1BG1A 1KQMC 1BODA 4E68A 2R2IA 4C0KA 1NSHA 2Q91A 1B7TZ 2LC5A 2EC6B 4HREE 1YURA 2LMVA 3AAJA 2PRUA 2KBMA 1OQPA 4OR9B 1PVAA 2E6WA 1IG5A 1FBVA 1L2OB 2ZFDA 2KFGA 3LL8B 4PALA 1KFXL 1G33A 1H8BA 1K2HA 1WRKA 1CMFA 1UWOA 3EVVA 4QJ3B 4YI8A 3ZWHA 1Q80A 2DOQA 3WNXB 3CR5X 4QJ5B 3SIBA 2JNXA 1F8HA 4DUQA 2F3YA 2SCPA 4F0ZB 4MN0A 3O78A 1IQ5A 1UHKA 2D8NA 2LVKA 5KTYA 2M7LA 3OHMB 1OMRA 3K21A 1E8AA 2JTZA 1C07A 2LHLA 2LLTA 1RROA 4MRYA 4PE4A 1UHNA 1QV0A 1DTLA 1SR6C 1M31A 1S3PA 3H4SE 5ER4X 1CM1A 2MLFC 3MSEB 4HSZA 1C7VA 2KQYA 1DJIA 5G08A 1F54A 4DIRA 2MJWB 1LA0A 2QACA 1WLZA 3BUNB 1J7OA 4P2YB 1S6IA 1YRUB 4YGAA 1K95A 2KI6D 1KSMA 4USLA 1RTP1 1N2DA 5CSNA 3PLFB 2KBIA 2Y5IA 1JFJA 1YVLA 2KI4B 3DVJA 1QX2A 2H2KA 1WRLA 3PM8A 3BOWB 2JU0A 2MAZA 2Y1MA 2L2EA 1CDNA 1FI6A 2JNFA 1DJZA 2AUCA 2A4JA 4GPLB 3JVTB 1B9AA 1YX8A 1B8LA 1WLMA 1EH2A 1K96A 1A2XA 1CFFA 1QVIY 3I5IB 1DF0B 3C1VA 3JTDC 2HPSA 1NCXA 2K7OA 5D7FA 1U5IA 2LAPA 1YUSA 2PMYA 4FQOA 2LVIA 1B7TY 4OV2A 5HYDA 5KSZA 1NYAA 2F2OA 1S1EA 5CSJA 5KU1A 2KSPA 1R6PA 1WDCB 4GFTA 3LLEA 1XFYO 2VRGA 3VRPA 4HRGA 4CPVA 2LLSA 1C7WA 5CSFA 2EHBA 5HKYA 4R1EA 1CLBA 1MF8B 2BBNA 1ALVA 1KSOA 2JXLA 1B8RA 2KFHA 4JWQA 1XFVO 3CR2A 1KFUL 1LINA 2KGBC 1LVCD 1OMDA 3CLNA 3E3RA 2BCXA 3O4YA 2OS8B 3CTNA 2G2BA 2F33A 2I2RE 4MZLA 4A4CA 2V53A 3BUWB 2OPOA 3SG4A 1EL4A 4U8DA 1MQ1A 2WOSA 2K2FA 1MR8A 1TNQA 1ZOTB 3SG5A 1CFCA 1XK4A 1G4YR 2JOJA 4ORAB 4BY5A 2KAYA 5AFPA 2NZ0A 1AK8A 2KI4C 4WQ3A 1CFPA 2ZRSA 1K9KA 1MHOA 1SK6D 2CT9A 3TDIA 1DJXA 3EKHA 4YI9A 3JVTC 1JUOA 1BU3A 1SL9A 1S5GY 2O5GA 1Y1UA 2FOTA 1NX3A 1YX7A 3HX4A 1LA3A 3I5IC 3KO0A 2LUXA 2OTGB 1DJHA 4ETOA 1QLSA 2JPTA 3SG7A 1JFKA 2M3WA 2HF5A 1GJYA 3PFVA 4DRWA 2P6BB 1WDCC 1OOJA 2FCEA 1W7JB 2MA2A 3PATA 4I5JA 4MZJA 2WORA 1XFZO 1NX2A 2FJUB 4OVNF 1QVIZ 3DVMA 1B1GA 1SL7A 1CMGA 2BE6A 3EK4A 3EK8A 3TS5C 2JRFA 2ISDA 2NCOA 1GGZA 1IGVA 3D10A 4MZKA 1CLLA 2CCMA 4I5NB 4N5XA 1UP5A 1JF2A 2LHIA 1XO5A 5I2QA 4GAOA 1K8UA 1BLQA 2CNPA 1Y1AA 1TOPA 4XJKB 4YGEB 1N0YA 2JQ6A 2M8UA 4CFQA 1J55A 4PCWA 5TNCA 2LP3A 2MRDA 1SY9A 3CS1A 2LE9B 1SBJA 3SG3A 1CNPA 1OE9B 3CGAA 4NDBA 1KK7Y 1SL8A 2PASA 3ICBA 3BXKA 4A4BA 2KHNA 2NCPA 3DF0A 3OP0A 4C0JA 2F3ZA 1QX7A 3HCMA 3I5FB 1RWYA 1TRFA 2ZKMX 3SJSA 2ZN9A 4PE0A 1BT6A 2LCPA 1Y0VH 2LMUA 1QXPA 1KFXS 4CLNA 1AVSA 1HT9A 3M0WA 2CXJA 3F45A 4L9MA
chains in the Genus database with same CATH superfamily
1S26D 3VGOA 4JQ0D 1XA5A 2IS9A 3I5GB 4GGNA 3SS5A 3TUYC 4XYNA 3KF9A 1SKTA 1CDMA 2BKHB 4JKTA 1NPQA 2ZRTA 1S5GZ 2M0RA 3BUOB 1H4BA 2KAVA 1DC1A 2I7AA 2LVJA 2HQ8A 2LMTA 1DGUA 1J7RA 2GTEA 1KCYA 5GQQC 1TCFA 3UO9A 3NSKA 3OB2B 2LVVA 1JSAA 3D0YA 2BNXA 1SPYA 3NXAA 2EC6C 1J7PA 1OOGA 1JF0A 2EGDA 5AEQA 1L2OC 2MHHA 1IIOA 1F4OA 1V1GA 1OMVA 1NX0A 1B8CA 1KK8B 4PHJA 5I94A 3FE8A 3A8RA 1F4QA 2KYFA 3Q8IA 3VROA 3WHTB 1XFRA 2L4IA 1TCOB 3NSIA 4I5KA 1KQVA 1QTXA 5JOLA 1D1OA 1F71A 5HLVA 1PRWA 2B1UA 1CLMA 1KWOB 1CDLA 3CYZA 1CNPA 2PVBA 1EJ3A 1QASA 2I94A 2KFFA 3BQ3A 1TUZA 2KAXA 2KYCA 2L0PA 2L50A 3DY9A 3OGNA 5HKWA 2LNKA 2H8VA 5DKRA 2Q4UA 1QATA 1DJGA 1IWQA 5ER5A 1YRTB 5B8IB 1M45A 1JWDA 4N1GA 4OCIA 3PN7B 4GGFC 1QS7A 1A29A 2YGUA 3KEVA 2WNDA 1PVBA 2KI6C 1WY9A 1FW4A 2H61C 3D75A 1XFWO 2RGIA 4PHKA 1BMOA 1DVIA 1K9PA 1KK7Z 5DICA 1GQMA 3BJHA 3KHEA 2F8PA 1OZOA 1SNLA 2KDHA 3OX5A 3IQQA 3GK4X 4WRIA 3D74A 3DVKA 4ZCVA 1FF1A 1NP8A 1ALWA 1K9UA 2K0JA 2K61A 3RM1A 1F55A 3FWBA 2QDIA 1YVHA 1F70A 1Y6WA 4MRXA 1JBAA 3TDZA 2K7CA 2BECA 2BCBA 2JC2A 2LM5A 4INWA 1IH0A 1GM0A 2LP2A 4MBEA 2GGMA 2BBMA 4IL1A 2WCHA 1EG4A 2M9GA 4GGFA 4TNCA 4AOMA 3BFHA 2QEOA 1TNWA 1CDPA 3TDUA 2BCAA 2JT0A 3PALA 2JTTA 2H61A 4QJ4B 1A75B 1C3YA 1CB1A 3D76A 1UHIA 2PALA 1IJ5A 1EG3A 2KOTA 3BOWA 3PM2A 2WC8A 2MLEC 1CFDA 1DQEA 3S0DA 1XVJA 3BFAA 3AKAA 1SR6B 3OBVA 1KWOC 4F7FA 5HL1A 1DELA 1IQ3A 1HQVA 1FI5A 2P71A 4M2OA 3I5HB 2M49B 3CR4X 1DF0A 3DD4A 1AJ5A 2Y4QA 4M2PA 4PE1A 1CKKA 2L4HA 2ZN8A 5CPVA 1CM4A 3B88A 3D78A 2KGRA 4GBAA 4INXA 1BF5A 1BJFA 1SRAA 2OS8C 4YBHB 1M39A 4UPGA 1AP4A 1NX1A 3R72A 2TN4A 2G9BA 1UHHA 1UUSA 3L4LA 2K7BA 2E30A 1QIWA 3OX6A 3CZTX 4YGDB 1GGWA 2AAOA 2JWWA 3S0FA 2HETA 2L51A 3TZ1A 2SASA 2FJYA 1NWDA 1S36A 4P5OE 2M1KB 3OB1B 4ZCUA 4C0LA 3VRQA 1MWNA 3O6BA 1UHJA 2NXQA 3EK7A 2NLNA 3JTDB 4ORBB 5AXIA 1XFXO 2MBXA 3S0EA 5D69A 5DKQA 5FI7A 1A03A 3AAKA 3FWCA 3VB1A 1L7ZA 5I2OA 2L5XB 1QLKA 2JPOA 2OTGC 2K60A 4OKHA 5J3XA 3SS3A 3NSOA 5AERA 2KPHA 3EVRA 3CZ1A 4PHMA 3VRRA 2BE4A 3SIAA 1ZFSA 3CWGA 1J1EA 1P28A 2JXCA 3BUXB 1S6JA 1WRZA 2WCJA 1QV1A 2M97A 1Y1XA 1YUTA 4PHNA 1SYMA 3DVEA 2AMIA 2K8MB 3SG6A 1DGVA 2COLB 5I8NA 2JT8A 1QIVA 1MUXA 1IRJA 1TN4A 4MLWA 2LUCA 1PALA 1JC2A 1PK0D 3I5HC 1EXRA 2KQ6A 2WCFA 1A75A 2P70A 4AQIA 3DZTA 2M7NA 5AANA 1ZMZA 1TNPA 1RECA 1X02A 3EVUA 3FS7A 3IF7A 3EG5B 1NIWA 4M2QA 2K7DA 4NDDA 4MEWA 3RLZA 2FCDA 1N65A 3IQOA 1DJYA 4N1FA 1BR4B 3V2LA 4NDCA 3GK2A 1YR5A 3SG2A 3DXLA 1C3ZA 3RZSA 1IKUA 1Z4HA 4GNKB 5D3OA 5DKNA 2BL0B 2KNEA 1PULA 1SCMB 1MXEA 2O60A 1A4PA 1CTRA 3I5FC 2BAPA 4BY4A 1AHRA 3NHTA 1DMOA 2JULA 4DS7A 5F6TA 4FTGA 2LANA 2KLDA 1BOCA 1SSEB 3L4AA 4XJKA 2QEVA 1K93D 3BUMB 1YTZC 4YRUA 4Q04A 2M29A 1M46A 1SMGA 1XK4C 1ZACA 2GV5A 3I5GC 1QJTA 1DT7B 3NSLA 1W7IB 3D77A 1KFUS 1AUIB 3LCPC 3WHUB 1KQMB 1V1FA 3TS5B 4YGCB 3DF0B 5K89A 2K2AA 1R2UA 2HQWA 1ZUZA 3CZ0A 1TTXA 1K94A 4PE7A 2LV7A 3B7AA 3PSRA 4OZDA 4YGBB 1J1DA 1G8IA 5HLOA 1TIZA 5JJGA 2L98A 1SCVA 1XYDA 2QPTA 3KPXA 2CBLA 1TUJA 5CSIA 2JT3A 4WQ2A 4MSPA 2BKIB 2PSRA 1MXLC 1K90D 3BYAA 5PALA 1AJ4A 4DCKA 2CTNA 1TNXA 1YUUA 1ODBA 2WCBA 3FE6A 1PSRA 3D73A 1OZSA 1RK9A 2JZIA 1VRKA 1KK8C 5IBWA 1LXFC 1RFJA 2QEBA 4JPZB 3S0BA 4ICBA 1NUBA 2ZNDA 3WXAA 4D1EA 1OSAA 2GGZA 1IJ6A 1LKJA 1B4CA 2F2PA 1PSBA 3B87A 4ORCB 4AQJA 4CIDA 1SW8A 1OOHA 2BL0C 1J7QA 2WCEA 3GOFA 3BFBA 3FIAA 1SCMC 3O2PA 3B6XA 2I18A 3LK1A 3D0YB 1U5IB 1RJVA 4I5LB 1NCYA 1FPWA 4NQGA 1B47A 5BPJA 4MVFA 4CFRA 1UURA 1XFUO 3AKBA 3TUYB 3VRNA 3PN7C 1BR1B 1OOFA 2LLUA 5FYXA 3A4UB 2M1UA 3ZNIA 2ZNEA 1QX5B 5HKZA 3LK0A 1DJWA 4GUKA 1M63B 3QRXA 1S6CA 1NCZA 2Y1NA 4HRHA 4PDZA 2PQLA 5I2LA 3EKJA 3GK1A 1BG1A 1KQMC 1BODA 4E68A 2R2IA 4C0KA 1NSHA 3DYEA 2Q91A 4JD9A 1B7TZ 2LC5A 3L47A 1W9ZA 2EC6B 4HREE 1OOIX 1YURA 2LMVA 3AAJA 2PRUA 2KBMA 1OQPA 4OR9B 1PVAA 2E6WA 1IG5A 1FBVA 1L2OB 1F54A 2ZFDA 2KFGA 3LL8B 4PALA 1KFXL 1G33A 1H8BA 1K2HA 1WRKA 1CMFA 1UWOA 3EVVA 4QJ3B 4YI8A 3ZWHA 1Q80A 2DOQA 3WNXB 3CR5X 4QJ5B 3SIBA 2JNXA 1F8HA 4DUQA 2F3YA 2SCPA 4F0ZB 4MN0A 3O78A 1IQ5A 1UHKA 2D8NA 2LVKA 5KTYA 2M7LA 3OHMB 3CDNA 1OMRA 3K21A 1E8AA 2JTZA 1C07A 2LHLA 2LLTA 1RROA 4MRYA 4PE4A 1UHNA 1QV0A 3UNWA 1DTLA 1SR6C 1M31A 1S3PA 3H4SE 5ER4X 4KYNA 1CM1A 2MLFC 3FE9A 3MSEB 4HSZA 2KQYA 1DJIA 5G08A 1C7VA 4DIRA 2MJWB 1LA0A 2QACA 1DEKA 1WLZA 3BUNB 4P2YB 1J7OA 1S6IA 1YRUB 4YGAA 1K95A 4PT1A 2KI6D 1KSMA 2PYQA 4USLA 1RTP1 1N2DA 5CSNA 3PLFB 2KBIA 2Y5IA 1JFJA 2QEHA 1YVLA 2KI4B 3DVJA 1QX2A 2H2KA 1WRLA 3PM8A 3BOWB 3NHIA 2JU0A 2KLEA 2MAZA 2L2EA 2Y1MA 1CDNA 2JNFA 1FI6A 1DJZA 2A4JA 2AUCA 4GPLB 3JVTB 1B9AA 1YX8A 1B8LA 1WLMA 3K1EA 1EH2A 1K96A 1A2XA 1Z2CB 1CFFA 1QVIY 3I5IB 1DF0B 3C1VA 3JTDC 5FI2A 2HPSA 1NCXA 2K7OA 5D7FA 3S0AA 1U5IA 2LAPA 1YUSA 2PMYA 4FQOA 3R1VA 2LVIA 1B7TY 4OV2A 5HYDA 5KSZA 3R1PA 1NYAA 2F2OA 1S1EA 5CSJA 5KU1A 2L5YA 2KSPA 1R6PA 1WDCB 4GFTA 3LLEA 1XFYO 2VRGA 1T14A 3VRPA 4HRGA 4CPVA 2LLSA 5FI6A 1C7WA 5CSFA 2EHBA 3PJIA 4FQTA 4R1EA 5HKYA 1MF8B 2BBNA 2WCLA 1ALVA 2WCMA 1CLBA 1KSOA 2JXLA 1B8RA 2KFHA 4JWQA 1XFVO 3CR2A 1KFUL 1LINA 2KGBC 1LS8A 1LVCD 1OMDA 3CLNA 3E3RA 2BCXA 3CABA 1ORGA 3O4YA 3QMEA 2OS8B 3CTNA 2G2BA 2F33A 2I2RE 4MZLA 4A4CA 2V53A 3BUWB 2OPOA 3SG4A 1EL4A 4U8DA 1MQ1A 2WOSA 3NGVA 2ERBA 2K2FA 1MR8A 1TNQA 1ZOTB 3SG5A 1CFCA 1XK4A 1G4YR 2JOJA 4ORAB 4BY5A 2KAYA 5AFPA 2NZ0A 1AK8A 2KI4C 4WQ3A 1CFPA 2ZRSA 1K9KA 1MHOA 1SK6D 2CT9A 3CZ2A 2WC5A 3TDIA 1DJXA 3EKHA 4YI9A 3JVTC 1JUOA 1BU3A 1SL9A 1S5GY 2O5GA 1Y1UA 2FOTA 1NX3A 1YX7A 3HX4A 2L2CA 1LA3A 3I5IC 3KO0A 2LUXA 2OTGB 1TWOA 5EL2A 3S0GA 1DJHA 4ETOA 1QLSA 2JPTA 3SG7A 1JFKA 2M3WA 2WC6A 2HF5A 1GJYA 3PFVA 4DRWA 2P6BB 4IJ7A 1WDCC 1OOJA 2FCEA 1W7JB 2MA2A 3PATA 4I5JA 4MZJA 2WORA 1XFZO 1NX2A 2FJUB 2WCKA 1QVIZ 3DVMA 4OVNF 1SL7A 1B1GA 1CMGA 2BE6A 3EK4A 3EK8A 3SS4A 3TS5C 2JRFA 2ISDA 2NCOA 1GGZA 1IGVA 3D10A 4MZKA 1CLLA 2CCMA 4I5NB 4N5XA 3B86A 1UP5A 1JF2A 2LHIA 1XO5A 5I2QA 4GAOA 1K8UA 1BLQA 2CNPA 1Y1AA 3R1OA 1TOPA 4XJKB 3N7HA 4YGEB 1N0YA 2JQ6A 2M8UA 4CFQA 1J55A 4PCWA 5TNCA 2LP3A 2MRDA 1SY9A 3CS1A 2LE9B 1QWVA 1SBJA 3SG3A 1OE9B 1OW4A 3CGAA 4NDBA 1KK7Y 1SL8A 2PASA 3ICBA 3BXKA 4A4BA 2KHNA 2NCPA 3DF0A 3OP0A 4C0JA 2F3ZA 1QX7A 3HCMA 3I5FB 1RWYA 1TRFA 2ZKMX 3SJSA 2ZN9A 4PE0A 1BT6A 3IVTA 2LCPA 1Y0VH 2LMUA 1QXPA 3O4XA 1KFXS 4CLNA 1AVSA 1HT9A 3M0WA 2CXJA 3F45A 4L9MA
chains in the Genus database with same CATH topology
1S26D 3VGOA 4JQ0D 1XA5A 2IS9A 3I5GB 4GGNA 3TUYC 4XYNA 3KF9A 1SKTA 1CDMA 2BKHB 1NPQA 2ZRTA 1S5GZ 2M0RA 3BUOB 1H4BA 2KAVA 2I7AA 2LVJA 2HQ8A 2LMTA 1DGUA 1J7RA 1KCYA 5GQQC 1TCFA 3NSKA 3OB2B 2LVVA 1JSAA 3D0YA 1SPYA 3NXAA 2EC6C 1J7PA 1JF0A 2EGDA 5AEQA 1L2OC 2MHHA 1F4OA 1V1GA 1OMVA 1NX0A 1B8CA 1KK8B 4PHJA 3A8RA 1F4QA 2KYFA 3VROA 3WHTB 2L4IA 1TCOB 3NSIA 4I5KA 1KQVA 1QTXA 5JOLA 1D1OA 1F71A 5HLVA 1PRWA 2B1UA 1CLMA 1KWOB 1CDLA 2PVBA 1EJ3A 1QASA 2I94A 2KFFA 3BQ3A 2KYCA 2KAXA 2L0PA 2L50A 5HKWA 2LNKA 5DKRA 2Q4UA 1QATA 1DJGA 1IWQA 5ER5A 1YRTB 5B8IB 1M45A 1JWDA 4N1GA 4OCIA 3PN7B 4GGFC 1QS7A 1A29A 3KEVA 2WNDA 1PVBA 2KI6C 1WY9A 1FW4A 2H61C 4PHKA 1XFWO 2RGIA 1BMOA 1DVIA 1K9PA 1KK7Z 1GQMA 3KHEA 2F8PA 1OZOA 1SNLA 2KDHA 3OX5A 3IQQA 3GK4X 4WRIA 4ZCVA 3DVKA 1FF1A 1NP8A 1ALWA 1K9UA 2K0JA 2K61A 3RM1A 1F55A 3FWBA 1YVHA 1F70A 1Y6WA 4MRXA 1JBAA 3TDZA 2K7CA 2BECA 2BCBA 2JC2A 2LM5A 1IH0A 2LP2A 4MBEA 2GGMA 2BBMA 4IL1A 1EG4A 2M9GA 4GGFA 4TNCA 4AOMA 1TNWA 1CDPA 3TDUA 2BCAA 2JT0A 3PALA 2JTTA 2H61A 4QJ4B 1A75B 1CB1A 1UHIA 2PALA 1IJ5A 1EG3A 2KOTA 3BOWA 2WC8A 2MLEC 1CFDA 1XVJA 3AKAA 1SR6B 1KWOC 1IQ3A 1HQVA 1FI5A 4M2OA 3I5HB 2M49B 3CR4X 1DF0A 3DD4A 1AJ5A 2Y4QA 4M2PA 4PE1A 1CKKA 2L4HA 2ZN8A 5CPVA 1CM4A 2KGRA 4GBAA 1BF5A 1BJFA 1SRAA 2OS8C 4YBHB 1M39A 4UPGA 1AP4A 1NX1A 2TN4A 2G9BA 1UHHA 1UUSA 2K7BA 2E30A 1QIWA 3OX6A 3CZTX 4YGDB 1GGWA 2AAOA 2JWWA 2HETA 2L51A 3TZ1A 2SASA 1NWDA 1S36A 4P5OE 2M1KB 3OB1B 4ZCUA 4C0LA 3VRQA 1MWNA 3O6BA 1UHJA 2NXQA 3EK7A 2NLNA 3JTDB 4ORBB 5AXIA 1XFXO 2MBXA 5D69A 5DKQA 1A03A 3AAKA 3FWCA 1L7ZA 5I2OA 2L5XB 1QLKA 2OTGC 5J3XA 4OKHA 3NSOA 5AERA 3EVRA 4PHMA 3VRRA 2BE4A 3SIAA 1ZFSA 3CWGA 1J1EA 2JXCA 3BUXB 1S6JA 1WRZA 1QV1A 2M97A 1Y1XA 1YUTA 4PHNA 1SYMA 3DVEA 2AMIA 2K8MB 3SG6A 1DGVA 2COLB 5I8NA 2JT8A 1QIVA 1MUXA 1IRJA 1TN4A 4MLWA 2LUCA 1PALA 1JC2A 1PK0D 3I5HC 1EXRA 2KQ6A 2WCFA 1A75A 4AQIA 2M7NA 5AANA 1ZMZA 1TNPA 1RECA 1X02A 3EVUA 3FS7A 3IF7A 4M2QA 1NIWA 2K7DA 4NDDA 4MEWA 3RLZA 2FCDA 1N65A 3IQOA 1DJYA 4N1FA 1BR4B 4NDCA 3GK2A 1YR5A 3SG2A 1IKUA 4GNKB 5DKNA 2BL0B 2KNEA 1PULA 1SCMB 1MXEA 2O60A 1A4PA 1CTRA 3I5FC 4BY4A 1AHRA 1DMOA 2JULA 4DS7A 5F6TA 4FTGA 2LANA 1BOCA 4XJKA 1K93D 3BUMB 1YTZC 4YRUA 4Q04A 2M29A 1M46A 1SMGA 1XK4C 1ZACA 2GV5A 3I5GC 1QJTA 1DT7B 3NSLA 1W7IB 1KFUS 1AUIB 3LCPC 3WHUB 1KQMB 1V1FA 3TS5B 4YGCB 3DF0B 5K89A 2K2AA 1R2UA 2HQWA 1ZUZA 1TTXA 1K94A 4PE7A 2LV7A 4YGBB 3PSRA 1J1DA 1G8IA 5HLOA 1TIZA 5JJGA 2L98A 1SCVA 1XYDA 2QPTA 3KPXA 2CBLA 5CSIA 2JT3A 4WQ2A 4MSPA 2BKIB 2PSRA 1MXLC 1K90D 3BYAA 5PALA 1AJ4A 4DCKA 2CTNA 1TNXA 1YUUA 1ODBA 2WCBA 1PSRA 1OZSA 1RK9A 2JZIA 1VRKA 1KK8C 5IBWA 1LXFC 1RFJA 4JPZB 4ICBA 1NUBA 2ZNDA 3WXAA 4D1EA 1OSAA 2GGZA 1IJ6A 1LKJA 1B4CA 2F2PA 1PSBA 4ORCB 4AQJA 4CIDA 1SW8A 2BL0C 1J7QA 2WCEA 3GOFA 3FIAA 1SCMC 3O2PA 2I18A 3LK1A 3D0YB 1U5IB 1RJVA 4I5LB 1NCYA 1FPWA 4NQGA 1B47A 5BPJA 4MVFA 4CFRA 1UURA 1XFUO 3AKBA 3TUYB 3VRNA 3PN7C 1BR1B 5FYXA 2LLUA 3ZNIA 3A4UB 2M1UA 2ZNEA 1QX5B 5HKZA 3LK0A 1DJWA 4GUKA 1M63B 3QRXA 1S6CA 1NCZA 2Y1NA 4HRHA 4PDZA 5I2LA 3EKJA 3GK1A 1BG1A 1KQMC 1BODA 4E68A 2R2IA 4C0KA 1NSHA 2Q91A 1B7TZ 2LC5A 2EC6B 4HREE 1YURA 2LMVA 3AAJA 2PRUA 2KBMA 1OQPA 4OR9B 1PVAA 2E6WA 1IG5A 1FBVA 1L2OB 2ZFDA 2KFGA 3LL8B 4PALA 1KFXL 1G33A 1H8BA 1K2HA 1WRKA 1CMFA 1UWOA 3EVVA 4QJ3B 4YI8A 3ZWHA 1Q80A 2DOQA 3WNXB 3CR5X 4QJ5B 3SIBA 2JNXA 1F8HA 4DUQA 2F3YA 2SCPA 4F0ZB 4MN0A 3O78A 1IQ5A 1UHKA 2D8NA 2LVKA 5KTYA 2M7LA 3OHMB 1OMRA 3K21A 1E8AA 2JTZA 1C07A 2LHLA 2LLTA 1RROA 4MRYA 4PE4A 1UHNA 1QV0A 1DTLA 1SR6C 1M31A 1S3PA 3H4SE 5ER4X 1CM1A 2MLFC 3MSEB 4HSZA 1C7VA 2KQYA 1DJIA 5G08A 1F54A 4DIRA 2MJWB 1LA0A 2QACA 1WLZA 3BUNB 1J7OA 4P2YB 1S6IA 1YRUB 4YGAA 1K95A 2KI6D 1KSMA 4USLA 1RTP1 1N2DA 5CSNA 3PLFB 2KBIA 2Y5IA 1JFJA 1YVLA 2KI4B 3DVJA 1QX2A 2H2KA 1WRLA 3PM8A 3BOWB 2JU0A 2MAZA 2Y1MA 2L2EA 1CDNA 1FI6A 2JNFA 1DJZA 2AUCA 2A4JA 4GPLB 3JVTB 1B9AA 1YX8A 1B8LA 1WLMA 1EH2A 1K96A 1A2XA 1CFFA 1QVIY 3I5IB 1DF0B 3C1VA 3JTDC 2HPSA 1NCXA 2K7OA 5D7FA 1U5IA 2LAPA 1YUSA 2PMYA 4FQOA 2LVIA 1B7TY 4OV2A 5HYDA 5KSZA 1NYAA 2F2OA 1S1EA 5CSJA 5KU1A 2KSPA 1R6PA 1WDCB 4GFTA 3LLEA 1XFYO 2VRGA 3VRPA 4HRGA 4CPVA 2LLSA 1C7WA 5CSFA 2EHBA 5HKYA 4R1EA 1CLBA 1MF8B 2BBNA 1ALVA 1KSOA 2JXLA 1B8RA 2KFHA 4JWQA 1XFVO 3CR2A 1KFUL 1LINA 2KGBC 1LVCD 1OMDA 3CLNA 3E3RA 2BCXA 3O4YA 2OS8B 3CTNA 2G2BA 2F33A 2I2RE 4MZLA 4A4CA 2V53A 3BUWB 2OPOA 3SG4A 1EL4A 4U8DA 1MQ1A 2WOSA 2K2FA 1MR8A 1TNQA 1ZOTB 3SG5A 1CFCA 1XK4A 1G4YR 2JOJA 4ORAB 4BY5A 2KAYA 5AFPA 2NZ0A 1AK8A 2KI4C 4WQ3A 1CFPA 2ZRSA 1K9KA 1MHOA 1SK6D 2CT9A 3TDIA 1DJXA 3EKHA 4YI9A 3JVTC 1JUOA 1BU3A 1SL9A 1S5GY 2O5GA 1Y1UA 2FOTA 1NX3A 1YX7A 3HX4A 1LA3A 3I5IC 3KO0A 2LUXA 2OTGB 1DJHA 4ETOA 1QLSA 2JPTA 3SG7A 1JFKA 2M3WA 2HF5A 1GJYA 3PFVA 4DRWA 2P6BB 1WDCC 1OOJA 2FCEA 1W7JB 2MA2A 3PATA 4I5JA 4MZJA 2WORA 1XFZO 1NX2A 2FJUB 4OVNF 1QVIZ 3DVMA 1B1GA 1SL7A 1CMGA 2BE6A 3EK4A 3EK8A 3TS5C 2JRFA 2ISDA 2NCOA 1GGZA 1IGVA 3D10A 4MZKA 1CLLA 2CCMA 4I5NB 4N5XA 1UP5A 1JF2A 2LHIA 1XO5A 5I2QA 4GAOA 1K8UA 1BLQA 2CNPA 1Y1AA 1TOPA 4XJKB 4YGEB 1N0YA 2JQ6A 2M8UA 4CFQA 1J55A 4PCWA 5TNCA 2LP3A 2MRDA 1SY9A 3CS1A 2LE9B 1SBJA 3SG3A 1CNPA 1OE9B 3CGAA 4NDBA 1KK7Y 1SL8A 2PASA 3ICBA 3BXKA 4A4BA 2KHNA 2NCPA 3DF0A 3OP0A 4C0JA 2F3ZA 1QX7A 3HCMA 3I5FB 1RWYA 1TRFA 2ZKMX 3SJSA 2ZN9A 4PE0A 1BT6A 2LCPA 1Y0VH 2LMUA 1QXPA 1KFXS 4CLNA 1AVSA 1HT9A 3M0WA 2CXJA 3F45A 4L9MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1S26 D;  3VGO A;  4JQ0 D;  1XA5 A;  2IS9 A;  3I5G B;  4GGN A;  3TUY C;  4XYN A;  3KF9 A;  1SKT A;  1CDM A;  2BKH B;  1NPQ A;  2ZRT A;  1S5G Z;  2M0R A;  3BUO B;  1H4B A;  2KAV A;  2I7A A;  2LVJ A;  2HQ8 A;  2LMT A;  1DGU A;  1J7R A;  1KCY A;  5GQQ C;  1TCF A;  3NSK A;  3OB2 B;  2LVV A;  1JSA A;  3D0Y A;  1SPY A;  3NXA A;  2EC6 C;  1J7P A;  1JF0 A;  2EGD A;  5AEQ A;  1L2O C;  2MHH A;  1F4O A;  1V1G A;  1OMV A;  1NX0 A;  1B8C A;  1KK8 B;  4PHJ A;  3A8R A;  1F4Q A;  2KYF A;  3VRO A;  3WHT B;  2L4I A;  1TCO B;  3NSI A;  4I5K A;  1KQV A;  1QTX A;  5JOL A;  1D1O A;  1F71 A;  5HLV A;  1PRW A;  2B1U A;  1CLM A;  1KWO B;  1CDL A;  2PVB A;  1EJ3 A;  1QAS A;  2I94 A;  2KFF A;  3BQ3 A;  2KYC A;  2KAX A;  2L0P A;  2L50 A;  5HKW A;  2LNK A;  5DKR A;  2Q4U A;  1QAT A;  1DJG A;  1IWQ A;  5ER5 A;  1YRT B;  5B8I B;  1M45 A;  1JWD A;  4N1G A;  4OCI A;  3PN7 B;  4GGF C;  1QS7 A;  1A29 A;  3KEV A;  2WND A;  1PVB A;  2KI6 C;  1WY9 A;  1FW4 A;  2H61 C;  4PHK A;  1XFW O;  2RGI A;  1BMO A;  1DVI A;  1K9P A;  1KK7 Z;  1GQM A;  3KHE A;  2F8P A;  1OZO A;  1SNL A;  2KDH A;  3OX5 A;  3IQQ A;  3GK4 X;  4WRI A;  4ZCV A;  3DVK A;  1FF1 A;  1NP8 A;  1ALW A;  1K9U A;  2K0J A;  2K61 A;  3RM1 A;  1F55 A;  3FWB A;  1YVH A;  1F70 A;  1Y6W A;  4MRX A;  1JBA A;  3TDZ A;  2K7C A;  2BEC A;  2BCB A;  2JC2 A;  2LM5 A;  1IH0 A;  2LP2 A;  4MBE A;  2GGM A;  2BBM A;  4IL1 A;  1EG4 A;  2M9G A;  4GGF A;  4TNC A;  4AOM A;  1TNW A;  1CDP A;  3TDU A;  2BCA A;  2JT0 A;  3PAL A;  2JTT A;  2H61 A;  4QJ4 B;  1A75 B;  1CB1 A;  1UHI A;  2PAL A;  1IJ5 A;  1EG3 A;  2KOT A;  3BOW A;  2WC8 A;  2MLE C;  1CFD A;  1XVJ A;  3AKA A;  1SR6 B;  1KWO C;  1IQ3 A;  1HQV A;  1FI5 A;  4M2O A;  3I5H B;  2M49 B;  3CR4 X;  1DF0 A;  3DD4 A;  1AJ5 A;  2Y4Q A;  4M2P A;  4PE1 A;  1CKK A;  2L4H A;  2ZN8 A;  5CPV A;  1CM4 A;  2KGR A;  4GBA A;  1BF5 A;  1BJF A;  1SRA A;  2OS8 C;  4YBH B;  1M39 A;  4UPG A;  1AP4 A;  1NX1 A;  2TN4 A;  2G9B A;  1UHH A;  1UUS A;  2K7B A;  2E30 A;  1QIW A;  3OX6 A;  3CZT X;  4YGD B;  1GGW A;  2AAO A;  2JWW A;  2HET A;  2L51 A;  3TZ1 A;  2SAS A;  1NWD A;  1S36 A;  4P5O E;  2M1K B;  3OB1 B;  4ZCU A;  4C0L A;  3VRQ A;  1MWN A;  3O6B A;  1UHJ A;  2NXQ A;  3EK7 A;  2NLN A;  3JTD B;  4ORB B;  5AXI A;  1XFX O;  2MBX A;  5D69 A;  5DKQ A;  1A03 A;  3AAK A;  3FWC A;  1L7Z A;  5I2O A;  2L5X B;  1QLK A;  2OTG C;  5J3X A;  4OKH A;  3NSO A;  5AER A;  3EVR A;  4PHM A;  3VRR A;  2BE4 A;  3SIA A;  1ZFS A;  3CWG A;  1J1E A;  2JXC A;  3BUX B;  1S6J A;  1WRZ A;  1QV1 A;  2M97 A;  1Y1X A;  1YUT A;  4PHN A;  1SYM A;  3DVE A;  2AMI A;  2K8M B;  3SG6 A;  1DGV A;  2COL B;  5I8N A;  2JT8 A;  1QIV A;  1MUX A;  1IRJ A;  1TN4 A;  4MLW A;  2LUC A;  1PAL A;  1JC2 A;  1PK0 D;  3I5H C;  1EXR A;  2KQ6 A;  2WCF A;  1A75 A;  4AQI A;  2M7N A;  5AAN A;  1ZMZ A;  1TNP A;  1REC A;  1X02 A;  3EVU A;  3FS7 A;  3IF7 A;  4M2Q A;  1NIW A;  2K7D A;  4NDD A;  4MEW A;  3RLZ A;  2FCD A;  1N65 A;  3IQO A;  1DJY A;  4N1F A;  1BR4 B;  4NDC A;  3GK2 A;  1YR5 A;  3SG2 A;  1IKU A;  4GNK B;  5DKN A;  2BL0 B;  2KNE A;  1PUL A;  1SCM B;  1MXE A;  2O60 A;  1A4P A;  1CTR A;  3I5F C;  4BY4 A;  1AHR A;  1DMO A;  2JUL A;  4DS7 A;  5F6T A;  4FTG A;  2LAN A;  1BOC A;  4XJK A;  1K93 D;  3BUM B;  1YTZ C;  4YRU A;  4Q04 A;  2M29 A;  1M46 A;  1SMG A;  1XK4 C;  1ZAC A;  2GV5 A;  3I5G C;  1QJT A;  1DT7 B;  3NSL A;  1W7I B;  1KFU S;  1AUI B;  3LCP C;  3WHU B;  1KQM B;  1V1F A;  3TS5 B;  4YGC B;  3DF0 B;  5K89 A;  2K2A A;  1R2U A;  2HQW A;  1ZUZ A;  1TTX A;  1K94 A;  4PE7 A;  2LV7 A;  4YGB B;  3PSR A;  1J1D A;  1G8I A;  5HLO A;  1TIZ A;  5JJG A;  2L98 A;  1SCV A;  1XYD A;  2QPT A;  3KPX A;  2CBL A;  5CSI A;  2JT3 A;  4WQ2 A;  4MSP A;  2BKI B;  2PSR A;  1MXL C;  1K90 D;  3BYA A;  5PAL A;  1AJ4 A;  4DCK A;  2CTN A;  1TNX A;  1YUU A;  1ODB A;  2WCB A;  1PSR A;  1OZS A;  1RK9 A;  2JZI A;  1VRK A;  1KK8 C;  5IBW A;  1LXF C;  1RFJ A;  4JPZ B;  4ICB A;  1NUB A;  2ZND A;  3WXA A;  4D1E A;  1OSA A;  2GGZ A;  1IJ6 A;  1LKJ A;  1B4C A;  2F2P A;  1PSB A;  4ORC B;  4AQJ A;  4CID A;  1SW8 A;  2BL0 C;  1J7Q A;  2WCE A;  3GOF A;  3FIA A;  1SCM C;  3O2P A;  2I18 A;  3LK1 A;  3D0Y B;  1U5I B;  1RJV A;  4I5L B;  1NCY A;  1FPW A;  4NQG A;  1B47 A;  5BPJ A;  4MVF A;  4CFR A;  1UUR A;  1XFU O;  3AKB A;  3TUY B;  3VRN A;  3PN7 C;  1BR1 B;  5FYX A;  2LLU A;  3ZNI A;  3A4U B;  2M1U A;  2ZNE A;  1QX5 B;  5HKZ A;  3LK0 A;  1DJW A;  4GUK A;  1M63 B;  3QRX A;  1S6C A;  1NCZ A;  2Y1N A;  4HRH A;  4PDZ A;  5I2L A;  3EKJ A;  3GK1 A;  1BG1 A;  1KQM C;  1BOD A;  4E68 A;  2R2I A;  4C0K A;  1NSH A;  2Q91 A;  1B7T Z;  2LC5 A;  2EC6 B;  4HRE E;  1YUR A;  2LMV A;  3AAJ A;  2PRU A;  2KBM A;  1OQP A;  4OR9 B;  1PVA A;  2E6W A;  1IG5 A;  1FBV A;  1L2O B;  2ZFD A;  2KFG A;  3LL8 B;  4PAL A;  1KFX L;  1G33 A;  1H8B A;  1K2H A;  1WRK A;  1CMF A;  1UWO A;  3EVV A;  4QJ3 B;  4YI8 A;  3ZWH A;  1Q80 A;  2DOQ A;  3WNX B;  3CR5 X;  4QJ5 B;  3SIB A;  2JNX A;  1F8H A;  4DUQ A;  2F3Y A;  2SCP A;  4F0Z B;  4MN0 A;  3O78 A;  1IQ5 A;  1UHK A;  2D8N A;  2LVK A;  5KTY A;  2M7L A;  3OHM B;  1OMR A;  3K21 A;  1E8A A;  2JTZ A;  1C07 A;  2LHL A;  2LLT A;  1RRO A;  4MRY A;  4PE4 A;  1UHN A;  1QV0 A;  1DTL A;  1SR6 C;  1M31 A;  1S3P A;  3H4S E;  5ER4 X;  1CM1 A;  2MLF C;  3MSE B;  4HSZ A;  1C7V A;  2KQY A;  1DJI A;  5G08 A;  1F54 A;  4DIR A;  2MJW B;  1LA0 A;  2QAC A;  1WLZ A;  3BUN B;  1J7O A;  4P2Y B;  1S6I A;  1YRU B;  4YGA A;  1K95 A;  2KI6 D;  1KSM A;  4USL A;  1RTP 1;  1N2D A;  5CSN A;  3PLF B;  2KBI A;  2Y5I A;  1JFJ A;  1YVL A;  2KI4 B;  3DVJ A;  1QX2 A;  2H2K A;  1WRL A;  3PM8 A;  3BOW B;  2JU0 A;  2MAZ A;  2Y1M A;  2L2E A;  1CDN A;  1FI6 A;  2JNF A;  1DJZ A;  2AUC A;  2A4J A;  4GPL B;  3JVT B;  1B9A A;  1YX8 A;  1B8L A;  1WLM A;  1EH2 A;  1K96 A;  1A2X A;  1CFF A;  1QVI Y;  3I5I B;  1DF0 B;  3C1V A;  3JTD C;  2HPS A;  1NCX A;  2K7O A;  5D7F A;  1U5I A;  2LAP A;  1YUS A;  2PMY A;  4FQO A;  2LVI A;  1B7T Y;  4OV2 A;  5HYD A;  5KSZ A;  1NYA A;  2F2O A;  1S1E A;  5CSJ A;  5KU1 A;  2KSP A;  1R6P A;  1WDC B;  4GFT A;  3LLE A;  1XFY O;  2VRG A;  3VRP A;  4HRG A;  4CPV A;  2LLS A;  1C7W A;  5CSF A;  2EHB A;  5HKY A;  4R1E A;  1CLB A;  1MF8 B;  2BBN A;  1ALV A;  1KSO A;  2JXL A;  1B8R A;  2KFH A;  4JWQ A;  1XFV O;  3CR2 A;  1KFU L;  1LIN A;  2KGB C;  1LVC D;  1OMD A;  3CLN A;  3E3R A;  2BCX A;  3O4Y A;  2OS8 B;  3CTN A;  2G2B A;  2F33 A;  2I2R E;  4MZL A;  4A4C A;  2V53 A;  3BUW B;  2OPO A;  3SG4 A;  1EL4 A;  4U8D A;  1MQ1 A;  2WOS A;  2K2F A;  1MR8 A;  1TNQ A;  1ZOT B;  3SG5 A;  1CFC A;  1XK4 A;  1G4Y R;  2JOJ A;  4ORA B;  4BY5 A;  2KAY A;  5AFP A;  2NZ0 A;  1AK8 A;  2KI4 C;  4WQ3 A;  1CFP A;  2ZRS A;  1K9K A;  1MHO A;  1SK6 D;  2CT9 A;  3TDI A;  1DJX A;  3EKH A;  4YI9 A;  3JVT C;  1JUO A;  1BU3 A;  1SL9 A;  1S5G Y;  2O5G A;  1Y1U A;  2FOT A;  1NX3 A;  1YX7 A;  3HX4 A;  1LA3 A;  3I5I C;  3KO0 A;  2LUX A;  2OTG B;  1DJH A;  4ETO A;  1QLS A;  2JPT A;  3SG7 A;  1JFK A;  2M3W A;  2HF5 A;  1GJY A;  3PFV A;  4DRW A;  2P6B B;  1WDC C;  1OOJ A;  2FCE A;  1W7J B;  2MA2 A;  3PAT A;  4I5J A;  4MZJ A;  2WOR A;  1XFZ O;  1NX2 A;  2FJU B;  4OVN F;  1QVI Z;  3DVM A;  1B1G A;  1SL7 A;  1CMG A;  2BE6 A;  3EK4 A;  3EK8 A;  3TS5 C;  2JRF A;  2ISD A;  2NCO A;  1GGZ A;  1IGV A;  3D10 A;  4MZK A;  1CLL A;  2CCM A;  4I5N B;  4N5X A;  1UP5 A;  1JF2 A;  2LHI A;  1XO5 A;  5I2Q A;  4GAO A;  1K8U A;  1BLQ A;  2CNP A;  1Y1A A;  1TOP A;  4XJK B;  4YGE B;  1N0Y A;  2JQ6 A;  2M8U A;  4CFQ A;  1J55 A;  4PCW A;  5TNC A;  2LP3 A;  2MRD A;  1SY9 A;  3CS1 A;  2LE9 B;  1SBJ A;  3SG3 A;  1CNP A;  1OE9 B;  3CGA A;  4NDB A;  1KK7 Y;  1SL8 A;  2PAS A;  3ICB A;  3BXK A;  4A4B A;  2KHN A;  2NCP A;  3DF0 A;  3OP0 A;  4C0J A;  2F3Z A;  1QX7 A;  3HCM A;  3I5F B;  1RWY A;  1TRF A;  2ZKM X;  3SJS A;  2ZN9 A;  4PE0 A;  1BT6 A;  2LCP A;  1Y0V H;  2LMU A;  1QXP A;  1KFX S;  4CLN A;  1AVS A;  1HT9 A;  3M0W A;  2CXJ A;  3F45 A;  4L9M A; 
#chains in the Genus database with same CATH topology
 1S26 D;  3VGO A;  4JQ0 D;  1XA5 A;  2IS9 A;  3I5G B;  4GGN A;  3SS5 A;  3TUY C;  4XYN A;  3KF9 A;  1SKT A;  1CDM A;  2BKH B;  4JKT A;  1NPQ A;  2ZRT A;  1S5G Z;  2M0R A;  3BUO B;  1H4B A;  2KAV A;  1DC1 A;  2I7A A;  2LVJ A;  2HQ8 A;  2LMT A;  1DGU A;  1J7R A;  2GTE A;  1KCY A;  5GQQ C;  1TCF A;  3UO9 A;  3NSK A;  3OB2 B;  2LVV A;  1JSA A;  3D0Y A;  2BNX A;  1SPY A;  3NXA A;  2EC6 C;  1J7P A;  1OOG A;  1JF0 A;  2EGD A;  5AEQ A;  1L2O C;  2MHH A;  1IIO A;  1F4O A;  1V1G A;  1OMV A;  1NX0 A;  1B8C A;  1KK8 B;  4PHJ A;  5I94 A;  3FE8 A;  3A8R A;  1F4Q A;  2KYF A;  3Q8I A;  3VRO A;  3WHT B;  1XFR A;  2L4I A;  1TCO B;  3NSI A;  4I5K A;  1KQV A;  1QTX A;  5JOL A;  1D1O A;  1F71 A;  5HLV A;  1PRW A;  2B1U A;  1CLM A;  1KWO B;  1CDL A;  3CYZ A;  1CNP A;  2PVB A;  1EJ3 A;  1QAS A;  2I94 A;  2KFF A;  3BQ3 A;  1TUZ A;  2KAX A;  2KYC A;  2L0P A;  2L50 A;  3DY9 A;  3OGN A;  5HKW A;  2LNK A;  2H8V A;  5DKR A;  2Q4U A;  1QAT A;  1DJG A;  1IWQ A;  5ER5 A;  1YRT B;  5B8I B;  1M45 A;  1JWD A;  4N1G A;  4OCI A;  3PN7 B;  4GGF C;  1QS7 A;  1A29 A;  2YGU A;  3KEV A;  2WND A;  1PVB A;  2KI6 C;  1WY9 A;  1FW4 A;  2H61 C;  3D75 A;  1XFW O;  2RGI A;  4PHK A;  1BMO A;  1DVI A;  1K9P A;  1KK7 Z;  5DIC A;  1GQM A;  3BJH A;  3KHE A;  2F8P A;  1OZO A;  1SNL A;  2KDH A;  3OX5 A;  3IQQ A;  3GK4 X;  4WRI A;  3D74 A;  3DVK A;  4ZCV A;  1FF1 A;  1NP8 A;  1ALW A;  1K9U A;  2K0J A;  2K61 A;  3RM1 A;  1F55 A;  3FWB A;  2QDI A;  1YVH A;  1F70 A;  1Y6W A;  4MRX A;  1JBA A;  3TDZ A;  2K7C A;  2BEC A;  2BCB A;  2JC2 A;  2LM5 A;  4INW A;  1IH0 A;  1GM0 A;  2LP2 A;  4MBE A;  2GGM A;  2BBM A;  4IL1 A;  2WCH A;  1EG4 A;  2M9G A;  4GGF A;  4TNC A;  4AOM A;  3BFH A;  2QEO A;  1TNW A;  1CDP A;  3TDU A;  2BCA A;  2JT0 A;  3PAL A;  2JTT A;  2H61 A;  4QJ4 B;  1A75 B;  1C3Y A;  1CB1 A;  3D76 A;  1UHI A;  2PAL A;  1IJ5 A;  1EG3 A;  2KOT A;  3BOW A;  3PM2 A;  2WC8 A;  2MLE C;  1CFD A;  1DQE A;  3S0D A;  1XVJ A;  3BFA A;  3AKA A;  1SR6 B;  3OBV A;  1KWO C;  4F7F A;  5HL1 A;  1DEL A;  1IQ3 A;  1HQV A;  1FI5 A;  2P71 A;  4M2O A;  3I5H B;  2M49 B;  3CR4 X;  1DF0 A;  3DD4 A;  1AJ5 A;  2Y4Q A;  4M2P A;  4PE1 A;  1CKK A;  2L4H A;  2ZN8 A;  5CPV A;  1CM4 A;  3B88 A;  3D78 A;  2KGR A;  4GBA A;  4INX A;  1BF5 A;  1BJF A;  1SRA A;  2OS8 C;  4YBH B;  1M39 A;  4UPG A;  1AP4 A;  1NX1 A;  3R72 A;  2TN4 A;  2G9B A;  1UHH A;  1UUS A;  3L4L A;  2K7B A;  2E30 A;  1QIW A;  3OX6 A;  3CZT X;  4YGD B;  1GGW A;  2AAO A;  2JWW A;  3S0F A;  2HET A;  2L51 A;  3TZ1 A;  2SAS A;  2FJY A;  1NWD A;  1S36 A;  4P5O E;  2M1K B;  3OB1 B;  4ZCU A;  4C0L A;  3VRQ A;  1MWN A;  3O6B A;  1UHJ A;  2NXQ A;  3EK7 A;  2NLN A;  3JTD B;  4ORB B;  5AXI A;  1XFX O;  2MBX A;  3S0E A;  5D69 A;  5DKQ A;  5FI7 A;  1A03 A;  3AAK A;  3FWC A;  3VB1 A;  1L7Z A;  5I2O A;  2L5X B;  1QLK A;  2JPO A;  2OTG C;  2K60 A;  4OKH A;  5J3X A;  3SS3 A;  3NSO A;  5AER A;  2KPH A;  3EVR A;  3CZ1 A;  4PHM A;  3VRR A;  2BE4 A;  3SIA A;  1ZFS A;  3CWG A;  1J1E A;  1P28 A;  2JXC A;  3BUX B;  1S6J A;  1WRZ A;  2WCJ A;  1QV1 A;  2M97 A;  1Y1X A;  1YUT A;  4PHN A;  1SYM A;  3DVE A;  2AMI A;  2K8M B;  3SG6 A;  1DGV A;  2COL B;  5I8N A;  2JT8 A;  1QIV A;  1MUX A;  1IRJ A;  1TN4 A;  4MLW A;  2LUC A;  1PAL A;  1JC2 A;  1PK0 D;  3I5H C;  1EXR A;  2KQ6 A;  2WCF A;  1A75 A;  2P70 A;  4AQI A;  3DZT A;  2M7N A;  5AAN A;  1ZMZ A;  1TNP A;  1REC A;  1X02 A;  3EVU A;  3FS7 A;  3IF7 A;  3EG5 B;  1NIW A;  4M2Q A;  2K7D A;  4NDD A;  4MEW A;  3RLZ A;  2FCD A;  1N65 A;  3IQO A;  1DJY A;  4N1F A;  1BR4 B;  3V2L A;  4NDC A;  3GK2 A;  1YR5 A;  3SG2 A;  3DXL A;  1C3Z A;  3RZS A;  1IKU A;  1Z4H A;  4GNK B;  5D3O A;  5DKN A;  2BL0 B;  2KNE A;  1PUL A;  1SCM B;  1MXE A;  2O60 A;  1A4P A;  1CTR A;  3I5F C;  2BAP A;  4BY4 A;  1AHR A;  3NHT A;  1DMO A;  2JUL A;  4DS7 A;  5F6T A;  4FTG A;  2LAN A;  2KLD A;  1BOC A;  1SSE B;  3L4A A;  4XJK A;  2QEV A;  1K93 D;  3BUM B;  1YTZ C;  4YRU A;  4Q04 A;  2M29 A;  1M46 A;  1SMG A;  1XK4 C;  1ZAC A;  2GV5 A;  3I5G C;  1QJT A;  1DT7 B;  3NSL A;  1W7I B;  3D77 A;  1KFU S;  1AUI B;  3LCP C;  3WHU B;  1KQM B;  1V1F A;  3TS5 B;  4YGC B;  3DF0 B;  5K89 A;  2K2A A;  1R2U A;  2HQW A;  1ZUZ A;  3CZ0 A;  1TTX A;  1K94 A;  4PE7 A;  2LV7 A;  3B7A A;  3PSR A;  4OZD A;  4YGB B;  1J1D A;  1G8I A;  5HLO A;  1TIZ A;  5JJG A;  2L98 A;  1SCV A;  1XYD A;  2QPT A;  3KPX A;  2CBL A;  1TUJ A;  5CSI A;  2JT3 A;  4WQ2 A;  4MSP A;  2BKI B;  2PSR A;  1MXL C;  1K90 D;  3BYA A;  5PAL A;  1AJ4 A;  4DCK A;  2CTN A;  1TNX A;  1YUU A;  1ODB A;  2WCB A;  3FE6 A;  1PSR A;  3D73 A;  1OZS A;  1RK9 A;  2JZI A;  1VRK A;  1KK8 C;  5IBW A;  1LXF C;  1RFJ A;  2QEB A;  4JPZ B;  3S0B A;  4ICB A;  1NUB A;  2ZND A;  3WXA A;  4D1E A;  1OSA A;  2GGZ A;  1IJ6 A;  1LKJ A;  1B4C A;  2F2P A;  1PSB A;  3B87 A;  4ORC B;  4AQJ A;  4CID A;  1SW8 A;  1OOH A;  2BL0 C;  1J7Q A;  2WCE A;  3GOF A;  3BFB A;  3FIA A;  1SCM C;  3O2P A;  3B6X A;  2I18 A;  3LK1 A;  3D0Y B;  1U5I B;  1RJV A;  4I5L B;  1NCY A;  1FPW A;  4NQG A;  1B47 A;  5BPJ A;  4MVF A;  4CFR A;  1UUR A;  1XFU O;  3AKB A;  3TUY B;  3VRN A;  3PN7 C;  1BR1 B;  1OOF A;  2LLU A;  5FYX A;  3A4U B;  2M1U A;  3ZNI A;  2ZNE A;  1QX5 B;  5HKZ A;  3LK0 A;  1DJW A;  4GUK A;  1M63 B;  3QRX A;  1S6C A;  1NCZ A;  2Y1N A;  4HRH A;  4PDZ A;  2PQL A;  5I2L A;  3EKJ A;  3GK1 A;  1BG1 A;  1KQM C;  1BOD A;  4E68 A;  2R2I A;  4C0K A;  1NSH A;  3DYE A;  2Q91 A;  4JD9 A;  1B7T Z;  2LC5 A;  3L47 A;  1W9Z A;  2EC6 B;  4HRE E;  1OOI X;  1YUR A;  2LMV A;  3AAJ A;  2PRU A;  2KBM A;  1OQP A;  4OR9 B;  1PVA A;  2E6W A;  1IG5 A;  1FBV A;  1L2O B;  1F54 A;  2ZFD A;  2KFG A;  3LL8 B;  4PAL A;  1KFX L;  1G33 A;  1H8B A;  1K2H A;  1WRK A;  1CMF A;  1UWO A;  3EVV A;  4QJ3 B;  4YI8 A;  3ZWH A;  1Q80 A;  2DOQ A;  3WNX B;  3CR5 X;  4QJ5 B;  3SIB A;  2JNX A;  1F8H A;  4DUQ A;  2F3Y A;  2SCP A;  4F0Z B;  4MN0 A;  3O78 A;  1IQ5 A;  1UHK A;  2D8N A;  2LVK A;  5KTY A;  2M7L A;  3OHM B;  3CDN A;  1OMR A;  3K21 A;  1E8A A;  2JTZ A;  1C07 A;  2LHL A;  2LLT A;  1RRO A;  4MRY A;  4PE4 A;  1UHN A;  1QV0 A;  3UNW A;  1DTL A;  1SR6 C;  1M31 A;  1S3P A;  3H4S E;  5ER4 X;  4KYN A;  1CM1 A;  2MLF C;  3FE9 A;  3MSE B;  4HSZ A;  2KQY A;  1DJI A;  5G08 A;  1C7V A;  4DIR A;  2MJW B;  1LA0 A;  2QAC A;  1DEK A;  1WLZ A;  3BUN B;  4P2Y B;  1J7O A;  1S6I A;  1YRU B;  4YGA A;  1K95 A;  4PT1 A;  2KI6 D;  1KSM A;  2PYQ A;  4USL A;  1RTP 1;  1N2D A;  5CSN A;  3PLF B;  2KBI A;  2Y5I A;  1JFJ A;  2QEH A;  1YVL A;  2KI4 B;  3DVJ A;  1QX2 A;  2H2K A;  1WRL A;  3PM8 A;  3BOW B;  3NHI A;  2JU0 A;  2KLE A;  2MAZ A;  2L2E A;  2Y1M A;  1CDN A;  2JNF A;  1FI6 A;  1DJZ A;  2A4J A;  2AUC A;  4GPL B;  3JVT B;  1B9A A;  1YX8 A;  1B8L A;  1WLM A;  3K1E A;  1EH2 A;  1K96 A;  1A2X A;  1Z2C B;  1CFF A;  1QVI Y;  3I5I B;  1DF0 B;  3C1V A;  3JTD C;  5FI2 A;  2HPS A;  1NCX A;  2K7O A;  5D7F A;  3S0A A;  1U5I A;  2LAP A;  1YUS A;  2PMY A;  4FQO A;  3R1V A;  2LVI A;  1B7T Y;  4OV2 A;  5HYD A;  5KSZ A;  3R1P A;  1NYA A;  2F2O A;  1S1E A;  5CSJ A;  5KU1 A;  2L5Y A;  2KSP A;  1R6P A;  1WDC B;  4GFT A;  3LLE A;  1XFY O;  2VRG A;  1T14 A;  3VRP A;  4HRG A;  4CPV A;  2LLS A;  5FI6 A;  1C7W A;  5CSF A;  2EHB A;  3PJI A;  4FQT A;  4R1E A;  5HKY A;  1MF8 B;  2BBN A;  2WCL A;  1ALV A;  2WCM A;  1CLB A;  1KSO A;  2JXL A;  1B8R A;  2KFH A;  4JWQ A;  1XFV O;  3CR2 A;  1KFU L;  1LIN A;  2KGB C;  1LS8 A;  1LVC D;  1OMD A;  3CLN A;  3E3R A;  2BCX A;  3CAB A;  1ORG A;  3O4Y A;  3QME A;  2OS8 B;  3CTN A;  2G2B A;  2F33 A;  2I2R E;  4MZL A;  4A4C A;  2V53 A;  3BUW B;  2OPO A;  3SG4 A;  1EL4 A;  4U8D A;  1MQ1 A;  2WOS A;  3NGV A;  2ERB A;  2K2F A;  1MR8 A;  1TNQ A;  1ZOT B;  3SG5 A;  1CFC A;  1XK4 A;  1G4Y R;  2JOJ A;  4ORA B;  4BY5 A;  2KAY A;  5AFP A;  2NZ0 A;  1AK8 A;  2KI4 C;  4WQ3 A;  1CFP A;  2ZRS A;  1K9K A;  1MHO A;  1SK6 D;  2CT9 A;  3CZ2 A;  2WC5 A;  3TDI A;  1DJX A;  3EKH A;  4YI9 A;  3JVT C;  1JUO A;  1BU3 A;  1SL9 A;  1S5G Y;  2O5G A;  1Y1U A;  2FOT A;  1NX3 A;  1YX7 A;  3HX4 A;  2L2C A;  1LA3 A;  3I5I C;  3KO0 A;  2LUX A;  2OTG B;  1TWO A;  5EL2 A;  3S0G A;  1DJH A;  4ETO A;  1QLS A;  2JPT A;  3SG7 A;  1JFK A;  2M3W A;  2WC6 A;  2HF5 A;  1GJY A;  3PFV A;  4DRW A;  2P6B B;  4IJ7 A;  1WDC C;  1OOJ A;  2FCE A;  1W7J B;  2MA2 A;  3PAT A;  4I5J A;  4MZJ A;  2WOR A;  1XFZ O;  1NX2 A;  2FJU B;  2WCK A;  1QVI Z;  3DVM A;  4OVN F;  1SL7 A;  1B1G A;  1CMG A;  2BE6 A;  3EK4 A;  3EK8 A;  3SS4 A;  3TS5 C;  2JRF A;  2ISD A;  2NCO A;  1GGZ A;  1IGV A;  3D10 A;  4MZK A;  1CLL A;  2CCM A;  4I5N B;  4N5X A;  3B86 A;  1UP5 A;  1JF2 A;  2LHI A;  1XO5 A;  5I2Q A;  4GAO A;  1K8U A;  1BLQ A;  2CNP A;  1Y1A A;  3R1O A;  1TOP A;  4XJK B;  3N7H A;  4YGE B;  1N0Y A;  2JQ6 A;  2M8U A;  4CFQ A;  1J55 A;  4PCW A;  5TNC A;  2LP3 A;  2MRD A;  1SY9 A;  3CS1 A;  2LE9 B;  1QWV A;  1SBJ A;  3SG3 A;  1OE9 B;  1OW4 A;  3CGA A;  4NDB A;  1KK7 Y;  1SL8 A;  2PAS A;  3ICB A;  3BXK A;  4A4B A;  2KHN A;  2NCP A;  3DF0 A;  3OP0 A;  4C0J A;  2F3Z A;  1QX7 A;  3HCM A;  3I5F B;  1RWY A;  1TRF A;  2ZKM X;  3SJS A;  2ZN9 A;  4PE0 A;  1BT6 A;  3IVT A;  2LCP A;  1Y0V H;  2LMU A;  1QXP A;  3O4X A;  1KFX S;  4CLN A;  1AVS A;  1HT9 A;  3M0W A;  2CXJ A;  3F45 A;  4L9M A; 
#chains in the Genus database with same CATH homology
 1S26 D;  3VGO A;  4JQ0 D;  1XA5 A;  2IS9 A;  3I5G B;  4GGN A;  3TUY C;  4XYN A;  3KF9 A;  1SKT A;  1CDM A;  2BKH B;  1NPQ A;  2ZRT A;  1S5G Z;  2M0R A;  3BUO B;  1H4B A;  2KAV A;  2I7A A;  2LVJ A;  2HQ8 A;  2LMT A;  1DGU A;  1J7R A;  1KCY A;  5GQQ C;  1TCF A;  3NSK A;  3OB2 B;  2LVV A;  1JSA A;  3D0Y A;  1SPY A;  3NXA A;  2EC6 C;  1J7P A;  1JF0 A;  2EGD A;  5AEQ A;  1L2O C;  2MHH A;  1F4O A;  1V1G A;  1OMV A;  1NX0 A;  1B8C A;  1KK8 B;  4PHJ A;  3A8R A;  1F4Q A;  2KYF A;  3VRO A;  3WHT B;  2L4I A;  1TCO B;  3NSI A;  4I5K A;  1KQV A;  1QTX A;  5JOL A;  1D1O A;  1F71 A;  5HLV A;  1PRW A;  2B1U A;  1CLM A;  1KWO B;  1CDL A;  2PVB A;  1EJ3 A;  1QAS A;  2I94 A;  2KFF A;  3BQ3 A;  2KYC A;  2KAX A;  2L0P A;  2L50 A;  5HKW A;  2LNK A;  5DKR A;  2Q4U A;  1QAT A;  1DJG A;  1IWQ A;  5ER5 A;  1YRT B;  5B8I B;  1M45 A;  1JWD A;  4N1G A;  4OCI A;  3PN7 B;  4GGF C;  1QS7 A;  1A29 A;  3KEV A;  2WND A;  1PVB A;  2KI6 C;  1WY9 A;  1FW4 A;  2H61 C;  4PHK A;  1XFW O;  2RGI A;  1BMO A;  1DVI A;  1K9P A;  1KK7 Z;  1GQM A;  3KHE A;  2F8P A;  1OZO A;  1SNL A;  2KDH A;  3OX5 A;  3IQQ A;  3GK4 X;  4WRI A;  4ZCV A;  3DVK A;  1FF1 A;  1NP8 A;  1ALW A;  1K9U A;  2K0J A;  2K61 A;  3RM1 A;  1F55 A;  3FWB A;  1YVH A;  1F70 A;  1Y6W A;  4MRX A;  1JBA A;  3TDZ A;  2K7C A;  2BEC A;  2BCB A;  2JC2 A;  2LM5 A;  1IH0 A;  2LP2 A;  4MBE A;  2GGM A;  2BBM A;  4IL1 A;  1EG4 A;  2M9G A;  4GGF A;  4TNC A;  4AOM A;  1TNW A;  1CDP A;  3TDU A;  2BCA A;  2JT0 A;  3PAL A;  2JTT A;  2H61 A;  4QJ4 B;  1A75 B;  1CB1 A;  1UHI A;  2PAL A;  1IJ5 A;  1EG3 A;  2KOT A;  3BOW A;  2WC8 A;  2MLE C;  1CFD A;  1XVJ A;  3AKA A;  1SR6 B;  1KWO C;  1IQ3 A;  1HQV A;  1FI5 A;  4M2O A;  3I5H B;  2M49 B;  3CR4 X;  1DF0 A;  3DD4 A;  1AJ5 A;  2Y4Q A;  4M2P A;  4PE1 A;  1CKK A;  2L4H A;  2ZN8 A;  5CPV A;  1CM4 A;  2KGR A;  4GBA A;  1BF5 A;  1BJF A;  1SRA A;  2OS8 C;  4YBH B;  1M39 A;  4UPG A;  1AP4 A;  1NX1 A;  2TN4 A;  2G9B A;  1UHH A;  1UUS A;  2K7B A;  2E30 A;  1QIW A;  3OX6 A;  3CZT X;  4YGD B;  1GGW A;  2AAO A;  2JWW A;  2HET A;  2L51 A;  3TZ1 A;  2SAS A;  1NWD A;  1S36 A;  4P5O E;  2M1K B;  3OB1 B;  4ZCU A;  4C0L A;  3VRQ A;  1MWN A;  3O6B A;  1UHJ A;  2NXQ A;  3EK7 A;  2NLN A;  3JTD B;  4ORB B;  5AXI A;  1XFX O;  2MBX A;  5D69 A;  5DKQ A;  1A03 A;  3AAK A;  3FWC A;  1L7Z A;  5I2O A;  2L5X B;  1QLK A;  2OTG C;  5J3X A;  4OKH A;  3NSO A;  5AER A;  3EVR A;  4PHM A;  3VRR A;  2BE4 A;  3SIA A;  1ZFS A;  3CWG A;  1J1E A;  2JXC A;  3BUX B;  1S6J A;  1WRZ A;  1QV1 A;  2M97 A;  1Y1X A;  1YUT A;  4PHN A;  1SYM A;  3DVE A;  2AMI A;  2K8M B;  3SG6 A;  1DGV A;  2COL B;  5I8N A;  2JT8 A;  1QIV A;  1MUX A;  1IRJ A;  1TN4 A;  4MLW A;  2LUC A;  1PAL A;  1JC2 A;  1PK0 D;  3I5H C;  1EXR A;  2KQ6 A;  2WCF A;  1A75 A;  4AQI A;  2M7N A;  5AAN A;  1ZMZ A;  1TNP A;  1REC A;  1X02 A;  3EVU A;  3FS7 A;  3IF7 A;  4M2Q A;  1NIW A;  2K7D A;  4NDD A;  4MEW A;  3RLZ A;  2FCD A;  1N65 A;  3IQO A;  1DJY A;  4N1F A;  1BR4 B;  4NDC A;  3GK2 A;  1YR5 A;  3SG2 A;  1IKU A;  4GNK B;  5DKN A;  2BL0 B;  2KNE A;  1PUL A;  1SCM B;  1MXE A;  2O60 A;  1A4P A;  1CTR A;  3I5F C;  4BY4 A;  1AHR A;  1DMO A;  2JUL A;  4DS7 A;  5F6T A;  4FTG A;  2LAN A;  1BOC A;  4XJK A;  1K93 D;  3BUM B;  1YTZ C;  4YRU A;  4Q04 A;  2M29 A;  1M46 A;  1SMG A;  1XK4 C;  1ZAC A;  2GV5 A;  3I5G C;  1QJT A;  1DT7 B;  3NSL A;  1W7I B;  1KFU S;  1AUI B;  3LCP C;  3WHU B;  1KQM B;  1V1F A;  3TS5 B;  4YGC B;  3DF0 B;  5K89 A;  2K2A A;  1R2U A;  2HQW A;  1ZUZ A;  1TTX A;  1K94 A;  4PE7 A;  2LV7 A;  4YGB B;  3PSR A;  1J1D A;  1G8I A;  5HLO A;  1TIZ A;  5JJG A;  2L98 A;  1SCV A;  1XYD A;  2QPT A;  3KPX A;  2CBL A;  5CSI A;  2JT3 A;  4WQ2 A;  4MSP A;  2BKI B;  2PSR A;  1MXL C;  1K90 D;  3BYA A;  5PAL A;  1AJ4 A;  4DCK A;  2CTN A;  1TNX A;  1YUU A;  1ODB A;  2WCB A;  1PSR A;  1OZS A;  1RK9 A;  2JZI A;  1VRK A;  1KK8 C;  5IBW A;  1LXF C;  1RFJ A;  4JPZ B;  4ICB A;  1NUB A;  2ZND A;  3WXA A;  4D1E A;  1OSA A;  2GGZ A;  1IJ6 A;  1LKJ A;  1B4C A;  2F2P A;  1PSB A;  4ORC B;  4AQJ A;  4CID A;  1SW8 A;  2BL0 C;  1J7Q A;  2WCE A;  3GOF A;  3FIA A;  1SCM C;  3O2P A;  2I18 A;  3LK1 A;  3D0Y B;  1U5I B;  1RJV A;  4I5L B;  1NCY A;  1FPW A;  4NQG A;  1B47 A;  5BPJ A;  4MVF A;  4CFR A;  1UUR A;  1XFU O;  3AKB A;  3TUY B;  3VRN A;  3PN7 C;  1BR1 B;  5FYX A;  2LLU A;  3ZNI A;  3A4U B;  2M1U A;  2ZNE A;  1QX5 B;  5HKZ A;  3LK0 A;  1DJW A;  4GUK A;  1M63 B;  3QRX A;  1S6C A;  1NCZ A;  2Y1N A;  4HRH A;  4PDZ A;  5I2L A;  3EKJ A;  3GK1 A;  1BG1 A;  1KQM C;  1BOD A;  4E68 A;  2R2I A;  4C0K A;  1NSH A;  2Q91 A;  1B7T Z;  2LC5 A;  2EC6 B;  4HRE E;  1YUR A;  2LMV A;  3AAJ A;  2PRU A;  2KBM A;  1OQP A;  4OR9 B;  1PVA A;  2E6W A;  1IG5 A;  1FBV A;  1L2O B;  2ZFD A;  2KFG A;  3LL8 B;  4PAL A;  1KFX L;  1G33 A;  1H8B A;  1K2H A;  1WRK A;  1CMF A;  1UWO A;  3EVV A;  4QJ3 B;  4YI8 A;  3ZWH A;  1Q80 A;  2DOQ A;  3WNX B;  3CR5 X;  4QJ5 B;  3SIB A;  2JNX A;  1F8H A;  4DUQ A;  2F3Y A;  2SCP A;  4F0Z B;  4MN0 A;  3O78 A;  1IQ5 A;  1UHK A;  2D8N A;  2LVK A;  5KTY A;  2M7L A;  3OHM B;  1OMR A;  3K21 A;  1E8A A;  2JTZ A;  1C07 A;  2LHL A;  2LLT A;  1RRO A;  4MRY A;  4PE4 A;  1UHN A;  1QV0 A;  1DTL A;  1SR6 C;  1M31 A;  1S3P A;  3H4S E;  5ER4 X;  1CM1 A;  2MLF C;  3MSE B;  4HSZ A;  1C7V A;  2KQY A;  1DJI A;  5G08 A;  1F54 A;  4DIR A;  2MJW B;  1LA0 A;  2QAC A;  1WLZ A;  3BUN B;  1J7O A;  4P2Y B;  1S6I A;  1YRU B;  4YGA A;  1K95 A;  2KI6 D;  1KSM A;  4USL A;  1RTP 1;  1N2D A;  5CSN A;  3PLF B;  2KBI A;  2Y5I A;  1JFJ A;  1YVL A;  2KI4 B;  3DVJ A;  1QX2 A;  2H2K A;  1WRL A;  3PM8 A;  3BOW B;  2JU0 A;  2MAZ A;  2Y1M A;  2L2E A;  1CDN A;  1FI6 A;  2JNF A;  1DJZ A;  2AUC A;  2A4J A;  4GPL B;  3JVT B;  1B9A A;  1YX8 A;  1B8L A;  1WLM A;  1EH2 A;  1K96 A;  1A2X A;  1CFF A;  1QVI Y;  3I5I B;  1DF0 B;  3C1V A;  3JTD C;  2HPS A;  1NCX A;  2K7O A;  5D7F A;  1U5I A;  2LAP A;  1YUS A;  2PMY A;  4FQO A;  2LVI A;  1B7T Y;  4OV2 A;  5HYD A;  5KSZ A;  1NYA A;  2F2O A;  1S1E A;  5CSJ A;  5KU1 A;  2KSP A;  1R6P A;  1WDC B;  4GFT A;  3LLE A;  1XFY O;  2VRG A;  3VRP A;  4HRG A;  4CPV A;  2LLS A;  1C7W A;  5CSF A;  2EHB A;  5HKY A;  4R1E A;  1CLB A;  1MF8 B;  2BBN A;  1ALV A;  1KSO A;  2JXL A;  1B8R A;  2KFH A;  4JWQ A;  1XFV O;  3CR2 A;  1KFU L;  1LIN A;  2KGB C;  1LVC D;  1OMD A;  3CLN A;  3E3R A;  2BCX A;  3O4Y A;  2OS8 B;  3CTN A;  2G2B A;  2F33 A;  2I2R E;  4MZL A;  4A4C A;  2V53 A;  3BUW B;  2OPO A;  3SG4 A;  1EL4 A;  4U8D A;  1MQ1 A;  2WOS A;  2K2F A;  1MR8 A;  1TNQ A;  1ZOT B;  3SG5 A;  1CFC A;  1XK4 A;  1G4Y R;  2JOJ A;  4ORA B;  4BY5 A;  2KAY A;  5AFP A;  2NZ0 A;  1AK8 A;  2KI4 C;  4WQ3 A;  1CFP A;  2ZRS A;  1K9K A;  1MHO A;  1SK6 D;  2CT9 A;  3TDI A;  1DJX A;  3EKH A;  4YI9 A;  3JVT C;  1JUO A;  1BU3 A;  1SL9 A;  1S5G Y;  2O5G A;  1Y1U A;  2FOT A;  1NX3 A;  1YX7 A;  3HX4 A;  1LA3 A;  3I5I C;  3KO0 A;  2LUX A;  2OTG B;  1DJH A;  4ETO A;  1QLS A;  2JPT A;  3SG7 A;  1JFK A;  2M3W A;  2HF5 A;  1GJY A;  3PFV A;  4DRW A;  2P6B B;  1WDC C;  1OOJ A;  2FCE A;  1W7J B;  2MA2 A;  3PAT A;  4I5J A;  4MZJ A;  2WOR A;  1XFZ O;  1NX2 A;  2FJU B;  4OVN F;  1QVI Z;  3DVM A;  1B1G A;  1SL7 A;  1CMG A;  2BE6 A;  3EK4 A;  3EK8 A;  3TS5 C;  2JRF A;  2ISD A;  2NCO A;  1GGZ A;  1IGV A;  3D10 A;  4MZK A;  1CLL A;  2CCM A;  4I5N B;  4N5X A;  1UP5 A;  1JF2 A;  2LHI A;  1XO5 A;  5I2Q A;  4GAO A;  1K8U A;  1BLQ A;  2CNP A;  1Y1A A;  1TOP A;  4XJK B;  4YGE B;  1N0Y A;  2JQ6 A;  2M8U A;  4CFQ A;  1J55 A;  4PCW A;  5TNC A;  2LP3 A;  2MRD A;  1SY9 A;  3CS1 A;  2LE9 B;  1SBJ A;  3SG3 A;  1CNP A;  1OE9 B;  3CGA A;  4NDB A;  1KK7 Y;  1SL8 A;  2PAS A;  3ICB A;  3BXK A;  4A4B A;  2KHN A;  2NCP A;  3DF0 A;  3OP0 A;  4C0J A;  2F3Z A;  1QX7 A;  3HCM A;  3I5F B;  1RWY A;  1TRF A;  2ZKM X;  3SJS A;  2ZN9 A;  4PE0 A;  1BT6 A;  2LCP A;  1Y0V H;  2LMU A;  1QXP A;  1KFX S;  4CLN A;  1AVS A;  1HT9 A;  3M0W A;  2CXJ A;  3F45 A;  4L9M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...